3LZ1C

Crystal structure of nucleosome core particle composed of the widom 601 dna sequence (orientation 2)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Crystal structures of nucleosome core particles containing the '601' strong positioning sequence
pubmed doi rcsb
source organism Xenopus laevis
total genus 29
structure length 103
sequence length 103
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3lz1C00
1AOID 4WU9C 3W97A 4NE6A 3KXBB 3C1BC 1P3KA 5B0ZA 3MGQB 1P3IC 3UT9B 1ZLAC 5B0YA 4ZUXC 4JJNC 2F8ND 5GT0B 1M1AC 1EQZC 5B1MB 5B33D 3VH5W 4XUJB 4KUDD 2HUEB 5AV5A 3A6ND 5GT3D 4KGCB 3UTBD 1S32B 3W99A 3MGRC 5JRGD 3MVDC 3AN2C 3KWQC 5G49A 4E44A 4WU8A 5BS7A 3MNND 4X23D 4LD9B 5AV9B 3B0BA 4CAYB 1B67A 3LZ0A 5CPKA 1P3AA 1P3BC 3AZMB 1P3LC 1P3FB 3VH6A 3O62C 5AVBC 3B6FA 4J8WB 5B32D 3AZNA 1TZYC 3AV1D 5DNMA 5B40B 3B6GA 3REKB 3W96B 3W98D 3REJD 3UTAD 2FJ7C 4E45A 5B31C 1P34C 4DRBA 5AV8A 3X1TD 3R45A 4QLCD 3AYWC 3VH6T 2AROC 3AV2A 3B0CW 4G91C 1P3BD 3X1SD 2YFVA 1BFMA 5AVBD 1JFIB 5GXQB 5GSUD 3TU4B 4Z66C 3AZGD 3MGSA 5CP6C 5B24C 3A6NB 5B2JA 1HTAA 4ZBJC 3LJAB 3C1CD 5CPJC 1P3GA 2FJ7D 2PYOB 3AFAC 5AVCA 3UTBB 2F8NG 5JRGB 5F99A 3AZHA 1HQ3D 2HIOC 4YM6C 3WTPA 4J8XC 3C1BB 4H9RB 1P3IB 3REHC 3AZJD 4JJNB 3AZLC 1P3OC 3REID 5BT1D 1M1AB 3WAAC 1EQZB 3KUYC 3KXBD 2CV5D 5E5AC 3MGQD 5CPJD 1KX4C 5GT0D 5AV6C 3MGRB 4XZQC 3MVDB 3AN2B 5BNVA 4Z5TC 1P3PA 3KWQB 3UT9A 5B32G 5B1LA 5DNNC 3AZID 2CWEA 4H9QB 3MGPC 4YS3D 4XUJD 1WWIA 3NQUB 1P3BB 2RVQC 3X1SB 3REHD 1P3LB 5B1MA 4KGCD 3O62B 4HGAC 1S32D 5AVBB 1M19C 3WA9C 1BH8B 1F66C 4R8PC 5B2ID 1TZYB 3RELC 1P3MC 3AZFA 4LD9D 1N1JB 4H9OA 4WNNB 2BYMA 3AZMD 1P3FD 1KX5C 2FJ7B 1BH9B 2LY8A 1ID3C 4WV4B 4G92C 5B31B 5AV9A 1P34B 4J8WD 1M18A 2NQBC 5B40D 1KX3D 3WKJC 3AYWB 3LZ1C 2NZDC 2AROB 4G91B 3X1UC 3W97C 1P3KC 5B0ZC 3W96A 5FUGB 3REIB 4Z66B 4DRAA 5CP6B 2YFWB 5AY8D 4UUZA 2CV5B 3X1VA 4ZBJB 5CPJB 1AOIA 5AV5C 5GXQD 3TU4D 2NQBD 5JA4B 3AZIB 3W99C 2HIOB 1U35A 3LZ1D 4YS3B 1JFIA 2F8NA 1A7WA 4J8XB 4WU8C 5BS7C 5KDMB 3LJAD 2PYOD 3REHB 3LZ0C 5CPKC 3AZLB 5B33A 1P3AC 1P3OB 4KUDA 3A6NA 5B2IB 3WAAB 3B6FC 5GT3A 4WU9D 3UTBA 3AZNC 3C1BD 3V9RB 5JRGA 5E5AB 4NE5A 5DNMC 1P3ID 1ZLAD 3B6GC 3LELC 4ZUXD 3MNNA 4JJND 3B0DC 4X23A 5AV6B 1H3OA 3NQJB 4XZQB 1M1AD 3VH5T 1EQZD 3MGPB 1KX3B 5AV8C 4CSRB 5BO0B 5B32A 3AV1A 3AV2C 4HGAB 3MGRD 3WA9B 3MVDD 2F8NK 3AN2D 3KWQD 1F66B 2F8NH 3W98A 4R8PB 3REJA 3RELB 3UTAA 1P3MB 4Z2MG 4J8VC 3MGSC 5AY8B 3X1TA 1P3LD 3LELD 1KX5B 4QLCA 3O62D 1ID3B 4G92B 5B2JC 1P3GC 1P3BA 3X1SA 1TZYD 2NQBB 5AVCC 3WKJB 5AVBA 5CPIC 3LZ1B 2NZDB 5GSUA 3AZGA 3WTPC 3W97B 1P3KB 5B31D 1P34D 4WNNA 3B0CT 3C1CA 3AYWD 2FJ7A 1BH9A 2AROD 4J8VD 4WU9B 1ZLAB 2JSSA 1HQ3A 4ZUXB 5AV5B 4H9PB 5BNXA 4KHAA 3WTPE 4Z66D 5CP6D 3W99B 3AZJA 1WWSA 5CPID 1P3PC 5B24D 3UT9C 5G49B 5FUGA 5B1LC 4WU8B 3REIA 3LZ0B 2YFWA 3AFAD 5CPKB 3KXBA 2CV5A 3MGQA 2HIOD 5CPJA 3AZKC 4YM6D 5GT0A 4J8XD 3AZFC 4NFTA 3AZIA 3B6GB 3LELB 4YS3A 3AZLD 1P3OD 3B0DB 4XUJA 5KDMA 3WAAD 4KGCA 3KUYD 4J8UC 1M18C 1S32A 4H9SA 5E5AD 1KX4D 5B2IA 3AV2B 4EO5C 5AV6D 4LD9A 4CAYA 4XZQD 2L5AA 4Z5TD 3AZMA 5DNND 3AZEC 3MGPD 3AZKD 1P3FA 3W96C 1TAFB 4J8VB 3MGSB 4J8WA 3AZFD 2RVQD 5B40A 1KX3A 1M19D 3WA9D 3X1VC 5B31G 3REKA 1P3GB 1F66D 5B0YC 4R8PD 1AOIC 3RELD 1P3MD 5AVCB 4J8UD 5CPIB 5B24B 1U35C 1KX5D 1ID3D 3AFAB 5AY8A 1F1EA 4H9NB 3AZED 5B33C 3WKJD 4KUDC 4YM6B 4NE3A 2NZDD 5GXQA 3A6NC 3TU4A 3X1UD 5GT3C 3VH5A 2NQBA 3UTBC 3W97D 5JRGC 5B0ZD 1P3KD 2BYKB 5B0YD 2IO5C 3MNNC 3LJAA 4X23C 2PYOA 3KUYB 1P3PB 5BNVB 4Z2MH 5B1LB 1U35D 1KX4B 5C3IC 5AV5D 4WU9A 5B32C 3C1BA 3AV1C 4H9RA 4Z5TB 1P3IA 1ZLAA 3W99D 5DNNB 3AZKB 4ZUXA 4JJNA 4H9PA 3W98C 3REJC 4WU8D 3UTAC 1M1AA 3AZFB 1EQZA 4H9OB 3LZ0D 5CPKD 2BYMB 1P3AD 1M19B 4AWLC 3X1TC 4QLCC 3B6FD 4J8UB 1M18B 3AZND 3X1SC 3VH6W 3MGRA 3MVDA 5DNMD 3AN2A 3KWQA 3B6GD 4H9QA 5GSUC 4EO5B 3NQUA 3AZGC 1P3LA 3AZEB 3LELA 3O62A 5AV8D 5F99C 3AZHC 1BH8A 3C1CC 3X1UB 1ULYA 1TZYA 3AV2D 4UUZB 5B0ZB 1N1JA 3X1VB 1HQ3C 5B0YB 1AOIB 4M6BA 5B31A 3MGSD 1P34A 1U35B 3AZJC 3AYWA 2F8NB 1TAFA 3REIC 5BT1C 2AROA 5B2JD 4J8VA 1P3GD 5AVCD 5B33B 3KXBC 5F99D 2CV5C 4KUDB 3MGQC 3AZHD 5GT3B 4Z66A 3WTPD 5CP6A 5GT0C 5CPIA 1P3AB 5B24A 3AZIC 5B1MC 2IO5B 4YS3C 3MNNB 4X23B 4XUJC 3B6FB 1H3OB 2HUEC 3AFAA 3AZNB 1B6WA 5DNMB 5JA4A 4KGCC 4H9NA 1S32C 2HIOA 5C3IB 4H9SC 4YM6A 4WZSB 5B32B 4J8XA 5B2IC 3AV1B 3REHA 4LD9C 5AV9C 1P3PD 3AZLA 5AV8B 3UT9D 1P3OA 5B1LD 3AZMC 3REJB 2BYKA 3R45B 1P3FC 3W98B 3UTAB 3WAAA 3KUYA 4J8WC 1R4VA 2YFVB 4AWLB 3V9RA 5B1MD 5E5AA 3X1TB 5B40C 1KX3C 4QLCB 1KX4A 1Q9CA 3REKC 5AV6A 3NQJA 4XZQA 4Z5TA 5DNNA 3MGPA 3AZKA 5GSUB 4CSRA 5B2JB 3AZGB 1KU5A 5BO0A 5AV9D 1M18D 5AY8C 5F99B 1M19A 3WA9A 3AZHB 3C1CB 1F66A 4R8PA 3WTPB 5GXQC 3RELA 1P3MA 3TU4C 4J8UA 1HQ3B 1KX5A 5CHLB 5BNXB 3REKD 4KHAB 3W96D 1ID3A 3LJAC 2PYOC 3AZJB 3AZEA 3WKJA 3KSYA 3LZ1A 2NZDA 3X1VD 3X1UA
chains in the Genus database with same CATH superfamily
1AOID 4WU9C 3W97A 4NE6A 3KXBB 3C1BC 1P3KA 5B0ZA 3MGQB 1P3IC 3UT9B 1ZLAC 5B0YA 3H0RC 4ZUXC 4JJNC 2F8ND 5GT0B 1M1AC 1EQZC 5B1MB 5B33D 3VH5W 4XUJB 4KUDD 2HUEB 5AV5A 3A6ND 5GT3D 4KGCB 3UTBD 1S32B 3W99A 3MGRC 5JRGD 3MVDC 3AN2C 2JE5A 3KWQC 5G49A 4E44A 4WU8A 5BS7A 3MNND 4X23D 4LD9B 5AV9B 3B0BA 4CAYB 1B67A 3LZ0A 5CPKA 1P3AA 1P3BC 3AZMB 1P3LC 1P3FB 3VH6A 3O62C 5AVBC 3B6FA 4J8WB 5B32D 3AZNA 1TZYC 3AV1D 5DNMA 5B40B 3B6GA 3REKB 3W96B 3W98D 2ZY3A 3REJD 3UTAD 2FJ7C 4E45A 5B31C 1P34C 2RIQA 3EPKA 4DRBA 5AV8A 3X1TD 3R45A 4QLCD 3AYWC 3VH6T 2AROC 3AV2A 3B0CW 4G91C 1P3BD 3X1SD 2YFVA 1BFMA 3EG5B 5AVBD 1JFIB 5GXQB 5GSUD 3TU4B 4Z66C 3AZGD 3MGSA 5CP6C 3EPHA 5B24C 3A6NB 5B2JA 1HTAA 4ZBJC 3LJAB 3C1CD 5CPJC 1P3GA 2FJ7D 2PYOB 3AFAC 1W2EA 5AVCA 2ZM5A 3UTBB 2F8NG 5JRGB 5F99A 3AZHA 1HQ3D 2HIOC 4YM6C 3WTPA 3EPJA 4J8XC 3C1BB 4H9RB 1P3IB 3REHC 3AZJD 4JJNB 3AZLC 1P3OC 3REID 5BT1D 1PZRA 1M1AB 3WAAC 1EQZB 3KUYC 3KXBD 2CV5D 5E5AC 3MGQD 5CPJD 1KX4C 5GT0D 5AV6C 3MGRB 4XZQC 3MVDB 3AN2B 5BNVA 4Z5TC 3A1IA 3KWQB 3UT9A 5B32G 5B1LA 5DNNC 3AZID 2CWEA 4H9QB 3MGPC 4YS3D 4XUJD 1WWIA 3NQUB 2Y2JA 2Y2IA 1P3BB 2RVQC 3X1SB 3REHD 1P3LB 5B1MA 4KGCD 3O62B 4HGAC 1S32D 5AVBB 1M19C 3WA9C 1BH8B 1F66C 4R8PC 5B2ID 1TZYB 3RELC 1P3MC 3AZFA 4LD9D 1N1JB 4H9OA 4WNNB 2BYMA 4WJ3C 3AZMD 1P3FD 1KX5C 2FJ7B 1BH9B 2LY8A 2Y2MA 4WV4B 4G92C 5B31B 5AV9A 1ID3C 1P34B 4J8WD 1M18A 2BG1A 2NQBC 5B40D 1KX3D 3WKJC 3AYWB 3LZ1C 2NZDC 2AROB 4G91B 3X1UC 3W97C 1P3KC 5B0ZC 3W96A 5FUGB 3REIB 2XD5A 4Z66B 4DRAA 5CP6B 2DQNC 2J8PA 2YFWB 5AY8D 4UUZA 2CV5B 3X1VA 4ZBJB 5CPJB 1AOIA 5AV5C 5GXQD 3TU4D 2NQBD 5JA4B 3AZIB 3W99C 2HIOB 1U35A 3LZ1D 4YS3B 1JFIA 2F8NA 1A7WA 4J8XB 4WU8C 5BS7C 5KDMB 3LJAD 2PYOD 3REHB 3LZ0C 5CPKC 3AZLB 5B33A 1P3AC 1P3OB 4KUDA 3A6NA 5B2IB 3WAAB 3B6FC 5GT3A 4WU9D 3UTBA 3AZNC 3C1BD 3V9RB 5JRGA 5E5AB 4NE5A 3IP4C 5DNMC 1P3ID 1ZLAD 3B6GC 3LELC 4ZUXD 2UWXA 3MNNA 4JJND 3B0DC 4X23A 2G5HC 5AV6B 1H3OA 3NQJB 4XZQB 1M1AD 3VH5T 1EQZD 3MGPB 1KX3B 3P5JB 1P3PA 5AV8C 3H0MC 4CSRB 5BO0B 5B32A 3AV1A 3AV2C 4HGAB 3MGRD 3WA9B 3MVDD 2F8NK 3AN2D 3KWQD 1F66B 2F8NH 3W98A 4R8PB 3REJA 3RELB 3UTAA 1P3MB 4Z2MG 4J8VC 3MGSC 5AY8B 2VQRA 3X1TA 1P3LD 3LELD 1KX5B 4QLCA 3O62D 1ID3B 4G92B 5B2JC 1P3GC 1P3BA 3X1SA 1TZYD 2NQBB 5AVCC 3WKJB 5AVBA 5CPIC 3LZ1B 2NZDB 5GSUA 3AZGA 3WTPC 3W97B 1P3KB 5B31D 1P34D 4WNNA 2JCHA 3B0CT 3C1CA 3AYWD 2FJ7A 1BH9A 2AROD 2ZY4A 4J8VD 4WU9B 1ZLAB 2JSSA 1HQ3A 4ZUXB 5AV5B 4H9PB 5BNXA 4KHAA 3WTPE 4Z66D 5CP6D 3W99B 3AZJA 1WWSA 5CPID 1P3PC 5B24D 3UT9C 5G49B 5FUGA 5B1LC 4WU8B 3REIA 2Y2OA 3AL0C 2Y2GA 1Z2CB 2YFWA 3LZ0B 3KXBA 3AFAD 5CPKB 2CV5A 3MGQA 2HIOD 5CPJA 3AZKC 4YM6D 5GT0A 4J8XD 3AZFC 4NFTA 3AZIA 3B6GB 3LELB 2Y2QA 4YS3A 3AZLD 1P3OD 3B0DB 4XUJA 5KDMA 3KFUG 3WAAD 3EPLA 4KGCA 3KUYD 4J8UC 1M18C 1S32A 4H9SA 5E5AD 1KX4D 5B2IA 3AV2B 4EO5C 5AV6D 4LD9A 4CAYA 4XZQD 2L5AA 4Z5TD 3AZMA 5DNND 3AZEC 3MGPD 3AZKD 1P3FA 3W96C 1TAFB 4J8VB 3MGSB 4J8WA 3AZFD 2RVQD 5B40A 1KX3A 1M19D 3WA9D 5B31G 3X1VC 3REKA 1P3GB 1F66D 5B0YC 4R8PD 2DF4C 1AOIC 3RELD 1P3MD 5AVCB 4J8UD 5CPIB 5B24B 1U35C 1KX5D 1ID3D 3AFAB 5AY8A 1F1EA 4H9NB 3AZED 2Y2NA 5B33C 3WKJD 4KUDC 4YM6B 4NE3A 2NZDD 5GXQA 3A6NC 3TU4A 2FFFB 3X1UD 5GT3C 3VH5A 2NQBA 3UTBC 3W97D 5JRGC 5B0ZD 1P3KD 2BYKB 5B0YD 2IO5C 3MNNC 3LJAA 4X23C 2PYOA 3KUYB 1P3PB 5BNVB 4Z2MH 5B1LB 1U35D 1KX4B 3F6TA 5C3IC 5AV5D 2Y2PA 4WU9A 5B32C 3C1BA 3AV1C 2XD1A 4H9RA 4Z5TB 1P3IA 1ZLAA 2Y2HA 3W99D 5DNNB 3AZKB 4ZUXA 3H0LC 4JJNA 4H9PA 3W98C 3REJC 4WU8D 3UTAC 1M1AA 3AZFB 1EQZA 4H9OB 3LZ0D 5CPKD 2BYMB 1P3AD 1M19B 4AWLC 3X1TC 4QLCC 3B6FD 4J8UB 1M18B 3AZND 3X1SC 3VH6W 3MGRA 3MVDA 5DNMD 3AN2A 3KWQA 3B6GD 4H9QA 5GSUC 4EO5B 3NQUA 3AZGC 1P3LA 3AZEB 3LELA 3O62A 5AV8D 5F99C 3AZHC 1BH8A 3C1CC 3X1UB 1ULYA 1TZYA 3AV2D 4UUZB 5B0ZB 1N1JA 3X1VB 1HQ3C 5B0YB 1AOIB 4M6BA 5B31A 3MGSD 1P34A 1U35B 3AZJC 3AYWA 2F8NB 1TAFA 2Y2LA 5BT1C 3REIC 2AROA 5B2JD 4J8VA 1P3GD 5AVCD 5B33B 3KXBC 5F99D 2CV5C 4KUDB 3MGQC 3AZHD 5GT3B 4Z66A 3WTPD 5CP6A 5GT0C 5CPIA 1P3AB 5B24A 3AZIC 5B1MC 2IO5B 4YS3C 3MNNB 4X23B 4XUJC 3B6FB 1H3OB 2HUEC 3AFAA 3AZNB 1B6WA 5DNMB 5JA4A 2G5IC 4H9NA 4KGCC 1S32C 2HIOA 5C3IB 4H9SC 4YM6A 3A1KA 4WZSB 5B32B 4J8XA 5B2IC 3AV1B 2W8SA 2F2AC 3REHA 4LD9C 5AV9C 1P3PD 3AZLA 5AV8B 3UT9D 1P3OA 2Y2KA 5B1LD 3AZMC 3REJB 2BYKA 3R45B 1P3FC 3W98B 3UTAB 3WAAA 3KUYA 4J8WC 1R4VA 2YFVB 4AWLB 3V9RA 5B1MD 5E5AA 3X1TB 5B40C 1KX3C 4QLCB 1KX4A 1Q9CA 3REKC 2ZY2A 5AV6A 3NQJA 4XZQA 4Z5TA 5DNNA 3MGPA 3AZKA 3FDDA 5GSUB 1T3UA 4CSRA 5B2JB 3AZGB 1KU5A 5BO0A 5AV9D 1M18D 5AY8C 5F99B 1M19A 3WA9A 3AZHB 3C1CB 1F66A 4R8PA 3WTPB 5GXQC 3RELA 1P3MA 3TU4C 4J8UA 1HQ3B 1KX5A 5CHLB 5BNXB 3REKD 4KHAB 3W96D 1ID3A 4UPKA 3LJAC 2PYOC 3AZJB 3AZEA 3WKJA 3KSYA 3LZ1A 2NZDA 3X1VD 2ZY5A 3X1UA 4DQYB
chains in the Genus database with same CATH topology
1AOID 4WU9C 3W97A 4NE6A 3KXBB 3C1BC 1P3KA 5B0ZA 3MGQB 1P3IC 3UT9B 1ZLAC 5B0YA 3H0RC 4ZUXC 4JJNC 2F8ND 5GT0B 1M1AC 1EQZC 5B1MB 5B33D 3VH5W 4XUJB 4KUDD 2HUEB 5AV5A 3A6ND 5GT3D 4KGCB 3UTBD 1S32B 3W99A 3MGRC 5JRGD 3MVDC 3AN2C 2JE5A 3KWQC 5G49A 4E44A 4WU8A 5BS7A 3MNND 4X23D 4LD9B 5AV9B 3B0BA 4CAYB 1B67A 3LZ0A 5CPKA 1P3AA 1P3BC 3AZMB 1P3LC 1P3FB 3VH6A 3O62C 5AVBC 3B6FA 4J8WB 5B32D 3AZNA 1TZYC 3AV1D 5DNMA 5B40B 3B6GA 3REKB 3W96B 3W98D 2ZY3A 3REJD 3UTAD 2FJ7C 4E45A 5B31C 1P34C 2RIQA 3EPKA 4DRBA 5AV8A 3X1TD 3R45A 4QLCD 3AYWC 3VH6T 2AROC 3AV2A 3B0CW 4G91C 1P3BD 3X1SD 2YFVA 1BFMA 3EG5B 5AVBD 1JFIB 5GXQB 5GSUD 3TU4B 4Z66C 3AZGD 3MGSA 5CP6C 3EPHA 5B24C 3A6NB 5B2JA 1HTAA 4ZBJC 3LJAB 3C1CD 5CPJC 1P3GA 2FJ7D 2PYOB 3AFAC 1W2EA 5AVCA 2ZM5A 3UTBB 2F8NG 5JRGB 5F99A 3AZHA 1HQ3D 2HIOC 4YM6C 3WTPA 3EPJA 4J8XC 3C1BB 4H9RB 1P3IB 3REHC 3AZJD 4JJNB 3AZLC 1P3OC 3REID 5BT1D 1PZRA 1M1AB 3WAAC 1EQZB 3KUYC 3KXBD 2CV5D 5E5AC 3MGQD 5CPJD 1KX4C 5GT0D 5AV6C 3MGRB 4XZQC 3MVDB 3AN2B 5BNVA 4Z5TC 3A1IA 3KWQB 3UT9A 5B32G 5B1LA 5DNNC 3AZID 2CWEA 4H9QB 3MGPC 4YS3D 4XUJD 1WWIA 3NQUB 2Y2JA 2Y2IA 1P3BB 2RVQC 3X1SB 3REHD 1P3LB 5B1MA 4KGCD 3O62B 4HGAC 1S32D 5AVBB 1M19C 3WA9C 1BH8B 1F66C 4R8PC 5B2ID 1TZYB 3RELC 1P3MC 3AZFA 4LD9D 1N1JB 4H9OA 4WNNB 2BYMA 4WJ3C 3AZMD 1P3FD 1KX5C 2FJ7B 1BH9B 2LY8A 2Y2MA 4WV4B 4G92C 5B31B 5AV9A 1ID3C 1P34B 4J8WD 1M18A 2BG1A 2NQBC 5B40D 1KX3D 3WKJC 3AYWB 3LZ1C 2NZDC 2AROB 4G91B 3X1UC 3W97C 1P3KC 5B0ZC 3W96A 5FUGB 3REIB 2XD5A 4Z66B 4DRAA 5CP6B 2DQNC 2J8PA 2YFWB 5AY8D 4UUZA 2CV5B 3X1VA 4ZBJB 5CPJB 1AOIA 5AV5C 5GXQD 3TU4D 2NQBD 5JA4B 3AZIB 3W99C 2HIOB 1U35A 3LZ1D 4YS3B 1JFIA 2F8NA 1A7WA 4J8XB 4WU8C 5BS7C 5KDMB 3LJAD 2PYOD 3REHB 3LZ0C 5CPKC 3AZLB 5B33A 1P3AC 1P3OB 4KUDA 3A6NA 5B2IB 3WAAB 3B6FC 5GT3A 4WU9D 3UTBA 3AZNC 3C1BD 3V9RB 5JRGA 5E5AB 4NE5A 3IP4C 5DNMC 1P3ID 1ZLAD 3B6GC 3LELC 4ZUXD 2UWXA 3MNNA 4JJND 3B0DC 4X23A 2G5HC 5AV6B 1H3OA 3NQJB 4XZQB 1M1AD 3VH5T 1EQZD 3MGPB 1KX3B 3P5JB 1P3PA 5AV8C 3H0MC 4CSRB 5BO0B 5B32A 3AV1A 3AV2C 4HGAB 3MGRD 3WA9B 3MVDD 2F8NK 3AN2D 3KWQD 1F66B 2F8NH 3W98A 4R8PB 3REJA 3RELB 3UTAA 1P3MB 4Z2MG 4J8VC 3MGSC 5AY8B 2VQRA 3X1TA 1P3LD 3LELD 1KX5B 4QLCA 3O62D 1ID3B 4G92B 5B2JC 1P3GC 1P3BA 3X1SA 1TZYD 2NQBB 5AVCC 3WKJB 5AVBA 5CPIC 3LZ1B 2NZDB 5GSUA 3AZGA 3WTPC 3W97B 1P3KB 5B31D 1P34D 4WNNA 2JCHA 3B0CT 3C1CA 3AYWD 2FJ7A 1BH9A 2AROD 2ZY4A 4J8VD 4WU9B 1ZLAB 2JSSA 1HQ3A 4ZUXB 5AV5B 4H9PB 5BNXA 4KHAA 3WTPE 4Z66D 5CP6D 3W99B 3AZJA 1WWSA 5CPID 1P3PC 5B24D 3UT9C 5G49B 5FUGA 5B1LC 4WU8B 3REIA 2Y2OA 3AL0C 2Y2GA 1Z2CB 2YFWA 3LZ0B 3KXBA 3AFAD 5CPKB 2CV5A 3MGQA 2HIOD 5CPJA 3AZKC 4YM6D 5GT0A 4J8XD 3AZFC 4NFTA 3AZIA 3B6GB 3LELB 2Y2QA 4YS3A 3AZLD 1P3OD 3B0DB 4XUJA 5KDMA 3KFUG 3WAAD 3EPLA 4KGCA 3KUYD 4J8UC 1M18C 1S32A 4H9SA 5E5AD 1KX4D 5B2IA 3AV2B 4EO5C 5AV6D 4LD9A 4CAYA 4XZQD 2L5AA 4Z5TD 3AZMA 5DNND 3AZEC 3MGPD 3AZKD 1P3FA 3W96C 1TAFB 4J8VB 3MGSB 4J8WA 3AZFD 2RVQD 5B40A 1KX3A 1M19D 3WA9D 5B31G 3X1VC 3REKA 1P3GB 1F66D 5B0YC 4R8PD 2DF4C 1AOIC 3RELD 1P3MD 5AVCB 4J8UD 5CPIB 5B24B 1U35C 1KX5D 1ID3D 3AFAB 5AY8A 1F1EA 4H9NB 3AZED 2Y2NA 5B33C 3WKJD 4KUDC 4YM6B 4NE3A 2NZDD 5GXQA 3A6NC 3TU4A 2FFFB 3X1UD 5GT3C 3VH5A 2NQBA 3UTBC 3W97D 5JRGC 5B0ZD 1P3KD 2BYKB 5B0YD 2IO5C 3MNNC 3LJAA 4X23C 2PYOA 3KUYB 1P3PB 5BNVB 4Z2MH 5B1LB 1U35D 1KX4B 3F6TA 5C3IC 5AV5D 2Y2PA 4WU9A 5B32C 3C1BA 3AV1C 2XD1A 4H9RA 4Z5TB 1P3IA 1ZLAA 2Y2HA 3W99D 5DNNB 3AZKB 4ZUXA 3H0LC 4JJNA 4H9PA 3W98C 3REJC 4WU8D 3UTAC 1M1AA 3AZFB 1EQZA 4H9OB 3LZ0D 5CPKD 2BYMB 1P3AD 1M19B 4AWLC 3X1TC 4QLCC 3B6FD 4J8UB 1M18B 3AZND 3X1SC 3VH6W 3MGRA 3MVDA 5DNMD 3AN2A 3KWQA 3B6GD 4H9QA 5GSUC 4EO5B 3NQUA 3AZGC 1P3LA 3AZEB 3LELA 3O62A 5AV8D 5F99C 3AZHC 1BH8A 3C1CC 3X1UB 1ULYA 1TZYA 3AV2D 4UUZB 5B0ZB 1N1JA 3X1VB 1HQ3C 5B0YB 1AOIB 4M6BA 5B31A 3MGSD 1P34A 1U35B 3AZJC 3AYWA 2F8NB 1TAFA 2Y2LA 5BT1C 3REIC 2AROA 5B2JD 4J8VA 1P3GD 5AVCD 5B33B 3KXBC 5F99D 2CV5C 4KUDB 3MGQC 3AZHD 5GT3B 4Z66A 3WTPD 5CP6A 5GT0C 5CPIA 1P3AB 5B24A 3AZIC 5B1MC 2IO5B 4YS3C 3MNNB 4X23B 4XUJC 3B6FB 1H3OB 2HUEC 3AFAA 3AZNB 1B6WA 5DNMB 5JA4A 2G5IC 4H9NA 4KGCC 1S32C 2HIOA 5C3IB 4H9SC 4YM6A 3A1KA 4WZSB 5B32B 4J8XA 5B2IC 3AV1B 2W8SA 2F2AC 3REHA 4LD9C 5AV9C 1P3PD 3AZLA 5AV8B 3UT9D 1P3OA 2Y2KA 5B1LD 3AZMC 3REJB 2BYKA 3R45B 1P3FC 3W98B 3UTAB 3WAAA 3KUYA 4J8WC 1R4VA 2YFVB 4AWLB 3V9RA 5B1MD 5E5AA 3X1TB 5B40C 1KX3C 4QLCB 1KX4A 1Q9CA 3REKC 2ZY2A 5AV6A 3NQJA 4XZQA 4Z5TA 5DNNA 3MGPA 3AZKA 3FDDA 5GSUB 1T3UA 4CSRA 5B2JB 3AZGB 1KU5A 5BO0A 5AV9D 1M18D 5AY8C 5F99B 1M19A 3WA9A 3AZHB 3C1CB 1F66A 4R8PA 3WTPB 5GXQC 3RELA 1P3MA 3TU4C 4J8UA 1HQ3B 1KX5A 5CHLB 5BNXB 3REKD 4KHAB 3W96D 1ID3A 4UPKA 3LJAC 2PYOC 3AZJB 3AZEA 3WKJA 3KSYA 3LZ1A 2NZDA 3X1VD 2ZY5A 3X1UA 4DQYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AOI D;  4WU9 C;  3W97 A;  4NE6 A;  3KXB B;  3C1B C;  1P3K A;  5B0Z A;  3MGQ B;  1P3I C;  3UT9 B;  1ZLA C;  5B0Y A;  4ZUX C;  4JJN C;  2F8N D;  5GT0 B;  1M1A C;  1EQZ C;  5B1M B;  5B33 D;  3VH5 W;  4XUJ B;  4KUD D;  2HUE B;  5AV5 A;  3A6N D;  5GT3 D;  4KGC B;  3UTB D;  1S32 B;  3W99 A;  3MGR C;  5JRG D;  3MVD C;  3AN2 C;  3KWQ C;  5G49 A;  4E44 A;  4WU8 A;  5BS7 A;  3MNN D;  4X23 D;  4LD9 B;  5AV9 B;  3B0B A;  4CAY B;  1B67 A;  3LZ0 A;  5CPK A;  1P3A A;  1P3B C;  3AZM B;  1P3L C;  1P3F B;  3VH6 A;  3O62 C;  5AVB C;  3B6F A;  4J8W B;  5B32 D;  3AZN A;  1TZY C;  3AV1 D;  5DNM A;  5B40 B;  3B6G A;  3REK B;  3W96 B;  3W98 D;  3REJ D;  3UTA D;  2FJ7 C;  4E45 A;  5B31 C;  1P34 C;  4DRB A;  5AV8 A;  3X1T D;  3R45 A;  4QLC D;  3AYW C;  3VH6 T;  2ARO C;  3AV2 A;  3B0C W;  4G91 C;  1P3B D;  3X1S D;  2YFV A;  1BFM A;  5AVB D;  1JFI B;  5GXQ B;  5GSU D;  3TU4 B;  4Z66 C;  3AZG D;  3MGS A;  5CP6 C;  5B24 C;  3A6N B;  5B2J A;  1HTA A;  4ZBJ C;  3LJA B;  3C1C D;  5CPJ C;  1P3G A;  2FJ7 D;  2PYO B;  3AFA C;  5AVC A;  3UTB B;  2F8N G;  5JRG B;  5F99 A;  3AZH A;  1HQ3 D;  2HIO C;  4YM6 C;  3WTP A;  4J8X C;  3C1B B;  4H9R B;  1P3I B;  3REH C;  3AZJ D;  4JJN B;  3AZL C;  1P3O C;  3REI D;  5BT1 D;  1M1A B;  3WAA C;  1EQZ B;  3KUY C;  3KXB D;  2CV5 D;  5E5A C;  3MGQ D;  5CPJ D;  1KX4 C;  5GT0 D;  5AV6 C;  3MGR B;  4XZQ C;  3MVD B;  3AN2 B;  5BNV A;  4Z5T C;  1P3P A;  3KWQ B;  3UT9 A;  5B32 G;  5B1L A;  5DNN C;  3AZI D;  2CWE A;  4H9Q B;  3MGP C;  4YS3 D;  4XUJ D;  1WWI A;  3NQU B;  1P3B B;  2RVQ C;  3X1S B;  3REH D;  1P3L B;  5B1M A;  4KGC D;  3O62 B;  4HGA C;  1S32 D;  5AVB B;  1M19 C;  3WA9 C;  1BH8 B;  1F66 C;  4R8P C;  5B2I D;  1TZY B;  3REL C;  1P3M C;  3AZF A;  4LD9 D;  1N1J B;  4H9O A;  4WNN B;  2BYM A;  3AZM D;  1P3F D;  1KX5 C;  2FJ7 B;  1BH9 B;  2LY8 A;  1ID3 C;  4WV4 B;  4G92 C;  5B31 B;  5AV9 A;  1P34 B;  4J8W D;  1M18 A;  2NQB C;  5B40 D;  1KX3 D;  3WKJ C;  3AYW B;  3LZ1 C;  2NZD C;  2ARO B;  4G91 B;  3X1U C;  3W97 C;  1P3K C;  5B0Z C;  3W96 A;  5FUG B;  3REI B;  4Z66 B;  4DRA A;  5CP6 B;  2YFW B;  5AY8 D;  4UUZ A;  2CV5 B;  3X1V A;  4ZBJ B;  5CPJ B;  1AOI A;  5AV5 C;  5GXQ D;  3TU4 D;  2NQB D;  5JA4 B;  3AZI B;  3W99 C;  2HIO B;  1U35 A;  3LZ1 D;  4YS3 B;  1JFI A;  2F8N A;  1A7W A;  4J8X B;  4WU8 C;  5BS7 C;  5KDM B;  3LJA D;  2PYO D;  3REH B;  3LZ0 C;  5CPK C;  3AZL B;  5B33 A;  1P3A C;  1P3O B;  4KUD A;  3A6N A;  5B2I B;  3WAA B;  3B6F C;  5GT3 A;  4WU9 D;  3UTB A;  3AZN C;  3C1B D;  3V9R B;  5JRG A;  5E5A B;  4NE5 A;  5DNM C;  1P3I D;  1ZLA D;  3B6G C;  3LEL C;  4ZUX D;  3MNN A;  4JJN D;  3B0D C;  4X23 A;  5AV6 B;  1H3O A;  3NQJ B;  4XZQ B;  1M1A D;  3VH5 T;  1EQZ D;  3MGP B;  1KX3 B;  5AV8 C;  4CSR B;  5BO0 B;  5B32 A;  3AV1 A;  3AV2 C;  4HGA B;  3MGR D;  3WA9 B;  3MVD D;  2F8N K;  3AN2 D;  3KWQ D;  1F66 B;  2F8N H;  3W98 A;  4R8P B;  3REJ A;  3REL B;  3UTA A;  1P3M B;  4Z2M G;  4J8V C;  3MGS C;  5AY8 B;  3X1T A;  1P3L D;  3LEL D;  1KX5 B;  4QLC A;  3O62 D;  1ID3 B;  4G92 B;  5B2J C;  1P3G C;  1P3B A;  3X1S A;  1TZY D;  2NQB B;  5AVC C;  3WKJ B;  5AVB A;  5CPI C;  3LZ1 B;  2NZD B;  5GSU A;  3AZG A;  3WTP C;  3W97 B;  1P3K B;  5B31 D;  1P34 D;  4WNN A;  3B0C T;  3C1C A;  3AYW D;  2FJ7 A;  1BH9 A;  2ARO D;  4J8V D;  4WU9 B;  1ZLA B;  2JSS A;  1HQ3 A;  4ZUX B;  5AV5 B;  4H9P B;  5BNX A;  4KHA A;  3WTP E;  4Z66 D;  5CP6 D;  3W99 B;  3AZJ A;  1WWS A;  5CPI D;  1P3P C;  5B24 D;  3UT9 C;  5G49 B;  5FUG A;  5B1L C;  4WU8 B;  3REI A;  3LZ0 B;  2YFW A;  3AFA D;  5CPK B;  3KXB A;  2CV5 A;  3MGQ A;  2HIO D;  5CPJ A;  3AZK C;  4YM6 D;  5GT0 A;  4J8X D;  3AZF C;  4NFT A;  3AZI A;  3B6G B;  3LEL B;  4YS3 A;  3AZL D;  1P3O D;  3B0D B;  4XUJ A;  5KDM A;  3WAA D;  4KGC A;  3KUY D;  4J8U C;  1M18 C;  1S32 A;  4H9S A;  5E5A D;  1KX4 D;  5B2I A;  3AV2 B;  4EO5 C;  5AV6 D;  4LD9 A;  4CAY A;  4XZQ D;  2L5A A;  4Z5T D;  3AZM A;  5DNN D;  3AZE C;  3MGP D;  3AZK D;  1P3F A;  3W96 C;  1TAF B;  4J8V B;  3MGS B;  4J8W A;  3AZF D;  2RVQ D;  5B40 A;  1KX3 A;  1M19 D;  3WA9 D;  3X1V C;  5B31 G;  3REK A;  1P3G B;  1F66 D;  5B0Y C;  4R8P D;  1AOI C;  3REL D;  1P3M D;  5AVC B;  4J8U D;  5CPI B;  5B24 B;  1U35 C;  1KX5 D;  1ID3 D;  3AFA B;  5AY8 A;  1F1E A;  4H9N B;  3AZE D;  5B33 C;  3WKJ D;  4KUD C;  4YM6 B;  4NE3 A;  2NZD D;  5GXQ A;  3A6N C;  3TU4 A;  3X1U D;  5GT3 C;  3VH5 A;  2NQB A;  3UTB C;  3W97 D;  5JRG C;  5B0Z D;  1P3K D;  2BYK B;  5B0Y D;  2IO5 C;  3MNN C;  3LJA A;  4X23 C;  2PYO A;  3KUY B;  1P3P B;  5BNV B;  4Z2M H;  5B1L B;  1U35 D;  1KX4 B;  5C3I C;  5AV5 D;  4WU9 A;  5B32 C;  3C1B A;  3AV1 C;  4H9R A;  4Z5T B;  1P3I A;  1ZLA A;  3W99 D;  5DNN B;  3AZK B;  4ZUX A;  4JJN A;  4H9P A;  3W98 C;  3REJ C;  4WU8 D;  3UTA C;  1M1A A;  3AZF B;  1EQZ A;  4H9O B;  3LZ0 D;  5CPK D;  2BYM B;  1P3A D;  1M19 B;  4AWL C;  3X1T C;  4QLC C;  3B6F D;  4J8U B;  1M18 B;  3AZN D;  3X1S C;  3VH6 W;  3MGR A;  3MVD A;  5DNM D;  3AN2 A;  3KWQ A;  3B6G D;  4H9Q A;  5GSU C;  4EO5 B;  3NQU A;  3AZG C;  1P3L A;  3AZE B;  3LEL A;  3O62 A;  5AV8 D;  5F99 C;  3AZH C;  1BH8 A;  3C1C C;  3X1U B;  1ULY A;  1TZY A;  3AV2 D;  4UUZ B;  5B0Z B;  1N1J A;  3X1V B;  1HQ3 C;  5B0Y B;  1AOI B;  4M6B A;  5B31 A;  3MGS D;  1P34 A;  1U35 B;  3AZJ C;  3AYW A;  2F8N B;  1TAF A;  3REI C;  5BT1 C;  2ARO A;  5B2J D;  4J8V A;  1P3G D;  5AVC D;  5B33 B;  3KXB C;  5F99 D;  2CV5 C;  4KUD B;  3MGQ C;  3AZH D;  5GT3 B;  4Z66 A;  3WTP D;  5CP6 A;  5GT0 C;  5CPI A;  1P3A B;  5B24 A;  3AZI C;  5B1M C;  2IO5 B;  4YS3 C;  3MNN B;  4X23 B;  4XUJ C;  3B6F B;  1H3O B;  2HUE C;  3AFA A;  3AZN B;  1B6W A;  5DNM B;  5JA4 A;  4KGC C;  4H9N A;  1S32 C;  2HIO A;  5C3I B;  4H9S C;  4YM6 A;  4WZS B;  5B32 B;  4J8X A;  5B2I C;  3AV1 B;  3REH A;  4LD9 C;  5AV9 C;  1P3P D;  3AZL A;  5AV8 B;  3UT9 D;  1P3O A;  5B1L D;  3AZM C;  3REJ B;  2BYK A;  3R45 B;  1P3F C;  3W98 B;  3UTA B;  3WAA A;  3KUY A;  4J8W C;  1R4V A;  2YFV B;  4AWL B;  3V9R A;  5B1M D;  5E5A A;  3X1T B;  5B40 C;  1KX3 C;  4QLC B;  1KX4 A;  1Q9C A;  3REK C;  5AV6 A;  3NQJ A;  4XZQ A;  4Z5T A;  5DNN A;  3MGP A;  3AZK A;  5GSU B;  4CSR A;  5B2J B;  3AZG B;  1KU5 A;  5BO0 A;  5AV9 D;  1M18 D;  5AY8 C;  5F99 B;  1M19 A;  3WA9 A;  3AZH B;  3C1C B;  1F66 A;  4R8P A;  3WTP B;  5GXQ C;  3REL A;  1P3M A;  3TU4 C;  4J8U A;  1HQ3 B;  1KX5 A;  5CHL B;  5BNX B;  3REK D;  4KHA B;  3W96 D;  1ID3 A;  3LJA C;  2PYO C;  3AZJ B;  3AZE A;  3WKJ A;  3KSY A;  3LZ1 A;  2NZD A;  3X1V D;  3X1U A; 
#chains in the Genus database with same CATH topology
 1AOI D;  4WU9 C;  3W97 A;  4NE6 A;  3KXB B;  3C1B C;  1P3K A;  5B0Z A;  3MGQ B;  1P3I C;  3UT9 B;  1ZLA C;  5B0Y A;  3H0R C;  4ZUX C;  4JJN C;  2F8N D;  5GT0 B;  1M1A C;  1EQZ C;  5B1M B;  5B33 D;  3VH5 W;  4XUJ B;  4KUD D;  2HUE B;  5AV5 A;  3A6N D;  5GT3 D;  4KGC B;  3UTB D;  1S32 B;  3W99 A;  3MGR C;  5JRG D;  3MVD C;  3AN2 C;  2JE5 A;  3KWQ C;  5G49 A;  4E44 A;  4WU8 A;  5BS7 A;  3MNN D;  4X23 D;  4LD9 B;  5AV9 B;  3B0B A;  4CAY B;  1B67 A;  3LZ0 A;  5CPK A;  1P3A A;  1P3B C;  3AZM B;  1P3L C;  1P3F B;  3VH6 A;  3O62 C;  5AVB C;  3B6F A;  4J8W B;  5B32 D;  3AZN A;  1TZY C;  3AV1 D;  5DNM A;  5B40 B;  3B6G A;  3REK B;  3W96 B;  3W98 D;  2ZY3 A;  3REJ D;  3UTA D;  2FJ7 C;  4E45 A;  5B31 C;  1P34 C;  2RIQ A;  3EPK A;  4DRB A;  5AV8 A;  3X1T D;  3R45 A;  4QLC D;  3AYW C;  3VH6 T;  2ARO C;  3AV2 A;  3B0C W;  4G91 C;  1P3B D;  3X1S D;  2YFV A;  1BFM A;  3EG5 B;  5AVB D;  1JFI B;  5GXQ B;  5GSU D;  3TU4 B;  4Z66 C;  3AZG D;  3MGS A;  5CP6 C;  3EPH A;  5B24 C;  3A6N B;  5B2J A;  1HTA A;  4ZBJ C;  3LJA B;  3C1C D;  5CPJ C;  1P3G A;  2FJ7 D;  2PYO B;  3AFA C;  1W2E A;  5AVC A;  2ZM5 A;  3UTB B;  2F8N G;  5JRG B;  5F99 A;  3AZH A;  1HQ3 D;  2HIO C;  4YM6 C;  3WTP A;  3EPJ A;  4J8X C;  3C1B B;  4H9R B;  1P3I B;  3REH C;  3AZJ D;  4JJN B;  3AZL C;  1P3O C;  3REI D;  5BT1 D;  1PZR A;  1M1A B;  3WAA C;  1EQZ B;  3KUY C;  3KXB D;  2CV5 D;  5E5A C;  3MGQ D;  5CPJ D;  1KX4 C;  5GT0 D;  5AV6 C;  3MGR B;  4XZQ C;  3MVD B;  3AN2 B;  5BNV A;  4Z5T C;  3A1I A;  3KWQ B;  3UT9 A;  5B32 G;  5B1L A;  5DNN C;  3AZI D;  2CWE A;  4H9Q B;  3MGP C;  4YS3 D;  4XUJ D;  1WWI A;  3NQU B;  2Y2J A;  2Y2I A;  1P3B B;  2RVQ C;  3X1S B;  3REH D;  1P3L B;  5B1M A;  4KGC D;  3O62 B;  4HGA C;  1S32 D;  5AVB B;  1M19 C;  3WA9 C;  1BH8 B;  1F66 C;  4R8P C;  5B2I D;  1TZY B;  3REL C;  1P3M C;  3AZF A;  4LD9 D;  1N1J B;  4H9O A;  4WNN B;  2BYM A;  4WJ3 C;  3AZM D;  1P3F D;  1KX5 C;  2FJ7 B;  1BH9 B;  2LY8 A;  2Y2M A;  4WV4 B;  4G92 C;  5B31 B;  5AV9 A;  1ID3 C;  1P34 B;  4J8W D;  1M18 A;  2BG1 A;  2NQB C;  5B40 D;  1KX3 D;  3WKJ C;  3AYW B;  3LZ1 C;  2NZD C;  2ARO B;  4G91 B;  3X1U C;  3W97 C;  1P3K C;  5B0Z C;  3W96 A;  5FUG B;  3REI B;  2XD5 A;  4Z66 B;  4DRA A;  5CP6 B;  2DQN C;  2J8P A;  2YFW B;  5AY8 D;  4UUZ A;  2CV5 B;  3X1V A;  4ZBJ B;  5CPJ B;  1AOI A;  5AV5 C;  5GXQ D;  3TU4 D;  2NQB D;  5JA4 B;  3AZI B;  3W99 C;  2HIO B;  1U35 A;  3LZ1 D;  4YS3 B;  1JFI A;  2F8N A;  1A7W A;  4J8X B;  4WU8 C;  5BS7 C;  5KDM B;  3LJA D;  2PYO D;  3REH B;  3LZ0 C;  5CPK C;  3AZL B;  5B33 A;  1P3A C;  1P3O B;  4KUD A;  3A6N A;  5B2I B;  3WAA B;  3B6F C;  5GT3 A;  4WU9 D;  3UTB A;  3AZN C;  3C1B D;  3V9R B;  5JRG A;  5E5A B;  4NE5 A;  3IP4 C;  5DNM C;  1P3I D;  1ZLA D;  3B6G C;  3LEL C;  4ZUX D;  2UWX A;  3MNN A;  4JJN D;  3B0D C;  4X23 A;  2G5H C;  5AV6 B;  1H3O A;  3NQJ B;  4XZQ B;  1M1A D;  3VH5 T;  1EQZ D;  3MGP B;  1KX3 B;  3P5J B;  1P3P A;  5AV8 C;  3H0M C;  4CSR B;  5BO0 B;  5B32 A;  3AV1 A;  3AV2 C;  4HGA B;  3MGR D;  3WA9 B;  3MVD D;  2F8N K;  3AN2 D;  3KWQ D;  1F66 B;  2F8N H;  3W98 A;  4R8P B;  3REJ A;  3REL B;  3UTA A;  1P3M B;  4Z2M G;  4J8V C;  3MGS C;  5AY8 B;  2VQR A;  3X1T A;  1P3L D;  3LEL D;  1KX5 B;  4QLC A;  3O62 D;  1ID3 B;  4G92 B;  5B2J C;  1P3G C;  1P3B A;  3X1S A;  1TZY D;  2NQB B;  5AVC C;  3WKJ B;  5AVB A;  5CPI C;  3LZ1 B;  2NZD B;  5GSU A;  3AZG A;  3WTP C;  3W97 B;  1P3K B;  5B31 D;  1P34 D;  4WNN A;  2JCH A;  3B0C T;  3C1C A;  3AYW D;  2FJ7 A;  1BH9 A;  2ARO D;  2ZY4 A;  4J8V D;  4WU9 B;  1ZLA B;  2JSS A;  1HQ3 A;  4ZUX B;  5AV5 B;  4H9P B;  5BNX A;  4KHA A;  3WTP E;  4Z66 D;  5CP6 D;  3W99 B;  3AZJ A;  1WWS A;  5CPI D;  1P3P C;  5B24 D;  3UT9 C;  5G49 B;  5FUG A;  5B1L C;  4WU8 B;  3REI A;  2Y2O A;  3AL0 C;  2Y2G A;  1Z2C B;  2YFW A;  3LZ0 B;  3KXB A;  3AFA D;  5CPK B;  2CV5 A;  3MGQ A;  2HIO D;  5CPJ A;  3AZK C;  4YM6 D;  5GT0 A;  4J8X D;  3AZF C;  4NFT A;  3AZI A;  3B6G B;  3LEL B;  2Y2Q A;  4YS3 A;  3AZL D;  1P3O D;  3B0D B;  4XUJ A;  5KDM A;  3KFU G;  3WAA D;  3EPL A;  4KGC A;  3KUY D;  4J8U C;  1M18 C;  1S32 A;  4H9S A;  5E5A D;  1KX4 D;  5B2I A;  3AV2 B;  4EO5 C;  5AV6 D;  4LD9 A;  4CAY A;  4XZQ D;  2L5A A;  4Z5T D;  3AZM A;  5DNN D;  3AZE C;  3MGP D;  3AZK D;  1P3F A;  3W96 C;  1TAF B;  4J8V B;  3MGS B;  4J8W A;  3AZF D;  2RVQ D;  5B40 A;  1KX3 A;  1M19 D;  3WA9 D;  5B31 G;  3X1V C;  3REK A;  1P3G B;  1F66 D;  5B0Y C;  4R8P D;  2DF4 C;  1AOI C;  3REL D;  1P3M D;  5AVC B;  4J8U D;  5CPI B;  5B24 B;  1U35 C;  1KX5 D;  1ID3 D;  3AFA B;  5AY8 A;  1F1E A;  4H9N B;  3AZE D;  2Y2N A;  5B33 C;  3WKJ D;  4KUD C;  4YM6 B;  4NE3 A;  2NZD D;  5GXQ A;  3A6N C;  3TU4 A;  2FFF B;  3X1U D;  5GT3 C;  3VH5 A;  2NQB A;  3UTB C;  3W97 D;  5JRG C;  5B0Z D;  1P3K D;  2BYK B;  5B0Y D;  2IO5 C;  3MNN C;  3LJA A;  4X23 C;  2PYO A;  3KUY B;  1P3P B;  5BNV B;  4Z2M H;  5B1L B;  1U35 D;  1KX4 B;  3F6T A;  5C3I C;  5AV5 D;  2Y2P A;  4WU9 A;  5B32 C;  3C1B A;  3AV1 C;  2XD1 A;  4H9R A;  4Z5T B;  1P3I A;  1ZLA A;  2Y2H A;  3W99 D;  5DNN B;  3AZK B;  4ZUX A;  3H0L C;  4JJN A;  4H9P A;  3W98 C;  3REJ C;  4WU8 D;  3UTA C;  1M1A A;  3AZF B;  1EQZ A;  4H9O B;  3LZ0 D;  5CPK D;  2BYM B;  1P3A D;  1M19 B;  4AWL C;  3X1T C;  4QLC C;  3B6F D;  4J8U B;  1M18 B;  3AZN D;  3X1S C;  3VH6 W;  3MGR A;  3MVD A;  5DNM D;  3AN2 A;  3KWQ A;  3B6G D;  4H9Q A;  5GSU C;  4EO5 B;  3NQU A;  3AZG C;  1P3L A;  3AZE B;  3LEL A;  3O62 A;  5AV8 D;  5F99 C;  3AZH C;  1BH8 A;  3C1C C;  3X1U B;  1ULY A;  1TZY A;  3AV2 D;  4UUZ B;  5B0Z B;  1N1J A;  3X1V B;  1HQ3 C;  5B0Y B;  1AOI B;  4M6B A;  5B31 A;  3MGS D;  1P34 A;  1U35 B;  3AZJ C;  3AYW A;  2F8N B;  1TAF A;  2Y2L A;  5BT1 C;  3REI C;  2ARO A;  5B2J D;  4J8V A;  1P3G D;  5AVC D;  5B33 B;  3KXB C;  5F99 D;  2CV5 C;  4KUD B;  3MGQ C;  3AZH D;  5GT3 B;  4Z66 A;  3WTP D;  5CP6 A;  5GT0 C;  5CPI A;  1P3A B;  5B24 A;  3AZI C;  5B1M C;  2IO5 B;  4YS3 C;  3MNN B;  4X23 B;  4XUJ C;  3B6F B;  1H3O B;  2HUE C;  3AFA A;  3AZN B;  1B6W A;  5DNM B;  5JA4 A;  2G5I C;  4H9N A;  4KGC C;  1S32 C;  2HIO A;  5C3I B;  4H9S C;  4YM6 A;  3A1K A;  4WZS B;  5B32 B;  4J8X A;  5B2I C;  3AV1 B;  2W8S A;  2F2A C;  3REH A;  4LD9 C;  5AV9 C;  1P3P D;  3AZL A;  5AV8 B;  3UT9 D;  1P3O A;  2Y2K A;  5B1L D;  3AZM C;  3REJ B;  2BYK A;  3R45 B;  1P3F C;  3W98 B;  3UTA B;  3WAA A;  3KUY A;  4J8W C;  1R4V A;  2YFV B;  4AWL B;  3V9R A;  5B1M D;  5E5A A;  3X1T B;  5B40 C;  1KX3 C;  4QLC B;  1KX4 A;  1Q9C A;  3REK C;  2ZY2 A;  5AV6 A;  3NQJ A;  4XZQ A;  4Z5T A;  5DNN A;  3MGP A;  3AZK A;  3FDD A;  5GSU B;  1T3U A;  4CSR A;  5B2J B;  3AZG B;  1KU5 A;  5BO0 A;  5AV9 D;  1M18 D;  5AY8 C;  5F99 B;  1M19 A;  3WA9 A;  3AZH B;  3C1C B;  1F66 A;  4R8P A;  3WTP B;  5GXQ C;  3REL A;  1P3M A;  3TU4 C;  4J8U A;  1HQ3 B;  1KX5 A;  5CHL B;  5BNX B;  3REK D;  4KHA B;  3W96 D;  1ID3 A;  4UPK A;  3LJA C;  2PYO C;  3AZJ B;  3AZE A;  3WKJ A;  3KSY A;  3LZ1 A;  2NZD A;  3X1V D;  2ZY5 A;  3X1U A;  4DQY B; 
#chains in the Genus database with same CATH homology
 1AOI D;  4WU9 C;  3W97 A;  4NE6 A;  3KXB B;  3C1B C;  1P3K A;  5B0Z A;  3MGQ B;  1P3I C;  3UT9 B;  1ZLA C;  5B0Y A;  3H0R C;  4ZUX C;  4JJN C;  2F8N D;  5GT0 B;  1M1A C;  1EQZ C;  5B1M B;  5B33 D;  3VH5 W;  4XUJ B;  4KUD D;  2HUE B;  5AV5 A;  3A6N D;  5GT3 D;  4KGC B;  3UTB D;  1S32 B;  3W99 A;  3MGR C;  5JRG D;  3MVD C;  3AN2 C;  2JE5 A;  3KWQ C;  5G49 A;  4E44 A;  4WU8 A;  5BS7 A;  3MNN D;  4X23 D;  4LD9 B;  5AV9 B;  3B0B A;  4CAY B;  1B67 A;  3LZ0 A;  5CPK A;  1P3A A;  1P3B C;  3AZM B;  1P3L C;  1P3F B;  3VH6 A;  3O62 C;  5AVB C;  3B6F A;  4J8W B;  5B32 D;  3AZN A;  1TZY C;  3AV1 D;  5DNM A;  5B40 B;  3B6G A;  3REK B;  3W96 B;  3W98 D;  2ZY3 A;  3REJ D;  3UTA D;  2FJ7 C;  4E45 A;  5B31 C;  1P34 C;  2RIQ A;  3EPK A;  4DRB A;  5AV8 A;  3X1T D;  3R45 A;  4QLC D;  3AYW C;  3VH6 T;  2ARO C;  3AV2 A;  3B0C W;  4G91 C;  1P3B D;  3X1S D;  2YFV A;  1BFM A;  3EG5 B;  5AVB D;  1JFI B;  5GXQ B;  5GSU D;  3TU4 B;  4Z66 C;  3AZG D;  3MGS A;  5CP6 C;  3EPH A;  5B24 C;  3A6N B;  5B2J A;  1HTA A;  4ZBJ C;  3LJA B;  3C1C D;  5CPJ C;  1P3G A;  2FJ7 D;  2PYO B;  3AFA C;  1W2E A;  5AVC A;  2ZM5 A;  3UTB B;  2F8N G;  5JRG B;  5F99 A;  3AZH A;  1HQ3 D;  2HIO C;  4YM6 C;  3WTP A;  3EPJ A;  4J8X C;  3C1B B;  4H9R B;  1P3I B;  3REH C;  3AZJ D;  4JJN B;  3AZL C;  1P3O C;  3REI D;  5BT1 D;  1PZR A;  1M1A B;  3WAA C;  1EQZ B;  3KUY C;  3KXB D;  2CV5 D;  5E5A C;  3MGQ D;  5CPJ D;  1KX4 C;  5GT0 D;  5AV6 C;  3MGR B;  4XZQ C;  3MVD B;  3AN2 B;  5BNV A;  4Z5T C;  3A1I A;  3KWQ B;  3UT9 A;  5B32 G;  5B1L A;  5DNN C;  3AZI D;  2CWE A;  4H9Q B;  3MGP C;  4YS3 D;  4XUJ D;  1WWI A;  3NQU B;  2Y2J A;  2Y2I A;  1P3B B;  2RVQ C;  3X1S B;  3REH D;  1P3L B;  5B1M A;  4KGC D;  3O62 B;  4HGA C;  1S32 D;  5AVB B;  1M19 C;  3WA9 C;  1BH8 B;  1F66 C;  4R8P C;  5B2I D;  1TZY B;  3REL C;  1P3M C;  3AZF A;  4LD9 D;  1N1J B;  4H9O A;  4WNN B;  2BYM A;  4WJ3 C;  3AZM D;  1P3F D;  1KX5 C;  2FJ7 B;  1BH9 B;  2LY8 A;  2Y2M A;  4WV4 B;  4G92 C;  5B31 B;  5AV9 A;  1ID3 C;  1P34 B;  4J8W D;  1M18 A;  2BG1 A;  2NQB C;  5B40 D;  1KX3 D;  3WKJ C;  3AYW B;  3LZ1 C;  2NZD C;  2ARO B;  4G91 B;  3X1U C;  3W97 C;  1P3K C;  5B0Z C;  3W96 A;  5FUG B;  3REI B;  2XD5 A;  4Z66 B;  4DRA A;  5CP6 B;  2DQN C;  2J8P A;  2YFW B;  5AY8 D;  4UUZ A;  2CV5 B;  3X1V A;  4ZBJ B;  5CPJ B;  1AOI A;  5AV5 C;  5GXQ D;  3TU4 D;  2NQB D;  5JA4 B;  3AZI B;  3W99 C;  2HIO B;  1U35 A;  3LZ1 D;  4YS3 B;  1JFI A;  2F8N A;  1A7W A;  4J8X B;  4WU8 C;  5BS7 C;  5KDM B;  3LJA D;  2PYO D;  3REH B;  3LZ0 C;  5CPK C;  3AZL B;  5B33 A;  1P3A C;  1P3O B;  4KUD A;  3A6N A;  5B2I B;  3WAA B;  3B6F C;  5GT3 A;  4WU9 D;  3UTB A;  3AZN C;  3C1B D;  3V9R B;  5JRG A;  5E5A B;  4NE5 A;  3IP4 C;  5DNM C;  1P3I D;  1ZLA D;  3B6G C;  3LEL C;  4ZUX D;  2UWX A;  3MNN A;  4JJN D;  3B0D C;  4X23 A;  2G5H C;  5AV6 B;  1H3O A;  3NQJ B;  4XZQ B;  1M1A D;  3VH5 T;  1EQZ D;  3MGP B;  1KX3 B;  3P5J B;  1P3P A;  5AV8 C;  3H0M C;  4CSR B;  5BO0 B;  5B32 A;  3AV1 A;  3AV2 C;  4HGA B;  3MGR D;  3WA9 B;  3MVD D;  2F8N K;  3AN2 D;  3KWQ D;  1F66 B;  2F8N H;  3W98 A;  4R8P B;  3REJ A;  3REL B;  3UTA A;  1P3M B;  4Z2M G;  4J8V C;  3MGS C;  5AY8 B;  2VQR A;  3X1T A;  1P3L D;  3LEL D;  1KX5 B;  4QLC A;  3O62 D;  1ID3 B;  4G92 B;  5B2J C;  1P3G C;  1P3B A;  3X1S A;  1TZY D;  2NQB B;  5AVC C;  3WKJ B;  5AVB A;  5CPI C;  3LZ1 B;  2NZD B;  5GSU A;  3AZG A;  3WTP C;  3W97 B;  1P3K B;  5B31 D;  1P34 D;  4WNN A;  2JCH A;  3B0C T;  3C1C A;  3AYW D;  2FJ7 A;  1BH9 A;  2ARO D;  2ZY4 A;  4J8V D;  4WU9 B;  1ZLA B;  2JSS A;  1HQ3 A;  4ZUX B;  5AV5 B;  4H9P B;  5BNX A;  4KHA A;  3WTP E;  4Z66 D;  5CP6 D;  3W99 B;  3AZJ A;  1WWS A;  5CPI D;  1P3P C;  5B24 D;  3UT9 C;  5G49 B;  5FUG A;  5B1L C;  4WU8 B;  3REI A;  2Y2O A;  3AL0 C;  2Y2G A;  1Z2C B;  2YFW A;  3LZ0 B;  3KXB A;  3AFA D;  5CPK B;  2CV5 A;  3MGQ A;  2HIO D;  5CPJ A;  3AZK C;  4YM6 D;  5GT0 A;  4J8X D;  3AZF C;  4NFT A;  3AZI A;  3B6G B;  3LEL B;  2Y2Q A;  4YS3 A;  3AZL D;  1P3O D;  3B0D B;  4XUJ A;  5KDM A;  3KFU G;  3WAA D;  3EPL A;  4KGC A;  3KUY D;  4J8U C;  1M18 C;  1S32 A;  4H9S A;  5E5A D;  1KX4 D;  5B2I A;  3AV2 B;  4EO5 C;  5AV6 D;  4LD9 A;  4CAY A;  4XZQ D;  2L5A A;  4Z5T D;  3AZM A;  5DNN D;  3AZE C;  3MGP D;  3AZK D;  1P3F A;  3W96 C;  1TAF B;  4J8V B;  3MGS B;  4J8W A;  3AZF D;  2RVQ D;  5B40 A;  1KX3 A;  1M19 D;  3WA9 D;  5B31 G;  3X1V C;  3REK A;  1P3G B;  1F66 D;  5B0Y C;  4R8P D;  2DF4 C;  1AOI C;  3REL D;  1P3M D;  5AVC B;  4J8U D;  5CPI B;  5B24 B;  1U35 C;  1KX5 D;  1ID3 D;  3AFA B;  5AY8 A;  1F1E A;  4H9N B;  3AZE D;  2Y2N A;  5B33 C;  3WKJ D;  4KUD C;  4YM6 B;  4NE3 A;  2NZD D;  5GXQ A;  3A6N C;  3TU4 A;  2FFF B;  3X1U D;  5GT3 C;  3VH5 A;  2NQB A;  3UTB C;  3W97 D;  5JRG C;  5B0Z D;  1P3K D;  2BYK B;  5B0Y D;  2IO5 C;  3MNN C;  3LJA A;  4X23 C;  2PYO A;  3KUY B;  1P3P B;  5BNV B;  4Z2M H;  5B1L B;  1U35 D;  1KX4 B;  3F6T A;  5C3I C;  5AV5 D;  2Y2P A;  4WU9 A;  5B32 C;  3C1B A;  3AV1 C;  2XD1 A;  4H9R A;  4Z5T B;  1P3I A;  1ZLA A;  2Y2H A;  3W99 D;  5DNN B;  3AZK B;  4ZUX A;  3H0L C;  4JJN A;  4H9P A;  3W98 C;  3REJ C;  4WU8 D;  3UTA C;  1M1A A;  3AZF B;  1EQZ A;  4H9O B;  3LZ0 D;  5CPK D;  2BYM B;  1P3A D;  1M19 B;  4AWL C;  3X1T C;  4QLC C;  3B6F D;  4J8U B;  1M18 B;  3AZN D;  3X1S C;  3VH6 W;  3MGR A;  3MVD A;  5DNM D;  3AN2 A;  3KWQ A;  3B6G D;  4H9Q A;  5GSU C;  4EO5 B;  3NQU A;  3AZG C;  1P3L A;  3AZE B;  3LEL A;  3O62 A;  5AV8 D;  5F99 C;  3AZH C;  1BH8 A;  3C1C C;  3X1U B;  1ULY A;  1TZY A;  3AV2 D;  4UUZ B;  5B0Z B;  1N1J A;  3X1V B;  1HQ3 C;  5B0Y B;  1AOI B;  4M6B A;  5B31 A;  3MGS D;  1P34 A;  1U35 B;  3AZJ C;  3AYW A;  2F8N B;  1TAF A;  2Y2L A;  5BT1 C;  3REI C;  2ARO A;  5B2J D;  4J8V A;  1P3G D;  5AVC D;  5B33 B;  3KXB C;  5F99 D;  2CV5 C;  4KUD B;  3MGQ C;  3AZH D;  5GT3 B;  4Z66 A;  3WTP D;  5CP6 A;  5GT0 C;  5CPI A;  1P3A B;  5B24 A;  3AZI C;  5B1M C;  2IO5 B;  4YS3 C;  3MNN B;  4X23 B;  4XUJ C;  3B6F B;  1H3O B;  2HUE C;  3AFA A;  3AZN B;  1B6W A;  5DNM B;  5JA4 A;  2G5I C;  4H9N A;  4KGC C;  1S32 C;  2HIO A;  5C3I B;  4H9S C;  4YM6 A;  3A1K A;  4WZS B;  5B32 B;  4J8X A;  5B2I C;  3AV1 B;  2W8S A;  2F2A C;  3REH A;  4LD9 C;  5AV9 C;  1P3P D;  3AZL A;  5AV8 B;  3UT9 D;  1P3O A;  2Y2K A;  5B1L D;  3AZM C;  3REJ B;  2BYK A;  3R45 B;  1P3F C;  3W98 B;  3UTA B;  3WAA A;  3KUY A;  4J8W C;  1R4V A;  2YFV B;  4AWL B;  3V9R A;  5B1M D;  5E5A A;  3X1T B;  5B40 C;  1KX3 C;  4QLC B;  1KX4 A;  1Q9C A;  3REK C;  2ZY2 A;  5AV6 A;  3NQJ A;  4XZQ A;  4Z5T A;  5DNN A;  3MGP A;  3AZK A;  3FDD A;  5GSU B;  1T3U A;  4CSR A;  5B2J B;  3AZG B;  1KU5 A;  5BO0 A;  5AV9 D;  1M18 D;  5AY8 C;  5F99 B;  1M19 A;  3WA9 A;  3AZH B;  3C1C B;  1F66 A;  4R8P A;  3WTP B;  5GXQ C;  3REL A;  1P3M A;  3TU4 C;  4J8U A;  1HQ3 B;  1KX5 A;  5CHL B;  5BNX B;  3REK D;  4KHA B;  3W96 D;  1ID3 A;  4UPK A;  3LJA C;  2PYO C;  3AZJ B;  3AZE A;  3WKJ A;  3KSY A;  3LZ1 A;  2NZD A;  3X1V D;  2ZY5 A;  3X1U A;  4DQY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...