3AV1D

The human nucleosome structure containing the histone variant h3.2
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
b'SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structures of human nucleosomes containing major histone H3 variants
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 34
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3av1D00
1WWSA 2NZDB 5GSUC 5AV6D 1KX3B 5E5AD 3AZKD 3AZND 3AFAA 3AZGC 3UT9B 5DNMB 1P3GA 1S32C 2NZDC 5B31D 4Z5TA 1KX3C 1HQ3A 4H9OB 3AYWA 2CV5B 3REKA 1ID3B 5F99C 5BS7C 3UT9C 2AROC 3TU4D 5DNMC 3R45A 3AZHB 5CP6B 3V9RA 3MGQA 1ULYA 3LZ1B 3AZED 1P3KD 3AV1C 2YFVB 3KWQB 3LELB 1JFIB 4KGCC 3LZ0B 3MGSB 4JJNC 3AZHC 4NE5A 3C1BB 4UUZA 5AY8A 1AOIC 4Z2MH 5B24B 3LELC 4XUJC 5AV9A 5GXQA 5GT0A 4YS3D 3MGSC 3WA9D 5CPJD 5DNNB 3AZIB 3LJAB 3MGRC 4ZUXD 3AV2D 3WAAB 4J8WA 3AN2C 1P3LA 3UTBD 5JRGD 3A6NA 3C1CA 5B2IC 3MNNC 4H9NB 3REJC 4J8UD 3LJAC 5CPKD 5AV5B 5BO0A 3NQJB 4WU9C 1BFMA 5BT1D 5GT3D 5B0YA 3REHC 4G91C 1M19D 5B1LD 3UTAD 1B6WA 5B2JB 4R8PD 1M1AB 4WU8A 3AZFC 3RELD 1P3PD 1P3FA 5AV6B 5E5AB 5B32A 3AZKB 2HIOD 3B0DB 1M1AC 5B1MA 3X1UA 4QLCB 5B31G 5CHLB 1ZLAD 1KX4D 1TZYD 4X23A 4WNNA 5B31B 5E5AC 3W99A 3B0DC 3AZNC 3TU4B 4G92C 5B33A 3X1SD 5AVBD 3KUYA 3AZEB 1S32D 1P3KB 5B0ZA 4WZSB 3TU4C 4KUDA 4CAYA 4H9SA 2FJ7A 1M18D 1F1EA 2AROD 1U35D 4ZBJB 3WTPC 2NQBD 3AV1D 4YS3B 4J8XA 4XZQA 5CPJB 1P3IC 1F66A 4KGCD 4JJND 4J8VA 3X1TA 2L5AA 4ZUXB 2PYOA 5CPIC 1KX5A 3O62A 5JRGB 4Z5TD 1EQZC 3WA9C 3W96C 4J8UB 3AYWD 1BH9B 5CPKB 4H9RB 3AV2C 4AWLC 4H9PA 5AVCA 2HUEB 3UTBC 5GT3B 4EO5C 3AN2D 1M19B 2BYKA 4LD9A 3MNND 5B1LB 3REJD 4R8PB 3UTAB 3AZMA 1P3PB 3RELB 5BT1C 5G49A 5AY8D 4WU9D 1M19C 2HIOB 3AZJA 3REHD 5GXQD 1P3MA 5AV8C 1ZLAB 1P3PC 3RELC 3B0BA 1KX4B 1TZYB 1Q9CA 1P3OA 4Z66A 3REIC 3AZFD 2HIOC 5GSUB 3C1CD 3AZLA 1KX4C 3X1SB 3KSYA 5AVBB 3AZGB 1R4VA 3B6GA 1P3AA 1S32B 2YFWA 5FUGA 1WWIA 3X1SC 5AVBC 5F99B 1M18B 1U35B 2AROB 1P34A 5BNXA 4WU8D 2F8NK 2NQBB 3AV1B 1H3OB 1M18C 1U35C 4KGCB 3VH5A 5B1MD 4JJNB 2NQBC 4X23D 3KXBA 1AOIB 3WTPD 4Z5TB 4XUJB 2CV5A 3AYWB 1ID3A 3AFAC 3MGPA 3WKJA 1P3ID 5CP6A 3KUYD 1P3GC 3MGRB 3LZ1A 4Z5TC 5CPID 1HQ3C 2YFVA 4YM6A 5B0ZD 3KWQA 3REKC 3AYWC 3AN2B 1EQZD 5B2IB 3MNNB 3W96D 3REJB 3LZ0A 4KUDD 3MGSA 3C1BA 1HTAA 4E44A 3MGQC 2FJ7D 4UUZB 5AY8B 5B24A 5B40A 4WU9B 5KDMB 3REHB 5GXQB 4G91B 2F8ND 5JA4B 4J8XD 5DNNA 3AZIA 5AY8C 3VH6A 4J8VD 3AZFB 4NE6A 3WAAA 2PYOD 5AV9C 5GXQC 5GT0C 3O62D 3C1CB 2CWEA 5AV8D 5AV5A 3NQJA 4J8WC 3REID 1P3LC 3A6NC 3C1CC 2BYMA 2IO5C 3AZNB 4G92B 4HGAC 5B2JA 3AZMD 4WU8B 5AV6A 5B0YC 5E5AA 3AZKA 4CSRA 4QLCA 1P3MD 5B1MB 4WU8C 3X1VA 5B31A 4X23B 1A7WA 4WNNB 3WTPB 5B32C 5B1MC 3X1UC 1P3IB 3KUYB 4X23C 3AZEA 1P3KA 5CPIB 3W99C 3W97A 1EQZB 1P3BA 3WA9B 3W96B 5BNVB 5B33C 4KUDB 3KUYC 3AFAD 1P34D 1P3GD 3AV2B 4AWLB 2F8NG 3B6FA 5B0ZC 3UTBB 4WV4B 4EO5B 1HQ3D 4YS3A 4KUDC 2F8NB 3REKD 4H9SC 1N1JB 4NFTA 5CPJA 4J8XB 2FJ7C 1TAFB 3W98A 3NQUB 3MGQD 4ZUXA 4J8VB 3KXBD 3MVDA 5JRGA 3O62B 4J8XC 4J8UA 4XZQC 5AV8B 1F66C 5CPKA 4H9RA 3MGPD 4J8VC 3X1TC 3WKJD 2PYOC 4H9PB 3REIB 1KX5C 1BH8B 5GT3A 3O62C 5AV9D 3B0CW 4YM6D 5GT0D 5B1LA 4DRBA 4R8PA 3UTAA 3AZMB 3VH5W 5AVCC 4J8WD 4H9QB 5B40D 1P3LD 3A6ND 4LD9C 3AZMC 1P3MB 1ZLAA 1TZYA 1KU5A 5GSUA 5B0YD 3AZJC 1P3MC 4KHAB 3AZGA 1P3OC 4Z66C 1S32A 1P3FD 2NZDA 5FUGB 5C3IC 1KX3A 5B32D 5F99A 3X1UD 5BS7A 3AFAB 2AROA 3UT9A 5DNMA 3B6GC 1P3GB 1P3AC 4E45A 3VH6W 2NQBA 4H9OA 3AV1A 1HQ3B 3W99D 3REKB 1H3OA 4KGCA 1P34C 5B33D 4JJNA 4QLCD 3AZHA 3R45B 3V9RB 3MGQB 3X1VD 1AOIA 3KXBB 3LELA 4XUJA 1JFIA 3MGPB 3WKJB 4DRAA 3KXBC 3MGRA 2LY8A 3B0CT 5AV9B 3AN2A 1TZYC 2CV5C 5GT0B 4YM6B 1ID3C 5B2IA 3MNNA 3W97D 3REJA 1P3BD 3MGPC 3VH5T 4XZQD 3WKJC 1F66D 5CP6C 3LJAA 3X1TD 3LZ1C 2F8NH 4J8WB 4WU9A 1KX5D 5B40B 4YM6C 3KWQC 5KDMA 1P3LB 3B6FD 3A6NB 4H9NA 3REHA 3LZ0C 2IO5B 1M1AD 5JA4A 3C1BC 4HGAB 2RVQC 5BO0B 3AZFA 3W98D 5B24C 5AVCD 5B40C 5B0YB 3MVDD 4LD9D 1M1AA 5DNNC 3AZIC 1P3FB 5B32G 3WAAC 5B32B 3AZNA 2BYMB 3AZJD 3X1UB 2JSSA 1P3FC 5AV5C 3VH6T 1P3OD 4Z66D 3W99B 3TU4A 5B2JC 5B33B 3AZLD 1B67A 4CSRB 4M6BA 3B6GD 3X1VB 1P3AD 3WTPA 5AV6C 5B0ZB 3AZKC 5GSUD 4QLCC 4CAYB 2FJ7B 1P3IA 3X1VC 3AZGD 5B31C 4Z2MG 5CPIA 2NZDD 1EQZA 3WA9A 1KX3D 3W96A 3W97B 1P3BB 5BNVA 4XZQB 1F66B 5F99D 3UT9D 5DNMD 3X1TB 3AV2A 3WTPE 3AZEC 1P3KC 2PYOB 1KX5B 3UTBA 3B6FB 3W97C 1P3BC 2CV5D 2F8NA 1BH9A 1N1JA 1ID3D 1TAFA 3AZHD 4ZBJC 5CP6D 3NQUA 3W98B 5AVCB 3B6FC 3LZ1D 1AOID 4YS3C 1M19A 3MVDB 3KWQD 4XUJD 3LELD 2BYKB 4LD9B 5CPJC 5AV8A 4NE3A 3LZ0D 3MGSD 1P3PA 3RELA 3W98C 3C1BD 4ZUXC 2RVQD 3REIA 5G49B 5B24D 3MGRD 1BH8A 3MVDC 5JRGC 2HIOA 3AZJB 4J8UC 5B2ID 5CPKC 1KX4A 5DNND 3AZID 3LJAD 1P3OB 2HUEC 4Z66B 5GT3C 3WAAD 4H9QA 5C3IB 5B1LC 3X1SA 4R8PC 5AVBA 3UTAC 3AZLB 3B6GB 5AV5D 1P3AB 2YFWB 3AZLC 4KHAA 1M18A 1U35A 1ZLAC 1P34B 5B2JD 5BNXB
chains in the Genus database with same CATH superfamily
1WWSA 2NZDB 5GSUC 5AV6D 1KX3B 5E5AD 3AZKD 3AZND 3AFAA 3AZGC 3H0LC 3UT9B 5DNMB 1P3GA 1S32C 2ZY4A 2NZDC 5B31D 4Z5TA 1KX3C 1HQ3A 4H9OB 3AYWA 2CV5B 3REKA 1ID3B 5F99C 5BS7C 3UT9C 2AROC 3TU4D 5DNMC 3R45A 3AZHB 5CP6B 3V9RA 3MGQA 1ULYA 3LZ1B 3AZED 1P3KD 3AV1C 2YFVB 3KWQB 3LELB 4WJ3C 1JFIB 4KGCC 3LZ0B 3MGSB 4JJNC 3AZHC 4NE5A 3C1BB 4UUZA 5AY8A 1AOIC 4Z2MH 2ZY2A 5B24B 3LELC 4XUJC 5AV9A 5GXQA 5GT0A 4YS3D 3MGSC 3WA9D 5CPJD 5DNNB 3AZIB 3LJAB 3MGRC 4ZUXD 3AV2D 3WAAB 4J8WA 3AN2C 1P3LA 3UTBD 5JRGD 3A6NA 3C1CA 5B2IC 3MNNC 4H9NB 3REJC 1T3UA 4J8UD 3KFUG 3LJAC 5CPKD 5AV5B 5BO0A 3NQJB 4WU9C 1BFMA 5BT1D 5GT3D 5B0YA 2FFFB 3REHC 4G91C 1M19D 5B1LD 3UTAD 1B6WA 5B2JB 4R8PD 1M1AB 4WU8A 3AZFC 3RELD 1P3PD 1P3FA 5AV6B 5E5AB 5B32A 3AZKB 2HIOD 3B0DB 1M1AC 5B1MA 3X1UA 4QLCB 5B31G 5CHLB 1ZLAD 1KX4D 1TZYD 4X23A 4WNNA 5B31B 5E5AC 3W99A 3B0DC 3AZNC 2Y2IA 3TU4B 4G92C 5B33A 3H0MC 5AVBD 3X1SD 3KUYA 3AZEB 1S32D 1P3KB 5B0ZA 4WZSB 3TU4C 2Y2NA 4KUDA 1Z2CB 4CAYA 4H9SA 2FJ7A 1M18D 1F1EA 2AROD 1U35D 4ZBJB 3WTPC 2NQBD 3AV1D 4YS3B 4J8XA 2Y2HA 3F6TA 4XZQA 5CPJB 1P3IC 1F66A 4KGCD 4JJND 4J8VA 3X1TA 4UPKA 2L5AA 4ZUXB 2PYOA 5CPIC 1KX5A 3O62A 5JRGB 4Z5TD 1EQZC 3WA9C 3W96C 4J8UB 3AYWD 1BH9B 5CPKB 4H9RB 3AV2C 4AWLC 4H9PA 5AVCA 2HUEB 3UTBC 5GT3B 4EO5C 3AN2D 1M19B 2BYKA 4LD9A 3MNND 5B1LB 3REJD 4R8PB 3UTAB 3AZMA 1W2EA 1P3PB 3RELB 5BT1C 5G49A 5AY8D 4WU9D 1M19C 2HIOB 3AZJA 3REHD 5GXQD 1P3MA 5AV8C 1ZLAB 1P3PC 3RELC 3B0BA 1KX4B 1TZYB 1Q9CA 1P3OA 4Z66A 3REIC 3AZFD 2HIOC 2XD1A 5GSUB 3C1CD 3AZLA 1KX4C 3X1SB 3KSYA 5AVBB 3AZGB 1R4VA 3B6GA 4DQYB 1P3AA 1S32B 2J8PA 2YFWA 5FUGA 1WWIA 3X1SC 5AVBC 5F99B 1M18B 1U35B 2AROB 1P34A 5BNXA 4WU8D 2F8NK 2NQBB 3AV1B 1H3OB 1M18C 1U35C 4KGCB 3VH5A 5B1MD 4JJNB 2NQBC 4X23D 3KXBA 1AOIB 3WTPD 4Z5TB 4XUJB 2ZM5A 2CV5A 3AYWB 1ID3A 3AFAC 3MGPA 3WKJA 1P3ID 5CP6A 3KUYD 1P3GC 3MGRB 3LZ1A 4Z5TC 5CPID 1HQ3C 2YFVA 4YM6A 5B0ZD 3KWQA 3REKC 3AYWC 3AN2B 1EQZD 5B2IB 3MNNB 3W96D 3REJB 3LZ0A 4KUDD 3MGSA 3C1BA 1HTAA 4E44A 3MGQC 2FJ7D 4UUZB 5AY8B 5B24A 5B40A 4WU9B 5KDMB 3REHB 5GXQB 4G91B 2F8ND 3EPHA 5JA4B 4J8XD 5DNNA 3AZIA 5AY8C 3VH6A 4J8VD 3AZFB 3H0RC 4NE6A 3WAAA 2PYOD 5AV9C 5GXQC 3FDDA 5GT0C 3O62D 3C1CB 2CWEA 5AV8D 5AV5A 3NQJA 4J8WC 3REID 1P3LC 3A6NC 3C1CC 2BYMA 2IO5C 3AZNB 4G92B 4HGAC 5B2JA 3AZMD 4WU8B 5AV6A 5B0YC 5E5AA 3AZKA 4CSRA 4QLCA 1P3MD 5B1MB 4WU8C 3X1VA 5B31A 4X23B 1A7WA 4WNNB 3WTPB 5B32C 5B1MC 3X1UC 1P3IB 3KUYB 4X23C 3AZEA 1P3KA 5CPIB 3W99C 3W97A 1EQZB 1P3BA 3WA9B 3W96B 5BNVB 5B33C 4KUDB 3KUYC 3AFAD 1P34D 1P3GD 3AV2B 4AWLB 2F8NG 3B6FA 5B0ZC 3UTBB 4WV4B 2DQNC 4EO5B 1HQ3D 4YS3A 4KUDC 2F8NB 3REKD 1N1JB 4H9SC 4NFTA 5CPJA 4J8XB 2FJ7C 1TAFB 2F2AC 3W98A 3NQUB 3MGQD 4ZUXA 4J8VB 3KXBD 2Y2PA 3MVDA 5JRGA 3O62B 4J8XC 4J8UA 4XZQC 5AV8B 1F66C 5CPKA 4H9RA 3MGPD 4J8VC 3X1TC 3WKJD 2PYOC 4H9PB 3REIB 1KX5C 1BH8B 5GT3A 3O62C 5AV9D 2Y2JA 3B0CW 4YM6D 5GT0D 5B1LA 4DRBA 4R8PA 3UTAA 2DF4C 3AZMB 3VH5W 5AVCC 4J8WD 4H9QB 3A1IA 5B40D 1P3LD 3A6ND 4LD9C 3AZMC 1P3MB 1ZLAA 2BG1A 3EG5B 1TZYA 2ZY5A 1KU5A 5GSUA 5B0YD 3AZJC 1P3MC 4KHAB 3AZGA 2Y2LA 1P3OC 2UWXA 4Z66C 2ZY3A 1S32A 1P3FD 2NZDA 5FUGB 5C3IC 1KX3A 5B32D 5F99A 3X1UD 5BS7A 3AFAB 2AROA 3UT9A 5DNMA 3B6GC 1P3GB 1P3AC 4E45A 3VH6W 2NQBA 4H9OA 3AV1A 1HQ3B 3W99D 3REKB 1H3OA 3A1KA 4KGCA 1P34C 5B33D 4JJNA 2Y2OA 2Y2GA 3R45B 4QLCD 3EPJA 3AZHA 3V9RB 3MGQB 3X1VD 1AOIA 3KXBB 3LELA 4XUJA 1JFIA 2G5HC 3MGPB 3WKJB 4DRAA 3KXBC 3MGRA 2JCHA 2LY8A 3B0CT 3AL0C 5AV9B 3AN2A 1TZYC 2CV5C 5GT0B 4YM6B 1ID3C 5B2IA 3MNNA 3W97D 3REJA 1P3BD 3MGPC 3VH5T 4XZQD 3WKJC 2Y2KA 1F66D 5CP6C 2RIQA 3LJAA 3X1TD 3LZ1C 2F8NH 4J8WB 4WU9A 1KX5D 5B40B 2JE5A 4YM6C 2Y2QA 5KDMA 3KWQC 3A6NB 4H9NA 3REHA 1P3LB 3B6FD 3LZ0C 2IO5B 1M1AD 5JA4A 3C1BC 4HGAB 2RVQC 5BO0B 3AZFA 3W98D 5B24C 5AVCD 5B40C 5B0YB 3MVDD 4LD9D 1M1AA 5DNNC 3AZIC 1P3FB 5B32G 3WAAC 3IP4C 5B32B 3AZNA 2BYMB 3AZJD 3X1UB 2JSSA 1P3FC 5AV5C 3VH6T 1P3OD 4Z66D 3EPLA 3W99B 3TU4A 5B2JC 5B33B 3AZLD 1B67A 4CSRB 4M6BA 3P5JB 3B6GD 3X1VB 1P3AD 3WTPA 5AV6C 5B0ZB 3AZKC 5GSUD 4QLCC 4CAYB 2FJ7B 1P3IA 3X1VC 3AZGD 5B31C 4Z2MG 5CPIA 2NZDD 1EQZA 3WA9A 1KX3D 3W96A 3W97B 1P3BB 5BNVA 4XZQB 1F66B 5F99D 3UT9D 5DNMD 3X1TB 3AV2A 3WTPE 3AZEC 1P3KC 2PYOB 1KX5B 2W8SA 3UTBA 3B6FB 3W97C 1P3BC 2CV5D 2F8NA 2G5IC 1BH9A 1N1JA 2VQRA 1ID3D 1TAFA 3AZHD 4ZBJC 5CP6D 3NQUA 3W98B 2Y2MA 5AVCB 3B6FC 3LZ1D 1AOID 4YS3C 1M19A 3MVDB 3KWQD 4XUJD 3LELD 2BYKB 4LD9B 5CPJC 5AV8A 4NE3A 3LZ0D 3MGSD 1P3PA 3RELA 3W98C 3C1BD 1PZRA 4ZUXC 2RVQD 3REIA 5G49B 5B24D 3MGRD 1BH8A 3MVDC 5JRGC 2HIOA 3AZJB 4J8UC 5B2ID 5CPKC 1KX4A 5DNND 3AZID 2XD5A 3LJAD 1P3OB 2HUEC 4Z66B 3EPKA 5GT3C 3WAAD 4H9QA 5C3IB 5B1LC 3X1SA 4R8PC 5AVBA 3UTAC 3AZLB 3B6GB 5AV5D 1P3AB 2YFWB 3AZLC 4KHAA 1M18A 1U35A 1ZLAC 1P34B 5B2JD 5BNXB
chains in the Genus database with same CATH topology
1WWSA 2NZDB 5GSUC 5AV6D 1KX3B 5E5AD 3AZKD 3AZND 3AFAA 3AZGC 3H0LC 3UT9B 5DNMB 1P3GA 1S32C 2ZY4A 2NZDC 5B31D 4Z5TA 1KX3C 1HQ3A 4H9OB 3AYWA 2CV5B 3REKA 1ID3B 5F99C 5BS7C 3UT9C 2AROC 3TU4D 5DNMC 3R45A 3AZHB 5CP6B 3V9RA 3MGQA 1ULYA 3LZ1B 3AZED 1P3KD 3AV1C 2YFVB 3KWQB 3LELB 4WJ3C 1JFIB 4KGCC 3LZ0B 3MGSB 4JJNC 3AZHC 4NE5A 3C1BB 4UUZA 5AY8A 1AOIC 4Z2MH 2ZY2A 5B24B 3LELC 4XUJC 5AV9A 5GXQA 5GT0A 4YS3D 3MGSC 3WA9D 5CPJD 5DNNB 3AZIB 3LJAB 3MGRC 4ZUXD 3AV2D 3WAAB 4J8WA 3AN2C 1P3LA 3UTBD 5JRGD 3A6NA 3C1CA 5B2IC 3MNNC 4H9NB 3REJC 1T3UA 4J8UD 3KFUG 3LJAC 5CPKD 5AV5B 5BO0A 3NQJB 4WU9C 1BFMA 5BT1D 5GT3D 5B0YA 2FFFB 3REHC 4G91C 1M19D 5B1LD 3UTAD 1B6WA 5B2JB 4R8PD 1M1AB 4WU8A 3AZFC 3RELD 1P3PD 1P3FA 5AV6B 5E5AB 5B32A 3AZKB 2HIOD 3B0DB 1M1AC 5B1MA 3X1UA 4QLCB 5B31G 5CHLB 1ZLAD 1KX4D 1TZYD 4X23A 4WNNA 5B31B 5E5AC 3W99A 3B0DC 3AZNC 2Y2IA 3TU4B 4G92C 5B33A 3H0MC 5AVBD 3X1SD 3KUYA 3AZEB 1S32D 1P3KB 5B0ZA 4WZSB 3TU4C 2Y2NA 4KUDA 1Z2CB 4CAYA 4H9SA 2FJ7A 1M18D 1F1EA 2AROD 1U35D 4ZBJB 3WTPC 2NQBD 3AV1D 4YS3B 4J8XA 2Y2HA 3F6TA 4XZQA 5CPJB 1P3IC 1F66A 4KGCD 4JJND 4J8VA 3X1TA 4UPKA 2L5AA 4ZUXB 2PYOA 5CPIC 1KX5A 3O62A 5JRGB 4Z5TD 1EQZC 3WA9C 3W96C 4J8UB 3AYWD 1BH9B 5CPKB 4H9RB 3AV2C 4AWLC 4H9PA 5AVCA 2HUEB 3UTBC 5GT3B 4EO5C 3AN2D 1M19B 2BYKA 4LD9A 3MNND 5B1LB 3REJD 4R8PB 3UTAB 3AZMA 1W2EA 1P3PB 3RELB 5BT1C 5G49A 5AY8D 4WU9D 1M19C 2HIOB 3AZJA 3REHD 5GXQD 1P3MA 5AV8C 1ZLAB 1P3PC 3RELC 3B0BA 1KX4B 1TZYB 1Q9CA 1P3OA 4Z66A 3REIC 3AZFD 2HIOC 2XD1A 5GSUB 3C1CD 3AZLA 1KX4C 3X1SB 3KSYA 5AVBB 3AZGB 1R4VA 3B6GA 4DQYB 1P3AA 1S32B 2J8PA 2YFWA 5FUGA 1WWIA 3X1SC 5AVBC 5F99B 1M18B 1U35B 2AROB 1P34A 5BNXA 4WU8D 2F8NK 2NQBB 3AV1B 1H3OB 1M18C 1U35C 4KGCB 3VH5A 5B1MD 4JJNB 2NQBC 4X23D 3KXBA 1AOIB 3WTPD 4Z5TB 4XUJB 2ZM5A 2CV5A 3AYWB 1ID3A 3AFAC 3MGPA 3WKJA 1P3ID 5CP6A 3KUYD 1P3GC 3MGRB 3LZ1A 4Z5TC 5CPID 1HQ3C 2YFVA 4YM6A 5B0ZD 3KWQA 3REKC 3AYWC 3AN2B 1EQZD 5B2IB 3MNNB 3W96D 3REJB 3LZ0A 4KUDD 3MGSA 3C1BA 1HTAA 4E44A 3MGQC 2FJ7D 4UUZB 5AY8B 5B24A 5B40A 4WU9B 5KDMB 3REHB 5GXQB 4G91B 2F8ND 3EPHA 5JA4B 4J8XD 5DNNA 3AZIA 5AY8C 3VH6A 4J8VD 3AZFB 3H0RC 4NE6A 3WAAA 2PYOD 5AV9C 5GXQC 3FDDA 5GT0C 3O62D 3C1CB 2CWEA 5AV8D 5AV5A 3NQJA 4J8WC 3REID 1P3LC 3A6NC 3C1CC 2BYMA 2IO5C 3AZNB 4G92B 4HGAC 5B2JA 3AZMD 4WU8B 5AV6A 5B0YC 5E5AA 3AZKA 4CSRA 4QLCA 1P3MD 5B1MB 4WU8C 3X1VA 5B31A 4X23B 1A7WA 4WNNB 3WTPB 5B32C 5B1MC 3X1UC 1P3IB 3KUYB 4X23C 3AZEA 1P3KA 5CPIB 3W99C 3W97A 1EQZB 1P3BA 3WA9B 3W96B 5BNVB 5B33C 4KUDB 3KUYC 3AFAD 1P34D 1P3GD 3AV2B 4AWLB 2F8NG 3B6FA 5B0ZC 3UTBB 4WV4B 2DQNC 4EO5B 1HQ3D 4YS3A 4KUDC 2F8NB 3REKD 1N1JB 4H9SC 4NFTA 5CPJA 4J8XB 2FJ7C 1TAFB 2F2AC 3W98A 3NQUB 3MGQD 4ZUXA 4J8VB 3KXBD 2Y2PA 3MVDA 5JRGA 3O62B 4J8XC 4J8UA 4XZQC 5AV8B 1F66C 5CPKA 4H9RA 3MGPD 4J8VC 3X1TC 3WKJD 2PYOC 4H9PB 3REIB 1KX5C 1BH8B 5GT3A 3O62C 5AV9D 2Y2JA 3B0CW 4YM6D 5GT0D 5B1LA 4DRBA 4R8PA 3UTAA 2DF4C 3AZMB 3VH5W 5AVCC 4J8WD 4H9QB 3A1IA 5B40D 1P3LD 3A6ND 4LD9C 3AZMC 1P3MB 1ZLAA 2BG1A 3EG5B 1TZYA 2ZY5A 1KU5A 5GSUA 5B0YD 3AZJC 1P3MC 4KHAB 3AZGA 2Y2LA 1P3OC 2UWXA 4Z66C 2ZY3A 1S32A 1P3FD 2NZDA 5FUGB 5C3IC 1KX3A 5B32D 5F99A 3X1UD 5BS7A 3AFAB 2AROA 3UT9A 5DNMA 3B6GC 1P3GB 1P3AC 4E45A 3VH6W 2NQBA 4H9OA 3AV1A 1HQ3B 3W99D 3REKB 1H3OA 3A1KA 4KGCA 1P34C 5B33D 4JJNA 2Y2OA 2Y2GA 3R45B 4QLCD 3EPJA 3AZHA 3V9RB 3MGQB 3X1VD 1AOIA 3KXBB 3LELA 4XUJA 1JFIA 2G5HC 3MGPB 3WKJB 4DRAA 3KXBC 3MGRA 2JCHA 2LY8A 3B0CT 3AL0C 5AV9B 3AN2A 1TZYC 2CV5C 5GT0B 4YM6B 1ID3C 5B2IA 3MNNA 3W97D 3REJA 1P3BD 3MGPC 3VH5T 4XZQD 3WKJC 2Y2KA 1F66D 5CP6C 2RIQA 3LJAA 3X1TD 3LZ1C 2F8NH 4J8WB 4WU9A 1KX5D 5B40B 2JE5A 4YM6C 2Y2QA 5KDMA 3KWQC 3A6NB 4H9NA 3REHA 1P3LB 3B6FD 3LZ0C 2IO5B 1M1AD 5JA4A 3C1BC 4HGAB 2RVQC 5BO0B 3AZFA 3W98D 5B24C 5AVCD 5B40C 5B0YB 3MVDD 4LD9D 1M1AA 5DNNC 3AZIC 1P3FB 5B32G 3WAAC 3IP4C 5B32B 3AZNA 2BYMB 3AZJD 3X1UB 2JSSA 1P3FC 5AV5C 3VH6T 1P3OD 4Z66D 3EPLA 3W99B 3TU4A 5B2JC 5B33B 3AZLD 1B67A 4CSRB 4M6BA 3P5JB 3B6GD 3X1VB 1P3AD 3WTPA 5AV6C 5B0ZB 3AZKC 5GSUD 4QLCC 4CAYB 2FJ7B 1P3IA 3X1VC 3AZGD 5B31C 4Z2MG 5CPIA 2NZDD 1EQZA 3WA9A 1KX3D 3W96A 3W97B 1P3BB 5BNVA 4XZQB 1F66B 5F99D 3UT9D 5DNMD 3X1TB 3AV2A 3WTPE 3AZEC 1P3KC 2PYOB 1KX5B 2W8SA 3UTBA 3B6FB 3W97C 1P3BC 2CV5D 2F8NA 2G5IC 1BH9A 1N1JA 2VQRA 1ID3D 1TAFA 3AZHD 4ZBJC 5CP6D 3NQUA 3W98B 2Y2MA 5AVCB 3B6FC 3LZ1D 1AOID 4YS3C 1M19A 3MVDB 3KWQD 4XUJD 3LELD 2BYKB 4LD9B 5CPJC 5AV8A 4NE3A 3LZ0D 3MGSD 1P3PA 3RELA 3W98C 3C1BD 1PZRA 4ZUXC 2RVQD 3REIA 5G49B 5B24D 3MGRD 1BH8A 3MVDC 5JRGC 2HIOA 3AZJB 4J8UC 5B2ID 5CPKC 1KX4A 5DNND 3AZID 2XD5A 3LJAD 1P3OB 2HUEC 4Z66B 3EPKA 5GT3C 3WAAD 4H9QA 5C3IB 5B1LC 3X1SA 4R8PC 5AVBA 3UTAC 3AZLB 3B6GB 5AV5D 1P3AB 2YFWB 3AZLC 4KHAA 1M18A 1U35A 1ZLAC 1P34B 5B2JD 5BNXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWS A;  2NZD B;  5GSU C;  5AV6 D;  1KX3 B;  5E5A D;  3AZK D;  3AZN D;  3AFA A;  3AZG C;  3UT9 B;  5DNM B;  1P3G A;  1S32 C;  2NZD C;  5B31 D;  4Z5T A;  1KX3 C;  1HQ3 A;  4H9O B;  3AYW A;  2CV5 B;  3REK A;  1ID3 B;  5F99 C;  5BS7 C;  3UT9 C;  2ARO C;  3TU4 D;  5DNM C;  3R45 A;  3AZH B;  5CP6 B;  3V9R A;  3MGQ A;  1ULY A;  3LZ1 B;  3AZE D;  1P3K D;  3AV1 C;  2YFV B;  3KWQ B;  3LEL B;  1JFI B;  4KGC C;  3LZ0 B;  3MGS B;  4JJN C;  3AZH C;  4NE5 A;  3C1B B;  4UUZ A;  5AY8 A;  1AOI C;  4Z2M H;  5B24 B;  3LEL C;  4XUJ C;  5AV9 A;  5GXQ A;  5GT0 A;  4YS3 D;  3MGS C;  3WA9 D;  5CPJ D;  5DNN B;  3AZI B;  3LJA B;  3MGR C;  4ZUX D;  3AV2 D;  3WAA B;  4J8W A;  3AN2 C;  1P3L A;  3UTB D;  5JRG D;  3A6N A;  3C1C A;  5B2I C;  3MNN C;  4H9N B;  3REJ C;  4J8U D;  3LJA C;  5CPK D;  5AV5 B;  5BO0 A;  3NQJ B;  4WU9 C;  1BFM A;  5BT1 D;  5GT3 D;  5B0Y A;  3REH C;  4G91 C;  1M19 D;  5B1L D;  3UTA D;  1B6W A;  5B2J B;  4R8P D;  1M1A B;  4WU8 A;  3AZF C;  3REL D;  1P3P D;  1P3F A;  5AV6 B;  5E5A B;  5B32 A;  3AZK B;  2HIO D;  3B0D B;  1M1A C;  5B1M A;  3X1U A;  4QLC B;  5B31 G;  5CHL B;  1ZLA D;  1KX4 D;  1TZY D;  4X23 A;  4WNN A;  5B31 B;  5E5A C;  3W99 A;  3B0D C;  3AZN C;  3TU4 B;  4G92 C;  5B33 A;  3X1S D;  5AVB D;  3KUY A;  3AZE B;  1S32 D;  1P3K B;  5B0Z A;  4WZS B;  3TU4 C;  4KUD A;  4CAY A;  4H9S A;  2FJ7 A;  1M18 D;  1F1E A;  2ARO D;  1U35 D;  4ZBJ B;  3WTP C;  2NQB D;  3AV1 D;  4YS3 B;  4J8X A;  4XZQ A;  5CPJ B;  1P3I C;  1F66 A;  4KGC D;  4JJN D;  4J8V A;  3X1T A;  2L5A A;  4ZUX B;  2PYO A;  5CPI C;  1KX5 A;  3O62 A;  5JRG B;  4Z5T D;  1EQZ C;  3WA9 C;  3W96 C;  4J8U B;  3AYW D;  1BH9 B;  5CPK B;  4H9R B;  3AV2 C;  4AWL C;  4H9P A;  5AVC A;  2HUE B;  3UTB C;  5GT3 B;  4EO5 C;  3AN2 D;  1M19 B;  2BYK A;  4LD9 A;  3MNN D;  5B1L B;  3REJ D;  4R8P B;  3UTA B;  3AZM A;  1P3P B;  3REL B;  5BT1 C;  5G49 A;  5AY8 D;  4WU9 D;  1M19 C;  2HIO B;  3AZJ A;  3REH D;  5GXQ D;  1P3M A;  5AV8 C;  1ZLA B;  1P3P C;  3REL C;  3B0B A;  1KX4 B;  1TZY B;  1Q9C A;  1P3O A;  4Z66 A;  3REI C;  3AZF D;  2HIO C;  5GSU B;  3C1C D;  3AZL A;  1KX4 C;  3X1S B;  3KSY A;  5AVB B;  3AZG B;  1R4V A;  3B6G A;  1P3A A;  1S32 B;  2YFW A;  5FUG A;  1WWI A;  3X1S C;  5AVB C;  5F99 B;  1M18 B;  1U35 B;  2ARO B;  1P34 A;  5BNX A;  4WU8 D;  2F8N K;  2NQB B;  3AV1 B;  1H3O B;  1M18 C;  1U35 C;  4KGC B;  3VH5 A;  5B1M D;  4JJN B;  2NQB C;  4X23 D;  3KXB A;  1AOI B;  3WTP D;  4Z5T B;  4XUJ B;  2CV5 A;  3AYW B;  1ID3 A;  3AFA C;  3MGP A;  3WKJ A;  1P3I D;  5CP6 A;  3KUY D;  1P3G C;  3MGR B;  3LZ1 A;  4Z5T C;  5CPI D;  1HQ3 C;  2YFV A;  4YM6 A;  5B0Z D;  3KWQ A;  3REK C;  3AYW C;  3AN2 B;  1EQZ D;  5B2I B;  3MNN B;  3W96 D;  3REJ B;  3LZ0 A;  4KUD D;  3MGS A;  3C1B A;  1HTA A;  4E44 A;  3MGQ C;  2FJ7 D;  4UUZ B;  5AY8 B;  5B24 A;  5B40 A;  4WU9 B;  5KDM B;  3REH B;  5GXQ B;  4G91 B;  2F8N D;  5JA4 B;  4J8X D;  5DNN A;  3AZI A;  5AY8 C;  3VH6 A;  4J8V D;  3AZF B;  4NE6 A;  3WAA A;  2PYO D;  5AV9 C;  5GXQ C;  5GT0 C;  3O62 D;  3C1C B;  2CWE A;  5AV8 D;  5AV5 A;  3NQJ A;  4J8W C;  3REI D;  1P3L C;  3A6N C;  3C1C C;  2BYM A;  2IO5 C;  3AZN B;  4G92 B;  4HGA C;  5B2J A;  3AZM D;  4WU8 B;  5AV6 A;  5B0Y C;  5E5A A;  3AZK A;  4CSR A;  4QLC A;  1P3M D;  5B1M B;  4WU8 C;  3X1V A;  5B31 A;  4X23 B;  1A7W A;  4WNN B;  3WTP B;  5B32 C;  5B1M C;  3X1U C;  1P3I B;  3KUY B;  4X23 C;  3AZE A;  1P3K A;  5CPI B;  3W99 C;  3W97 A;  1EQZ B;  1P3B A;  3WA9 B;  3W96 B;  5BNV B;  5B33 C;  4KUD B;  3KUY C;  3AFA D;  1P34 D;  1P3G D;  3AV2 B;  4AWL B;  2F8N G;  3B6F A;  5B0Z C;  3UTB B;  4WV4 B;  4EO5 B;  1HQ3 D;  4YS3 A;  4KUD C;  2F8N B;  3REK D;  4H9S C;  1N1J B;  4NFT A;  5CPJ A;  4J8X B;  2FJ7 C;  1TAF B;  3W98 A;  3NQU B;  3MGQ D;  4ZUX A;  4J8V B;  3KXB D;  3MVD A;  5JRG A;  3O62 B;  4J8X C;  4J8U A;  4XZQ C;  5AV8 B;  1F66 C;  5CPK A;  4H9R A;  3MGP D;  4J8V C;  3X1T C;  3WKJ D;  2PYO C;  4H9P B;  3REI B;  1KX5 C;  1BH8 B;  5GT3 A;  3O62 C;  5AV9 D;  3B0C W;  4YM6 D;  5GT0 D;  5B1L A;  4DRB A;  4R8P A;  3UTA A;  3AZM B;  3VH5 W;  5AVC C;  4J8W D;  4H9Q B;  5B40 D;  1P3L D;  3A6N D;  4LD9 C;  3AZM C;  1P3M B;  1ZLA A;  1TZY A;  1KU5 A;  5GSU A;  5B0Y D;  3AZJ C;  1P3M C;  4KHA B;  3AZG A;  1P3O C;  4Z66 C;  1S32 A;  1P3F D;  2NZD A;  5FUG B;  5C3I C;  1KX3 A;  5B32 D;  5F99 A;  3X1U D;  5BS7 A;  3AFA B;  2ARO A;  3UT9 A;  5DNM A;  3B6G C;  1P3G B;  1P3A C;  4E45 A;  3VH6 W;  2NQB A;  4H9O A;  3AV1 A;  1HQ3 B;  3W99 D;  3REK B;  1H3O A;  4KGC A;  1P34 C;  5B33 D;  4JJN A;  4QLC D;  3AZH A;  3R45 B;  3V9R B;  3MGQ B;  3X1V D;  1AOI A;  3KXB B;  3LEL A;  4XUJ A;  1JFI A;  3MGP B;  3WKJ B;  4DRA A;  3KXB C;  3MGR A;  2LY8 A;  3B0C T;  5AV9 B;  3AN2 A;  1TZY C;  2CV5 C;  5GT0 B;  4YM6 B;  1ID3 C;  5B2I A;  3MNN A;  3W97 D;  3REJ A;  1P3B D;  3MGP C;  3VH5 T;  4XZQ D;  3WKJ C;  1F66 D;  5CP6 C;  3LJA A;  3X1T D;  3LZ1 C;  2F8N H;  4J8W B;  4WU9 A;  1KX5 D;  5B40 B;  4YM6 C;  3KWQ C;  5KDM A;  1P3L B;  3B6F D;  3A6N B;  4H9N A;  3REH A;  3LZ0 C;  2IO5 B;  1M1A D;  5JA4 A;  3C1B C;  4HGA B;  2RVQ C;  5BO0 B;  3AZF A;  3W98 D;  5B24 C;  5AVC D;  5B40 C;  5B0Y B;  3MVD D;  4LD9 D;  1M1A A;  5DNN C;  3AZI C;  1P3F B;  5B32 G;  3WAA C;  5B32 B;  3AZN A;  2BYM B;  3AZJ D;  3X1U B;  2JSS A;  1P3F C;  5AV5 C;  3VH6 T;  1P3O D;  4Z66 D;  3W99 B;  3TU4 A;  5B2J C;  5B33 B;  3AZL D;  1B67 A;  4CSR B;  4M6B A;  3B6G D;  3X1V B;  1P3A D;  3WTP A;  5AV6 C;  5B0Z B;  3AZK C;  5GSU D;  4QLC C;  4CAY B;  2FJ7 B;  1P3I A;  3X1V C;  3AZG D;  5B31 C;  4Z2M G;  5CPI A;  2NZD D;  1EQZ A;  3WA9 A;  1KX3 D;  3W96 A;  3W97 B;  1P3B B;  5BNV A;  4XZQ B;  1F66 B;  5F99 D;  3UT9 D;  5DNM D;  3X1T B;  3AV2 A;  3WTP E;  3AZE C;  1P3K C;  2PYO B;  1KX5 B;  3UTB A;  3B6F B;  3W97 C;  1P3B C;  2CV5 D;  2F8N A;  1BH9 A;  1N1J A;  1ID3 D;  1TAF A;  3AZH D;  4ZBJ C;  5CP6 D;  3NQU A;  3W98 B;  5AVC B;  3B6F C;  3LZ1 D;  1AOI D;  4YS3 C;  1M19 A;  3MVD B;  3KWQ D;  4XUJ D;  3LEL D;  2BYK B;  4LD9 B;  5CPJ C;  5AV8 A;  4NE3 A;  3LZ0 D;  3MGS D;  1P3P A;  3REL A;  3W98 C;  3C1B D;  4ZUX C;  2RVQ D;  3REI A;  5G49 B;  5B24 D;  3MGR D;  1BH8 A;  3MVD C;  5JRG C;  2HIO A;  3AZJ B;  4J8U C;  5B2I D;  5CPK C;  1KX4 A;  5DNN D;  3AZI D;  3LJA D;  1P3O B;  2HUE C;  4Z66 B;  5GT3 C;  3WAA D;  4H9Q A;  5C3I B;  5B1L C;  3X1S A;  4R8P C;  5AVB A;  3UTA C;  3AZL B;  3B6G B;  5AV5 D;  1P3A B;  2YFW B;  3AZL C;  4KHA A;  1M18 A;  1U35 A;  1ZLA C;  1P34 B;  5B2J D;  5BNX B; 
#chains in the Genus database with same CATH topology
 1WWS A;  2NZD B;  5GSU C;  5AV6 D;  1KX3 B;  5E5A D;  3AZK D;  3AZN D;  3AFA A;  3AZG C;  3H0L C;  3UT9 B;  5DNM B;  1P3G A;  1S32 C;  2ZY4 A;  2NZD C;  5B31 D;  4Z5T A;  1KX3 C;  1HQ3 A;  4H9O B;  3AYW A;  2CV5 B;  3REK A;  1ID3 B;  5F99 C;  5BS7 C;  3UT9 C;  2ARO C;  3TU4 D;  5DNM C;  3R45 A;  3AZH B;  5CP6 B;  3V9R A;  3MGQ A;  1ULY A;  3LZ1 B;  3AZE D;  1P3K D;  3AV1 C;  2YFV B;  3KWQ B;  3LEL B;  4WJ3 C;  1JFI B;  4KGC C;  3LZ0 B;  3MGS B;  4JJN C;  3AZH C;  4NE5 A;  3C1B B;  4UUZ A;  5AY8 A;  1AOI C;  4Z2M H;  2ZY2 A;  5B24 B;  3LEL C;  4XUJ C;  5AV9 A;  5GXQ A;  5GT0 A;  4YS3 D;  3MGS C;  3WA9 D;  5CPJ D;  5DNN B;  3AZI B;  3LJA B;  3MGR C;  4ZUX D;  3AV2 D;  3WAA B;  4J8W A;  3AN2 C;  1P3L A;  3UTB D;  5JRG D;  3A6N A;  3C1C A;  5B2I C;  3MNN C;  4H9N B;  3REJ C;  1T3U A;  4J8U D;  3KFU G;  3LJA C;  5CPK D;  5AV5 B;  5BO0 A;  3NQJ B;  4WU9 C;  1BFM A;  5BT1 D;  5GT3 D;  5B0Y A;  2FFF B;  3REH C;  4G91 C;  1M19 D;  5B1L D;  3UTA D;  1B6W A;  5B2J B;  4R8P D;  1M1A B;  4WU8 A;  3AZF C;  3REL D;  1P3P D;  1P3F A;  5AV6 B;  5E5A B;  5B32 A;  3AZK B;  2HIO D;  3B0D B;  1M1A C;  5B1M A;  3X1U A;  4QLC B;  5B31 G;  5CHL B;  1ZLA D;  1KX4 D;  1TZY D;  4X23 A;  4WNN A;  5B31 B;  5E5A C;  3W99 A;  3B0D C;  3AZN C;  2Y2I A;  3TU4 B;  4G92 C;  5B33 A;  3H0M C;  5AVB D;  3X1S D;  3KUY A;  3AZE B;  1S32 D;  1P3K B;  5B0Z A;  4WZS B;  3TU4 C;  2Y2N A;  4KUD A;  1Z2C B;  4CAY A;  4H9S A;  2FJ7 A;  1M18 D;  1F1E A;  2ARO D;  1U35 D;  4ZBJ B;  3WTP C;  2NQB D;  3AV1 D;  4YS3 B;  4J8X A;  2Y2H A;  3F6T A;  4XZQ A;  5CPJ B;  1P3I C;  1F66 A;  4KGC D;  4JJN D;  4J8V A;  3X1T A;  4UPK A;  2L5A A;  4ZUX B;  2PYO A;  5CPI C;  1KX5 A;  3O62 A;  5JRG B;  4Z5T D;  1EQZ C;  3WA9 C;  3W96 C;  4J8U B;  3AYW D;  1BH9 B;  5CPK B;  4H9R B;  3AV2 C;  4AWL C;  4H9P A;  5AVC A;  2HUE B;  3UTB C;  5GT3 B;  4EO5 C;  3AN2 D;  1M19 B;  2BYK A;  4LD9 A;  3MNN D;  5B1L B;  3REJ D;  4R8P B;  3UTA B;  3AZM A;  1W2E A;  1P3P B;  3REL B;  5BT1 C;  5G49 A;  5AY8 D;  4WU9 D;  1M19 C;  2HIO B;  3AZJ A;  3REH D;  5GXQ D;  1P3M A;  5AV8 C;  1ZLA B;  1P3P C;  3REL C;  3B0B A;  1KX4 B;  1TZY B;  1Q9C A;  1P3O A;  4Z66 A;  3REI C;  3AZF D;  2HIO C;  2XD1 A;  5GSU B;  3C1C D;  3AZL A;  1KX4 C;  3X1S B;  3KSY A;  5AVB B;  3AZG B;  1R4V A;  3B6G A;  4DQY B;  1P3A A;  1S32 B;  2J8P A;  2YFW A;  5FUG A;  1WWI A;  3X1S C;  5AVB C;  5F99 B;  1M18 B;  1U35 B;  2ARO B;  1P34 A;  5BNX A;  4WU8 D;  2F8N K;  2NQB B;  3AV1 B;  1H3O B;  1M18 C;  1U35 C;  4KGC B;  3VH5 A;  5B1M D;  4JJN B;  2NQB C;  4X23 D;  3KXB A;  1AOI B;  3WTP D;  4Z5T B;  4XUJ B;  2ZM5 A;  2CV5 A;  3AYW B;  1ID3 A;  3AFA C;  3MGP A;  3WKJ A;  1P3I D;  5CP6 A;  3KUY D;  1P3G C;  3MGR B;  3LZ1 A;  4Z5T C;  5CPI D;  1HQ3 C;  2YFV A;  4YM6 A;  5B0Z D;  3KWQ A;  3REK C;  3AYW C;  3AN2 B;  1EQZ D;  5B2I B;  3MNN B;  3W96 D;  3REJ B;  3LZ0 A;  4KUD D;  3MGS A;  3C1B A;  1HTA A;  4E44 A;  3MGQ C;  2FJ7 D;  4UUZ B;  5AY8 B;  5B24 A;  5B40 A;  4WU9 B;  5KDM B;  3REH B;  5GXQ B;  4G91 B;  2F8N D;  3EPH A;  5JA4 B;  4J8X D;  5DNN A;  3AZI A;  5AY8 C;  3VH6 A;  4J8V D;  3AZF B;  3H0R C;  4NE6 A;  3WAA A;  2PYO D;  5AV9 C;  5GXQ C;  3FDD A;  5GT0 C;  3O62 D;  3C1C B;  2CWE A;  5AV8 D;  5AV5 A;  3NQJ A;  4J8W C;  3REI D;  1P3L C;  3A6N C;  3C1C C;  2BYM A;  2IO5 C;  3AZN B;  4G92 B;  4HGA C;  5B2J A;  3AZM D;  4WU8 B;  5AV6 A;  5B0Y C;  5E5A A;  3AZK A;  4CSR A;  4QLC A;  1P3M D;  5B1M B;  4WU8 C;  3X1V A;  5B31 A;  4X23 B;  1A7W A;  4WNN B;  3WTP B;  5B32 C;  5B1M C;  3X1U C;  1P3I B;  3KUY B;  4X23 C;  3AZE A;  1P3K A;  5CPI B;  3W99 C;  3W97 A;  1EQZ B;  1P3B A;  3WA9 B;  3W96 B;  5BNV B;  5B33 C;  4KUD B;  3KUY C;  3AFA D;  1P34 D;  1P3G D;  3AV2 B;  4AWL B;  2F8N G;  3B6F A;  5B0Z C;  3UTB B;  4WV4 B;  2DQN C;  4EO5 B;  1HQ3 D;  4YS3 A;  4KUD C;  2F8N B;  3REK D;  1N1J B;  4H9S C;  4NFT A;  5CPJ A;  4J8X B;  2FJ7 C;  1TAF B;  2F2A C;  3W98 A;  3NQU B;  3MGQ D;  4ZUX A;  4J8V B;  3KXB D;  2Y2P A;  3MVD A;  5JRG A;  3O62 B;  4J8X C;  4J8U A;  4XZQ C;  5AV8 B;  1F66 C;  5CPK A;  4H9R A;  3MGP D;  4J8V C;  3X1T C;  3WKJ D;  2PYO C;  4H9P B;  3REI B;  1KX5 C;  1BH8 B;  5GT3 A;  3O62 C;  5AV9 D;  2Y2J A;  3B0C W;  4YM6 D;  5GT0 D;  5B1L A;  4DRB A;  4R8P A;  3UTA A;  2DF4 C;  3AZM B;  3VH5 W;  5AVC C;  4J8W D;  4H9Q B;  3A1I A;  5B40 D;  1P3L D;  3A6N D;  4LD9 C;  3AZM C;  1P3M B;  1ZLA A;  2BG1 A;  3EG5 B;  1TZY A;  2ZY5 A;  1KU5 A;  5GSU A;  5B0Y D;  3AZJ C;  1P3M C;  4KHA B;  3AZG A;  2Y2L A;  1P3O C;  2UWX A;  4Z66 C;  2ZY3 A;  1S32 A;  1P3F D;  2NZD A;  5FUG B;  5C3I C;  1KX3 A;  5B32 D;  5F99 A;  3X1U D;  5BS7 A;  3AFA B;  2ARO A;  3UT9 A;  5DNM A;  3B6G C;  1P3G B;  1P3A C;  4E45 A;  3VH6 W;  2NQB A;  4H9O A;  3AV1 A;  1HQ3 B;  3W99 D;  3REK B;  1H3O A;  3A1K A;  4KGC A;  1P34 C;  5B33 D;  4JJN A;  2Y2O A;  2Y2G A;  3R45 B;  4QLC D;  3EPJ A;  3AZH A;  3V9R B;  3MGQ B;  3X1V D;  1AOI A;  3KXB B;  3LEL A;  4XUJ A;  1JFI A;  2G5H C;  3MGP B;  3WKJ B;  4DRA A;  3KXB C;  3MGR A;  2JCH A;  2LY8 A;  3B0C T;  3AL0 C;  5AV9 B;  3AN2 A;  1TZY C;  2CV5 C;  5GT0 B;  4YM6 B;  1ID3 C;  5B2I A;  3MNN A;  3W97 D;  3REJ A;  1P3B D;  3MGP C;  3VH5 T;  4XZQ D;  3WKJ C;  2Y2K A;  1F66 D;  5CP6 C;  2RIQ A;  3LJA A;  3X1T D;  3LZ1 C;  2F8N H;  4J8W B;  4WU9 A;  1KX5 D;  5B40 B;  2JE5 A;  4YM6 C;  2Y2Q A;  5KDM A;  3KWQ C;  3A6N B;  4H9N A;  3REH A;  1P3L B;  3B6F D;  3LZ0 C;  2IO5 B;  1M1A D;  5JA4 A;  3C1B C;  4HGA B;  2RVQ C;  5BO0 B;  3AZF A;  3W98 D;  5B24 C;  5AVC D;  5B40 C;  5B0Y B;  3MVD D;  4LD9 D;  1M1A A;  5DNN C;  3AZI C;  1P3F B;  5B32 G;  3WAA C;  3IP4 C;  5B32 B;  3AZN A;  2BYM B;  3AZJ D;  3X1U B;  2JSS A;  1P3F C;  5AV5 C;  3VH6 T;  1P3O D;  4Z66 D;  3EPL A;  3W99 B;  3TU4 A;  5B2J C;  5B33 B;  3AZL D;  1B67 A;  4CSR B;  4M6B A;  3P5J B;  3B6G D;  3X1V B;  1P3A D;  3WTP A;  5AV6 C;  5B0Z B;  3AZK C;  5GSU D;  4QLC C;  4CAY B;  2FJ7 B;  1P3I A;  3X1V C;  3AZG D;  5B31 C;  4Z2M G;  5CPI A;  2NZD D;  1EQZ A;  3WA9 A;  1KX3 D;  3W96 A;  3W97 B;  1P3B B;  5BNV A;  4XZQ B;  1F66 B;  5F99 D;  3UT9 D;  5DNM D;  3X1T B;  3AV2 A;  3WTP E;  3AZE C;  1P3K C;  2PYO B;  1KX5 B;  2W8S A;  3UTB A;  3B6F B;  3W97 C;  1P3B C;  2CV5 D;  2F8N A;  2G5I C;  1BH9 A;  1N1J A;  2VQR A;  1ID3 D;  1TAF A;  3AZH D;  4ZBJ C;  5CP6 D;  3NQU A;  3W98 B;  2Y2M A;  5AVC B;  3B6F C;  3LZ1 D;  1AOI D;  4YS3 C;  1M19 A;  3MVD B;  3KWQ D;  4XUJ D;  3LEL D;  2BYK B;  4LD9 B;  5CPJ C;  5AV8 A;  4NE3 A;  3LZ0 D;  3MGS D;  1P3P A;  3REL A;  3W98 C;  3C1B D;  1PZR A;  4ZUX C;  2RVQ D;  3REI A;  5G49 B;  5B24 D;  3MGR D;  1BH8 A;  3MVD C;  5JRG C;  2HIO A;  3AZJ B;  4J8U C;  5B2I D;  5CPK C;  1KX4 A;  5DNN D;  3AZI D;  2XD5 A;  3LJA D;  1P3O B;  2HUE C;  4Z66 B;  3EPK A;  5GT3 C;  3WAA D;  4H9Q A;  5C3I B;  5B1L C;  3X1S A;  4R8P C;  5AVB A;  3UTA C;  3AZL B;  3B6G B;  5AV5 D;  1P3A B;  2YFW B;  3AZL C;  4KHA A;  1M18 A;  1U35 A;  1ZLA C;  1P34 B;  5B2J D;  5BNX B; 
#chains in the Genus database with same CATH homology
 1WWS A;  2NZD B;  5GSU C;  5AV6 D;  1KX3 B;  5E5A D;  3AZK D;  3AZN D;  3AFA A;  3AZG C;  3H0L C;  3UT9 B;  5DNM B;  1P3G A;  1S32 C;  2ZY4 A;  2NZD C;  5B31 D;  4Z5T A;  1KX3 C;  1HQ3 A;  4H9O B;  3AYW A;  2CV5 B;  3REK A;  1ID3 B;  5F99 C;  5BS7 C;  3UT9 C;  2ARO C;  3TU4 D;  5DNM C;  3R45 A;  3AZH B;  5CP6 B;  3V9R A;  3MGQ A;  1ULY A;  3LZ1 B;  3AZE D;  1P3K D;  3AV1 C;  2YFV B;  3KWQ B;  3LEL B;  4WJ3 C;  1JFI B;  4KGC C;  3LZ0 B;  3MGS B;  4JJN C;  3AZH C;  4NE5 A;  3C1B B;  4UUZ A;  5AY8 A;  1AOI C;  4Z2M H;  2ZY2 A;  5B24 B;  3LEL C;  4XUJ C;  5AV9 A;  5GXQ A;  5GT0 A;  4YS3 D;  3MGS C;  3WA9 D;  5CPJ D;  5DNN B;  3AZI B;  3LJA B;  3MGR C;  4ZUX D;  3AV2 D;  3WAA B;  4J8W A;  3AN2 C;  1P3L A;  3UTB D;  5JRG D;  3A6N A;  3C1C A;  5B2I C;  3MNN C;  4H9N B;  3REJ C;  1T3U A;  4J8U D;  3KFU G;  3LJA C;  5CPK D;  5AV5 B;  5BO0 A;  3NQJ B;  4WU9 C;  1BFM A;  5BT1 D;  5GT3 D;  5B0Y A;  2FFF B;  3REH C;  4G91 C;  1M19 D;  5B1L D;  3UTA D;  1B6W A;  5B2J B;  4R8P D;  1M1A B;  4WU8 A;  3AZF C;  3REL D;  1P3P D;  1P3F A;  5AV6 B;  5E5A B;  5B32 A;  3AZK B;  2HIO D;  3B0D B;  1M1A C;  5B1M A;  3X1U A;  4QLC B;  5B31 G;  5CHL B;  1ZLA D;  1KX4 D;  1TZY D;  4X23 A;  4WNN A;  5B31 B;  5E5A C;  3W99 A;  3B0D C;  3AZN C;  2Y2I A;  3TU4 B;  4G92 C;  5B33 A;  3H0M C;  5AVB D;  3X1S D;  3KUY A;  3AZE B;  1S32 D;  1P3K B;  5B0Z A;  4WZS B;  3TU4 C;  2Y2N A;  4KUD A;  1Z2C B;  4CAY A;  4H9S A;  2FJ7 A;  1M18 D;  1F1E A;  2ARO D;  1U35 D;  4ZBJ B;  3WTP C;  2NQB D;  3AV1 D;  4YS3 B;  4J8X A;  2Y2H A;  3F6T A;  4XZQ A;  5CPJ B;  1P3I C;  1F66 A;  4KGC D;  4JJN D;  4J8V A;  3X1T A;  4UPK A;  2L5A A;  4ZUX B;  2PYO A;  5CPI C;  1KX5 A;  3O62 A;  5JRG B;  4Z5T D;  1EQZ C;  3WA9 C;  3W96 C;  4J8U B;  3AYW D;  1BH9 B;  5CPK B;  4H9R B;  3AV2 C;  4AWL C;  4H9P A;  5AVC A;  2HUE B;  3UTB C;  5GT3 B;  4EO5 C;  3AN2 D;  1M19 B;  2BYK A;  4LD9 A;  3MNN D;  5B1L B;  3REJ D;  4R8P B;  3UTA B;  3AZM A;  1W2E A;  1P3P B;  3REL B;  5BT1 C;  5G49 A;  5AY8 D;  4WU9 D;  1M19 C;  2HIO B;  3AZJ A;  3REH D;  5GXQ D;  1P3M A;  5AV8 C;  1ZLA B;  1P3P C;  3REL C;  3B0B A;  1KX4 B;  1TZY B;  1Q9C A;  1P3O A;  4Z66 A;  3REI C;  3AZF D;  2HIO C;  2XD1 A;  5GSU B;  3C1C D;  3AZL A;  1KX4 C;  3X1S B;  3KSY A;  5AVB B;  3AZG B;  1R4V A;  3B6G A;  4DQY B;  1P3A A;  1S32 B;  2J8P A;  2YFW A;  5FUG A;  1WWI A;  3X1S C;  5AVB C;  5F99 B;  1M18 B;  1U35 B;  2ARO B;  1P34 A;  5BNX A;  4WU8 D;  2F8N K;  2NQB B;  3AV1 B;  1H3O B;  1M18 C;  1U35 C;  4KGC B;  3VH5 A;  5B1M D;  4JJN B;  2NQB C;  4X23 D;  3KXB A;  1AOI B;  3WTP D;  4Z5T B;  4XUJ B;  2ZM5 A;  2CV5 A;  3AYW B;  1ID3 A;  3AFA C;  3MGP A;  3WKJ A;  1P3I D;  5CP6 A;  3KUY D;  1P3G C;  3MGR B;  3LZ1 A;  4Z5T C;  5CPI D;  1HQ3 C;  2YFV A;  4YM6 A;  5B0Z D;  3KWQ A;  3REK C;  3AYW C;  3AN2 B;  1EQZ D;  5B2I B;  3MNN B;  3W96 D;  3REJ B;  3LZ0 A;  4KUD D;  3MGS A;  3C1B A;  1HTA A;  4E44 A;  3MGQ C;  2FJ7 D;  4UUZ B;  5AY8 B;  5B24 A;  5B40 A;  4WU9 B;  5KDM B;  3REH B;  5GXQ B;  4G91 B;  2F8N D;  3EPH A;  5JA4 B;  4J8X D;  5DNN A;  3AZI A;  5AY8 C;  3VH6 A;  4J8V D;  3AZF B;  3H0R C;  4NE6 A;  3WAA A;  2PYO D;  5AV9 C;  5GXQ C;  3FDD A;  5GT0 C;  3O62 D;  3C1C B;  2CWE A;  5AV8 D;  5AV5 A;  3NQJ A;  4J8W C;  3REI D;  1P3L C;  3A6N C;  3C1C C;  2BYM A;  2IO5 C;  3AZN B;  4G92 B;  4HGA C;  5B2J A;  3AZM D;  4WU8 B;  5AV6 A;  5B0Y C;  5E5A A;  3AZK A;  4CSR A;  4QLC A;  1P3M D;  5B1M B;  4WU8 C;  3X1V A;  5B31 A;  4X23 B;  1A7W A;  4WNN B;  3WTP B;  5B32 C;  5B1M C;  3X1U C;  1P3I B;  3KUY B;  4X23 C;  3AZE A;  1P3K A;  5CPI B;  3W99 C;  3W97 A;  1EQZ B;  1P3B A;  3WA9 B;  3W96 B;  5BNV B;  5B33 C;  4KUD B;  3KUY C;  3AFA D;  1P34 D;  1P3G D;  3AV2 B;  4AWL B;  2F8N G;  3B6F A;  5B0Z C;  3UTB B;  4WV4 B;  2DQN C;  4EO5 B;  1HQ3 D;  4YS3 A;  4KUD C;  2F8N B;  3REK D;  1N1J B;  4H9S C;  4NFT A;  5CPJ A;  4J8X B;  2FJ7 C;  1TAF B;  2F2A C;  3W98 A;  3NQU B;  3MGQ D;  4ZUX A;  4J8V B;  3KXB D;  2Y2P A;  3MVD A;  5JRG A;  3O62 B;  4J8X C;  4J8U A;  4XZQ C;  5AV8 B;  1F66 C;  5CPK A;  4H9R A;  3MGP D;  4J8V C;  3X1T C;  3WKJ D;  2PYO C;  4H9P B;  3REI B;  1KX5 C;  1BH8 B;  5GT3 A;  3O62 C;  5AV9 D;  2Y2J A;  3B0C W;  4YM6 D;  5GT0 D;  5B1L A;  4DRB A;  4R8P A;  3UTA A;  2DF4 C;  3AZM B;  3VH5 W;  5AVC C;  4J8W D;  4H9Q B;  3A1I A;  5B40 D;  1P3L D;  3A6N D;  4LD9 C;  3AZM C;  1P3M B;  1ZLA A;  2BG1 A;  3EG5 B;  1TZY A;  2ZY5 A;  1KU5 A;  5GSU A;  5B0Y D;  3AZJ C;  1P3M C;  4KHA B;  3AZG A;  2Y2L A;  1P3O C;  2UWX A;  4Z66 C;  2ZY3 A;  1S32 A;  1P3F D;  2NZD A;  5FUG B;  5C3I C;  1KX3 A;  5B32 D;  5F99 A;  3X1U D;  5BS7 A;  3AFA B;  2ARO A;  3UT9 A;  5DNM A;  3B6G C;  1P3G B;  1P3A C;  4E45 A;  3VH6 W;  2NQB A;  4H9O A;  3AV1 A;  1HQ3 B;  3W99 D;  3REK B;  1H3O A;  3A1K A;  4KGC A;  1P34 C;  5B33 D;  4JJN A;  2Y2O A;  2Y2G A;  3R45 B;  4QLC D;  3EPJ A;  3AZH A;  3V9R B;  3MGQ B;  3X1V D;  1AOI A;  3KXB B;  3LEL A;  4XUJ A;  1JFI A;  2G5H C;  3MGP B;  3WKJ B;  4DRA A;  3KXB C;  3MGR A;  2JCH A;  2LY8 A;  3B0C T;  3AL0 C;  5AV9 B;  3AN2 A;  1TZY C;  2CV5 C;  5GT0 B;  4YM6 B;  1ID3 C;  5B2I A;  3MNN A;  3W97 D;  3REJ A;  1P3B D;  3MGP C;  3VH5 T;  4XZQ D;  3WKJ C;  2Y2K A;  1F66 D;  5CP6 C;  2RIQ A;  3LJA A;  3X1T D;  3LZ1 C;  2F8N H;  4J8W B;  4WU9 A;  1KX5 D;  5B40 B;  2JE5 A;  4YM6 C;  2Y2Q A;  5KDM A;  3KWQ C;  3A6N B;  4H9N A;  3REH A;  1P3L B;  3B6F D;  3LZ0 C;  2IO5 B;  1M1A D;  5JA4 A;  3C1B C;  4HGA B;  2RVQ C;  5BO0 B;  3AZF A;  3W98 D;  5B24 C;  5AVC D;  5B40 C;  5B0Y B;  3MVD D;  4LD9 D;  1M1A A;  5DNN C;  3AZI C;  1P3F B;  5B32 G;  3WAA C;  3IP4 C;  5B32 B;  3AZN A;  2BYM B;  3AZJ D;  3X1U B;  2JSS A;  1P3F C;  5AV5 C;  3VH6 T;  1P3O D;  4Z66 D;  3EPL A;  3W99 B;  3TU4 A;  5B2J C;  5B33 B;  3AZL D;  1B67 A;  4CSR B;  4M6B A;  3P5J B;  3B6G D;  3X1V B;  1P3A D;  3WTP A;  5AV6 C;  5B0Z B;  3AZK C;  5GSU D;  4QLC C;  4CAY B;  2FJ7 B;  1P3I A;  3X1V C;  3AZG D;  5B31 C;  4Z2M G;  5CPI A;  2NZD D;  1EQZ A;  3WA9 A;  1KX3 D;  3W96 A;  3W97 B;  1P3B B;  5BNV A;  4XZQ B;  1F66 B;  5F99 D;  3UT9 D;  5DNM D;  3X1T B;  3AV2 A;  3WTP E;  3AZE C;  1P3K C;  2PYO B;  1KX5 B;  2W8S A;  3UTB A;  3B6F B;  3W97 C;  1P3B C;  2CV5 D;  2F8N A;  2G5I C;  1BH9 A;  1N1J A;  2VQR A;  1ID3 D;  1TAF A;  3AZH D;  4ZBJ C;  5CP6 D;  3NQU A;  3W98 B;  2Y2M A;  5AVC B;  3B6F C;  3LZ1 D;  1AOI D;  4YS3 C;  1M19 A;  3MVD B;  3KWQ D;  4XUJ D;  3LEL D;  2BYK B;  4LD9 B;  5CPJ C;  5AV8 A;  4NE3 A;  3LZ0 D;  3MGS D;  1P3P A;  3REL A;  3W98 C;  3C1B D;  1PZR A;  4ZUX C;  2RVQ D;  3REI A;  5G49 B;  5B24 D;  3MGR D;  1BH8 A;  3MVD C;  5JRG C;  2HIO A;  3AZJ B;  4J8U C;  5B2I D;  5CPK C;  1KX4 A;  5DNN D;  3AZI D;  2XD5 A;  3LJA D;  1P3O B;  2HUE C;  4Z66 B;  3EPK A;  5GT3 C;  3WAA D;  4H9Q A;  5C3I B;  5B1L C;  3X1S A;  4R8P C;  5AVB A;  3UTA C;  3AZL B;  3B6G B;  5AV5 D;  1P3A B;  2YFW B;  3AZL C;  4KHA A;  1M18 A;  1U35 A;  1ZLA C;  1P34 B;  5B2J D;  5BNX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...