3AV1D

The human nucleosome structure containing the histone variant h3.2
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structures of human nucleosomes containing major histone H3 variants
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 34
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3av1D00
5AV5B 3TU4C 5JRGA 5KDMB 3MNNC 5CPID 5B1MB 2AROC 3AV1D 5DNMD 1HQ3B 4J8UD 1P3LD 4M6BA 2LY8A 5B0YC 4X23D 3MGQA 4KUDA 3KWQD 4NE3A 4H9PA 5GT0D 5B32A 1M1AD 2FJ7B 4NFTA 1TZYB 5AV8D 3MGSD 3W97C 1U35B 3REIA 5BO0B 5B2JD 5AV5A 5KDMA 5AV6B 3LZ1C 1EQZD 5B1MA 4YS3C 4XUJB 3B0DC 5C3IB 3R45B 3REKB 5B1LB 3UTBB 1ID3D 3WAAB 4KHAB 1BFMA 3REIB 2NZDB 3RELB 1KX4D 5CP6C 5CPIB 3C1CB 1P3PC 3WTPC 3LJAC 3LELD 2FJ7A 1S32D 3LZ0C 3W97D 1TZYA 2YFWB 5AV9D 5B40B 3UT9C 4YM6B 5G49B 1P3ID 1U35A 3AYWA 2CV5B 2PYOB 3WA9D 1KX5B 4H9RB 5AV6A 3AZMD 5AVBC 5AVCB 5BS7C 3REJB 4CSRB 4XUJA 3MGSB 4Z2MG 3R45A 3REKA 5B1LA 3UTBA 3TU4B 3AZHC 4KHAA 3WKJD 3WAAA 2NZDA 3MNNB 3KUYD 3RELA 3C1CA 3A6ND 2AROB 2F8NB 5B0ZC 3AZNC 2YFWA 1P3AD 5B40A 1ZLAC 5B31G 5B0YB 4YM6A 2CV5A 2PYOA 2HIOC 1KX5A 1P3MD 4H9QB 4H9RA 1P3BC 4J8XA 4QLCD 1S32B 5AVCA 3V9RA 3UTAC 4ZBJC 5GSUD 3W97B 4J8WC 3REJA 4CSRA 3AZKC 3MGSA 3TU4A 5JRGD 3VH6A 1A7WA 3MNNA 4WZSB 3LZ1B 4YS3B 2AROA 3B0DB 2F8NA 4WV4B 3WKJB 5B0YA 3MGQD 4KUDD 5CP6B 5F99C 1P3PB 4WU8C 3WTPB 3LJAB 2L5AA 4H9QA 5B32D 3A6NB 3B6GC 5AY8C 3LZ0B 1M19C 4LD9C 1JFIA 3UT9B 3REID 3AZGC 3KXBC 5AV5D 1P3KC 5AVBB 3LZ1A 1TAFB 4CAYB 3AZIC 4YS3A 5B1MD 3W99C 2BYKB 5CP6A 1P3PA 3WTPA 3LJAA 2FJ7D 1M19D 3O62C 5B0ZB 3AZNB 3LZ0A 1TZYD 3UT9A 1ZLAB 4E45A 1M18C 3MGRC 3AYWD 1U35D 3W98C 2HIOB 3VH5A 5DNNC 2HUEC 1P3BB 5AV6D 5AVBA 4G91B 4J8XC 2RVQD 4DRBA 1TAFA 3W99D 4CAYA 5BS7A 5BT1C 3UTAB 3AZKB 4XUJD 3REKD 3UTBD 5B1LD 3WAAD 3AZHA 3AN2C 2NZDD 3RELD 2BYKA 3C1CD 5B0ZA 3AZNA 3MGRD 5B40D 1ZLAA 4YM6D 3AZJC 2PYOD 2CV5D 5F99B 2BYMA 2HIOA 4WU8B 1KX5D 3X1SC 1R4VA 1P3BA 3B6GB 5AY8B 4J8XD 4LD9B 1M19B 5AVCD 2NQBC 3UTAA 1N1JB 4J8WA 3REJD 3AZKA 3AZGB 3KXBB 3AYWB 5JA4B 3TU4D 3MNND 1KX3C 3X1UC 1P3KB 3AZIB 4Z5TC 2AROD 3W99B 2F8ND 2F8NK 4UUZA 5B0YD 1P3OC 5F99A 3W96C 4WU8A 4NE6A 3O62B 3B6GA 5AY8A 4LD9A 1M19A 1KU5A 3VH6W 4J8VC 5CPKC 1N1JA 3MGRB 1M18B 3B6FC 3W98B 3AZGA 5B24C 1P3GC 3KXBA 2HUEB 5JA4A 3REHC 1P3KA 3LZ1D 4J8XB 3AV2B 3AZIA 4YS3D 3V9RB 4HGAC 3W99A 5B2IC 5BNXA 3AN2B 5CP6D 3NQJB 1P3PD 3WTPD 3LJAD 3O62A 3LZ0D 3AZLC 3UT9D 3AZJB 1M18A 3MGRA 3W98A 4XZQC 5DNNA 5CPJC 1BH9B 3X1SB 1H3OB 3VH6T 5AVBD 2NQBB 3AV2A 5B2ID 4H9NB 1JFIB 3AZHD 3AN2A 1KX3B 3X1UB 2JSSA 5FUGB 2YFVB 3NQJA 1AOIC 4JJNC 1Q9CA 3VH5W 5B0ZD 3AZND 1F66C 4WU9C 3C1BC 1ZLAD 3AZJA 1P3OB 2HIOD 3W96B 1BH9A 5E5AC 3X1SA 3AFAC 1H3OA 1P3BD 3AZEC 4J8VB 2NQBA 3UTAD 5B33C 5CPKB 4H9NA 4J8WD 3AZKD 1P3GB 5B24B 2IO5C 3B0CW 4G92C 3REHB 1KX3A 3X1VC 4ZUXC 3X1UA 5FUGA 2YFVA 4JJND 4Z5TA 3MGPC 4HGAB 5B2IB 4Z66C 3AZHB 1HQ3C 1P3OA 5F99D 4H9SC 3W96A 3VH5T 3AZFA 4WU8D 3B6GD 5AY8D 3AZLB 5B33D 1B67A 4LD9D 4J8VA 5CPKA 1P3FC 4R8PC 5GXQC 3B6FA 4XZQB 5B24A 3AZGD 1P3GA 3KXBD 5CPJB 2BYMB 5B31C 3REHA 1P3KD 4KGCC 3AZID 4ZBJB 5B2IA 4J8WB 3B0CT 4NE5A 5GT3C 1AOIB 1WWSA 4JJNB 3O62D 5CPIC 3X1TC 3AZLA 1F66B 3MVDC 4WU9B 3C1BB 1M18D 3AV1C 4UUZB 3W98D 4XZQA 5DNMC 5DNND 5CPJA 4J8UC 5E5AB 1P3LC 4X23C 3AFAB 3AZEB 2F8NH 3KWQC 5GT0C 5B33B 3AV2D 1M1AC 5BT1D 3WTPE 2IO5B 5AV8C 3AN2D 4G92B 4ZUXB 3X1VB 3AV2C 1BH8B 5B2JC 1WWIA 1AOIA 2CWEA 3MGPB 3X1TD 4JJNA 3MVDD 5BNXB 4WU9A 1F66A 4Z66B 3C1BA 1EQZC 3AZJD 3NQUB 1ID3C 5E5AA 3X1SD 3AFAA 3AZFC 1KX4C 3AZEA 5B32G 2NQBD 5B33A 1P3FB 4R8PB 5GXQB 3LELC 1S32C 5B31B 5DNNB 5AV9C 1P34C 1P3IC 1KX3D 4ZUXA 3X1VA 3X1UD 3WA9C 4KGCB 1BH8A 4WNNB 4Z5TD 3MGPA 3AZMC 5GT3B 4Z66A 1HQ3A 1P3OD 3NQUA 4H9SA 3WKJC 3W96D 3AZFD 3KUYC 4EO5C 3X1TB 3MVDB 4J8VD 3A6NC 5CPKD 4R8PA 5GXQA 4DRAA 1P3FA 3AV1B 3B6FD 5DNMB 5B24D 1P3GD 1P34D 4J8UB 1P3LB 5B31A 1P3AC 3REHD 4X23B 1F1EA 5BO0A 3KWQB 4KGCA 4WNNA 5GT0B 1M1AB 1P3MC 4QLCC 5AV8B 5GT3A 5GSUC 3KSYA 5B2JB 5JRGC 4Z5TB 5CPIA 1ULYA 3X1TA 3AZLD 4E44A 3MVDA 1EQZB 3AV1A 5DNMA 4XZQD 1ID3B 5G49A 5CPJD 4J8UA 1P3LA 1HTAA 4X23A 3AZFB 3MGQC 1KX4B 4KUDC 3KWQA 5GT0A 1M1AA 5BNVB 5B32C 3LELB 4G91C 4AWLC 3B6FB 5AV8A 5AV9B 3B0BA 1P34B 1P3IB 3WA9B 3REIC 5B2JA 5AV5C 1AOID 3AZMB 1F66D 4WU9D 1EQZA 2F8NG 3C1BD 5B1MC 1ID3A 5CHLB 5E5AD 3KUYB 4EO5B 3AFAD 1KX4A 3AZED 4H9OB 4Z2MH 5BNVA 3LELA 2FJ7C 1S32A 3W97A 1TZYC 5AV9A 1P3AB 1P34A 1P3IA 1U35C 3AYWC 4ZUXD 3X1VD 3WA9A 1B6WA 1P3MB 3MGPD 3AZMA 5AV6C 4QLCB 2RVQC 5GSUB 4Z66D 1HQ3D 4XUJC 5C3IC 3WAAC 3REKC 5B1LC 3UTBC 3WKJA 5JRGB 2NZDC 3KUYA 3RELC 4H9OA 3C1CC 3A6NA 1P3FD 4R8PD 5GXQD 5B31D 1P3AA 5B40C 4YM6C 2PYOC 3MGQB 2CV5C 4KUDB 4KGCD 4H9PB 1KX5C 5B32B 1P3MA 4AWLB 4QLCA 5AVCC 5GT3D 5GSUA 3REJC 3MGSC
chains in the Genus database with same CATH superfamily
2Y2GA 5AV5B 3TU4C 5JRGA 5KDMB 3MNNC 2Y2PA 5CPID 5B1MB 2AROC 2F2AC 3AV1D 3A1KA 5DNMD 1HQ3B 4J8UD 1P3LD 4M6BA 2LY8A 5B0YC 4X23D 3MGQA 2Y2JA 4KUDA 3KWQD 4NE3A 4H9PA 5GT0D 5B32A 1M1AD 2FJ7B 4NFTA 1TZYB 5AV8D 3MGSD 3W97C 2Y2KA 1U35B 3REIA 5BO0B 5B2JD 5AV5A 5KDMA 5AV6B 3LZ1C 4DQYB 1EQZD 5B1MA 4YS3C 4XUJB 3B0DC 5C3IB 3R45B 3REKB 5B1LB 3UTBB 2Y2IA 1ID3D 4KHAB 3WAAB 1BFMA 3REIB 2NZDB 3RELB 1KX4D 5CP6C 5CPIB 3C1CB 1P3PC 3WTPC 3LJAC 3LELD 2FJ7A 1S32D 3EPLA 3LZ0C 3W97D 2W8SA 1TZYA 2YFWB 5AV9D 5B40B 3UT9C 4YM6B 1Z2CB 5G49B 1U35A 3AYWA 2CV5B 1P3ID 2PYOB 3WA9D 1KX5B 4H9RB 5AV6A 3AZMD 5AVBC 5AVCB 5BS7C 3REJB 4CSRB 4XUJA 3MGSB 4Z2MG 3R45A 3REKA 5B1LA 3UTBA 3TU4B 3AZHC 4KHAA 3WKJD 3WAAA 2NZDA 3MNNB 3KUYD 3RELA 3C1CA 3A6ND 2AROB 2F8NB 5B0ZC 3AZNC 2YFWA 1P3AD 5B40A 1ZLAC 5B31G 5B0YB 4YM6A 2CV5A 2PYOA 2HIOC 1KX5A 1P3MD 4H9QB 4H9RA 1P3BC 4J8XA 4QLCD 1S32B 5AVCA 3V9RA 3UTAC 4ZBJC 5GSUD 3W97B 4J8WC 3REJA 4CSRA 3AZKC 3MGSA 3TU4A 2Y2MA 5JRGD 3VH6A 1A7WA 3KFUG 3MNNA 4WZSB 3LZ1B 2G5IC 4YS3B 2AROA 3B0DB 3EPKA 3H0RC 2F8NA 3AL0C 4WV4B 3WKJB 5B0YA 3MGQD 4KUDD 5CP6B 5F99C 1P3PB 4WU8C 3WTPB 3LJAB 2L5AA 3IP4C 4H9QA 5B32D 3A6NB 3B6GC 5AY8C 3LZ0B 1M19C 4LD9C 4WJ3C 3EPJA 1JFIA 3UT9B 3REID 3AZGC 3KXBC 5AV5D 1P3KC 5AVBB 3LZ1A 2Y2HA 1TAFB 4CAYB 3AZIC 4YS3A 5B1MD 3W99C 3FDDA 2BYKB 5CP6A 1P3PA 3WTPA 3LJAA 2FJ7D 1M19D 3O62C 5B0ZB 3AZNB 1T3UA 3LZ0A 1TZYD 3UT9A 1ZLAB 4E45A 1M18C 3MGRC 3AYWD 1U35D 3W98C 2HIOB 3VH5A 5DNNC 4UPKA 2HUEC 1P3BB 5AV6D 3EPHA 5AVBA 2DF4C 4G91B 4J8XC 2RVQD 2DQNC 1TAFA 3W99D 4CAYA 4DRBA 5BS7A 5BT1C 3UTAB 4XUJD 3AZKB 3REKD 3UTBD 5B1LD 3WAAD 3AZHA 3AN2C 2NZDD 3RELD 2BYKA 3C1CD 5B0ZA 3AZNA 3MGRD 5B40D 1ZLAA 4YM6D 3AZJC 2PYOD 2CV5D 5F99B 2BYMA 2HIOA 4WU8B 1KX5D 3X1SC 1R4VA 1P3BA 3B6GB 5AY8B 4J8XD 4LD9B 1M19B 5AVCD 2NQBC 3UTAA 1N1JB 4J8WA 3REJD 3AZKA 3AZGB 3KXBB 3AYWB 5JA4B 3TU4D 3MNND 1KX3C 3X1UC 1P3KB 3AZIB 4Z5TC 2AROD 2ZY2A 3W99B 2F8ND 2F8NK 2XD5A 4UUZA 5B0YD 1P3OC 2Y2OA 5F99A 3W96C 4WU8A 4NE6A 3O62B 3B6GA 5AY8A 4LD9A 1M19A 1KU5A 3VH6W 4J8VC 2VQRA 5CPKC 1N1JA 3MGRB 1M18B 3B6FC 3W98B 3AZGA 5B24C 1P3GC 3KXBA 2HUEB 5JA4A 3REHC 1P3KA 3LZ1D 4J8XB 3AV2B 3AZIA 3V9RB 4YS3D 4HGAC 3W99A 5B2IC 5BNXA 2UWXA 3AN2B 5CP6D 3NQJB 1P3PD 3WTPD 3LJAD 3O62A 3LZ0D 3AZLC 3UT9D 3AZJB 1M18A 3MGRA 3W98A 4XZQC 5DNNA 5CPJC 1BH9B 3X1SB 1H3OB 3VH6T 2Y2QA 5AVBD 2NQBB 3AV2A 5B2ID 4H9NB 1JFIB 3AZHD 3AN2A 1KX3B 3X1UB 2JSSA 5FUGB 2YFVB 2J8PA 3NQJA 1AOIC 4JJNC 1Q9CA 3VH5W 5B0ZD 3AZND 1F66C 4WU9C 3C1BC 1ZLAD 3AZJA 1P3OB 2HIOD 3W96B 3P5JB 1BH9A 5E5AC 3X1SA 3AFAC 1H3OA 1P3BD 3AZEC 4J8VB 2NQBA 3UTAD 5B33C 5CPKB 4H9NA 4J8WD 3AZKD 1P3GB 5B24B 2ZY4A 2ZY3A 2IO5C 3B0CW 4G92C 3REHB 1KX3A 4ZUXC 3X1UA 3X1VC 5FUGA 2YFVA 4JJND 4Z5TA 3MGPC 4HGAB 5B2IB 1W2EA 4Z66C 3AZHB 1HQ3C 1P3OA 5F99D 4H9SC 3W96A 3VH5T 3AZFA 4WU8D 3B6GD 5AY8D 3AZLB 5B33D 1B67A 4LD9D 4J8VA 3H0LC 5CPKA 1P3FC 4R8PC 5GXQC 3B6FA 2XD1A 4XZQB 5B24A 3AZGD 1P3GA 3KXBD 5CPJB 2BYMB 5B31C 3REHA 3H0MC 1P3KD 4KGCC 3AZID 4ZBJB 5B2IA 4J8WB 3B0CT 4NE5A 5GT3C 1AOIB 1WWSA 4JJNB 3O62D 5CPIC 3X1TC 3AZLA 1F66B 3MVDC 4WU9B 3C1BB 1M18D 3AV1C 4UUZB 3W98D 4XZQA 5DNMC 5DNND 5CPJA 2FFFB 4J8UC 5E5AB 1P3LC 4X23C 3AFAB 3AZEB 2F8NH 3KWQC 5GT0C 5B33B 3AV2D 2JCHA 1M1AC 5BT1D 3WTPE 2IO5B 5AV8C 3AN2D 4G92B 4ZUXB 3X1VB 3AV2C 1BH8B 5B2JC 1WWIA 1AOIA 2CWEA 3MGPB 3X1TD 4JJNA 3MVDD 2Y2LA 5BNXB 4WU9A 1F66A 4Z66B 3C1BA 1EQZC 3AZJD 3NQUB 1ID3C 5E5AA 3X1SD 3AFAA 3AZFC 1KX4C 3AZEA 1PZRA 5B32G 2NQBD 5B33A 1P3FB 4R8PB 5GXQB 3LELC 1S32C 5B31B 5DNNB 5AV9C 1P34C 1P3IC 1KX3D 4ZUXA 3X1VA 3X1UD 3WA9C 4KGCB 1BH8A 4WNNB 2ZM5A 4Z5TD 3MGPA 3AZMC 5GT3B 4Z66A 1HQ3A 1P3OD 3NQUA 4H9SA 3WKJC 3W96D 3AZFD 3KUYC 4EO5C 3X1TB 2ZY5A 3MVDB 4J8VD 3A6NC 5CPKD 4R8PA 5GXQA 4DRAA 1P3FA 3AV1B 3B6FD 5DNMB 5B24D 1P3GD 1P34D 4J8UB 1P3LB 5B31A 1P3AC 3REHD 4X23B 1F1EA 5BO0A 3KWQB 4KGCA 4WNNA 5GT0B 1M1AB 1P3MC 4QLCC 3F6TA 5AV8B 5GT3A 5GSUC 3A1IA 3KSYA 5B2JB 5JRGC 3EG5B 4Z5TB 5CPIA 1ULYA 3X1TA 3AZLD 4E44A 3MVDA 1EQZB 3AV1A 5DNMA 4XZQD 1ID3B 5G49A 5CPJD 4J8UA 1P3LA 1HTAA 4X23A 3AZFB 3MGQC 1KX4B 4KUDC 3KWQA 2G5HC 5GT0A 1M1AA 5BNVB 5B32C 3LELB 4G91C 4AWLC 3B6FB 5AV8A 5AV9B 3B0BA 1P34B 1P3IB 3WA9B 3REIC 5B2JA 5AV5C 1AOID 3AZMB 2RIQA 1F66D 2BG1A 4WU9D 1EQZA 3C1BD 2F8NG 5B1MC 1ID3A 5CHLB 5E5AD 3KUYB 4EO5B 3AFAD 1KX4A 3AZED 4H9OB 2JE5A 4Z2MH 5BNVA 3LELA 2FJ7C 1S32A 3W97A 1TZYC 5AV9A 1P3AB 1P34A 1P3IA 1U35C 3AYWC 4ZUXD 3X1VD 3WA9A 1B6WA 1P3MB 3MGPD 3AZMA 5AV6C 4QLCB 2RVQC 5GSUB 4Z66D 1HQ3D 4XUJC 5C3IC 3WAAC 3REKC 2Y2NA 5B1LC 3UTBC 5JRGB 3WKJA 2NZDC 3KUYA 3RELC 4H9OA 3C1CC 3A6NA 1P3FD 4R8PD 5GXQD 5B31D 1P3AA 5B40C 4YM6C 2PYOC 3MGQB 2CV5C 4KUDB 4KGCD 4H9PB 1KX5C 5B32B 1P3MA 4AWLB 4QLCA 5AVCC 5GT3D 5GSUA 3REJC 3MGSC
chains in the Genus database with same CATH topology
2Y2GA 5AV5B 3TU4C 5JRGA 5KDMB 3MNNC 2Y2PA 5CPID 5B1MB 2AROC 2F2AC 3AV1D 3A1KA 5DNMD 1HQ3B 4J8UD 1P3LD 4M6BA 2LY8A 5B0YC 4X23D 3MGQA 2Y2JA 4KUDA 3KWQD 4NE3A 4H9PA 5GT0D 5B32A 1M1AD 2FJ7B 4NFTA 1TZYB 5AV8D 3MGSD 3W97C 2Y2KA 1U35B 3REIA 5BO0B 5B2JD 5AV5A 5KDMA 5AV6B 3LZ1C 4DQYB 1EQZD 5B1MA 4YS3C 4XUJB 3B0DC 5C3IB 3R45B 3REKB 5B1LB 3UTBB 2Y2IA 1ID3D 4KHAB 3WAAB 1BFMA 3REIB 2NZDB 3RELB 1KX4D 5CP6C 5CPIB 3C1CB 1P3PC 3WTPC 3LJAC 3LELD 2FJ7A 1S32D 3EPLA 3LZ0C 3W97D 2W8SA 1TZYA 2YFWB 5AV9D 5B40B 3UT9C 4YM6B 1Z2CB 5G49B 1U35A 3AYWA 2CV5B 1P3ID 2PYOB 3WA9D 1KX5B 4H9RB 5AV6A 3AZMD 5AVBC 5AVCB 5BS7C 3REJB 4CSRB 4XUJA 3MGSB 4Z2MG 3R45A 3REKA 5B1LA 3UTBA 3TU4B 3AZHC 4KHAA 3WKJD 3WAAA 2NZDA 3MNNB 3KUYD 3RELA 3C1CA 3A6ND 2AROB 2F8NB 5B0ZC 3AZNC 2YFWA 1P3AD 5B40A 1ZLAC 5B31G 5B0YB 4YM6A 2CV5A 2PYOA 2HIOC 1KX5A 1P3MD 4H9QB 4H9RA 1P3BC 4J8XA 4QLCD 1S32B 5AVCA 3V9RA 3UTAC 4ZBJC 5GSUD 3W97B 4J8WC 3REJA 4CSRA 3AZKC 3MGSA 3TU4A 2Y2MA 5JRGD 3VH6A 1A7WA 3KFUG 3MNNA 4WZSB 3LZ1B 2G5IC 4YS3B 2AROA 3B0DB 3EPKA 3H0RC 2F8NA 3AL0C 4WV4B 3WKJB 5B0YA 3MGQD 4KUDD 5CP6B 5F99C 1P3PB 4WU8C 3WTPB 3LJAB 2L5AA 3IP4C 4H9QA 5B32D 3A6NB 3B6GC 5AY8C 3LZ0B 1M19C 4LD9C 4WJ3C 3EPJA 1JFIA 3UT9B 3REID 3AZGC 3KXBC 5AV5D 1P3KC 5AVBB 3LZ1A 2Y2HA 1TAFB 4CAYB 3AZIC 4YS3A 5B1MD 3W99C 3FDDA 2BYKB 5CP6A 1P3PA 3WTPA 3LJAA 2FJ7D 1M19D 3O62C 5B0ZB 3AZNB 1T3UA 3LZ0A 1TZYD 3UT9A 1ZLAB 4E45A 1M18C 3MGRC 3AYWD 1U35D 3W98C 2HIOB 3VH5A 5DNNC 4UPKA 2HUEC 1P3BB 5AV6D 3EPHA 5AVBA 2DF4C 4G91B 4J8XC 2RVQD 2DQNC 1TAFA 3W99D 4CAYA 4DRBA 5BS7A 5BT1C 3UTAB 4XUJD 3AZKB 3REKD 3UTBD 5B1LD 3WAAD 3AZHA 3AN2C 2NZDD 3RELD 2BYKA 3C1CD 5B0ZA 3AZNA 3MGRD 5B40D 1ZLAA 4YM6D 3AZJC 2PYOD 2CV5D 5F99B 2BYMA 2HIOA 4WU8B 1KX5D 3X1SC 1R4VA 1P3BA 3B6GB 5AY8B 4J8XD 4LD9B 1M19B 5AVCD 2NQBC 3UTAA 1N1JB 4J8WA 3REJD 3AZKA 3AZGB 3KXBB 3AYWB 5JA4B 3TU4D 3MNND 1KX3C 3X1UC 1P3KB 3AZIB 4Z5TC 2AROD 2ZY2A 3W99B 2F8ND 2F8NK 2XD5A 4UUZA 5B0YD 1P3OC 2Y2OA 5F99A 3W96C 4WU8A 4NE6A 3O62B 3B6GA 5AY8A 4LD9A 1M19A 1KU5A 3VH6W 4J8VC 2VQRA 5CPKC 1N1JA 3MGRB 1M18B 3B6FC 3W98B 3AZGA 5B24C 1P3GC 3KXBA 2HUEB 5JA4A 3REHC 1P3KA 3LZ1D 4J8XB 3AV2B 3AZIA 3V9RB 4YS3D 4HGAC 3W99A 5B2IC 5BNXA 2UWXA 3AN2B 5CP6D 3NQJB 1P3PD 3WTPD 3LJAD 3O62A 3LZ0D 3AZLC 3UT9D 3AZJB 1M18A 3MGRA 3W98A 4XZQC 5DNNA 5CPJC 1BH9B 3X1SB 1H3OB 3VH6T 2Y2QA 5AVBD 2NQBB 3AV2A 5B2ID 4H9NB 1JFIB 3AZHD 3AN2A 1KX3B 3X1UB 2JSSA 5FUGB 2YFVB 2J8PA 3NQJA 1AOIC 4JJNC 1Q9CA 3VH5W 5B0ZD 3AZND 1F66C 4WU9C 3C1BC 1ZLAD 3AZJA 1P3OB 2HIOD 3W96B 3P5JB 1BH9A 5E5AC 3X1SA 3AFAC 1H3OA 1P3BD 3AZEC 4J8VB 2NQBA 3UTAD 5B33C 5CPKB 4H9NA 4J8WD 3AZKD 1P3GB 5B24B 2ZY4A 2ZY3A 2IO5C 3B0CW 4G92C 3REHB 1KX3A 4ZUXC 3X1UA 3X1VC 5FUGA 2YFVA 4JJND 4Z5TA 3MGPC 4HGAB 5B2IB 1W2EA 4Z66C 3AZHB 1HQ3C 1P3OA 5F99D 4H9SC 3W96A 3VH5T 3AZFA 4WU8D 3B6GD 5AY8D 3AZLB 5B33D 1B67A 4LD9D 4J8VA 3H0LC 5CPKA 1P3FC 4R8PC 5GXQC 3B6FA 2XD1A 4XZQB 5B24A 3AZGD 1P3GA 3KXBD 5CPJB 2BYMB 5B31C 3REHA 3H0MC 1P3KD 4KGCC 3AZID 4ZBJB 5B2IA 4J8WB 3B0CT 4NE5A 5GT3C 1AOIB 1WWSA 4JJNB 3O62D 5CPIC 3X1TC 3AZLA 1F66B 3MVDC 4WU9B 3C1BB 1M18D 3AV1C 4UUZB 3W98D 4XZQA 5DNMC 5DNND 5CPJA 2FFFB 4J8UC 5E5AB 1P3LC 4X23C 3AFAB 3AZEB 2F8NH 3KWQC 5GT0C 5B33B 3AV2D 2JCHA 1M1AC 5BT1D 3WTPE 2IO5B 5AV8C 3AN2D 4G92B 4ZUXB 3X1VB 3AV2C 1BH8B 5B2JC 1WWIA 1AOIA 2CWEA 3MGPB 3X1TD 4JJNA 3MVDD 2Y2LA 5BNXB 4WU9A 1F66A 4Z66B 3C1BA 1EQZC 3AZJD 3NQUB 1ID3C 5E5AA 3X1SD 3AFAA 3AZFC 1KX4C 3AZEA 1PZRA 5B32G 2NQBD 5B33A 1P3FB 4R8PB 5GXQB 3LELC 1S32C 5B31B 5DNNB 5AV9C 1P34C 1P3IC 1KX3D 4ZUXA 3X1VA 3X1UD 3WA9C 4KGCB 1BH8A 4WNNB 2ZM5A 4Z5TD 3MGPA 3AZMC 5GT3B 4Z66A 1HQ3A 1P3OD 3NQUA 4H9SA 3WKJC 3W96D 3AZFD 3KUYC 4EO5C 3X1TB 2ZY5A 3MVDB 4J8VD 3A6NC 5CPKD 4R8PA 5GXQA 4DRAA 1P3FA 3AV1B 3B6FD 5DNMB 5B24D 1P3GD 1P34D 4J8UB 1P3LB 5B31A 1P3AC 3REHD 4X23B 1F1EA 5BO0A 3KWQB 4KGCA 4WNNA 5GT0B 1M1AB 1P3MC 4QLCC 3F6TA 5AV8B 5GT3A 5GSUC 3A1IA 3KSYA 5B2JB 5JRGC 3EG5B 4Z5TB 5CPIA 1ULYA 3X1TA 3AZLD 4E44A 3MVDA 1EQZB 3AV1A 5DNMA 4XZQD 1ID3B 5G49A 5CPJD 4J8UA 1P3LA 1HTAA 4X23A 3AZFB 3MGQC 1KX4B 4KUDC 3KWQA 2G5HC 5GT0A 1M1AA 5BNVB 5B32C 3LELB 4G91C 4AWLC 3B6FB 5AV8A 5AV9B 3B0BA 1P34B 1P3IB 3WA9B 3REIC 5B2JA 5AV5C 1AOID 3AZMB 2RIQA 1F66D 2BG1A 4WU9D 1EQZA 3C1BD 2F8NG 5B1MC 1ID3A 5CHLB 5E5AD 3KUYB 4EO5B 3AFAD 1KX4A 3AZED 4H9OB 2JE5A 4Z2MH 5BNVA 3LELA 2FJ7C 1S32A 3W97A 1TZYC 5AV9A 1P3AB 1P34A 1P3IA 1U35C 3AYWC 4ZUXD 3X1VD 3WA9A 1B6WA 1P3MB 3MGPD 3AZMA 5AV6C 4QLCB 2RVQC 5GSUB 4Z66D 1HQ3D 4XUJC 5C3IC 3WAAC 3REKC 2Y2NA 5B1LC 3UTBC 5JRGB 3WKJA 2NZDC 3KUYA 3RELC 4H9OA 3C1CC 3A6NA 1P3FD 4R8PD 5GXQD 5B31D 1P3AA 5B40C 4YM6C 2PYOC 3MGQB 2CV5C 4KUDB 4KGCD 4H9PB 1KX5C 5B32B 1P3MA 4AWLB 4QLCA 5AVCC 5GT3D 5GSUA 3REJC 3MGSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV5 B;  3TU4 C;  5JRG A;  5KDM B;  3MNN C;  5CPI D;  5B1M B;  2ARO C;  3AV1 D;  5DNM D;  1HQ3 B;  4J8U D;  1P3L D;  4M6B A;  2LY8 A;  5B0Y C;  4X23 D;  3MGQ A;  4KUD A;  3KWQ D;  4NE3 A;  4H9P A;  5GT0 D;  5B32 A;  1M1A D;  2FJ7 B;  4NFT A;  1TZY B;  5AV8 D;  3MGS D;  3W97 C;  1U35 B;  3REI A;  5BO0 B;  5B2J D;  5AV5 A;  5KDM A;  5AV6 B;  3LZ1 C;  1EQZ D;  5B1M A;  4YS3 C;  4XUJ B;  3B0D C;  5C3I B;  3R45 B;  3REK B;  5B1L B;  3UTB B;  1ID3 D;  3WAA B;  4KHA B;  1BFM A;  3REI B;  2NZD B;  3REL B;  1KX4 D;  5CP6 C;  5CPI B;  3C1C B;  1P3P C;  3WTP C;  3LJA C;  3LEL D;  2FJ7 A;  1S32 D;  3LZ0 C;  3W97 D;  1TZY A;  2YFW B;  5AV9 D;  5B40 B;  3UT9 C;  4YM6 B;  5G49 B;  1P3I D;  1U35 A;  3AYW A;  2CV5 B;  2PYO B;  3WA9 D;  1KX5 B;  4H9R B;  5AV6 A;  3AZM D;  5AVB C;  5AVC B;  5BS7 C;  3REJ B;  4CSR B;  4XUJ A;  3MGS B;  4Z2M G;  3R45 A;  3REK A;  5B1L A;  3UTB A;  3TU4 B;  3AZH C;  4KHA A;  3WKJ D;  3WAA A;  2NZD A;  3MNN B;  3KUY D;  3REL A;  3C1C A;  3A6N D;  2ARO B;  2F8N B;  5B0Z C;  3AZN C;  2YFW A;  1P3A D;  5B40 A;  1ZLA C;  5B31 G;  5B0Y B;  4YM6 A;  2CV5 A;  2PYO A;  2HIO C;  1KX5 A;  1P3M D;  4H9Q B;  4H9R A;  1P3B C;  4J8X A;  4QLC D;  1S32 B;  5AVC A;  3V9R A;  3UTA C;  4ZBJ C;  5GSU D;  3W97 B;  4J8W C;  3REJ A;  4CSR A;  3AZK C;  3MGS A;  3TU4 A;  5JRG D;  3VH6 A;  1A7W A;  3MNN A;  4WZS B;  3LZ1 B;  4YS3 B;  2ARO A;  3B0D B;  2F8N A;  4WV4 B;  3WKJ B;  5B0Y A;  3MGQ D;  4KUD D;  5CP6 B;  5F99 C;  1P3P B;  4WU8 C;  3WTP B;  3LJA B;  2L5A A;  4H9Q A;  5B32 D;  3A6N B;  3B6G C;  5AY8 C;  3LZ0 B;  1M19 C;  4LD9 C;  1JFI A;  3UT9 B;  3REI D;  3AZG C;  3KXB C;  5AV5 D;  1P3K C;  5AVB B;  3LZ1 A;  1TAF B;  4CAY B;  3AZI C;  4YS3 A;  5B1M D;  3W99 C;  2BYK B;  5CP6 A;  1P3P A;  3WTP A;  3LJA A;  2FJ7 D;  1M19 D;  3O62 C;  5B0Z B;  3AZN B;  3LZ0 A;  1TZY D;  3UT9 A;  1ZLA B;  4E45 A;  1M18 C;  3MGR C;  3AYW D;  1U35 D;  3W98 C;  2HIO B;  3VH5 A;  5DNN C;  2HUE C;  1P3B B;  5AV6 D;  5AVB A;  4G91 B;  4J8X C;  2RVQ D;  4DRB A;  1TAF A;  3W99 D;  4CAY A;  5BS7 A;  5BT1 C;  3UTA B;  3AZK B;  4XUJ D;  3REK D;  3UTB D;  5B1L D;  3WAA D;  3AZH A;  3AN2 C;  2NZD D;  3REL D;  2BYK A;  3C1C D;  5B0Z A;  3AZN A;  3MGR D;  5B40 D;  1ZLA A;  4YM6 D;  3AZJ C;  2PYO D;  2CV5 D;  5F99 B;  2BYM A;  2HIO A;  4WU8 B;  1KX5 D;  3X1S C;  1R4V A;  1P3B A;  3B6G B;  5AY8 B;  4J8X D;  4LD9 B;  1M19 B;  5AVC D;  2NQB C;  3UTA A;  1N1J B;  4J8W A;  3REJ D;  3AZK A;  3AZG B;  3KXB B;  3AYW B;  5JA4 B;  3TU4 D;  3MNN D;  1KX3 C;  3X1U C;  1P3K B;  3AZI B;  4Z5T C;  2ARO D;  3W99 B;  2F8N D;  2F8N K;  4UUZ A;  5B0Y D;  1P3O C;  5F99 A;  3W96 C;  4WU8 A;  4NE6 A;  3O62 B;  3B6G A;  5AY8 A;  4LD9 A;  1M19 A;  1KU5 A;  3VH6 W;  4J8V C;  5CPK C;  1N1J A;  3MGR B;  1M18 B;  3B6F C;  3W98 B;  3AZG A;  5B24 C;  1P3G C;  3KXB A;  2HUE B;  5JA4 A;  3REH C;  1P3K A;  3LZ1 D;  4J8X B;  3AV2 B;  3AZI A;  4YS3 D;  3V9R B;  4HGA C;  3W99 A;  5B2I C;  5BNX A;  3AN2 B;  5CP6 D;  3NQJ B;  1P3P D;  3WTP D;  3LJA D;  3O62 A;  3LZ0 D;  3AZL C;  3UT9 D;  3AZJ B;  1M18 A;  3MGR A;  3W98 A;  4XZQ C;  5DNN A;  5CPJ C;  1BH9 B;  3X1S B;  1H3O B;  3VH6 T;  5AVB D;  2NQB B;  3AV2 A;  5B2I D;  4H9N B;  1JFI B;  3AZH D;  3AN2 A;  1KX3 B;  3X1U B;  2JSS A;  5FUG B;  2YFV B;  3NQJ A;  1AOI C;  4JJN C;  1Q9C A;  3VH5 W;  5B0Z D;  3AZN D;  1F66 C;  4WU9 C;  3C1B C;  1ZLA D;  3AZJ A;  1P3O B;  2HIO D;  3W96 B;  1BH9 A;  5E5A C;  3X1S A;  3AFA C;  1H3O A;  1P3B D;  3AZE C;  4J8V B;  2NQB A;  3UTA D;  5B33 C;  5CPK B;  4H9N A;  4J8W D;  3AZK D;  1P3G B;  5B24 B;  2IO5 C;  3B0C W;  4G92 C;  3REH B;  1KX3 A;  3X1V C;  4ZUX C;  3X1U A;  5FUG A;  2YFV A;  4JJN D;  4Z5T A;  3MGP C;  4HGA B;  5B2I B;  4Z66 C;  3AZH B;  1HQ3 C;  1P3O A;  5F99 D;  4H9S C;  3W96 A;  3VH5 T;  3AZF A;  4WU8 D;  3B6G D;  5AY8 D;  3AZL B;  5B33 D;  1B67 A;  4LD9 D;  4J8V A;  5CPK A;  1P3F C;  4R8P C;  5GXQ C;  3B6F A;  4XZQ B;  5B24 A;  3AZG D;  1P3G A;  3KXB D;  5CPJ B;  2BYM B;  5B31 C;  3REH A;  1P3K D;  4KGC C;  3AZI D;  4ZBJ B;  5B2I A;  4J8W B;  3B0C T;  4NE5 A;  5GT3 C;  1AOI B;  1WWS A;  4JJN B;  3O62 D;  5CPI C;  3X1T C;  3AZL A;  1F66 B;  3MVD C;  4WU9 B;  3C1B B;  1M18 D;  3AV1 C;  4UUZ B;  3W98 D;  4XZQ A;  5DNM C;  5DNN D;  5CPJ A;  4J8U C;  5E5A B;  1P3L C;  4X23 C;  3AFA B;  3AZE B;  2F8N H;  3KWQ C;  5GT0 C;  5B33 B;  3AV2 D;  1M1A C;  5BT1 D;  3WTP E;  2IO5 B;  5AV8 C;  3AN2 D;  4G92 B;  4ZUX B;  3X1V B;  3AV2 C;  1BH8 B;  5B2J C;  1WWI A;  1AOI A;  2CWE A;  3MGP B;  3X1T D;  4JJN A;  3MVD D;  5BNX B;  4WU9 A;  1F66 A;  4Z66 B;  3C1B A;  1EQZ C;  3AZJ D;  3NQU B;  1ID3 C;  5E5A A;  3X1S D;  3AFA A;  3AZF C;  1KX4 C;  3AZE A;  5B32 G;  2NQB D;  5B33 A;  1P3F B;  4R8P B;  5GXQ B;  3LEL C;  1S32 C;  5B31 B;  5DNN B;  5AV9 C;  1P34 C;  1P3I C;  1KX3 D;  4ZUX A;  3X1V A;  3X1U D;  3WA9 C;  4KGC B;  1BH8 A;  4WNN B;  4Z5T D;  3MGP A;  3AZM C;  5GT3 B;  4Z66 A;  1HQ3 A;  1P3O D;  3NQU A;  4H9S A;  3WKJ C;  3W96 D;  3AZF D;  3KUY C;  4EO5 C;  3X1T B;  3MVD B;  4J8V D;  3A6N C;  5CPK D;  4R8P A;  5GXQ A;  4DRA A;  1P3F A;  3AV1 B;  3B6F D;  5DNM B;  5B24 D;  1P3G D;  1P34 D;  4J8U B;  1P3L B;  5B31 A;  1P3A C;  3REH D;  4X23 B;  1F1E A;  5BO0 A;  3KWQ B;  4KGC A;  4WNN A;  5GT0 B;  1M1A B;  1P3M C;  4QLC C;  5AV8 B;  5GT3 A;  5GSU C;  3KSY A;  5B2J B;  5JRG C;  4Z5T B;  5CPI A;  1ULY A;  3X1T A;  3AZL D;  4E44 A;  3MVD A;  1EQZ B;  3AV1 A;  5DNM A;  4XZQ D;  1ID3 B;  5G49 A;  5CPJ D;  4J8U A;  1P3L A;  1HTA A;  4X23 A;  3AZF B;  3MGQ C;  1KX4 B;  4KUD C;  3KWQ A;  5GT0 A;  1M1A A;  5BNV B;  5B32 C;  3LEL B;  4G91 C;  4AWL C;  3B6F B;  5AV8 A;  5AV9 B;  3B0B A;  1P34 B;  1P3I B;  3WA9 B;  3REI C;  5B2J A;  5AV5 C;  1AOI D;  3AZM B;  1F66 D;  4WU9 D;  1EQZ A;  2F8N G;  3C1B D;  5B1M C;  1ID3 A;  5CHL B;  5E5A D;  3KUY B;  4EO5 B;  3AFA D;  1KX4 A;  3AZE D;  4H9O B;  4Z2M H;  5BNV A;  3LEL A;  2FJ7 C;  1S32 A;  3W97 A;  1TZY C;  5AV9 A;  1P3A B;  1P34 A;  1P3I A;  1U35 C;  3AYW C;  4ZUX D;  3X1V D;  3WA9 A;  1B6W A;  1P3M B;  3MGP D;  3AZM A;  5AV6 C;  4QLC B;  2RVQ C;  5GSU B;  4Z66 D;  1HQ3 D;  4XUJ C;  5C3I C;  3WAA C;  3REK C;  5B1L C;  3UTB C;  3WKJ A;  5JRG B;  2NZD C;  3KUY A;  3REL C;  4H9O A;  3C1C C;  3A6N A;  1P3F D;  4R8P D;  5GXQ D;  5B31 D;  1P3A A;  5B40 C;  4YM6 C;  2PYO C;  3MGQ B;  2CV5 C;  4KUD B;  4KGC D;  4H9P B;  1KX5 C;  5B32 B;  1P3M A;  4AWL B;  4QLC A;  5AVC C;  5GT3 D;  5GSU A;  3REJ C;  3MGS C; 
#chains in the Genus database with same CATH topology
 2Y2G A;  5AV5 B;  3TU4 C;  5JRG A;  5KDM B;  3MNN C;  2Y2P A;  5CPI D;  5B1M B;  2ARO C;  2F2A C;  3AV1 D;  3A1K A;  5DNM D;  1HQ3 B;  4J8U D;  1P3L D;  4M6B A;  2LY8 A;  5B0Y C;  4X23 D;  3MGQ A;  2Y2J A;  4KUD A;  3KWQ D;  4NE3 A;  4H9P A;  5GT0 D;  5B32 A;  1M1A D;  2FJ7 B;  4NFT A;  1TZY B;  5AV8 D;  3MGS D;  3W97 C;  2Y2K A;  1U35 B;  3REI A;  5BO0 B;  5B2J D;  5AV5 A;  5KDM A;  5AV6 B;  3LZ1 C;  4DQY B;  1EQZ D;  5B1M A;  4YS3 C;  4XUJ B;  3B0D C;  5C3I B;  3R45 B;  3REK B;  5B1L B;  3UTB B;  2Y2I A;  1ID3 D;  4KHA B;  3WAA B;  1BFM A;  3REI B;  2NZD B;  3REL B;  1KX4 D;  5CP6 C;  5CPI B;  3C1C B;  1P3P C;  3WTP C;  3LJA C;  3LEL D;  2FJ7 A;  1S32 D;  3EPL A;  3LZ0 C;  3W97 D;  2W8S A;  1TZY A;  2YFW B;  5AV9 D;  5B40 B;  3UT9 C;  4YM6 B;  1Z2C B;  5G49 B;  1U35 A;  3AYW A;  2CV5 B;  1P3I D;  2PYO B;  3WA9 D;  1KX5 B;  4H9R B;  5AV6 A;  3AZM D;  5AVB C;  5AVC B;  5BS7 C;  3REJ B;  4CSR B;  4XUJ A;  3MGS B;  4Z2M G;  3R45 A;  3REK A;  5B1L A;  3UTB A;  3TU4 B;  3AZH C;  4KHA A;  3WKJ D;  3WAA A;  2NZD A;  3MNN B;  3KUY D;  3REL A;  3C1C A;  3A6N D;  2ARO B;  2F8N B;  5B0Z C;  3AZN C;  2YFW A;  1P3A D;  5B40 A;  1ZLA C;  5B31 G;  5B0Y B;  4YM6 A;  2CV5 A;  2PYO A;  2HIO C;  1KX5 A;  1P3M D;  4H9Q B;  4H9R A;  1P3B C;  4J8X A;  4QLC D;  1S32 B;  5AVC A;  3V9R A;  3UTA C;  4ZBJ C;  5GSU D;  3W97 B;  4J8W C;  3REJ A;  4CSR A;  3AZK C;  3MGS A;  3TU4 A;  2Y2M A;  5JRG D;  3VH6 A;  1A7W A;  3KFU G;  3MNN A;  4WZS B;  3LZ1 B;  2G5I C;  4YS3 B;  2ARO A;  3B0D B;  3EPK A;  3H0R C;  2F8N A;  3AL0 C;  4WV4 B;  3WKJ B;  5B0Y A;  3MGQ D;  4KUD D;  5CP6 B;  5F99 C;  1P3P B;  4WU8 C;  3WTP B;  3LJA B;  2L5A A;  3IP4 C;  4H9Q A;  5B32 D;  3A6N B;  3B6G C;  5AY8 C;  3LZ0 B;  1M19 C;  4LD9 C;  4WJ3 C;  3EPJ A;  1JFI A;  3UT9 B;  3REI D;  3AZG C;  3KXB C;  5AV5 D;  1P3K C;  5AVB B;  3LZ1 A;  2Y2H A;  1TAF B;  4CAY B;  3AZI C;  4YS3 A;  5B1M D;  3W99 C;  3FDD A;  2BYK B;  5CP6 A;  1P3P A;  3WTP A;  3LJA A;  2FJ7 D;  1M19 D;  3O62 C;  5B0Z B;  3AZN B;  1T3U A;  3LZ0 A;  1TZY D;  3UT9 A;  1ZLA B;  4E45 A;  1M18 C;  3MGR C;  3AYW D;  1U35 D;  3W98 C;  2HIO B;  3VH5 A;  5DNN C;  4UPK A;  2HUE C;  1P3B B;  5AV6 D;  3EPH A;  5AVB A;  2DF4 C;  4G91 B;  4J8X C;  2RVQ D;  2DQN C;  1TAF A;  3W99 D;  4CAY A;  4DRB A;  5BS7 A;  5BT1 C;  3UTA B;  4XUJ D;  3AZK B;  3REK D;  3UTB D;  5B1L D;  3WAA D;  3AZH A;  3AN2 C;  2NZD D;  3REL D;  2BYK A;  3C1C D;  5B0Z A;  3AZN A;  3MGR D;  5B40 D;  1ZLA A;  4YM6 D;  3AZJ C;  2PYO D;  2CV5 D;  5F99 B;  2BYM A;  2HIO A;  4WU8 B;  1KX5 D;  3X1S C;  1R4V A;  1P3B A;  3B6G B;  5AY8 B;  4J8X D;  4LD9 B;  1M19 B;  5AVC D;  2NQB C;  3UTA A;  1N1J B;  4J8W A;  3REJ D;  3AZK A;  3AZG B;  3KXB B;  3AYW B;  5JA4 B;  3TU4 D;  3MNN D;  1KX3 C;  3X1U C;  1P3K B;  3AZI B;  4Z5T C;  2ARO D;  2ZY2 A;  3W99 B;  2F8N D;  2F8N K;  2XD5 A;  4UUZ A;  5B0Y D;  1P3O C;  2Y2O A;  5F99 A;  3W96 C;  4WU8 A;  4NE6 A;  3O62 B;  3B6G A;  5AY8 A;  4LD9 A;  1M19 A;  1KU5 A;  3VH6 W;  4J8V C;  2VQR A;  5CPK C;  1N1J A;  3MGR B;  1M18 B;  3B6F C;  3W98 B;  3AZG A;  5B24 C;  1P3G C;  3KXB A;  2HUE B;  5JA4 A;  3REH C;  1P3K A;  3LZ1 D;  4J8X B;  3AV2 B;  3AZI A;  3V9R B;  4YS3 D;  4HGA C;  3W99 A;  5B2I C;  5BNX A;  2UWX A;  3AN2 B;  5CP6 D;  3NQJ B;  1P3P D;  3WTP D;  3LJA D;  3O62 A;  3LZ0 D;  3AZL C;  3UT9 D;  3AZJ B;  1M18 A;  3MGR A;  3W98 A;  4XZQ C;  5DNN A;  5CPJ C;  1BH9 B;  3X1S B;  1H3O B;  3VH6 T;  2Y2Q A;  5AVB D;  2NQB B;  3AV2 A;  5B2I D;  4H9N B;  1JFI B;  3AZH D;  3AN2 A;  1KX3 B;  3X1U B;  2JSS A;  5FUG B;  2YFV B;  2J8P A;  3NQJ A;  1AOI C;  4JJN C;  1Q9C A;  3VH5 W;  5B0Z D;  3AZN D;  1F66 C;  4WU9 C;  3C1B C;  1ZLA D;  3AZJ A;  1P3O B;  2HIO D;  3W96 B;  3P5J B;  1BH9 A;  5E5A C;  3X1S A;  3AFA C;  1H3O A;  1P3B D;  3AZE C;  4J8V B;  2NQB A;  3UTA D;  5B33 C;  5CPK B;  4H9N A;  4J8W D;  3AZK D;  1P3G B;  5B24 B;  2ZY4 A;  2ZY3 A;  2IO5 C;  3B0C W;  4G92 C;  3REH B;  1KX3 A;  4ZUX C;  3X1U A;  3X1V C;  5FUG A;  2YFV A;  4JJN D;  4Z5T A;  3MGP C;  4HGA B;  5B2I B;  1W2E A;  4Z66 C;  3AZH B;  1HQ3 C;  1P3O A;  5F99 D;  4H9S C;  3W96 A;  3VH5 T;  3AZF A;  4WU8 D;  3B6G D;  5AY8 D;  3AZL B;  5B33 D;  1B67 A;  4LD9 D;  4J8V A;  3H0L C;  5CPK A;  1P3F C;  4R8P C;  5GXQ C;  3B6F A;  2XD1 A;  4XZQ B;  5B24 A;  3AZG D;  1P3G A;  3KXB D;  5CPJ B;  2BYM B;  5B31 C;  3REH A;  3H0M C;  1P3K D;  4KGC C;  3AZI D;  4ZBJ B;  5B2I A;  4J8W B;  3B0C T;  4NE5 A;  5GT3 C;  1AOI B;  1WWS A;  4JJN B;  3O62 D;  5CPI C;  3X1T C;  3AZL A;  1F66 B;  3MVD C;  4WU9 B;  3C1B B;  1M18 D;  3AV1 C;  4UUZ B;  3W98 D;  4XZQ A;  5DNM C;  5DNN D;  5CPJ A;  2FFF B;  4J8U C;  5E5A B;  1P3L C;  4X23 C;  3AFA B;  3AZE B;  2F8N H;  3KWQ C;  5GT0 C;  5B33 B;  3AV2 D;  2JCH A;  1M1A C;  5BT1 D;  3WTP E;  2IO5 B;  5AV8 C;  3AN2 D;  4G92 B;  4ZUX B;  3X1V B;  3AV2 C;  1BH8 B;  5B2J C;  1WWI A;  1AOI A;  2CWE A;  3MGP B;  3X1T D;  4JJN A;  3MVD D;  2Y2L A;  5BNX B;  4WU9 A;  1F66 A;  4Z66 B;  3C1B A;  1EQZ C;  3AZJ D;  3NQU B;  1ID3 C;  5E5A A;  3X1S D;  3AFA A;  3AZF C;  1KX4 C;  3AZE A;  1PZR A;  5B32 G;  2NQB D;  5B33 A;  1P3F B;  4R8P B;  5GXQ B;  3LEL C;  1S32 C;  5B31 B;  5DNN B;  5AV9 C;  1P34 C;  1P3I C;  1KX3 D;  4ZUX A;  3X1V A;  3X1U D;  3WA9 C;  4KGC B;  1BH8 A;  4WNN B;  2ZM5 A;  4Z5T D;  3MGP A;  3AZM C;  5GT3 B;  4Z66 A;  1HQ3 A;  1P3O D;  3NQU A;  4H9S A;  3WKJ C;  3W96 D;  3AZF D;  3KUY C;  4EO5 C;  3X1T B;  2ZY5 A;  3MVD B;  4J8V D;  3A6N C;  5CPK D;  4R8P A;  5GXQ A;  4DRA A;  1P3F A;  3AV1 B;  3B6F D;  5DNM B;  5B24 D;  1P3G D;  1P34 D;  4J8U B;  1P3L B;  5B31 A;  1P3A C;  3REH D;  4X23 B;  1F1E A;  5BO0 A;  3KWQ B;  4KGC A;  4WNN A;  5GT0 B;  1M1A B;  1P3M C;  4QLC C;  3F6T A;  5AV8 B;  5GT3 A;  5GSU C;  3A1I A;  3KSY A;  5B2J B;  5JRG C;  3EG5 B;  4Z5T B;  5CPI A;  1ULY A;  3X1T A;  3AZL D;  4E44 A;  3MVD A;  1EQZ B;  3AV1 A;  5DNM A;  4XZQ D;  1ID3 B;  5G49 A;  5CPJ D;  4J8U A;  1P3L A;  1HTA A;  4X23 A;  3AZF B;  3MGQ C;  1KX4 B;  4KUD C;  3KWQ A;  2G5H C;  5GT0 A;  1M1A A;  5BNV B;  5B32 C;  3LEL B;  4G91 C;  4AWL C;  3B6F B;  5AV8 A;  5AV9 B;  3B0B A;  1P34 B;  1P3I B;  3WA9 B;  3REI C;  5B2J A;  5AV5 C;  1AOI D;  3AZM B;  2RIQ A;  1F66 D;  2BG1 A;  4WU9 D;  1EQZ A;  3C1B D;  2F8N G;  5B1M C;  1ID3 A;  5CHL B;  5E5A D;  3KUY B;  4EO5 B;  3AFA D;  1KX4 A;  3AZE D;  4H9O B;  2JE5 A;  4Z2M H;  5BNV A;  3LEL A;  2FJ7 C;  1S32 A;  3W97 A;  1TZY C;  5AV9 A;  1P3A B;  1P34 A;  1P3I A;  1U35 C;  3AYW C;  4ZUX D;  3X1V D;  3WA9 A;  1B6W A;  1P3M B;  3MGP D;  3AZM A;  5AV6 C;  4QLC B;  2RVQ C;  5GSU B;  4Z66 D;  1HQ3 D;  4XUJ C;  5C3I C;  3WAA C;  3REK C;  2Y2N A;  5B1L C;  3UTB C;  5JRG B;  3WKJ A;  2NZD C;  3KUY A;  3REL C;  4H9O A;  3C1C C;  3A6N A;  1P3F D;  4R8P D;  5GXQ D;  5B31 D;  1P3A A;  5B40 C;  4YM6 C;  2PYO C;  3MGQ B;  2CV5 C;  4KUD B;  4KGC D;  4H9P B;  1KX5 C;  5B32 B;  1P3M A;  4AWL B;  4QLC A;  5AVC C;  5GT3 D;  5GSU A;  3REJ C;  3MGS C; 
#chains in the Genus database with same CATH homology
 2Y2G A;  5AV5 B;  3TU4 C;  5JRG A;  5KDM B;  3MNN C;  2Y2P A;  5CPI D;  5B1M B;  2ARO C;  2F2A C;  3AV1 D;  3A1K A;  5DNM D;  1HQ3 B;  4J8U D;  1P3L D;  4M6B A;  2LY8 A;  5B0Y C;  4X23 D;  3MGQ A;  2Y2J A;  4KUD A;  3KWQ D;  4NE3 A;  4H9P A;  5GT0 D;  5B32 A;  1M1A D;  2FJ7 B;  4NFT A;  1TZY B;  5AV8 D;  3MGS D;  3W97 C;  2Y2K A;  1U35 B;  3REI A;  5BO0 B;  5B2J D;  5AV5 A;  5KDM A;  5AV6 B;  3LZ1 C;  4DQY B;  1EQZ D;  5B1M A;  4YS3 C;  4XUJ B;  3B0D C;  5C3I B;  3R45 B;  3REK B;  5B1L B;  3UTB B;  2Y2I A;  1ID3 D;  4KHA B;  3WAA B;  1BFM A;  3REI B;  2NZD B;  3REL B;  1KX4 D;  5CP6 C;  5CPI B;  3C1C B;  1P3P C;  3WTP C;  3LJA C;  3LEL D;  2FJ7 A;  1S32 D;  3EPL A;  3LZ0 C;  3W97 D;  2W8S A;  1TZY A;  2YFW B;  5AV9 D;  5B40 B;  3UT9 C;  4YM6 B;  1Z2C B;  5G49 B;  1U35 A;  3AYW A;  2CV5 B;  1P3I D;  2PYO B;  3WA9 D;  1KX5 B;  4H9R B;  5AV6 A;  3AZM D;  5AVB C;  5AVC B;  5BS7 C;  3REJ B;  4CSR B;  4XUJ A;  3MGS B;  4Z2M G;  3R45 A;  3REK A;  5B1L A;  3UTB A;  3TU4 B;  3AZH C;  4KHA A;  3WKJ D;  3WAA A;  2NZD A;  3MNN B;  3KUY D;  3REL A;  3C1C A;  3A6N D;  2ARO B;  2F8N B;  5B0Z C;  3AZN C;  2YFW A;  1P3A D;  5B40 A;  1ZLA C;  5B31 G;  5B0Y B;  4YM6 A;  2CV5 A;  2PYO A;  2HIO C;  1KX5 A;  1P3M D;  4H9Q B;  4H9R A;  1P3B C;  4J8X A;  4QLC D;  1S32 B;  5AVC A;  3V9R A;  3UTA C;  4ZBJ C;  5GSU D;  3W97 B;  4J8W C;  3REJ A;  4CSR A;  3AZK C;  3MGS A;  3TU4 A;  2Y2M A;  5JRG D;  3VH6 A;  1A7W A;  3KFU G;  3MNN A;  4WZS B;  3LZ1 B;  2G5I C;  4YS3 B;  2ARO A;  3B0D B;  3EPK A;  3H0R C;  2F8N A;  3AL0 C;  4WV4 B;  3WKJ B;  5B0Y A;  3MGQ D;  4KUD D;  5CP6 B;  5F99 C;  1P3P B;  4WU8 C;  3WTP B;  3LJA B;  2L5A A;  3IP4 C;  4H9Q A;  5B32 D;  3A6N B;  3B6G C;  5AY8 C;  3LZ0 B;  1M19 C;  4LD9 C;  4WJ3 C;  3EPJ A;  1JFI A;  3UT9 B;  3REI D;  3AZG C;  3KXB C;  5AV5 D;  1P3K C;  5AVB B;  3LZ1 A;  2Y2H A;  1TAF B;  4CAY B;  3AZI C;  4YS3 A;  5B1M D;  3W99 C;  3FDD A;  2BYK B;  5CP6 A;  1P3P A;  3WTP A;  3LJA A;  2FJ7 D;  1M19 D;  3O62 C;  5B0Z B;  3AZN B;  1T3U A;  3LZ0 A;  1TZY D;  3UT9 A;  1ZLA B;  4E45 A;  1M18 C;  3MGR C;  3AYW D;  1U35 D;  3W98 C;  2HIO B;  3VH5 A;  5DNN C;  4UPK A;  2HUE C;  1P3B B;  5AV6 D;  3EPH A;  5AVB A;  2DF4 C;  4G91 B;  4J8X C;  2RVQ D;  2DQN C;  1TAF A;  3W99 D;  4CAY A;  4DRB A;  5BS7 A;  5BT1 C;  3UTA B;  4XUJ D;  3AZK B;  3REK D;  3UTB D;  5B1L D;  3WAA D;  3AZH A;  3AN2 C;  2NZD D;  3REL D;  2BYK A;  3C1C D;  5B0Z A;  3AZN A;  3MGR D;  5B40 D;  1ZLA A;  4YM6 D;  3AZJ C;  2PYO D;  2CV5 D;  5F99 B;  2BYM A;  2HIO A;  4WU8 B;  1KX5 D;  3X1S C;  1R4V A;  1P3B A;  3B6G B;  5AY8 B;  4J8X D;  4LD9 B;  1M19 B;  5AVC D;  2NQB C;  3UTA A;  1N1J B;  4J8W A;  3REJ D;  3AZK A;  3AZG B;  3KXB B;  3AYW B;  5JA4 B;  3TU4 D;  3MNN D;  1KX3 C;  3X1U C;  1P3K B;  3AZI B;  4Z5T C;  2ARO D;  2ZY2 A;  3W99 B;  2F8N D;  2F8N K;  2XD5 A;  4UUZ A;  5B0Y D;  1P3O C;  2Y2O A;  5F99 A;  3W96 C;  4WU8 A;  4NE6 A;  3O62 B;  3B6G A;  5AY8 A;  4LD9 A;  1M19 A;  1KU5 A;  3VH6 W;  4J8V C;  2VQR A;  5CPK C;  1N1J A;  3MGR B;  1M18 B;  3B6F C;  3W98 B;  3AZG A;  5B24 C;  1P3G C;  3KXB A;  2HUE B;  5JA4 A;  3REH C;  1P3K A;  3LZ1 D;  4J8X B;  3AV2 B;  3AZI A;  3V9R B;  4YS3 D;  4HGA C;  3W99 A;  5B2I C;  5BNX A;  2UWX A;  3AN2 B;  5CP6 D;  3NQJ B;  1P3P D;  3WTP D;  3LJA D;  3O62 A;  3LZ0 D;  3AZL C;  3UT9 D;  3AZJ B;  1M18 A;  3MGR A;  3W98 A;  4XZQ C;  5DNN A;  5CPJ C;  1BH9 B;  3X1S B;  1H3O B;  3VH6 T;  2Y2Q A;  5AVB D;  2NQB B;  3AV2 A;  5B2I D;  4H9N B;  1JFI B;  3AZH D;  3AN2 A;  1KX3 B;  3X1U B;  2JSS A;  5FUG B;  2YFV B;  2J8P A;  3NQJ A;  1AOI C;  4JJN C;  1Q9C A;  3VH5 W;  5B0Z D;  3AZN D;  1F66 C;  4WU9 C;  3C1B C;  1ZLA D;  3AZJ A;  1P3O B;  2HIO D;  3W96 B;  3P5J B;  1BH9 A;  5E5A C;  3X1S A;  3AFA C;  1H3O A;  1P3B D;  3AZE C;  4J8V B;  2NQB A;  3UTA D;  5B33 C;  5CPK B;  4H9N A;  4J8W D;  3AZK D;  1P3G B;  5B24 B;  2ZY4 A;  2ZY3 A;  2IO5 C;  3B0C W;  4G92 C;  3REH B;  1KX3 A;  4ZUX C;  3X1U A;  3X1V C;  5FUG A;  2YFV A;  4JJN D;  4Z5T A;  3MGP C;  4HGA B;  5B2I B;  1W2E A;  4Z66 C;  3AZH B;  1HQ3 C;  1P3O A;  5F99 D;  4H9S C;  3W96 A;  3VH5 T;  3AZF A;  4WU8 D;  3B6G D;  5AY8 D;  3AZL B;  5B33 D;  1B67 A;  4LD9 D;  4J8V A;  3H0L C;  5CPK A;  1P3F C;  4R8P C;  5GXQ C;  3B6F A;  2XD1 A;  4XZQ B;  5B24 A;  3AZG D;  1P3G A;  3KXB D;  5CPJ B;  2BYM B;  5B31 C;  3REH A;  3H0M C;  1P3K D;  4KGC C;  3AZI D;  4ZBJ B;  5B2I A;  4J8W B;  3B0C T;  4NE5 A;  5GT3 C;  1AOI B;  1WWS A;  4JJN B;  3O62 D;  5CPI C;  3X1T C;  3AZL A;  1F66 B;  3MVD C;  4WU9 B;  3C1B B;  1M18 D;  3AV1 C;  4UUZ B;  3W98 D;  4XZQ A;  5DNM C;  5DNN D;  5CPJ A;  2FFF B;  4J8U C;  5E5A B;  1P3L C;  4X23 C;  3AFA B;  3AZE B;  2F8N H;  3KWQ C;  5GT0 C;  5B33 B;  3AV2 D;  2JCH A;  1M1A C;  5BT1 D;  3WTP E;  2IO5 B;  5AV8 C;  3AN2 D;  4G92 B;  4ZUX B;  3X1V B;  3AV2 C;  1BH8 B;  5B2J C;  1WWI A;  1AOI A;  2CWE A;  3MGP B;  3X1T D;  4JJN A;  3MVD D;  2Y2L A;  5BNX B;  4WU9 A;  1F66 A;  4Z66 B;  3C1B A;  1EQZ C;  3AZJ D;  3NQU B;  1ID3 C;  5E5A A;  3X1S D;  3AFA A;  3AZF C;  1KX4 C;  3AZE A;  1PZR A;  5B32 G;  2NQB D;  5B33 A;  1P3F B;  4R8P B;  5GXQ B;  3LEL C;  1S32 C;  5B31 B;  5DNN B;  5AV9 C;  1P34 C;  1P3I C;  1KX3 D;  4ZUX A;  3X1V A;  3X1U D;  3WA9 C;  4KGC B;  1BH8 A;  4WNN B;  2ZM5 A;  4Z5T D;  3MGP A;  3AZM C;  5GT3 B;  4Z66 A;  1HQ3 A;  1P3O D;  3NQU A;  4H9S A;  3WKJ C;  3W96 D;  3AZF D;  3KUY C;  4EO5 C;  3X1T B;  2ZY5 A;  3MVD B;  4J8V D;  3A6N C;  5CPK D;  4R8P A;  5GXQ A;  4DRA A;  1P3F A;  3AV1 B;  3B6F D;  5DNM B;  5B24 D;  1P3G D;  1P34 D;  4J8U B;  1P3L B;  5B31 A;  1P3A C;  3REH D;  4X23 B;  1F1E A;  5BO0 A;  3KWQ B;  4KGC A;  4WNN A;  5GT0 B;  1M1A B;  1P3M C;  4QLC C;  3F6T A;  5AV8 B;  5GT3 A;  5GSU C;  3A1I A;  3KSY A;  5B2J B;  5JRG C;  3EG5 B;  4Z5T B;  5CPI A;  1ULY A;  3X1T A;  3AZL D;  4E44 A;  3MVD A;  1EQZ B;  3AV1 A;  5DNM A;  4XZQ D;  1ID3 B;  5G49 A;  5CPJ D;  4J8U A;  1P3L A;  1HTA A;  4X23 A;  3AZF B;  3MGQ C;  1KX4 B;  4KUD C;  3KWQ A;  2G5H C;  5GT0 A;  1M1A A;  5BNV B;  5B32 C;  3LEL B;  4G91 C;  4AWL C;  3B6F B;  5AV8 A;  5AV9 B;  3B0B A;  1P34 B;  1P3I B;  3WA9 B;  3REI C;  5B2J A;  5AV5 C;  1AOI D;  3AZM B;  2RIQ A;  1F66 D;  2BG1 A;  4WU9 D;  1EQZ A;  3C1B D;  2F8N G;  5B1M C;  1ID3 A;  5CHL B;  5E5A D;  3KUY B;  4EO5 B;  3AFA D;  1KX4 A;  3AZE D;  4H9O B;  2JE5 A;  4Z2M H;  5BNV A;  3LEL A;  2FJ7 C;  1S32 A;  3W97 A;  1TZY C;  5AV9 A;  1P3A B;  1P34 A;  1P3I A;  1U35 C;  3AYW C;  4ZUX D;  3X1V D;  3WA9 A;  1B6W A;  1P3M B;  3MGP D;  3AZM A;  5AV6 C;  4QLC B;  2RVQ C;  5GSU B;  4Z66 D;  1HQ3 D;  4XUJ C;  5C3I C;  3WAA C;  3REK C;  2Y2N A;  5B1L C;  3UTB C;  5JRG B;  3WKJ A;  2NZD C;  3KUY A;  3REL C;  4H9O A;  3C1C C;  3A6N A;  1P3F D;  4R8P D;  5GXQ D;  5B31 D;  1P3A A;  5B40 C;  4YM6 C;  2PYO C;  3MGQ B;  2CV5 C;  4KUD B;  4KGC D;  4H9P B;  1KX5 C;  5B32 B;  1P3M A;  4AWL B;  4QLC A;  5AVC C;  5GT3 D;  5GSU A;  3REJ C;  3MGS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...