3AV1D

The human nucleosome structure containing the histone variant h3.2
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Structures of human nucleosomes containing major histone H3 variants
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3av1D00
1P3MD 4X23B 3LELD 5B1MC 2JSSA 5B1LD 3AZIA 5CPIA 4X23C 3MVDD 5DNNC 2NZDD 3AZFA 3VH6A 3REHB 3WA9A 3LZ0B 4J8UD 3REHC 5BT1D 3LZ0C 1P3GA 1TZYB 3C1CB 1P3OA 4R8PD 1TZYC 5E5AC 3C1CC 2FJ7B 1S32A 4AWLC 3AZND 4WU8B 4QLCC 1F66D 3LJAB 4WU8C 3B6FA 5B33B 3LJAC 1HQ3D 1JFIB 5B33C 3REJB 5AV8B 4Z66A 3MNND 4WU9C 4Z5TB 1P3PB 1M18D 1KU5A 3W96A 3REJC 5AV8C 3AN2A 4Z5TC 1P3BB 3REKD 3LELA 5B1LA 1P3BC 3LZ1C 3NQUA 3MVDA 3AZGD 2RVQC 3REID 4Z2MH 1B6WA 5B24D 2NZDA 1N1JA 3AFAD 3AZIB 5CPIB 4KUDC 1H3OB 4J8UA 1KX4D 5CPIC 3UTBC 5G49A 3AZMD 3AZFB 3WA9B 4R8PA 3AZFC 3AZHD 3WA9C 1ZLAB 1TAFA 1P3GB 3AZNA 1P3OB 4NE3A 1P3GC 3UTAD 1P3OC 1S32B 5B0ZC 2LY8A 1HQ3A 2BYKA 1S32C 2YFWA 3KUYD 3MNNA 1M18A 3B6FB 1BH8A 3B6FC 3REKA 3AZEC 3VH6W 3W96B 3AN2B 4Z66C 3AZGA 1P3MB 3REIA 5B31G 1AOID 4UUZB 3W96C 5B24A 3LELB 3AN2C 3AZLD 5B1LB 3AFAA 3NQUB 4KHAA 5DNND 3MVDB 3LELC 5B1LC 1KX4A 2NZDB 3AZMA 3WAAD 1N1JB 3TU4D 2NZDC 5B32G 4J8UB 3AZHA 5B2ID 2HIOB 5G49B 4J8UC 3X1UB 5BT1C 4R8PB 3C1BD 3AZKD 3UTAA 3VH5T 5B31B 1TAFB 4R8PC 4QLCD 3AZNB 1F66B 3B6GD 3KUYA 3AZNC 1A7WA 1HQ3B 2BYKB 1B67A 5AV9D 4WU9D 2YFWB 4H9RA 3MNNB 1BH8B 1M18C 3MNNC 1AOIA 3AZLA 3REKC 4DRAA 5DNNA 4H9PA 3AZGB 3REIB 4WNNA 3WAAA 4KUDD 3TU4A 3AFAB 3REIC 4KHAB 4JJND 5B24C 3UTBD 3AFAC 1KX4B 5B2IA 3AZMB 1KX4C 1EQZD 5GSUD 3C1BA 3AZKA 3AZHB 3AZMC 5DNMD 4QLCA 3W99D 3AZHC 3WTPD 5B2JD 4ZBJC 5B0ZD 3UTAB 3VH5A 3B6GA 1P3KD 3UTAC 5AV9A 4WU9A 3MGRC 3KUYB 3AZED 3KUYC 3W98D 4H9RB 4G91C 1AOIB 3AZLB 4KUDA 1AOIC 4DRBA 4JJNA 5DNNB 3UTBA 5AV6D 3AZLC 4WNNB 4LD9D 3MGPD 3TU4B 5GT3D 2F8ND 1EQZA 5GSUA 3WAAC 3KXBC 3TU4C 1WWSA 2F8NK 5B2IB 3V9RB 5DNMA 3W99A 1KX5D 5B2IC 3WTPA 5E5AB 5B2JA 4NE6A 3C1BB 5B0ZA 4AWLB 4E45A 4NE5A 1P3KA 4QLCB 3C1BC 5B0YD 3AZKC 3B6GB 3O62D 4CAYB 2CV5D 5AY8D 3AZEA 4M6BA 3B6GC 5AV9B 5GT0D 4WU9B 3W98A 5AV9C 3KSYA 3MGSC 2YFVA 3UT9D 3LZ1B 3X1TD 5AV6A 4LD9A 3MGPA 4KUDB 5CPJD 5GT3A 2F8NA 3UTBB 3WKJD 4JJNC 1KX5A 1EQZB 3AZJD 5DNMB 1EQZC 3W99B 5GSUC 5CHLB 5B0YA 3WTPB 5DNMC 5B2JB 3W99C 5B0ZB 3O62A 1P3KB 3WTPC 2CV5A 5B2JC 5AY8A 4WZSB 3MGRD 5GT0A 1P3KC 4H9OA 2AROD 5JRGD 4ZUXD 3AZEB 1KX3D 3B0CW 3UT9A 3W98B 4Z66B 1ID3D 3W98C 3X1TA 5GXQD 2YFVB 3KWQD 5CPJA 4KGCD 5AV6B 3WKJA 4LD9B 5AV6C 5GT3B 3KXBD 3AZJA 3AYWD 4XZQD 3MGPC 2PYOD 4LD9C 5GT3C 1F1EA 5C3IB 5AV5D 1P3FD 4CSRA 1KX5C 5C3IC 4YM6C 5B0YB 3MGRA 5B0YC 3O62B 2AROA 5JRGA 5KDMA 5AY8B 4ZUXA 1KX3A 2BYMA 3O62C 1P3AC 5GT0B 1M1AD 2CV5C 4H9OB 5AY8C 1M19D 3MGSD 5GT0C 1M18B 4XUJC 1ID3A 3WTPE 5GXQA 3UT9B 3KWQA 4YS3D 3REKB 3UT9C 5JA4A 2NQBD 4KGCA 3X1TC 5B24B 5CPJB 3A6ND 3KXBA 1R4VA 4XZQA 3AYWA 2FJ7D 5CPJC 2PYOA 3W97D 3WKJB 4J8XD 4EO5B 5AV5A 3WKJC 3X1VC 3AZJB 1P3FA 4EO5C 3AZJC 4ZBJB 4J8VD 4CSRB 1P3PD 3MGRB 5B40D 1M1AA 1HTAA 1M19A 2AROB 3MGSA 5JRGB 5KDMB 4ZUXB 2AROC 2HUEC 5JRGC 4G91B 4YS3A 4ZUXC 1KX3C 1ID3B 2NQBA 5GXQB 3KWQB 1ID3C 4NFTA 5CPKD 5GXQC 3A6NA 5BO0A 5JA4B 1BH9A 3KWQC 1ZLAD 2FJ7A 4H9PB 4H9SA 3W97A 4J8XA 4KGCC 1Q9CA 3WAAB 3KXBB 3B0BA 2PYOB 4XZQB 3AV2C 3AV1D 3AYWC 4XZQC 1JFIA 2PYOC 5AV5B 4YM6D 4J8VA 1P3FB 4HGAB 1P3PA 1ULYA 3AZKB 5AV5C 4WV4B 4HGAC 4H9QA 1U35D 1P3FC 5B40A 5AVBD 5BS7A 3MGQD 5F99D 1P3AD 1M1AB 4XUJD 1M19B 3MGSB 4H9NA 1M1AC 2CWEA 1H3OA 1M19C 1P34D 4YS3B 5CPKA 4YS3C 2NQBB 1ZLAA 2HIOD 3X1UD 2NQBC 3A6NB 5BO0B 1BH9B 4JJNB 5B31D 3A6NC 3W97B 3AV1A 4J8XB 3VH5W 3X1VD 2FJ7C 4H9SC 4J8WD 3W97C 4YM6A 4J8XC 5GSUB 3NQJA 5BNXA 1U35A 5AVBA 3MGQA 4J8VB 5B32D 5F99A 1P3AA 4J8VC 1P3MA 4H9QB 1P3PC 5B40B 4UUZA 4XUJA 5B40C 5BS7C 5CP6D 2F8NG 1P34A 4H9NB 3AZIC 2HIOA 1P3ID 1WWIA 3X1UA 5CPKB 5CPKC 2IO5B 5B31A 1ZLAC 3X1VA 1F66A 2IO5C 3MGPB 4J8WA 3AV2D 2F8NB 3X1SD 3AV1B 3RELD 1KX5B 3AV1C 4YM6B 5B32A 5AVCD 3NQJB 5BNXB 1U35B 5AVBB 3MGQB 5F99B 1U35C 1P3LD 5BNVA 5AVBC 1P3AB 3MGQC 5CP6A 2CV5B 5B1MD 5F99C 4X23D 4XUJB 1P3MC 1BFMA 3MVDC 1P34B 1P3IA 3REHD 5FUGA 1P34C 3LZ0D 4G92B 3X1TB 4G92C 1TZYD 2HIOC 5E5AD 3C1CD 3AV2A 3X1UC 3X1SA 4Z2MG 3RELA 3X1VB 3B0DB 5B31C 4WU8D 4J8WB 3LJAD 3B0DC 1F66C 5AVCA 4J8WC 5B33D 1HQ3C 5B32B 5AV8D 3REJD 1P3LA 3R45A 4Z5TD 5B32C 5B1MA 1P3BD 3LZ1D 4X23A 2RVQD 5BNVB 4E44A 2HUEB 5CP6B 3B0CT 1KX3B 2BYMB 3AZGC 5CP6C 3VH6T 3REHA 3AZID 5CPID 3LZ0A 3V9RA 1P3IB 3AZFD 1TZYA 5FUGB 3WA9D 5E5AA 3C1CA 1P3IC 4KGCB 1P3GD 4WU8A 1P3OD 3AV2B 3LJAA 3X1SB 4CAYA 3AYWB 2F8NH 1S32D 2L5AA 5B33A 3RELB 3X1SC 3RELC 3REJA 5AV8A 4Z5TA 3B6FD 5AVCB 1P3BA 5AVCC 3LZ1A 4Z66D 1P3LB 3R45B 3W96D 3AN2D 5B1MB 1P3LC
chains in the Genus database with same CATH superfamily
1P3MD 4X23B 3LELD 5B1MC 2XD5A 2JSSA 5B1LD 3AZIA 5CPIA 4X23C 3MVDD 2DF4C 5DNNC 2NZDD 3AZFA 3VH6A 3REHB 3WA9A 3LZ0B 4J8UD 2FFFB 2Y2KA 5BT1D 3EPLA 3REHC 3LZ0C 1P3GA 1TZYB 3C1CB 1P3OA 4R8PD 1TZYC 2Y2HA 5E5AC 3A1IA 3C1CC 2FJ7B 1S32A 4AWLC 3AZND 4WU8B 4QLCC 1F66D 3LJAB 3H0RC 4WU8C 3B6FA 5B33B 3LJAC 1HQ3D 1JFIB 5B33C 3REJB 5AV8B 4Z66A 3MNND 4WU9C 4Z5TB 1P3PB 1M18D 2DQNC 1KU5A 3W96A 3REJC 5AV8C 3AN2A 4Z5TC 1P3BB 3REKD 3LELA 2XD1A 5B1LA 1P3BC 3LZ1C 3NQUA 3MVDA 3AZGD 2RVQC 3REID 4Z2MH 3IP4C 1B6WA 5B24D 2NZDA 1N1JA 3AFAD 3AZIB 5CPIB 4KUDC 1H3OB 4J8UA 1KX4D 5CPIC 3UTBC 5G49A 3AZMD 3AZFB 3WA9B 4R8PA 4WJ3C 3AZFC 3AZHD 3WA9C 1ZLAB 1TAFA 1P3GB 3AZNA 1P3OB 1PZRA 4NE3A 1P3GC 3UTAD 1P3OC 1S32B 5B0ZC 2LY8A 1HQ3A 2BYKA 2VQRA 1S32C 2YFWA 3KUYD 3MNNA 1M18A 3H0MC 3B6FB 1BH8A 3B6FC 3REKA 3AZEC 3VH6W 3W96B 3AN2B 4Z66C 3AZGA 1P3MB 3REIA 5B31G 1AOID 4UUZB 3W96C 5B24A 3LELB 3AN2C 3AZLD 5B1LB 3AFAA 3NQUB 4KHAA 5DNND 3MVDB 3LELC 5B1LC 1KX4A 2NZDB 3AZMA 3WAAD 1N1JB 3TU4D 2NZDC 5B32G 4J8UB 3AZHA 5B2ID 2HIOB 2J8PA 5G49B 4J8UC 3X1UB 5BT1C 4R8PB 3C1BD 3AZKD 3UTAA 3VH5T 5B31B 1TAFB 4R8PC 4QLCD 3AZNB 1F66B 3B6GD 3KUYA 3AZNC 1A7WA 1HQ3B 2BYKB 1B67A 5AV9D 4WU9D 2YFWB 2F2AC 4H9RA 3MNNB 1BH8B 1M18C 3MNNC 1AOIA 3AZLA 3REKC 4DRAA 5DNNA 4H9PA 3AZGB 3REIB 4WNNA 3WAAA 4KUDD 3TU4A 3AFAB 3REIC 4KHAB 4JJND 2JCHA 5B24C 3UTBD 3AFAC 1KX4B 5B2IA 3AZMB 1Z2CB 1KX4C 1EQZD 5GSUD 3C1BA 3FDDA 3AZHB 3AZKA 3AZMC 5DNMD 4QLCA 3W99D 3AZHC 3WTPD 5B2JD 4ZBJC 5B0ZD 3UTAB 3VH5A 3B6GA 1P3KD 2Y2QA 3UTAC 5AV9A 4WU9A 3MGRC 2W8SA 3KUYB 3AZED 3KUYC 3W98D 4H9RB 4G91C 1AOIB 3AZLB 4KUDA 2ZY2A 4DRBA 4JJNA 5DNNB 3UTBA 3A1KA 5AV6D 3AZLC 1AOIC 4WNNB 4LD9D 3MGPD 3TU4B 2RIQA 5GT3D 2F8ND 1EQZA 5GSUA 3WAAC 3KXBC 3TU4C 1WWSA 2F8NK 5B2IB 3V9RB 5DNMA 3W99A 1KX5D 5B2IC 3WTPA 5E5AB 5B2JA 4NE6A 3C1BB 5B0ZA 4AWLB 4E45A 4NE5A 1P3KA 4QLCB 3C1BC 5B0YD 3AZKC 2Y2IA 3B6GB 3O62D 4CAYB 2ZM5A 2CV5D 5AY8D 3AZEA 4M6BA 3B6GC 5AV9B 5GT0D 4WU9B 3W98A 5AV9C 3KSYA 3MGSC 2YFVA 3UT9D 3LZ1B 2Y2GA 3X1TD 5AV6A 4LD9A 3MGPA 4KUDB 5CPJD 5GT3A 2F8NA 3EPHA 3UTBB 3WKJD 4JJNC 1KX5A 1EQZB 3AZJD 5DNMB 1EQZC 3W99B 5GSUC 5CHLB 5B0YA 3WTPB 5DNMC 5B2JB 3W99C 5B0ZB 2ZY4A 3O62A 1P3KB 3WTPC 2CV5A 5B2JC 5AY8A 4WZSB 3MGRD 5GT0A 1P3KC 4H9OA 2AROD 5JRGD 4ZUXD 2Y2LA 3AZEB 1KX3D 3B0CW 4DQYB 3UT9A 3W98B 4Z66B 1ID3D 3W98C 3X1TA 5GXQD 2YFVB 3KWQD 5CPJA 4KGCD 5AV6B 3WKJA 4LD9B 5AV6C 2Y2NA 5GT3B 3KXBD 3AZJA 3AYWD 4XZQD 3MGPC 2PYOD 4LD9C 5GT3C 1F1EA 5C3IB 5AV5D 1P3FD 4CSRA 1KX5C 5C3IC 4YM6C 1W2EA 5B0YB 3MGRA 5B0YC 3O62B 2AROA 5JRGA 5KDMA 5AY8B 4ZUXA 1KX3A 2BYMA 3O62C 1P3AC 5GT0B 1M1AD 2CV5C 4H9OB 5AY8C 1M19D 3MGSD 5GT0C 1M18B 4XUJC 1ID3A 3WTPE 5GXQA 3UT9B 3KWQA 4YS3D 3REKB 3UT9C 5JA4A 2NQBD 4KGCA 3X1TC 5B24B 5CPJB 3A6ND 3KXBA 1R4VA 4XZQA 3AYWA 2FJ7D 5CPJC 2PYOA 2G5IC 3W97D 3WKJB 4J8XD 4EO5B 5AV5A 3WKJC 3X1VC 3AZJB 1P3FA 4EO5C 3EPKA 3AZJC 4ZBJB 4J8VD 4CSRB 1P3PD 2G5HC 3MGRB 5B40D 1M1AA 1HTAA 1M19A 2AROB 3MGSA 5JRGB 5KDMB 4ZUXB 2AROC 2HUEC 5JRGC 4G91B 4YS3A 4ZUXC 1KX3C 1ID3B 3F6TA 2NQBA 5GXQB 3KWQB 1ID3C 4NFTA 2JE5A 5CPKD 5GXQC 3A6NA 5BO0A 5JA4B 1BH9A 3KWQC 1ZLAD 2FJ7A 4H9PB 4H9SA 3W97A 4J8XA 4KGCC 1Q9CA 3WAAB 3KXBB 3AL0C 3B0BA 2PYOB 4XZQB 3EG5B 2Y2JA 3AV2C 3AV1D 3AYWC 4XZQC 1JFIA 2PYOC 5AV5B 4YM6D 4J8VA 1P3FB 4HGAB 1P3PA 1ULYA 3AZKB 5AV5C 3EPJA 2UWXA 4WV4B 4HGAC 4H9QA 1U35D 1P3FC 5B40A 2BG1A 5AVBD 5BS7A 3MGQD 5F99D 1P3AD 1M1AB 4XUJD 1M19B 3MGSB 4H9NA 1M1AC 2CWEA 1H3OA 1M19C 1P34D 4YS3B 5CPKA 4YS3C 2NQBB 1ZLAA 2HIOD 3X1UD 2NQBC 3A6NB 5BO0B 1BH9B 4JJNB 5B31D 3A6NC 3W97B 3AV1A 4J8XB 3VH5W 3X1VD 2FJ7C 4H9SC 4J8WD 3W97C 4YM6A 4J8XC 5GSUB 3NQJA 5BNXA 1U35A 5AVBA 3MGQA 4J8VB 5B32D 5F99A 1P3AA 4J8VC 1P3MA 4H9QB 1P3PC 5B40B 4UUZA 1T3UA 4XUJA 5B40C 5BS7C 5CP6D 2F8NG 1P34A 4H9NB 2Y2PA 3AZIC 2HIOA 1P3ID 1WWIA 3X1UA 5CPKB 2ZY5A 5CPKC 2IO5B 5B31A 3H0LC 1ZLAC 3X1VA 1F66A 2IO5C 3MGPB 4J8WA 3AV2D 2F8NB 3X1SD 3AV1B 3RELD 1KX5B 3AV1C 4YM6B 5B32A 2Y2OA 2ZY3A 5AVCD 3NQJB 5BNXB 1U35B 2Y2MA 5AVBB 3MGQB 5F99B 1U35C 1P3LD 5BNVA 5AVBC 1P3AB 3MGQC 5CP6A 2CV5B 5B1MD 5F99C 4X23D 4XUJB 1P3MC 1BFMA 3KFUG 3MVDC 1P34B 1P3IA 3REHD 5FUGA 1P34C 3LZ0D 4G92B 3X1TB 4G92C 1TZYD 2HIOC 5E5AD 3C1CD 3AV2A 3X1UC 3X1SA 4UPKA 4Z2MG 3RELA 3X1VB 3B0DB 5B31C 4WU8D 4J8WB 3LJAD 3B0DC 1F66C 5AVCA 4J8WC 5B33D 1HQ3C 5B32B 5AV8D 3REJD 1P3LA 3R45A 4Z5TD 5B32C 5B1MA 1P3BD 3LZ1D 4X23A 2RVQD 5BNVB 4E44A 2HUEB 5CP6B 3B0CT 1KX3B 2BYMB 3AZGC 5CP6C 3VH6T 3REHA 3AZID 3P5JB 5CPID 3LZ0A 3V9RA 1P3IB 3AZFD 1TZYA 5FUGB 3WA9D 5E5AA 3C1CA 1P3IC 4KGCB 1P3GD 4WU8A 1P3OD 3AV2B 3LJAA 3X1SB 4CAYA 3AYWB 2F8NH 1S32D 2L5AA 5B33A 3RELB 3X1SC 3RELC 3REJA 5AV8A 4Z5TA 3B6FD 5AVCB 1P3BA 5AVCC 3LZ1A 4Z66D 1P3LB 3R45B 3W96D 3AN2D 5B1MB 1P3LC
chains in the Genus database with same CATH topology
1P3MD 4X23B 3LELD 5B1MC 2XD5A 2JSSA 5B1LD 3AZIA 5CPIA 4X23C 3MVDD 2DF4C 5DNNC 2NZDD 3AZFA 3VH6A 3REHB 3WA9A 3LZ0B 4J8UD 2FFFB 2Y2KA 5BT1D 3EPLA 3REHC 3LZ0C 1P3GA 1TZYB 3C1CB 1P3OA 4R8PD 1TZYC 2Y2HA 5E5AC 3A1IA 3C1CC 2FJ7B 1S32A 4AWLC 3AZND 4WU8B 4QLCC 1F66D 3LJAB 3H0RC 4WU8C 3B6FA 5B33B 3LJAC 1HQ3D 1JFIB 5B33C 3REJB 5AV8B 4Z66A 3MNND 4WU9C 4Z5TB 1P3PB 1M18D 2DQNC 1KU5A 3W96A 3REJC 5AV8C 3AN2A 4Z5TC 1P3BB 3REKD 3LELA 2XD1A 5B1LA 1P3BC 3LZ1C 3NQUA 3MVDA 3AZGD 2RVQC 3REID 4Z2MH 3IP4C 1B6WA 5B24D 2NZDA 1N1JA 3AFAD 3AZIB 5CPIB 4KUDC 1H3OB 4J8UA 1KX4D 5CPIC 3UTBC 5G49A 3AZMD 3AZFB 3WA9B 4R8PA 4WJ3C 3AZFC 3AZHD 3WA9C 1ZLAB 1TAFA 1P3GB 3AZNA 1P3OB 1PZRA 4NE3A 1P3GC 3UTAD 1P3OC 1S32B 5B0ZC 2LY8A 1HQ3A 2BYKA 2VQRA 1S32C 2YFWA 3KUYD 3MNNA 1M18A 3H0MC 3B6FB 1BH8A 3B6FC 3REKA 3AZEC 3VH6W 3W96B 3AN2B 4Z66C 3AZGA 1P3MB 3REIA 5B31G 1AOID 4UUZB 3W96C 5B24A 3LELB 3AN2C 3AZLD 5B1LB 3AFAA 3NQUB 4KHAA 5DNND 3MVDB 3LELC 5B1LC 1KX4A 2NZDB 3AZMA 3WAAD 1N1JB 3TU4D 2NZDC 5B32G 4J8UB 3AZHA 5B2ID 2HIOB 2J8PA 5G49B 4J8UC 3X1UB 5BT1C 4R8PB 3C1BD 3AZKD 3UTAA 3VH5T 5B31B 1TAFB 4R8PC 4QLCD 3AZNB 1F66B 3B6GD 3KUYA 3AZNC 1A7WA 1HQ3B 2BYKB 1B67A 5AV9D 4WU9D 2YFWB 2F2AC 4H9RA 3MNNB 1BH8B 1M18C 3MNNC 1AOIA 3AZLA 3REKC 4DRAA 5DNNA 4H9PA 3AZGB 3REIB 4WNNA 3WAAA 4KUDD 3TU4A 3AFAB 3REIC 4KHAB 4JJND 2JCHA 5B24C 3UTBD 3AFAC 1KX4B 5B2IA 3AZMB 1Z2CB 1KX4C 1EQZD 5GSUD 3C1BA 3FDDA 3AZHB 3AZKA 3AZMC 5DNMD 4QLCA 3W99D 3AZHC 3WTPD 5B2JD 4ZBJC 5B0ZD 3UTAB 3VH5A 3B6GA 1P3KD 2Y2QA 3UTAC 5AV9A 4WU9A 3MGRC 2W8SA 3KUYB 3AZED 3KUYC 3W98D 4H9RB 4G91C 1AOIB 3AZLB 4KUDA 2ZY2A 4DRBA 4JJNA 5DNNB 3UTBA 3A1KA 5AV6D 3AZLC 1AOIC 4WNNB 4LD9D 3MGPD 3TU4B 2RIQA 5GT3D 2F8ND 1EQZA 5GSUA 3WAAC 3KXBC 3TU4C 1WWSA 2F8NK 5B2IB 3V9RB 5DNMA 3W99A 1KX5D 5B2IC 3WTPA 5E5AB 5B2JA 4NE6A 3C1BB 5B0ZA 4AWLB 4E45A 4NE5A 1P3KA 4QLCB 3C1BC 5B0YD 3AZKC 2Y2IA 3B6GB 3O62D 4CAYB 2ZM5A 2CV5D 5AY8D 3AZEA 4M6BA 3B6GC 5AV9B 5GT0D 4WU9B 3W98A 5AV9C 3KSYA 3MGSC 2YFVA 3UT9D 3LZ1B 2Y2GA 3X1TD 5AV6A 4LD9A 3MGPA 4KUDB 5CPJD 5GT3A 2F8NA 3EPHA 3UTBB 3WKJD 4JJNC 1KX5A 1EQZB 3AZJD 5DNMB 1EQZC 3W99B 5GSUC 5CHLB 5B0YA 3WTPB 5DNMC 5B2JB 3W99C 5B0ZB 2ZY4A 3O62A 1P3KB 3WTPC 2CV5A 5B2JC 5AY8A 4WZSB 3MGRD 5GT0A 1P3KC 4H9OA 2AROD 5JRGD 4ZUXD 2Y2LA 3AZEB 1KX3D 3B0CW 4DQYB 3UT9A 3W98B 4Z66B 1ID3D 3W98C 3X1TA 5GXQD 2YFVB 3KWQD 5CPJA 4KGCD 5AV6B 3WKJA 4LD9B 5AV6C 2Y2NA 5GT3B 3KXBD 3AZJA 3AYWD 4XZQD 3MGPC 2PYOD 4LD9C 5GT3C 1F1EA 5C3IB 5AV5D 1P3FD 4CSRA 1KX5C 5C3IC 4YM6C 1W2EA 5B0YB 3MGRA 5B0YC 3O62B 2AROA 5JRGA 5KDMA 5AY8B 4ZUXA 1KX3A 2BYMA 3O62C 1P3AC 5GT0B 1M1AD 2CV5C 4H9OB 5AY8C 1M19D 3MGSD 5GT0C 1M18B 4XUJC 1ID3A 3WTPE 5GXQA 3UT9B 3KWQA 4YS3D 3REKB 3UT9C 5JA4A 2NQBD 4KGCA 3X1TC 5B24B 5CPJB 3A6ND 3KXBA 1R4VA 4XZQA 3AYWA 2FJ7D 5CPJC 2PYOA 2G5IC 3W97D 3WKJB 4J8XD 4EO5B 5AV5A 3WKJC 3X1VC 3AZJB 1P3FA 4EO5C 3EPKA 3AZJC 4ZBJB 4J8VD 4CSRB 1P3PD 2G5HC 3MGRB 5B40D 1M1AA 1HTAA 1M19A 2AROB 3MGSA 5JRGB 5KDMB 4ZUXB 2AROC 2HUEC 5JRGC 4G91B 4YS3A 4ZUXC 1KX3C 1ID3B 3F6TA 2NQBA 5GXQB 3KWQB 1ID3C 4NFTA 2JE5A 5CPKD 5GXQC 3A6NA 5BO0A 5JA4B 1BH9A 3KWQC 1ZLAD 2FJ7A 4H9PB 4H9SA 3W97A 4J8XA 4KGCC 1Q9CA 3WAAB 3KXBB 3AL0C 3B0BA 2PYOB 4XZQB 3EG5B 2Y2JA 3AV2C 3AV1D 3AYWC 4XZQC 1JFIA 2PYOC 5AV5B 4YM6D 4J8VA 1P3FB 4HGAB 1P3PA 1ULYA 3AZKB 5AV5C 3EPJA 2UWXA 4WV4B 4HGAC 4H9QA 1U35D 1P3FC 5B40A 2BG1A 5AVBD 5BS7A 3MGQD 5F99D 1P3AD 1M1AB 4XUJD 1M19B 3MGSB 4H9NA 1M1AC 2CWEA 1H3OA 1M19C 1P34D 4YS3B 5CPKA 4YS3C 2NQBB 1ZLAA 2HIOD 3X1UD 2NQBC 3A6NB 5BO0B 1BH9B 4JJNB 5B31D 3A6NC 3W97B 3AV1A 4J8XB 3VH5W 3X1VD 2FJ7C 4H9SC 4J8WD 3W97C 4YM6A 4J8XC 5GSUB 3NQJA 5BNXA 1U35A 5AVBA 3MGQA 4J8VB 5B32D 5F99A 1P3AA 4J8VC 1P3MA 4H9QB 1P3PC 5B40B 4UUZA 1T3UA 4XUJA 5B40C 5BS7C 5CP6D 2F8NG 1P34A 4H9NB 2Y2PA 3AZIC 2HIOA 1P3ID 1WWIA 3X1UA 5CPKB 2ZY5A 5CPKC 2IO5B 5B31A 3H0LC 1ZLAC 3X1VA 1F66A 2IO5C 3MGPB 4J8WA 3AV2D 2F8NB 3X1SD 3AV1B 3RELD 1KX5B 3AV1C 4YM6B 5B32A 2Y2OA 2ZY3A 5AVCD 3NQJB 5BNXB 1U35B 2Y2MA 5AVBB 3MGQB 5F99B 1U35C 1P3LD 5BNVA 5AVBC 1P3AB 3MGQC 5CP6A 2CV5B 5B1MD 5F99C 4X23D 4XUJB 1P3MC 1BFMA 3KFUG 3MVDC 1P34B 1P3IA 3REHD 5FUGA 1P34C 3LZ0D 4G92B 3X1TB 4G92C 1TZYD 2HIOC 5E5AD 3C1CD 3AV2A 3X1UC 3X1SA 4UPKA 4Z2MG 3RELA 3X1VB 3B0DB 5B31C 4WU8D 4J8WB 3LJAD 3B0DC 1F66C 5AVCA 4J8WC 5B33D 1HQ3C 5B32B 5AV8D 3REJD 1P3LA 3R45A 4Z5TD 5B32C 5B1MA 1P3BD 3LZ1D 4X23A 2RVQD 5BNVB 4E44A 2HUEB 5CP6B 3B0CT 1KX3B 2BYMB 3AZGC 5CP6C 3VH6T 3REHA 3AZID 3P5JB 5CPID 3LZ0A 3V9RA 1P3IB 3AZFD 1TZYA 5FUGB 3WA9D 5E5AA 3C1CA 1P3IC 4KGCB 1P3GD 4WU8A 1P3OD 3AV2B 3LJAA 3X1SB 4CAYA 3AYWB 2F8NH 1S32D 2L5AA 5B33A 3RELB 3X1SC 3RELC 3REJA 5AV8A 4Z5TA 3B6FD 5AVCB 1P3BA 5AVCC 3LZ1A 4Z66D 1P3LB 3R45B 3W96D 3AN2D 5B1MB 1P3LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3M D;  4X23 B;  3LEL D;  5B1M C;  2JSS A;  5B1L D;  3AZI A;  5CPI A;  4X23 C;  3MVD D;  5DNN C;  2NZD D;  3AZF A;  3VH6 A;  3REH B;  3WA9 A;  3LZ0 B;  4J8U D;  3REH C;  5BT1 D;  3LZ0 C;  1P3G A;  1TZY B;  3C1C B;  1P3O A;  4R8P D;  1TZY C;  5E5A C;  3C1C C;  2FJ7 B;  1S32 A;  4AWL C;  3AZN D;  4WU8 B;  4QLC C;  1F66 D;  3LJA B;  4WU8 C;  3B6F A;  5B33 B;  3LJA C;  1HQ3 D;  1JFI B;  5B33 C;  3REJ B;  5AV8 B;  4Z66 A;  3MNN D;  4WU9 C;  4Z5T B;  1P3P B;  1M18 D;  1KU5 A;  3W96 A;  3REJ C;  5AV8 C;  3AN2 A;  4Z5T C;  1P3B B;  3REK D;  3LEL A;  5B1L A;  1P3B C;  3LZ1 C;  3NQU A;  3MVD A;  3AZG D;  2RVQ C;  3REI D;  4Z2M H;  1B6W A;  5B24 D;  2NZD A;  1N1J A;  3AFA D;  3AZI B;  5CPI B;  4KUD C;  1H3O B;  4J8U A;  1KX4 D;  5CPI C;  3UTB C;  5G49 A;  3AZM D;  3AZF B;  3WA9 B;  4R8P A;  3AZF C;  3AZH D;  3WA9 C;  1ZLA B;  1TAF A;  1P3G B;  3AZN A;  1P3O B;  4NE3 A;  1P3G C;  3UTA D;  1P3O C;  1S32 B;  5B0Z C;  2LY8 A;  1HQ3 A;  2BYK A;  1S32 C;  2YFW A;  3KUY D;  3MNN A;  1M18 A;  3B6F B;  1BH8 A;  3B6F C;  3REK A;  3AZE C;  3VH6 W;  3W96 B;  3AN2 B;  4Z66 C;  3AZG A;  1P3M B;  3REI A;  5B31 G;  1AOI D;  4UUZ B;  3W96 C;  5B24 A;  3LEL B;  3AN2 C;  3AZL D;  5B1L B;  3AFA A;  3NQU B;  4KHA A;  5DNN D;  3MVD B;  3LEL C;  5B1L C;  1KX4 A;  2NZD B;  3AZM A;  3WAA D;  1N1J B;  3TU4 D;  2NZD C;  5B32 G;  4J8U B;  3AZH A;  5B2I D;  2HIO B;  5G49 B;  4J8U C;  3X1U B;  5BT1 C;  4R8P B;  3C1B D;  3AZK D;  3UTA A;  3VH5 T;  5B31 B;  1TAF B;  4R8P C;  4QLC D;  3AZN B;  1F66 B;  3B6G D;  3KUY A;  3AZN C;  1A7W A;  1HQ3 B;  2BYK B;  1B67 A;  5AV9 D;  4WU9 D;  2YFW B;  4H9R A;  3MNN B;  1BH8 B;  1M18 C;  3MNN C;  1AOI A;  3AZL A;  3REK C;  4DRA A;  5DNN A;  4H9P A;  3AZG B;  3REI B;  4WNN A;  3WAA A;  4KUD D;  3TU4 A;  3AFA B;  3REI C;  4KHA B;  4JJN D;  5B24 C;  3UTB D;  3AFA C;  1KX4 B;  5B2I A;  3AZM B;  1KX4 C;  1EQZ D;  5GSU D;  3C1B A;  3AZK A;  3AZH B;  3AZM C;  5DNM D;  4QLC A;  3W99 D;  3AZH C;  3WTP D;  5B2J D;  4ZBJ C;  5B0Z D;  3UTA B;  3VH5 A;  3B6G A;  1P3K D;  3UTA C;  5AV9 A;  4WU9 A;  3MGR C;  3KUY B;  3AZE D;  3KUY C;  3W98 D;  4H9R B;  4G91 C;  1AOI B;  3AZL B;  4KUD A;  1AOI C;  4DRB A;  4JJN A;  5DNN B;  3UTB A;  5AV6 D;  3AZL C;  4WNN B;  4LD9 D;  3MGP D;  3TU4 B;  5GT3 D;  2F8N D;  1EQZ A;  5GSU A;  3WAA C;  3KXB C;  3TU4 C;  1WWS A;  2F8N K;  5B2I B;  3V9R B;  5DNM A;  3W99 A;  1KX5 D;  5B2I C;  3WTP A;  5E5A B;  5B2J A;  4NE6 A;  3C1B B;  5B0Z A;  4AWL B;  4E45 A;  4NE5 A;  1P3K A;  4QLC B;  3C1B C;  5B0Y D;  3AZK C;  3B6G B;  3O62 D;  4CAY B;  2CV5 D;  5AY8 D;  3AZE A;  4M6B A;  3B6G C;  5AV9 B;  5GT0 D;  4WU9 B;  3W98 A;  5AV9 C;  3KSY A;  3MGS C;  2YFV A;  3UT9 D;  3LZ1 B;  3X1T D;  5AV6 A;  4LD9 A;  3MGP A;  4KUD B;  5CPJ D;  5GT3 A;  2F8N A;  3UTB B;  3WKJ D;  4JJN C;  1KX5 A;  1EQZ B;  3AZJ D;  5DNM B;  1EQZ C;  3W99 B;  5GSU C;  5CHL B;  5B0Y A;  3WTP B;  5DNM C;  5B2J B;  3W99 C;  5B0Z B;  3O62 A;  1P3K B;  3WTP C;  2CV5 A;  5B2J C;  5AY8 A;  4WZS B;  3MGR D;  5GT0 A;  1P3K C;  4H9O A;  2ARO D;  5JRG D;  4ZUX D;  3AZE B;  1KX3 D;  3B0C W;  3UT9 A;  3W98 B;  4Z66 B;  1ID3 D;  3W98 C;  3X1T A;  5GXQ D;  2YFV B;  3KWQ D;  5CPJ A;  4KGC D;  5AV6 B;  3WKJ A;  4LD9 B;  5AV6 C;  5GT3 B;  3KXB D;  3AZJ A;  3AYW D;  4XZQ D;  3MGP C;  2PYO D;  4LD9 C;  5GT3 C;  1F1E A;  5C3I B;  5AV5 D;  1P3F D;  4CSR A;  1KX5 C;  5C3I C;  4YM6 C;  5B0Y B;  3MGR A;  5B0Y C;  3O62 B;  2ARO A;  5JRG A;  5KDM A;  5AY8 B;  4ZUX A;  1KX3 A;  2BYM A;  3O62 C;  1P3A C;  5GT0 B;  1M1A D;  2CV5 C;  4H9O B;  5AY8 C;  1M19 D;  3MGS D;  5GT0 C;  1M18 B;  4XUJ C;  1ID3 A;  3WTP E;  5GXQ A;  3UT9 B;  3KWQ A;  4YS3 D;  3REK B;  3UT9 C;  5JA4 A;  2NQB D;  4KGC A;  3X1T C;  5B24 B;  5CPJ B;  3A6N D;  3KXB A;  1R4V A;  4XZQ A;  3AYW A;  2FJ7 D;  5CPJ C;  2PYO A;  3W97 D;  3WKJ B;  4J8X D;  4EO5 B;  5AV5 A;  3WKJ C;  3X1V C;  3AZJ B;  1P3F A;  4EO5 C;  3AZJ C;  4ZBJ B;  4J8V D;  4CSR B;  1P3P D;  3MGR B;  5B40 D;  1M1A A;  1HTA A;  1M19 A;  2ARO B;  3MGS A;  5JRG B;  5KDM B;  4ZUX B;  2ARO C;  2HUE C;  5JRG C;  4G91 B;  4YS3 A;  4ZUX C;  1KX3 C;  1ID3 B;  2NQB A;  5GXQ B;  3KWQ B;  1ID3 C;  4NFT A;  5CPK D;  5GXQ C;  3A6N A;  5BO0 A;  5JA4 B;  1BH9 A;  3KWQ C;  1ZLA D;  2FJ7 A;  4H9P B;  4H9S A;  3W97 A;  4J8X A;  4KGC C;  1Q9C A;  3WAA B;  3KXB B;  3B0B A;  2PYO B;  4XZQ B;  3AV2 C;  3AV1 D;  3AYW C;  4XZQ C;  1JFI A;  2PYO C;  5AV5 B;  4YM6 D;  4J8V A;  1P3F B;  4HGA B;  1P3P A;  1ULY A;  3AZK B;  5AV5 C;  4WV4 B;  4HGA C;  4H9Q A;  1U35 D;  1P3F C;  5B40 A;  5AVB D;  5BS7 A;  3MGQ D;  5F99 D;  1P3A D;  1M1A B;  4XUJ D;  1M19 B;  3MGS B;  4H9N A;  1M1A C;  2CWE A;  1H3O A;  1M19 C;  1P34 D;  4YS3 B;  5CPK A;  4YS3 C;  2NQB B;  1ZLA A;  2HIO D;  3X1U D;  2NQB C;  3A6N B;  5BO0 B;  1BH9 B;  4JJN B;  5B31 D;  3A6N C;  3W97 B;  3AV1 A;  4J8X B;  3VH5 W;  3X1V D;  2FJ7 C;  4H9S C;  4J8W D;  3W97 C;  4YM6 A;  4J8X C;  5GSU B;  3NQJ A;  5BNX A;  1U35 A;  5AVB A;  3MGQ A;  4J8V B;  5B32 D;  5F99 A;  1P3A A;  4J8V C;  1P3M A;  4H9Q B;  1P3P C;  5B40 B;  4UUZ A;  4XUJ A;  5B40 C;  5BS7 C;  5CP6 D;  2F8N G;  1P34 A;  4H9N B;  3AZI C;  2HIO A;  1P3I D;  1WWI A;  3X1U A;  5CPK B;  5CPK C;  2IO5 B;  5B31 A;  1ZLA C;  3X1V A;  1F66 A;  2IO5 C;  3MGP B;  4J8W A;  3AV2 D;  2F8N B;  3X1S D;  3AV1 B;  3REL D;  1KX5 B;  3AV1 C;  4YM6 B;  5B32 A;  5AVC D;  3NQJ B;  5BNX B;  1U35 B;  5AVB B;  3MGQ B;  5F99 B;  1U35 C;  1P3L D;  5BNV A;  5AVB C;  1P3A B;  3MGQ C;  5CP6 A;  2CV5 B;  5B1M D;  5F99 C;  4X23 D;  4XUJ B;  1P3M C;  1BFM A;  3MVD C;  1P34 B;  1P3I A;  3REH D;  5FUG A;  1P34 C;  3LZ0 D;  4G92 B;  3X1T B;  4G92 C;  1TZY D;  2HIO C;  5E5A D;  3C1C D;  3AV2 A;  3X1U C;  3X1S A;  4Z2M G;  3REL A;  3X1V B;  3B0D B;  5B31 C;  4WU8 D;  4J8W B;  3LJA D;  3B0D C;  1F66 C;  5AVC A;  4J8W C;  5B33 D;  1HQ3 C;  5B32 B;  5AV8 D;  3REJ D;  1P3L A;  3R45 A;  4Z5T D;  5B32 C;  5B1M A;  1P3B D;  3LZ1 D;  4X23 A;  2RVQ D;  5BNV B;  4E44 A;  2HUE B;  5CP6 B;  3B0C T;  1KX3 B;  2BYM B;  3AZG C;  5CP6 C;  3VH6 T;  3REH A;  3AZI D;  5CPI D;  3LZ0 A;  3V9R A;  1P3I B;  3AZF D;  1TZY A;  5FUG B;  3WA9 D;  5E5A A;  3C1C A;  1P3I C;  4KGC B;  1P3G D;  4WU8 A;  1P3O D;  3AV2 B;  3LJA A;  3X1S B;  4CAY A;  3AYW B;  2F8N H;  1S32 D;  2L5A A;  5B33 A;  3REL B;  3X1S C;  3REL C;  3REJ A;  5AV8 A;  4Z5T A;  3B6F D;  5AVC B;  1P3B A;  5AVC C;  3LZ1 A;  4Z66 D;  1P3L B;  3R45 B;  3W96 D;  3AN2 D;  5B1M B;  1P3L C; 
#chains in the Genus database with same CATH topology
 1P3M D;  4X23 B;  3LEL D;  5B1M C;  2XD5 A;  2JSS A;  5B1L D;  3AZI A;  5CPI A;  4X23 C;  3MVD D;  2DF4 C;  5DNN C;  2NZD D;  3AZF A;  3VH6 A;  3REH B;  3WA9 A;  3LZ0 B;  4J8U D;  2FFF B;  2Y2K A;  5BT1 D;  3EPL A;  3REH C;  3LZ0 C;  1P3G A;  1TZY B;  3C1C B;  1P3O A;  4R8P D;  1TZY C;  2Y2H A;  5E5A C;  3A1I A;  3C1C C;  2FJ7 B;  1S32 A;  4AWL C;  3AZN D;  4WU8 B;  4QLC C;  1F66 D;  3LJA B;  3H0R C;  4WU8 C;  3B6F A;  5B33 B;  3LJA C;  1HQ3 D;  1JFI B;  5B33 C;  3REJ B;  5AV8 B;  4Z66 A;  3MNN D;  4WU9 C;  4Z5T B;  1P3P B;  1M18 D;  2DQN C;  1KU5 A;  3W96 A;  3REJ C;  5AV8 C;  3AN2 A;  4Z5T C;  1P3B B;  3REK D;  3LEL A;  2XD1 A;  5B1L A;  1P3B C;  3LZ1 C;  3NQU A;  3MVD A;  3AZG D;  2RVQ C;  3REI D;  4Z2M H;  3IP4 C;  1B6W A;  5B24 D;  2NZD A;  1N1J A;  3AFA D;  3AZI B;  5CPI B;  4KUD C;  1H3O B;  4J8U A;  1KX4 D;  5CPI C;  3UTB C;  5G49 A;  3AZM D;  3AZF B;  3WA9 B;  4R8P A;  4WJ3 C;  3AZF C;  3AZH D;  3WA9 C;  1ZLA B;  1TAF A;  1P3G B;  3AZN A;  1P3O B;  1PZR A;  4NE3 A;  1P3G C;  3UTA D;  1P3O C;  1S32 B;  5B0Z C;  2LY8 A;  1HQ3 A;  2BYK A;  2VQR A;  1S32 C;  2YFW A;  3KUY D;  3MNN A;  1M18 A;  3H0M C;  3B6F B;  1BH8 A;  3B6F C;  3REK A;  3AZE C;  3VH6 W;  3W96 B;  3AN2 B;  4Z66 C;  3AZG A;  1P3M B;  3REI A;  5B31 G;  1AOI D;  4UUZ B;  3W96 C;  5B24 A;  3LEL B;  3AN2 C;  3AZL D;  5B1L B;  3AFA A;  3NQU B;  4KHA A;  5DNN D;  3MVD B;  3LEL C;  5B1L C;  1KX4 A;  2NZD B;  3AZM A;  3WAA D;  1N1J B;  3TU4 D;  2NZD C;  5B32 G;  4J8U B;  3AZH A;  5B2I D;  2HIO B;  2J8P A;  5G49 B;  4J8U C;  3X1U B;  5BT1 C;  4R8P B;  3C1B D;  3AZK D;  3UTA A;  3VH5 T;  5B31 B;  1TAF B;  4R8P C;  4QLC D;  3AZN B;  1F66 B;  3B6G D;  3KUY A;  3AZN C;  1A7W A;  1HQ3 B;  2BYK B;  1B67 A;  5AV9 D;  4WU9 D;  2YFW B;  2F2A C;  4H9R A;  3MNN B;  1BH8 B;  1M18 C;  3MNN C;  1AOI A;  3AZL A;  3REK C;  4DRA A;  5DNN A;  4H9P A;  3AZG B;  3REI B;  4WNN A;  3WAA A;  4KUD D;  3TU4 A;  3AFA B;  3REI C;  4KHA B;  4JJN D;  2JCH A;  5B24 C;  3UTB D;  3AFA C;  1KX4 B;  5B2I A;  3AZM B;  1Z2C B;  1KX4 C;  1EQZ D;  5GSU D;  3C1B A;  3FDD A;  3AZH B;  3AZK A;  3AZM C;  5DNM D;  4QLC A;  3W99 D;  3AZH C;  3WTP D;  5B2J D;  4ZBJ C;  5B0Z D;  3UTA B;  3VH5 A;  3B6G A;  1P3K D;  2Y2Q A;  3UTA C;  5AV9 A;  4WU9 A;  3MGR C;  2W8S A;  3KUY B;  3AZE D;  3KUY C;  3W98 D;  4H9R B;  4G91 C;  1AOI B;  3AZL B;  4KUD A;  2ZY2 A;  4DRB A;  4JJN A;  5DNN B;  3UTB A;  3A1K A;  5AV6 D;  3AZL C;  1AOI C;  4WNN B;  4LD9 D;  3MGP D;  3TU4 B;  2RIQ A;  5GT3 D;  2F8N D;  1EQZ A;  5GSU A;  3WAA C;  3KXB C;  3TU4 C;  1WWS A;  2F8N K;  5B2I B;  3V9R B;  5DNM A;  3W99 A;  1KX5 D;  5B2I C;  3WTP A;  5E5A B;  5B2J A;  4NE6 A;  3C1B B;  5B0Z A;  4AWL B;  4E45 A;  4NE5 A;  1P3K A;  4QLC B;  3C1B C;  5B0Y D;  3AZK C;  2Y2I A;  3B6G B;  3O62 D;  4CAY B;  2ZM5 A;  2CV5 D;  5AY8 D;  3AZE A;  4M6B A;  3B6G C;  5AV9 B;  5GT0 D;  4WU9 B;  3W98 A;  5AV9 C;  3KSY A;  3MGS C;  2YFV A;  3UT9 D;  3LZ1 B;  2Y2G A;  3X1T D;  5AV6 A;  4LD9 A;  3MGP A;  4KUD B;  5CPJ D;  5GT3 A;  2F8N A;  3EPH A;  3UTB B;  3WKJ D;  4JJN C;  1KX5 A;  1EQZ B;  3AZJ D;  5DNM B;  1EQZ C;  3W99 B;  5GSU C;  5CHL B;  5B0Y A;  3WTP B;  5DNM C;  5B2J B;  3W99 C;  5B0Z B;  2ZY4 A;  3O62 A;  1P3K B;  3WTP C;  2CV5 A;  5B2J C;  5AY8 A;  4WZS B;  3MGR D;  5GT0 A;  1P3K C;  4H9O A;  2ARO D;  5JRG D;  4ZUX D;  2Y2L A;  3AZE B;  1KX3 D;  3B0C W;  4DQY B;  3UT9 A;  3W98 B;  4Z66 B;  1ID3 D;  3W98 C;  3X1T A;  5GXQ D;  2YFV B;  3KWQ D;  5CPJ A;  4KGC D;  5AV6 B;  3WKJ A;  4LD9 B;  5AV6 C;  2Y2N A;  5GT3 B;  3KXB D;  3AZJ A;  3AYW D;  4XZQ D;  3MGP C;  2PYO D;  4LD9 C;  5GT3 C;  1F1E A;  5C3I B;  5AV5 D;  1P3F D;  4CSR A;  1KX5 C;  5C3I C;  4YM6 C;  1W2E A;  5B0Y B;  3MGR A;  5B0Y C;  3O62 B;  2ARO A;  5JRG A;  5KDM A;  5AY8 B;  4ZUX A;  1KX3 A;  2BYM A;  3O62 C;  1P3A C;  5GT0 B;  1M1A D;  2CV5 C;  4H9O B;  5AY8 C;  1M19 D;  3MGS D;  5GT0 C;  1M18 B;  4XUJ C;  1ID3 A;  3WTP E;  5GXQ A;  3UT9 B;  3KWQ A;  4YS3 D;  3REK B;  3UT9 C;  5JA4 A;  2NQB D;  4KGC A;  3X1T C;  5B24 B;  5CPJ B;  3A6N D;  3KXB A;  1R4V A;  4XZQ A;  3AYW A;  2FJ7 D;  5CPJ C;  2PYO A;  2G5I C;  3W97 D;  3WKJ B;  4J8X D;  4EO5 B;  5AV5 A;  3WKJ C;  3X1V C;  3AZJ B;  1P3F A;  4EO5 C;  3EPK A;  3AZJ C;  4ZBJ B;  4J8V D;  4CSR B;  1P3P D;  2G5H C;  3MGR B;  5B40 D;  1M1A A;  1HTA A;  1M19 A;  2ARO B;  3MGS A;  5JRG B;  5KDM B;  4ZUX B;  2ARO C;  2HUE C;  5JRG C;  4G91 B;  4YS3 A;  4ZUX C;  1KX3 C;  1ID3 B;  3F6T A;  2NQB A;  5GXQ B;  3KWQ B;  1ID3 C;  4NFT A;  2JE5 A;  5CPK D;  5GXQ C;  3A6N A;  5BO0 A;  5JA4 B;  1BH9 A;  3KWQ C;  1ZLA D;  2FJ7 A;  4H9P B;  4H9S A;  3W97 A;  4J8X A;  4KGC C;  1Q9C A;  3WAA B;  3KXB B;  3AL0 C;  3B0B A;  2PYO B;  4XZQ B;  3EG5 B;  2Y2J A;  3AV2 C;  3AV1 D;  3AYW C;  4XZQ C;  1JFI A;  2PYO C;  5AV5 B;  4YM6 D;  4J8V A;  1P3F B;  4HGA B;  1P3P A;  1ULY A;  3AZK B;  5AV5 C;  3EPJ A;  2UWX A;  4WV4 B;  4HGA C;  4H9Q A;  1U35 D;  1P3F C;  5B40 A;  2BG1 A;  5AVB D;  5BS7 A;  3MGQ D;  5F99 D;  1P3A D;  1M1A B;  4XUJ D;  1M19 B;  3MGS B;  4H9N A;  1M1A C;  2CWE A;  1H3O A;  1M19 C;  1P34 D;  4YS3 B;  5CPK A;  4YS3 C;  2NQB B;  1ZLA A;  2HIO D;  3X1U D;  2NQB C;  3A6N B;  5BO0 B;  1BH9 B;  4JJN B;  5B31 D;  3A6N C;  3W97 B;  3AV1 A;  4J8X B;  3VH5 W;  3X1V D;  2FJ7 C;  4H9S C;  4J8W D;  3W97 C;  4YM6 A;  4J8X C;  5GSU B;  3NQJ A;  5BNX A;  1U35 A;  5AVB A;  3MGQ A;  4J8V B;  5B32 D;  5F99 A;  1P3A A;  4J8V C;  1P3M A;  4H9Q B;  1P3P C;  5B40 B;  4UUZ A;  1T3U A;  4XUJ A;  5B40 C;  5BS7 C;  5CP6 D;  2F8N G;  1P34 A;  4H9N B;  2Y2P A;  3AZI C;  2HIO A;  1P3I D;  1WWI A;  3X1U A;  5CPK B;  2ZY5 A;  5CPK C;  2IO5 B;  5B31 A;  3H0L C;  1ZLA C;  3X1V A;  1F66 A;  2IO5 C;  3MGP B;  4J8W A;  3AV2 D;  2F8N B;  3X1S D;  3AV1 B;  3REL D;  1KX5 B;  3AV1 C;  4YM6 B;  5B32 A;  2Y2O A;  2ZY3 A;  5AVC D;  3NQJ B;  5BNX B;  1U35 B;  2Y2M A;  5AVB B;  3MGQ B;  5F99 B;  1U35 C;  1P3L D;  5BNV A;  5AVB C;  1P3A B;  3MGQ C;  5CP6 A;  2CV5 B;  5B1M D;  5F99 C;  4X23 D;  4XUJ B;  1P3M C;  1BFM A;  3KFU G;  3MVD C;  1P34 B;  1P3I A;  3REH D;  5FUG A;  1P34 C;  3LZ0 D;  4G92 B;  3X1T B;  4G92 C;  1TZY D;  2HIO C;  5E5A D;  3C1C D;  3AV2 A;  3X1U C;  3X1S A;  4UPK A;  4Z2M G;  3REL A;  3X1V B;  3B0D B;  5B31 C;  4WU8 D;  4J8W B;  3LJA D;  3B0D C;  1F66 C;  5AVC A;  4J8W C;  5B33 D;  1HQ3 C;  5B32 B;  5AV8 D;  3REJ D;  1P3L A;  3R45 A;  4Z5T D;  5B32 C;  5B1M A;  1P3B D;  3LZ1 D;  4X23 A;  2RVQ D;  5BNV B;  4E44 A;  2HUE B;  5CP6 B;  3B0C T;  1KX3 B;  2BYM B;  3AZG C;  5CP6 C;  3VH6 T;  3REH A;  3AZI D;  3P5J B;  5CPI D;  3LZ0 A;  3V9R A;  1P3I B;  3AZF D;  1TZY A;  5FUG B;  3WA9 D;  5E5A A;  3C1C A;  1P3I C;  4KGC B;  1P3G D;  4WU8 A;  1P3O D;  3AV2 B;  3LJA A;  3X1S B;  4CAY A;  3AYW B;  2F8N H;  1S32 D;  2L5A A;  5B33 A;  3REL B;  3X1S C;  3REL C;  3REJ A;  5AV8 A;  4Z5T A;  3B6F D;  5AVC B;  1P3B A;  5AVC C;  3LZ1 A;  4Z66 D;  1P3L B;  3R45 B;  3W96 D;  3AN2 D;  5B1M B;  1P3L C; 
#chains in the Genus database with same CATH homology
 1P3M D;  4X23 B;  3LEL D;  5B1M C;  2XD5 A;  2JSS A;  5B1L D;  3AZI A;  5CPI A;  4X23 C;  3MVD D;  2DF4 C;  5DNN C;  2NZD D;  3AZF A;  3VH6 A;  3REH B;  3WA9 A;  3LZ0 B;  4J8U D;  2FFF B;  2Y2K A;  5BT1 D;  3EPL A;  3REH C;  3LZ0 C;  1P3G A;  1TZY B;  3C1C B;  1P3O A;  4R8P D;  1TZY C;  2Y2H A;  5E5A C;  3A1I A;  3C1C C;  2FJ7 B;  1S32 A;  4AWL C;  3AZN D;  4WU8 B;  4QLC C;  1F66 D;  3LJA B;  3H0R C;  4WU8 C;  3B6F A;  5B33 B;  3LJA C;  1HQ3 D;  1JFI B;  5B33 C;  3REJ B;  5AV8 B;  4Z66 A;  3MNN D;  4WU9 C;  4Z5T B;  1P3P B;  1M18 D;  2DQN C;  1KU5 A;  3W96 A;  3REJ C;  5AV8 C;  3AN2 A;  4Z5T C;  1P3B B;  3REK D;  3LEL A;  2XD1 A;  5B1L A;  1P3B C;  3LZ1 C;  3NQU A;  3MVD A;  3AZG D;  2RVQ C;  3REI D;  4Z2M H;  3IP4 C;  1B6W A;  5B24 D;  2NZD A;  1N1J A;  3AFA D;  3AZI B;  5CPI B;  4KUD C;  1H3O B;  4J8U A;  1KX4 D;  5CPI C;  3UTB C;  5G49 A;  3AZM D;  3AZF B;  3WA9 B;  4R8P A;  4WJ3 C;  3AZF C;  3AZH D;  3WA9 C;  1ZLA B;  1TAF A;  1P3G B;  3AZN A;  1P3O B;  1PZR A;  4NE3 A;  1P3G C;  3UTA D;  1P3O C;  1S32 B;  5B0Z C;  2LY8 A;  1HQ3 A;  2BYK A;  2VQR A;  1S32 C;  2YFW A;  3KUY D;  3MNN A;  1M18 A;  3H0M C;  3B6F B;  1BH8 A;  3B6F C;  3REK A;  3AZE C;  3VH6 W;  3W96 B;  3AN2 B;  4Z66 C;  3AZG A;  1P3M B;  3REI A;  5B31 G;  1AOI D;  4UUZ B;  3W96 C;  5B24 A;  3LEL B;  3AN2 C;  3AZL D;  5B1L B;  3AFA A;  3NQU B;  4KHA A;  5DNN D;  3MVD B;  3LEL C;  5B1L C;  1KX4 A;  2NZD B;  3AZM A;  3WAA D;  1N1J B;  3TU4 D;  2NZD C;  5B32 G;  4J8U B;  3AZH A;  5B2I D;  2HIO B;  2J8P A;  5G49 B;  4J8U C;  3X1U B;  5BT1 C;  4R8P B;  3C1B D;  3AZK D;  3UTA A;  3VH5 T;  5B31 B;  1TAF B;  4R8P C;  4QLC D;  3AZN B;  1F66 B;  3B6G D;  3KUY A;  3AZN C;  1A7W A;  1HQ3 B;  2BYK B;  1B67 A;  5AV9 D;  4WU9 D;  2YFW B;  2F2A C;  4H9R A;  3MNN B;  1BH8 B;  1M18 C;  3MNN C;  1AOI A;  3AZL A;  3REK C;  4DRA A;  5DNN A;  4H9P A;  3AZG B;  3REI B;  4WNN A;  3WAA A;  4KUD D;  3TU4 A;  3AFA B;  3REI C;  4KHA B;  4JJN D;  2JCH A;  5B24 C;  3UTB D;  3AFA C;  1KX4 B;  5B2I A;  3AZM B;  1Z2C B;  1KX4 C;  1EQZ D;  5GSU D;  3C1B A;  3FDD A;  3AZH B;  3AZK A;  3AZM C;  5DNM D;  4QLC A;  3W99 D;  3AZH C;  3WTP D;  5B2J D;  4ZBJ C;  5B0Z D;  3UTA B;  3VH5 A;  3B6G A;  1P3K D;  2Y2Q A;  3UTA C;  5AV9 A;  4WU9 A;  3MGR C;  2W8S A;  3KUY B;  3AZE D;  3KUY C;  3W98 D;  4H9R B;  4G91 C;  1AOI B;  3AZL B;  4KUD A;  2ZY2 A;  4DRB A;  4JJN A;  5DNN B;  3UTB A;  3A1K A;  5AV6 D;  3AZL C;  1AOI C;  4WNN B;  4LD9 D;  3MGP D;  3TU4 B;  2RIQ A;  5GT3 D;  2F8N D;  1EQZ A;  5GSU A;  3WAA C;  3KXB C;  3TU4 C;  1WWS A;  2F8N K;  5B2I B;  3V9R B;  5DNM A;  3W99 A;  1KX5 D;  5B2I C;  3WTP A;  5E5A B;  5B2J A;  4NE6 A;  3C1B B;  5B0Z A;  4AWL B;  4E45 A;  4NE5 A;  1P3K A;  4QLC B;  3C1B C;  5B0Y D;  3AZK C;  2Y2I A;  3B6G B;  3O62 D;  4CAY B;  2ZM5 A;  2CV5 D;  5AY8 D;  3AZE A;  4M6B A;  3B6G C;  5AV9 B;  5GT0 D;  4WU9 B;  3W98 A;  5AV9 C;  3KSY A;  3MGS C;  2YFV A;  3UT9 D;  3LZ1 B;  2Y2G A;  3X1T D;  5AV6 A;  4LD9 A;  3MGP A;  4KUD B;  5CPJ D;  5GT3 A;  2F8N A;  3EPH A;  3UTB B;  3WKJ D;  4JJN C;  1KX5 A;  1EQZ B;  3AZJ D;  5DNM B;  1EQZ C;  3W99 B;  5GSU C;  5CHL B;  5B0Y A;  3WTP B;  5DNM C;  5B2J B;  3W99 C;  5B0Z B;  2ZY4 A;  3O62 A;  1P3K B;  3WTP C;  2CV5 A;  5B2J C;  5AY8 A;  4WZS B;  3MGR D;  5GT0 A;  1P3K C;  4H9O A;  2ARO D;  5JRG D;  4ZUX D;  2Y2L A;  3AZE B;  1KX3 D;  3B0C W;  4DQY B;  3UT9 A;  3W98 B;  4Z66 B;  1ID3 D;  3W98 C;  3X1T A;  5GXQ D;  2YFV B;  3KWQ D;  5CPJ A;  4KGC D;  5AV6 B;  3WKJ A;  4LD9 B;  5AV6 C;  2Y2N A;  5GT3 B;  3KXB D;  3AZJ A;  3AYW D;  4XZQ D;  3MGP C;  2PYO D;  4LD9 C;  5GT3 C;  1F1E A;  5C3I B;  5AV5 D;  1P3F D;  4CSR A;  1KX5 C;  5C3I C;  4YM6 C;  1W2E A;  5B0Y B;  3MGR A;  5B0Y C;  3O62 B;  2ARO A;  5JRG A;  5KDM A;  5AY8 B;  4ZUX A;  1KX3 A;  2BYM A;  3O62 C;  1P3A C;  5GT0 B;  1M1A D;  2CV5 C;  4H9O B;  5AY8 C;  1M19 D;  3MGS D;  5GT0 C;  1M18 B;  4XUJ C;  1ID3 A;  3WTP E;  5GXQ A;  3UT9 B;  3KWQ A;  4YS3 D;  3REK B;  3UT9 C;  5JA4 A;  2NQB D;  4KGC A;  3X1T C;  5B24 B;  5CPJ B;  3A6N D;  3KXB A;  1R4V A;  4XZQ A;  3AYW A;  2FJ7 D;  5CPJ C;  2PYO A;  2G5I C;  3W97 D;  3WKJ B;  4J8X D;  4EO5 B;  5AV5 A;  3WKJ C;  3X1V C;  3AZJ B;  1P3F A;  4EO5 C;  3EPK A;  3AZJ C;  4ZBJ B;  4J8V D;  4CSR B;  1P3P D;  2G5H C;  3MGR B;  5B40 D;  1M1A A;  1HTA A;  1M19 A;  2ARO B;  3MGS A;  5JRG B;  5KDM B;  4ZUX B;  2ARO C;  2HUE C;  5JRG C;  4G91 B;  4YS3 A;  4ZUX C;  1KX3 C;  1ID3 B;  3F6T A;  2NQB A;  5GXQ B;  3KWQ B;  1ID3 C;  4NFT A;  2JE5 A;  5CPK D;  5GXQ C;  3A6N A;  5BO0 A;  5JA4 B;  1BH9 A;  3KWQ C;  1ZLA D;  2FJ7 A;  4H9P B;  4H9S A;  3W97 A;  4J8X A;  4KGC C;  1Q9C A;  3WAA B;  3KXB B;  3AL0 C;  3B0B A;  2PYO B;  4XZQ B;  3EG5 B;  2Y2J A;  3AV2 C;  3AV1 D;  3AYW C;  4XZQ C;  1JFI A;  2PYO C;  5AV5 B;  4YM6 D;  4J8V A;  1P3F B;  4HGA B;  1P3P A;  1ULY A;  3AZK B;  5AV5 C;  3EPJ A;  2UWX A;  4WV4 B;  4HGA C;  4H9Q A;  1U35 D;  1P3F C;  5B40 A;  2BG1 A;  5AVB D;  5BS7 A;  3MGQ D;  5F99 D;  1P3A D;  1M1A B;  4XUJ D;  1M19 B;  3MGS B;  4H9N A;  1M1A C;  2CWE A;  1H3O A;  1M19 C;  1P34 D;  4YS3 B;  5CPK A;  4YS3 C;  2NQB B;  1ZLA A;  2HIO D;  3X1U D;  2NQB C;  3A6N B;  5BO0 B;  1BH9 B;  4JJN B;  5B31 D;  3A6N C;  3W97 B;  3AV1 A;  4J8X B;  3VH5 W;  3X1V D;  2FJ7 C;  4H9S C;  4J8W D;  3W97 C;  4YM6 A;  4J8X C;  5GSU B;  3NQJ A;  5BNX A;  1U35 A;  5AVB A;  3MGQ A;  4J8V B;  5B32 D;  5F99 A;  1P3A A;  4J8V C;  1P3M A;  4H9Q B;  1P3P C;  5B40 B;  4UUZ A;  1T3U A;  4XUJ A;  5B40 C;  5BS7 C;  5CP6 D;  2F8N G;  1P34 A;  4H9N B;  2Y2P A;  3AZI C;  2HIO A;  1P3I D;  1WWI A;  3X1U A;  5CPK B;  2ZY5 A;  5CPK C;  2IO5 B;  5B31 A;  3H0L C;  1ZLA C;  3X1V A;  1F66 A;  2IO5 C;  3MGP B;  4J8W A;  3AV2 D;  2F8N B;  3X1S D;  3AV1 B;  3REL D;  1KX5 B;  3AV1 C;  4YM6 B;  5B32 A;  2Y2O A;  2ZY3 A;  5AVC D;  3NQJ B;  5BNX B;  1U35 B;  2Y2M A;  5AVB B;  3MGQ B;  5F99 B;  1U35 C;  1P3L D;  5BNV A;  5AVB C;  1P3A B;  3MGQ C;  5CP6 A;  2CV5 B;  5B1M D;  5F99 C;  4X23 D;  4XUJ B;  1P3M C;  1BFM A;  3KFU G;  3MVD C;  1P34 B;  1P3I A;  3REH D;  5FUG A;  1P34 C;  3LZ0 D;  4G92 B;  3X1T B;  4G92 C;  1TZY D;  2HIO C;  5E5A D;  3C1C D;  3AV2 A;  3X1U C;  3X1S A;  4UPK A;  4Z2M G;  3REL A;  3X1V B;  3B0D B;  5B31 C;  4WU8 D;  4J8W B;  3LJA D;  3B0D C;  1F66 C;  5AVC A;  4J8W C;  5B33 D;  1HQ3 C;  5B32 B;  5AV8 D;  3REJ D;  1P3L A;  3R45 A;  4Z5T D;  5B32 C;  5B1M A;  1P3B D;  3LZ1 D;  4X23 A;  2RVQ D;  5BNV B;  4E44 A;  2HUE B;  5CP6 B;  3B0C T;  1KX3 B;  2BYM B;  3AZG C;  5CP6 C;  3VH6 T;  3REH A;  3AZI D;  3P5J B;  5CPI D;  3LZ0 A;  3V9R A;  1P3I B;  3AZF D;  1TZY A;  5FUG B;  3WA9 D;  5E5A A;  3C1C A;  1P3I C;  4KGC B;  1P3G D;  4WU8 A;  1P3O D;  3AV2 B;  3LJA A;  3X1S B;  4CAY A;  3AYW B;  2F8N H;  1S32 D;  2L5A A;  5B33 A;  3REL B;  3X1S C;  3REL C;  3REJ A;  5AV8 A;  4Z5T A;  3B6F D;  5AVC B;  1P3B A;  5AVC C;  3LZ1 A;  4Z66 D;  1P3L B;  3R45 B;  3W96 D;  3AN2 D;  5B1M B;  1P3L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...