1P3PA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
100
structure length
100
Chain Sequence
KKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 100
sequence length 100
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3pA00
3A6ND 4X23A 5B31C 5AVBB 3MGSD 5F99C 1KX4D 4J8UB 2HUEC 3WTPC 5AV8A 2CV5A 3WTPE 3VH5W 2PYOA 3W99C 3WAAB 3X1VD 3TU4D 1ZLAD 3B6GD 5CPKC 2BYMA 3UTAC 4WU8B 3B6FC 1P3MC 4Z66D 5B32B 3UT9C 1F66C 4J8WA 1P3BC 3AFAC 3UTBA 4NE5A 1KX3B 4XZQD 3C1BB 3X1UA 2F8NB 2F8NH 4M6BA 5AV6C 4KGCB 4J8XD 5B0ZB 3AZMA 3AV2C 1JFIB 1P3LA 1P3AB 5AVBC 3MNNA 5B24A 4LD9C 1P3PC 4H9NA 4J8UC 4H9QB 5B1MC 5E5AD 1H3OA 1ID3C 4QLCA 5B33D 3MGQB 3WAAC 1U35D 1M1AD 5B1LB 3W98A 1P3GA 5DNMB 1S32A 2AROB 5AY8B 1M18A 5JRGA 3AZED 4WU8C 4JJNB 4UUZB 5B32C 5B2JB 3AN2B 1WWSA 5G49B 4WV4B 2NQBD 5F99A 4X23C 1P3IB 1KX3C 5BNXB 5JA4A 3C1BC 4J8VD 5B2ID 4KGCC 3MVDB 3W97D 5B0ZC 5B40A 3KUYB 3AV1D 3AZGD 2PYOC 1P3AC 3X1TB 1P34B 3WA9A 3W98B 5BT1C 5CPKA 1P3KD 3UTAA 4E45A 3REKD 2RVQD 3B6FA 3REIB 1P3FB 1P3MA 1BH8A 5CPJB 1HQ3D 2FJ7B 3AZJD 3MGQC 3UT9A 3REHD 1M19D 1F66A 3NQJA 4YS3D 3MGPB 5B1LC 3AZKB 3KXBB 1P3BA 5DNMC 2AROC 5AVCB 2YFVA 4WU9D 4J8WC 3AZFD 4HGAC 3LZ1A 3AFAA 3AYWD 3A6NB 5CP6D 4WNNA 3O62D 4JJNC 4R8PD 1KX4B 5JA4B 5B0YD 5CHLB 5GT3D 3X1UC 3AV2A 3AN2C 5AVBA 4J8UA 4G91C 5B24C 3X1VB 1P3OD 3AZID 3MVDC 3TU4B 1ZLAB 3KUYC 3B6GB 4Z5TD 3WAAA 1WWIA 3X1TC 5GXQD 4Z66B 5FUGB 5GT0D 4ZBJB 3W98C 5DNNA 4YM6D 1S32C 4WU8A 3REIC 1P3FC 2HIOD 3LZ1B 3LELA 3C1CD 5CPJC 5B32A 2FJ7C 3WKJD 4XZQB 3MGPC 4H9SC 3AZKC 3KXBC 4KHAB 3RELD 4H9PB 4J8XB 1KX3A 1TZYD 3A6NC 3C1BA 2F8NA 1KX4C 4KGCA 3REJD 5B0ZA 5GSUA 1JFIA 3W96A 5E5AB 3AZND 4WZSB 1P3AA 5B40C 2BYKB 3KWQD 5AV9D 5B33B 5CPID 4H9QA 3X1VC 1M1AB 4KUDA 3WA9C 1KX5D 1ZLAC 5DNNB 3B6GC 3MGQA 5B31D 3LELB 5B1LA 4XUJD 5DNMA 2AROA 4Z66C 5AY8A 4ZBJC 3WTPD 2CWEA 4JJNA 3LZ1C 4UUZA 3W99D 2NQBB 5B2JA 3AZHA 4J8VB 5B2IB 3AN2A 3W97B 5G49A 5GSUB 4J8XC 1P3IA 3W96B 5BNXA 3AV1B 1EQZD 3AZGB 3MVDA 2YFWB 3LJAA 4KUDB 3KUYA 1P3KB 4DRAA 3B0DB 5E5AC 3REKB 3X1TA 1P34A 1HQ3B 3AZLD 3AZJB 3REHB 1M19B 1Q9CA 4YS3B 1M1AC 5AV6D 2F8NK 3REIA 4WU9B 1P3FA 3AZFB 5DNNC 1ULYA 3X1SD 5CPJA 3AYWB 2FJ7A 5CP6B 3O62B 3LELC 4R8PB 4H9SA 3MGPA 3KXBA 3AZKA 5AVCA 4ZUXD 4LD9D 5KDMB 5B0YB 3AZHB 1P3PD 4H9RB 5GT3B 3LZ0D 4NE3A 5B1MD 4EO5B 3A6NA 1KU5A 3KSYA 2NQBC 1KX4A 1ID3D 4J8VC 5C3IB 5B2IC 1B6WA 1P3OB 3AZIB 3LJAB 3W97C 5GSUC 2NZDD 3W96C 4Z5TB 3AZGC 3X1VA 5GXQB 3VH6T 1AOIB 3TU4A 3MGRD 5GT0B 1ZLAA 4KUDC 3B6GA 1P3KC 4YM6B 5AV5D 3B0DC 3REKC 2RVQC 2HIOB 3C1CB 1HQ3C 4Z66A 4X23D 5FUGA 3WKJB 3AZJC 3REHC 1M19C 4YS3C 5AY8C 5BO0B 4WU9C 3RELB 3AZFC 1BFMA 5AV8D 2CV5D 1TZYB 4XZQA 5BNVB 3O62C 3MGSB 4R8PC 2PYOD 1P3AD 4KHAA 5B2JC 5B0YC 3AZHC 4H9PA 3REJB 5GT3C 4J8XA 1B67A 4NE6A 4EO5C 5BT1D 3AZNB 1P3IC 3KWQB 5AV9B 5CPIB 5C3IC 3R45B 5E5AA 4CAYA 3AZIC 3LJAC 4J8WD 2BYKA 4Z5TC 5B33A 1U35A 5B31B 1P34C 1M1AA 5GXQC 3UTBD 1AOIC 4XUJB 5GT0C 3X1UD 4YM6C 3AZEA 2HIOC 3AZMD 3WKJC 1P3LD 3MNND 3V9RB 5B24D 5AVCC 3RELC 2NQBA 1TZYC 1EQZB 1BH9B 3MGSC 4J8VA 5B2IA 4G92B 4QLCD 3W97A 3REJC 3W98D 4CAYB 4E44A 1P3GD 3AV1A 1S32D 3AZGA 2IO5B 3AZNC 1M18D 5JRGD 3KWQC 2YFWA 3AZLB 1U35B 5AV9C 1P3KA 3TU4C 4CSRB 3NQUB 3REKA 1N1JB 1F1EA 3X1SB 1HQ3A 3AZEB 3AZJA 3REHA 1M19A 4YS3A 5F99D 4XUJC 4WU9A 4ZUXB 4LD9B 1R4VA 3AZFA 1P3PB 3LZ0B 4H9OA 3AYWA 5B1MB 5CP6A 3O62A 4R8PA 5B40D 4XZQC 5KDMA 5B0YA 1ID3B 4H9RA 5GT3A 3WA9D 5CPKD 2NZDB 3UTAD 1EQZC 3B6FD 1P3MD 1TAFB 4NFTA 1P3OA 3AZIA 4G92C 5BS7C 3UT9D 3MGRB 1F66D 1P3BD 4Z5TA 5AV5B 2IO5C 3LZ1D 5GXQA 3AFAD 1AOIA 3AZLC 5B33C 4X23B 5GT0A 1U35C 4YM6A 2HIOA 4H9OB 4DRBA 3C1CA 3AV2D 3X1SC 5AV8B 3WKJA 2CV5B 3AZEC 4Z2MG 5AVBD 2PYOB 5BO0A 4J8UD 4ZUXC 3RELA 1HTAA 3LZ0C 1TZYA 5BNVA 3MGSA 4AWLB 2LY8A 2BYMB 3REJA 3WAAD 3AZNA 4J8WB 4HGAB 5DNND 5B31G 3KWQA 3AV1C 2NZDC 4WU8D 5AV9A 5CPIA 3LELD 5B32D 3R45A 3UTBB 3MGRC 1KX5A 3X1UB 5AV5C 5B31A 3AZMB 4XUJA 1KX3D 1P3LB 3C1BD 2F8ND 3WTPA 4G91B 3VH6A 5B24B 3MNNB 4KGCD 4H9NB 3B0CT 3B0BA 5B0ZD 3AYWC 5GSUD 3W99A 5AV8C 5CP6C 2CV5C 3W96D 1A7WA 1H3OB 3V9RA 4Z2MH 4QLCB 4KUDD 1P3GB 1EQZA 1S32B 1BH9A 4AWLC 1M18B 3VH6W 5JRGB 5BS7A 3MGQD 5B1LD 1P3OC 5DNMD 2AROD 5AY8D 1KX5B 3AZLA 4JJND 5F99B 5AV6A 3UTBC 4CSRA 3NQUA 3B0CW 1N1JA 2HUEB 5B2JD 3AZHD 3WTPB 3X1SA 3AN2D 3C1CC 3W99B 3AZMC 5B40B 1P3ID 4ZUXA 4LD9A 1P3LC 1P3PA 3LZ0A 3MNNC 5B1MA 3MVDD 3WA9B 2L5AA 3LJAD 3KUYD 5CPKB 3UTAB 1ID3A 3VH5T 3B6FB 3X1TD 1P3MB 5B32G 1BH8B 1P34D 1AOID 2JSSA 4QLCC 3UT9B 1F66B 3NQJB 2NZDA 1P3BB 1P3GC 3REID 2YFVB 1P3FD 1M18C 1TAFA 5CPJD 5JRGC 3AFAB 2FJ7D 5CPIC 3MGRA 2F8NG 4WNNB 3VH5A 3MGPD 3AZKD 3KXBD 5AV6B 5AVCD 5AV5A 1KX5C 3AV2B
chains in the Genus database with same CATH superfamily
3A6ND 4X23A 5B31C 5AVBB 3MGSD 5F99C 1KX4D 4J8UB 2HUEC 3EPLA 3WTPC 5AV8A 2CV5A 3WTPE 3VH5W 2JCHA 2PYOA 3W99C 3WAAB 3X1VD 3TU4D 1ZLAD 3B6GD 5CPKC 2BYMA 3UTAC 4WU8B 3B6FC 1P3MC 4Z66D 5B32B 3UT9C 1F66C 4J8WA 1P3BC 3AFAC 3UTBA 4NE5A 1KX3B 4XZQD 3C1BB 3F6TA 3X1UA 2F8NB 2F8NH 4M6BA 5AV6C 4KGCB 2Y2OA 4J8XD 5B0ZB 3AZMA 2F2AC 3AV2C 1JFIB 1P3LA 1P3AB 5AVBC 3MNNA 5B24A 4LD9C 1P3PC 4H9NA 4J8UC 3H0LC 4H9QB 5B1MC 5E5AD 1H3OA 1ID3C 3EPJA 4QLCA 5B33D 3MGQB 3WAAC 1U35D 1M1AD 5B1LB 3W98A 1P3GA 5DNMB 1S32A 2AROB 5AY8B 1M18A 5JRGA 3AZED 4WU8C 4JJNB 4UUZB 5B32C 5B2JB 2ZY5A 2W8SA 3AN2B 1WWSA 5G49B 4WV4B 2NQBD 5F99A 4X23C 1P3IB 1KX3C 5BNXB 5JA4A 3C1BC 4J8VD 5B2ID 4KGCC 3MVDB 3W97D 5B0ZC 5B40A 3KUYB 3AV1D 3AZGD 2PYOC 1P3AC 3X1TB 1P34B 3WA9A 3W98B 5BT1C 5CPKA 1P3KD 3UTAA 4E45A 3REKD 2RVQD 3B6FA 3REIB 2Y2HA 1P3FB 1P3MA 1BH8A 5CPJB 1HQ3D 2ZM5A 2FJ7B 3AZJD 3MGQC 3UT9A 3REHD 1M19D 1F66A 3NQJA 4YS3D 3MGPB 5B1LC 3AZKB 3KXBB 1P3BA 5DNMC 2AROC 5AVCB 2YFVA 4WU9D 4J8WC 3AZFD 4HGAC 3LZ1A 3AFAA 3AYWD 3A6NB 5CP6D 4WNNA 3O62D 4JJNC 4R8PD 1KX4B 5JA4B 5B0YD 5CHLB 5GT3D 3X1UC 3AV2A 3AN2C 5AVBA 4J8UA 4G91C 5B24C 3X1VB 1P3OD 3AZID 3MVDC 3TU4B 1ZLAB 3KUYC 3B6GB 2Y2QA 4Z5TD 3WAAA 1WWIA 3X1TC 5GXQD 4Z66B 5FUGB 5GT0D 4ZBJB 3W98C 5DNNA 4YM6D 1S32C 4WU8A 3REIC 1P3FC 2HIOD 3LZ1B 3LELA 3C1CD 5CPJC 5B32A 2FJ7C 3WKJD 4XZQB 3MGPC 4H9SC 3AZKC 3KXBC 4KHAB 3RELD 4H9PB 4J8XB 1KX3A 1TZYD 3A6NC 2FFFB 3C1BA 2F8NA 2DF4C 1KX4C 4KGCA 3REJD 1Z2CB 5B0ZA 5GSUA 1JFIA 4WJ3C 3W96A 5E5AB 3AZND 2G5HC 2BG1A 4WZSB 1P3AA 5B40C 2BYKB 3KWQD 5AV9D 5B33B 5CPID 4H9QA 3X1VC 1M1AB 4KUDA 3WA9C 3FDDA 1KX5D 1ZLAC 5DNNB 3B6GC 3MGQA 5B31D 3LELB 5B1LA 4XUJD 5DNMA 2AROA 4Z66C 5AY8A 4ZBJC 3WTPD 2CWEA 4UPKA 2Y2LA 4JJNA 3LZ1C 4UUZA 3W99D 2NQBB 5B2JA 3AZHA 4J8VB 5B2IB 3AN2A 3W97B 5G49A 5GSUB 4J8XC 1P3IA 3W96B 5BNXA 3AV1B 1EQZD 3AZGB 3MVDA 2YFWB 3EG5B 3LJAA 1T3UA 4KUDB 3KUYA 1P3KB 4DRAA 3B0DB 5E5AC 3REKB 3X1TA 1P34A 1HQ3B 3AZLD 2Y2PA 3AZJB 3REHB 1M19B 1Q9CA 4YS3B 1M1AC 5AV6D 2F8NK 3REIA 4WU9B 1P3FA 3AZFB 5DNNC 1ULYA 3X1SD 5CPJA 3AYWB 2FJ7A 5CP6B 3O62B 3LELC 4R8PB 4H9SA 3MGPA 3KXBA 3AZKA 5AVCA 4ZUXD 4LD9D 2Y2JA 5KDMB 5B0YB 3AZHB 1P3PD 4H9RB 5GT3B 3LZ0D 4NE3A 5B1MD 4EO5B 3A6NA 1KU5A 3A1IA 3KSYA 2NQBC 1KX4A 1ID3D 4J8VC 5C3IB 5B2IC 1B6WA 1P3OB 3AZIB 3LJAB 3W97C 5GSUC 2NZDD 3W96C 4Z5TB 3AZGC 2DQNC 3X1VA 5GXQB 3VH6T 1AOIB 3IP4C 3TU4A 3MGRD 5GT0B 1ZLAA 4KUDC 3B6GA 1P3KC 4YM6B 5AV5D 3B0DC 3REKC 2RVQC 2HIOB 3C1CB 1HQ3C 4Z66A 4X23D 5FUGA 3WKJB 3AZJC 3REHC 1M19C 4YS3C 5AY8C 5BO0B 4WU9C 3RELB 3AZFC 1BFMA 3A1KA 5AV8D 2CV5D 1TZYB 4XZQA 5BNVB 3O62C 3MGSB 4R8PC 2PYOD 3P5JB 1P3AD 4KHAA 5B2JC 5B0YC 3AZHC 4H9PA 3REJB 5GT3C 4J8XA 1B67A 4NE6A 4EO5C 5BT1D 3AZNB 1P3IC 3KWQB 5AV9B 5CPIB 5C3IC 3R45B 5E5AA 4CAYA 3AZIC 3LJAC 4J8WD 2BYKA 4Z5TC 5B33A 1U35A 5B31B 1P34C 1M1AA 2Y2MA 5GXQC 3UTBD 1AOIC 4XUJB 5GT0C 2VQRA 3X1UD 1PZRA 4YM6C 3AZEA 2HIOC 2ZY2A 3AZMD 3WKJC 1P3LD 3MNND 3V9RB 5B24D 5AVCC 2ZY4A 3RELC 2RIQA 2NQBA 1TZYC 1EQZB 1BH9B 3MGSC 4J8VA 5B2IA 4G92B 4QLCD 3W97A 3REJC 3W98D 4CAYB 4E44A 1P3GD 3AV1A 1S32D 3AZGA 2IO5B 3AZNC 1M18D 5JRGD 3KWQC 2YFWA 3AZLB 1U35B 5AV9C 1P3KA 3TU4C 4CSRB 3NQUB 3REKA 1N1JB 2J8PA 1F1EA 3EPHA 3X1SB 1HQ3A 3AZEB 3AZJA 3REHA 1M19A 4YS3A 5F99D 4XUJC 4WU9A 4ZUXB 4LD9B 1R4VA 3AZFA 3H0MC 1P3PB 3LZ0B 2Y2NA 4H9OA 3AYWA 5B1MB 5CP6A 3O62A 4R8PA 5B40D 4XZQC 2JE5A 5KDMA 5B0YA 1ID3B 4H9RA 5GT3A 2Y2GA 3WA9D 5CPKD 2NZDB 3UTAD 1EQZC 3B6FD 1P3MD 1TAFB 4NFTA 1P3OA 3AZIA 4G92C 5BS7C 3UT9D 3MGRB 1F66D 1P3BD 4Z5TA 5AV5B 2IO5C 3LZ1D 5GXQA 3AFAD 1AOIA 3AZLC 5B33C 4X23B 5GT0A 1U35C 2XD1A 4YM6A 2HIOA 4H9OB 4DRBA 3C1CA 3AV2D 3X1SC 5AV8B 3WKJA 2CV5B 3AZEC 4Z2MG 5AVBD 2PYOB 5BO0A 2ZY3A 4J8UD 4ZUXC 3RELA 1HTAA 3LZ0C 1TZYA 1W2EA 5BNVA 3MGSA 4AWLB 2LY8A 2BYMB 3REJA 3WAAD 2Y2KA 3AZNA 4DQYB 4J8WB 4HGAB 5DNND 5B31G 3KWQA 3AV1C 2NZDC 4WU8D 5AV9A 5CPIA 3LELD 5B32D 3R45A 3UTBB 3MGRC 1KX5A 3X1UB 5AV5C 5B31A 3EPKA 3AZMB 4XUJA 1KX3D 1P3LB 3C1BD 2F8ND 3WTPA 4G91B 3VH6A 5B24B 3MNNB 4KGCD 3B0CT 4H9NB 3B0BA 5B0ZD 3AYWC 5GSUD 3W99A 5AV8C 5CP6C 2CV5C 3KFUG 3W96D 2G5IC 1A7WA 1H3OB 3V9RA 4Z2MH 4QLCB 4KUDD 1P3GB 1EQZA 1S32B 1BH9A 4AWLC 1M18B 3VH6W 3AL0C 5JRGB 5BS7A 3MGQD 5B1LD 1P3OC 5DNMD 2AROD 5AY8D 1KX5B 3AZLA 4JJND 2UWXA 5F99B 5AV6A 3UTBC 4CSRA 3NQUA 3B0CW 1N1JA 2HUEB 5B2JD 3AZHD 3WTPB 3X1SA 3AN2D 3C1CC 3W99B 3AZMC 5B40B 1P3ID 4ZUXA 4LD9A 1P3LC 1P3PA 3LZ0A 3MNNC 5B1MA 3MVDD 3WA9B 2L5AA 3LJAD 3KUYD 5CPKB 3UTAB 1ID3A 3VH5T 3B6FB 3X1TD 1P3MB 5B32G 1BH8B 3H0RC 1P34D 1AOID 2JSSA 4QLCC 3UT9B 1F66B 3NQJB 2NZDA 1P3BB 1P3GC 3REID 2YFVB 1P3FD 1M18C 1TAFA 5CPJD 5JRGC 2XD5A 3AFAB 2FJ7D 5CPIC 3MGRA 2F8NG 4WNNB 3VH5A 3MGPD 3AZKD 3KXBD 5AV6B 2Y2IA 5AVCD 5AV5A 1KX5C 3AV2B
chains in the Genus database with same CATH topology
3A6ND 4X23A 5B31C 5AVBB 3MGSD 5F99C 1KX4D 4J8UB 2HUEC 3EPLA 3WTPC 5AV8A 2CV5A 3WTPE 3VH5W 2JCHA 2PYOA 3W99C 3WAAB 3X1VD 3TU4D 1ZLAD 3B6GD 5CPKC 2BYMA 3UTAC 4WU8B 3B6FC 1P3MC 4Z66D 5B32B 3UT9C 1F66C 4J8WA 1P3BC 3AFAC 3UTBA 4NE5A 1KX3B 4XZQD 3C1BB 3F6TA 3X1UA 2F8NB 2F8NH 4M6BA 5AV6C 4KGCB 2Y2OA 4J8XD 5B0ZB 3AZMA 2F2AC 3AV2C 1JFIB 1P3LA 1P3AB 5AVBC 3MNNA 5B24A 4LD9C 1P3PC 4H9NA 4J8UC 3H0LC 4H9QB 5B1MC 5E5AD 1H3OA 1ID3C 3EPJA 4QLCA 5B33D 3MGQB 3WAAC 1U35D 1M1AD 5B1LB 3W98A 1P3GA 5DNMB 1S32A 2AROB 5AY8B 1M18A 5JRGA 3AZED 4WU8C 4JJNB 4UUZB 5B32C 5B2JB 2ZY5A 2W8SA 3AN2B 1WWSA 5G49B 4WV4B 2NQBD 5F99A 4X23C 1P3IB 1KX3C 5BNXB 5JA4A 3C1BC 4J8VD 5B2ID 4KGCC 3MVDB 3W97D 5B0ZC 5B40A 3KUYB 3AV1D 3AZGD 2PYOC 1P3AC 3X1TB 1P34B 3WA9A 3W98B 5BT1C 5CPKA 1P3KD 3UTAA 4E45A 3REKD 2RVQD 3B6FA 3REIB 2Y2HA 1P3FB 1P3MA 1BH8A 5CPJB 1HQ3D 2ZM5A 2FJ7B 3AZJD 3MGQC 3UT9A 3REHD 1M19D 1F66A 3NQJA 4YS3D 3MGPB 5B1LC 3AZKB 3KXBB 1P3BA 5DNMC 2AROC 5AVCB 2YFVA 4WU9D 4J8WC 3AZFD 4HGAC 3LZ1A 3AFAA 3AYWD 3A6NB 5CP6D 4WNNA 3O62D 4JJNC 4R8PD 1KX4B 5JA4B 5B0YD 5CHLB 5GT3D 3X1UC 3AV2A 3AN2C 5AVBA 4J8UA 4G91C 5B24C 3X1VB 1P3OD 3AZID 3MVDC 3TU4B 1ZLAB 3KUYC 3B6GB 2Y2QA 4Z5TD 3WAAA 1WWIA 3X1TC 5GXQD 4Z66B 5FUGB 5GT0D 4ZBJB 3W98C 5DNNA 4YM6D 1S32C 4WU8A 3REIC 1P3FC 2HIOD 3LZ1B 3LELA 3C1CD 5CPJC 5B32A 2FJ7C 3WKJD 4XZQB 3MGPC 4H9SC 3AZKC 3KXBC 4KHAB 3RELD 4H9PB 4J8XB 1KX3A 1TZYD 3A6NC 2FFFB 3C1BA 2F8NA 2DF4C 1KX4C 4KGCA 3REJD 1Z2CB 5B0ZA 5GSUA 1JFIA 4WJ3C 3W96A 5E5AB 3AZND 2G5HC 2BG1A 4WZSB 1P3AA 5B40C 2BYKB 3KWQD 5AV9D 5B33B 5CPID 4H9QA 3X1VC 1M1AB 4KUDA 3WA9C 3FDDA 1KX5D 1ZLAC 5DNNB 3B6GC 3MGQA 5B31D 3LELB 5B1LA 4XUJD 5DNMA 2AROA 4Z66C 5AY8A 4ZBJC 3WTPD 2CWEA 4UPKA 2Y2LA 4JJNA 3LZ1C 4UUZA 3W99D 2NQBB 5B2JA 3AZHA 4J8VB 5B2IB 3AN2A 3W97B 5G49A 5GSUB 4J8XC 1P3IA 3W96B 5BNXA 3AV1B 1EQZD 3AZGB 3MVDA 2YFWB 3EG5B 3LJAA 1T3UA 4KUDB 3KUYA 1P3KB 4DRAA 3B0DB 5E5AC 3REKB 3X1TA 1P34A 1HQ3B 3AZLD 2Y2PA 3AZJB 3REHB 1M19B 1Q9CA 4YS3B 1M1AC 5AV6D 2F8NK 3REIA 4WU9B 1P3FA 3AZFB 5DNNC 1ULYA 3X1SD 5CPJA 3AYWB 2FJ7A 5CP6B 3O62B 3LELC 4R8PB 4H9SA 3MGPA 3KXBA 3AZKA 5AVCA 4ZUXD 4LD9D 2Y2JA 5KDMB 5B0YB 3AZHB 1P3PD 4H9RB 5GT3B 3LZ0D 4NE3A 5B1MD 4EO5B 3A6NA 1KU5A 3A1IA 3KSYA 2NQBC 1KX4A 1ID3D 4J8VC 5C3IB 5B2IC 1B6WA 1P3OB 3AZIB 3LJAB 3W97C 5GSUC 2NZDD 3W96C 4Z5TB 3AZGC 2DQNC 3X1VA 5GXQB 3VH6T 1AOIB 3IP4C 3TU4A 3MGRD 5GT0B 1ZLAA 4KUDC 3B6GA 1P3KC 4YM6B 5AV5D 3B0DC 3REKC 2RVQC 2HIOB 3C1CB 1HQ3C 4Z66A 4X23D 5FUGA 3WKJB 3AZJC 3REHC 1M19C 4YS3C 5AY8C 5BO0B 4WU9C 3RELB 3AZFC 1BFMA 3A1KA 5AV8D 2CV5D 1TZYB 4XZQA 5BNVB 3O62C 3MGSB 4R8PC 2PYOD 3P5JB 1P3AD 4KHAA 5B2JC 5B0YC 3AZHC 4H9PA 3REJB 5GT3C 4J8XA 1B67A 4NE6A 4EO5C 5BT1D 3AZNB 1P3IC 3KWQB 5AV9B 5CPIB 5C3IC 3R45B 5E5AA 4CAYA 3AZIC 3LJAC 4J8WD 2BYKA 4Z5TC 5B33A 1U35A 5B31B 1P34C 1M1AA 2Y2MA 5GXQC 3UTBD 1AOIC 4XUJB 5GT0C 2VQRA 3X1UD 1PZRA 4YM6C 3AZEA 2HIOC 2ZY2A 3AZMD 3WKJC 1P3LD 3MNND 3V9RB 5B24D 5AVCC 2ZY4A 3RELC 2RIQA 2NQBA 1TZYC 1EQZB 1BH9B 3MGSC 4J8VA 5B2IA 4G92B 4QLCD 3W97A 3REJC 3W98D 4CAYB 4E44A 1P3GD 3AV1A 1S32D 3AZGA 2IO5B 3AZNC 1M18D 5JRGD 3KWQC 2YFWA 3AZLB 1U35B 5AV9C 1P3KA 3TU4C 4CSRB 3NQUB 3REKA 1N1JB 2J8PA 1F1EA 3EPHA 3X1SB 1HQ3A 3AZEB 3AZJA 3REHA 1M19A 4YS3A 5F99D 4XUJC 4WU9A 4ZUXB 4LD9B 1R4VA 3AZFA 3H0MC 1P3PB 3LZ0B 2Y2NA 4H9OA 3AYWA 5B1MB 5CP6A 3O62A 4R8PA 5B40D 4XZQC 2JE5A 5KDMA 5B0YA 1ID3B 4H9RA 5GT3A 2Y2GA 3WA9D 5CPKD 2NZDB 3UTAD 1EQZC 3B6FD 1P3MD 1TAFB 4NFTA 1P3OA 3AZIA 4G92C 5BS7C 3UT9D 3MGRB 1F66D 1P3BD 4Z5TA 5AV5B 2IO5C 3LZ1D 5GXQA 3AFAD 1AOIA 3AZLC 5B33C 4X23B 5GT0A 1U35C 2XD1A 4YM6A 2HIOA 4H9OB 4DRBA 3C1CA 3AV2D 3X1SC 5AV8B 3WKJA 2CV5B 3AZEC 4Z2MG 5AVBD 2PYOB 5BO0A 2ZY3A 4J8UD 4ZUXC 3RELA 1HTAA 3LZ0C 1TZYA 1W2EA 5BNVA 3MGSA 4AWLB 2LY8A 2BYMB 3REJA 3WAAD 2Y2KA 3AZNA 4DQYB 4J8WB 4HGAB 5DNND 5B31G 3KWQA 3AV1C 2NZDC 4WU8D 5AV9A 5CPIA 3LELD 5B32D 3R45A 3UTBB 3MGRC 1KX5A 3X1UB 5AV5C 5B31A 3EPKA 3AZMB 4XUJA 1KX3D 1P3LB 3C1BD 2F8ND 3WTPA 4G91B 3VH6A 5B24B 3MNNB 4KGCD 3B0CT 4H9NB 3B0BA 5B0ZD 3AYWC 5GSUD 3W99A 5AV8C 5CP6C 2CV5C 3KFUG 3W96D 2G5IC 1A7WA 1H3OB 3V9RA 4Z2MH 4QLCB 4KUDD 1P3GB 1EQZA 1S32B 1BH9A 4AWLC 1M18B 3VH6W 3AL0C 5JRGB 5BS7A 3MGQD 5B1LD 1P3OC 5DNMD 2AROD 5AY8D 1KX5B 3AZLA 4JJND 2UWXA 5F99B 5AV6A 3UTBC 4CSRA 3NQUA 3B0CW 1N1JA 2HUEB 5B2JD 3AZHD 3WTPB 3X1SA 3AN2D 3C1CC 3W99B 3AZMC 5B40B 1P3ID 4ZUXA 4LD9A 1P3LC 1P3PA 3LZ0A 3MNNC 5B1MA 3MVDD 3WA9B 2L5AA 3LJAD 3KUYD 5CPKB 3UTAB 1ID3A 3VH5T 3B6FB 3X1TD 1P3MB 5B32G 1BH8B 3H0RC 1P34D 1AOID 2JSSA 4QLCC 3UT9B 1F66B 3NQJB 2NZDA 1P3BB 1P3GC 3REID 2YFVB 1P3FD 1M18C 1TAFA 5CPJD 5JRGC 2XD5A 3AFAB 2FJ7D 5CPIC 3MGRA 2F8NG 4WNNB 3VH5A 3MGPD 3AZKD 3KXBD 5AV6B 2Y2IA 5AVCD 5AV5A 1KX5C 3AV2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A6N D;  4X23 A;  5B31 C;  5AVB B;  3MGS D;  5F99 C;  1KX4 D;  4J8U B;  2HUE C;  3WTP C;  5AV8 A;  2CV5 A;  3WTP E;  3VH5 W;  2PYO A;  3W99 C;  3WAA B;  3X1V D;  3TU4 D;  1ZLA D;  3B6G D;  5CPK C;  2BYM A;  3UTA C;  4WU8 B;  3B6F C;  1P3M C;  4Z66 D;  5B32 B;  3UT9 C;  1F66 C;  4J8W A;  1P3B C;  3AFA C;  3UTB A;  4NE5 A;  1KX3 B;  4XZQ D;  3C1B B;  3X1U A;  2F8N B;  2F8N H;  4M6B A;  5AV6 C;  4KGC B;  4J8X D;  5B0Z B;  3AZM A;  3AV2 C;  1JFI B;  1P3L A;  1P3A B;  5AVB C;  3MNN A;  5B24 A;  4LD9 C;  1P3P C;  4H9N A;  4J8U C;  4H9Q B;  5B1M C;  5E5A D;  1H3O A;  1ID3 C;  4QLC A;  5B33 D;  3MGQ B;  3WAA C;  1U35 D;  1M1A D;  5B1L B;  3W98 A;  1P3G A;  5DNM B;  1S32 A;  2ARO B;  5AY8 B;  1M18 A;  5JRG A;  3AZE D;  4WU8 C;  4JJN B;  4UUZ B;  5B32 C;  5B2J B;  3AN2 B;  1WWS A;  5G49 B;  4WV4 B;  2NQB D;  5F99 A;  4X23 C;  1P3I B;  1KX3 C;  5BNX B;  5JA4 A;  3C1B C;  4J8V D;  5B2I D;  4KGC C;  3MVD B;  3W97 D;  5B0Z C;  5B40 A;  3KUY B;  3AV1 D;  3AZG D;  2PYO C;  1P3A C;  3X1T B;  1P34 B;  3WA9 A;  3W98 B;  5BT1 C;  5CPK A;  1P3K D;  3UTA A;  4E45 A;  3REK D;  2RVQ D;  3B6F A;  3REI B;  1P3F B;  1P3M A;  1BH8 A;  5CPJ B;  1HQ3 D;  2FJ7 B;  3AZJ D;  3MGQ C;  3UT9 A;  3REH D;  1M19 D;  1F66 A;  3NQJ A;  4YS3 D;  3MGP B;  5B1L C;  3AZK B;  3KXB B;  1P3B A;  5DNM C;  2ARO C;  5AVC B;  2YFV A;  4WU9 D;  4J8W C;  3AZF D;  4HGA C;  3LZ1 A;  3AFA A;  3AYW D;  3A6N B;  5CP6 D;  4WNN A;  3O62 D;  4JJN C;  4R8P D;  1KX4 B;  5JA4 B;  5B0Y D;  5CHL B;  5GT3 D;  3X1U C;  3AV2 A;  3AN2 C;  5AVB A;  4J8U A;  4G91 C;  5B24 C;  3X1V B;  1P3O D;  3AZI D;  3MVD C;  3TU4 B;  1ZLA B;  3KUY C;  3B6G B;  4Z5T D;  3WAA A;  1WWI A;  3X1T C;  5GXQ D;  4Z66 B;  5FUG B;  5GT0 D;  4ZBJ B;  3W98 C;  5DNN A;  4YM6 D;  1S32 C;  4WU8 A;  3REI C;  1P3F C;  2HIO D;  3LZ1 B;  3LEL A;  3C1C D;  5CPJ C;  5B32 A;  2FJ7 C;  3WKJ D;  4XZQ B;  3MGP C;  4H9S C;  3AZK C;  3KXB C;  4KHA B;  3REL D;  4H9P B;  4J8X B;  1KX3 A;  1TZY D;  3A6N C;  3C1B A;  2F8N A;  1KX4 C;  4KGC A;  3REJ D;  5B0Z A;  5GSU A;  1JFI A;  3W96 A;  5E5A B;  3AZN D;  4WZS B;  1P3A A;  5B40 C;  2BYK B;  3KWQ D;  5AV9 D;  5B33 B;  5CPI D;  4H9Q A;  3X1V C;  1M1A B;  4KUD A;  3WA9 C;  1KX5 D;  1ZLA C;  5DNN B;  3B6G C;  3MGQ A;  5B31 D;  3LEL B;  5B1L A;  4XUJ D;  5DNM A;  2ARO A;  4Z66 C;  5AY8 A;  4ZBJ C;  3WTP D;  2CWE A;  4JJN A;  3LZ1 C;  4UUZ A;  3W99 D;  2NQB B;  5B2J A;  3AZH A;  4J8V B;  5B2I B;  3AN2 A;  3W97 B;  5G49 A;  5GSU B;  4J8X C;  1P3I A;  3W96 B;  5BNX A;  3AV1 B;  1EQZ D;  3AZG B;  3MVD A;  2YFW B;  3LJA A;  4KUD B;  3KUY A;  1P3K B;  4DRA A;  3B0D B;  5E5A C;  3REK B;  3X1T A;  1P34 A;  1HQ3 B;  3AZL D;  3AZJ B;  3REH B;  1M19 B;  1Q9C A;  4YS3 B;  1M1A C;  5AV6 D;  2F8N K;  3REI A;  4WU9 B;  1P3F A;  3AZF B;  5DNN C;  1ULY A;  3X1S D;  5CPJ A;  3AYW B;  2FJ7 A;  5CP6 B;  3O62 B;  3LEL C;  4R8P B;  4H9S A;  3MGP A;  3KXB A;  3AZK A;  5AVC A;  4ZUX D;  4LD9 D;  5KDM B;  5B0Y B;  3AZH B;  1P3P D;  4H9R B;  5GT3 B;  3LZ0 D;  4NE3 A;  5B1M D;  4EO5 B;  3A6N A;  1KU5 A;  3KSY A;  2NQB C;  1KX4 A;  1ID3 D;  4J8V C;  5C3I B;  5B2I C;  1B6W A;  1P3O B;  3AZI B;  3LJA B;  3W97 C;  5GSU C;  2NZD D;  3W96 C;  4Z5T B;  3AZG C;  3X1V A;  5GXQ B;  3VH6 T;  1AOI B;  3TU4 A;  3MGR D;  5GT0 B;  1ZLA A;  4KUD C;  3B6G A;  1P3K C;  4YM6 B;  5AV5 D;  3B0D C;  3REK C;  2RVQ C;  2HIO B;  3C1C B;  1HQ3 C;  4Z66 A;  4X23 D;  5FUG A;  3WKJ B;  3AZJ C;  3REH C;  1M19 C;  4YS3 C;  5AY8 C;  5BO0 B;  4WU9 C;  3REL B;  3AZF C;  1BFM A;  5AV8 D;  2CV5 D;  1TZY B;  4XZQ A;  5BNV B;  3O62 C;  3MGS B;  4R8P C;  2PYO D;  1P3A D;  4KHA A;  5B2J C;  5B0Y C;  3AZH C;  4H9P A;  3REJ B;  5GT3 C;  4J8X A;  1B67 A;  4NE6 A;  4EO5 C;  5BT1 D;  3AZN B;  1P3I C;  3KWQ B;  5AV9 B;  5CPI B;  5C3I C;  3R45 B;  5E5A A;  4CAY A;  3AZI C;  3LJA C;  4J8W D;  2BYK A;  4Z5T C;  5B33 A;  1U35 A;  5B31 B;  1P34 C;  1M1A A;  5GXQ C;  3UTB D;  1AOI C;  4XUJ B;  5GT0 C;  3X1U D;  4YM6 C;  3AZE A;  2HIO C;  3AZM D;  3WKJ C;  1P3L D;  3MNN D;  3V9R B;  5B24 D;  5AVC C;  3REL C;  2NQB A;  1TZY C;  1EQZ B;  1BH9 B;  3MGS C;  4J8V A;  5B2I A;  4G92 B;  4QLC D;  3W97 A;  3REJ C;  3W98 D;  4CAY B;  4E44 A;  1P3G D;  3AV1 A;  1S32 D;  3AZG A;  2IO5 B;  3AZN C;  1M18 D;  5JRG D;  3KWQ C;  2YFW A;  3AZL B;  1U35 B;  5AV9 C;  1P3K A;  3TU4 C;  4CSR B;  3NQU B;  3REK A;  1N1J B;  1F1E A;  3X1S B;  1HQ3 A;  3AZE B;  3AZJ A;  3REH A;  1M19 A;  4YS3 A;  5F99 D;  4XUJ C;  4WU9 A;  4ZUX B;  4LD9 B;  1R4V A;  3AZF A;  1P3P B;  3LZ0 B;  4H9O A;  3AYW A;  5B1M B;  5CP6 A;  3O62 A;  4R8P A;  5B40 D;  4XZQ C;  5KDM A;  5B0Y A;  1ID3 B;  4H9R A;  5GT3 A;  3WA9 D;  5CPK D;  2NZD B;  3UTA D;  1EQZ C;  3B6F D;  1P3M D;  1TAF B;  4NFT A;  1P3O A;  3AZI A;  4G92 C;  5BS7 C;  3UT9 D;  3MGR B;  1F66 D;  1P3B D;  4Z5T A;  5AV5 B;  2IO5 C;  3LZ1 D;  5GXQ A;  3AFA D;  1AOI A;  3AZL C;  5B33 C;  4X23 B;  5GT0 A;  1U35 C;  4YM6 A;  2HIO A;  4H9O B;  4DRB A;  3C1C A;  3AV2 D;  3X1S C;  5AV8 B;  3WKJ A;  2CV5 B;  3AZE C;  4Z2M G;  5AVB D;  2PYO B;  5BO0 A;  4J8U D;  4ZUX C;  3REL A;  1HTA A;  3LZ0 C;  1TZY A;  5BNV A;  3MGS A;  4AWL B;  2LY8 A;  2BYM B;  3REJ A;  3WAA D;  3AZN A;  4J8W B;  4HGA B;  5DNN D;  5B31 G;  3KWQ A;  3AV1 C;  2NZD C;  4WU8 D;  5AV9 A;  5CPI A;  3LEL D;  5B32 D;  3R45 A;  3UTB B;  3MGR C;  1KX5 A;  3X1U B;  5AV5 C;  5B31 A;  3AZM B;  4XUJ A;  1KX3 D;  1P3L B;  3C1B D;  2F8N D;  3WTP A;  4G91 B;  3VH6 A;  5B24 B;  3MNN B;  4KGC D;  4H9N B;  3B0C T;  3B0B A;  5B0Z D;  3AYW C;  5GSU D;  3W99 A;  5AV8 C;  5CP6 C;  2CV5 C;  3W96 D;  1A7W A;  1H3O B;  3V9R A;  4Z2M H;  4QLC B;  4KUD D;  1P3G B;  1EQZ A;  1S32 B;  1BH9 A;  4AWL C;  1M18 B;  3VH6 W;  5JRG B;  5BS7 A;  3MGQ D;  5B1L D;  1P3O C;  5DNM D;  2ARO D;  5AY8 D;  1KX5 B;  3AZL A;  4JJN D;  5F99 B;  5AV6 A;  3UTB C;  4CSR A;  3NQU A;  3B0C W;  1N1J A;  2HUE B;  5B2J D;  3AZH D;  3WTP B;  3X1S A;  3AN2 D;  3C1C C;  3W99 B;  3AZM C;  5B40 B;  1P3I D;  4ZUX A;  4LD9 A;  1P3L C;  1P3P A;  3LZ0 A;  3MNN C;  5B1M A;  3MVD D;  3WA9 B;  2L5A A;  3LJA D;  3KUY D;  5CPK B;  3UTA B;  1ID3 A;  3VH5 T;  3B6F B;  3X1T D;  1P3M B;  5B32 G;  1BH8 B;  1P34 D;  1AOI D;  2JSS A;  4QLC C;  3UT9 B;  1F66 B;  3NQJ B;  2NZD A;  1P3B B;  1P3G C;  3REI D;  2YFV B;  1P3F D;  1M18 C;  1TAF A;  5CPJ D;  5JRG C;  3AFA B;  2FJ7 D;  5CPI C;  3MGR A;  2F8N G;  4WNN B;  3VH5 A;  3MGP D;  3AZK D;  3KXB D;  5AV6 B;  5AVC D;  5AV5 A;  1KX5 C;  3AV2 B; 
#chains in the Genus database with same CATH topology
 3A6N D;  4X23 A;  5B31 C;  5AVB B;  3MGS D;  5F99 C;  1KX4 D;  4J8U B;  2HUE C;  3EPL A;  3WTP C;  5AV8 A;  2CV5 A;  3WTP E;  3VH5 W;  2JCH A;  2PYO A;  3W99 C;  3WAA B;  3X1V D;  3TU4 D;  1ZLA D;  3B6G D;  5CPK C;  2BYM A;  3UTA C;  4WU8 B;  3B6F C;  1P3M C;  4Z66 D;  5B32 B;  3UT9 C;  1F66 C;  4J8W A;  1P3B C;  3AFA C;  3UTB A;  4NE5 A;  1KX3 B;  4XZQ D;  3C1B B;  3F6T A;  3X1U A;  2F8N B;  2F8N H;  4M6B A;  5AV6 C;  4KGC B;  2Y2O A;  4J8X D;  5B0Z B;  3AZM A;  2F2A C;  3AV2 C;  1JFI B;  1P3L A;  1P3A B;  5AVB C;  3MNN A;  5B24 A;  4LD9 C;  1P3P C;  4H9N A;  4J8U C;  3H0L C;  4H9Q B;  5B1M C;  5E5A D;  1H3O A;  1ID3 C;  3EPJ A;  4QLC A;  5B33 D;  3MGQ B;  3WAA C;  1U35 D;  1M1A D;  5B1L B;  3W98 A;  1P3G A;  5DNM B;  1S32 A;  2ARO B;  5AY8 B;  1M18 A;  5JRG A;  3AZE D;  4WU8 C;  4JJN B;  4UUZ B;  5B32 C;  5B2J B;  2ZY5 A;  2W8S A;  3AN2 B;  1WWS A;  5G49 B;  4WV4 B;  2NQB D;  5F99 A;  4X23 C;  1P3I B;  1KX3 C;  5BNX B;  5JA4 A;  3C1B C;  4J8V D;  5B2I D;  4KGC C;  3MVD B;  3W97 D;  5B0Z C;  5B40 A;  3KUY B;  3AV1 D;  3AZG D;  2PYO C;  1P3A C;  3X1T B;  1P34 B;  3WA9 A;  3W98 B;  5BT1 C;  5CPK A;  1P3K D;  3UTA A;  4E45 A;  3REK D;  2RVQ D;  3B6F A;  3REI B;  2Y2H A;  1P3F B;  1P3M A;  1BH8 A;  5CPJ B;  1HQ3 D;  2ZM5 A;  2FJ7 B;  3AZJ D;  3MGQ C;  3UT9 A;  3REH D;  1M19 D;  1F66 A;  3NQJ A;  4YS3 D;  3MGP B;  5B1L C;  3AZK B;  3KXB B;  1P3B A;  5DNM C;  2ARO C;  5AVC B;  2YFV A;  4WU9 D;  4J8W C;  3AZF D;  4HGA C;  3LZ1 A;  3AFA A;  3AYW D;  3A6N B;  5CP6 D;  4WNN A;  3O62 D;  4JJN C;  4R8P D;  1KX4 B;  5JA4 B;  5B0Y D;  5CHL B;  5GT3 D;  3X1U C;  3AV2 A;  3AN2 C;  5AVB A;  4J8U A;  4G91 C;  5B24 C;  3X1V B;  1P3O D;  3AZI D;  3MVD C;  3TU4 B;  1ZLA B;  3KUY C;  3B6G B;  2Y2Q A;  4Z5T D;  3WAA A;  1WWI A;  3X1T C;  5GXQ D;  4Z66 B;  5FUG B;  5GT0 D;  4ZBJ B;  3W98 C;  5DNN A;  4YM6 D;  1S32 C;  4WU8 A;  3REI C;  1P3F C;  2HIO D;  3LZ1 B;  3LEL A;  3C1C D;  5CPJ C;  5B32 A;  2FJ7 C;  3WKJ D;  4XZQ B;  3MGP C;  4H9S C;  3AZK C;  3KXB C;  4KHA B;  3REL D;  4H9P B;  4J8X B;  1KX3 A;  1TZY D;  3A6N C;  2FFF B;  3C1B A;  2F8N A;  2DF4 C;  1KX4 C;  4KGC A;  3REJ D;  1Z2C B;  5B0Z A;  5GSU A;  1JFI A;  4WJ3 C;  3W96 A;  5E5A B;  3AZN D;  2G5H C;  2BG1 A;  4WZS B;  1P3A A;  5B40 C;  2BYK B;  3KWQ D;  5AV9 D;  5B33 B;  5CPI D;  4H9Q A;  3X1V C;  1M1A B;  4KUD A;  3WA9 C;  3FDD A;  1KX5 D;  1ZLA C;  5DNN B;  3B6G C;  3MGQ A;  5B31 D;  3LEL B;  5B1L A;  4XUJ D;  5DNM A;  2ARO A;  4Z66 C;  5AY8 A;  4ZBJ C;  3WTP D;  2CWE A;  4UPK A;  2Y2L A;  4JJN A;  3LZ1 C;  4UUZ A;  3W99 D;  2NQB B;  5B2J A;  3AZH A;  4J8V B;  5B2I B;  3AN2 A;  3W97 B;  5G49 A;  5GSU B;  4J8X C;  1P3I A;  3W96 B;  5BNX A;  3AV1 B;  1EQZ D;  3AZG B;  3MVD A;  2YFW B;  3EG5 B;  3LJA A;  1T3U A;  4KUD B;  3KUY A;  1P3K B;  4DRA A;  3B0D B;  5E5A C;  3REK B;  3X1T A;  1P34 A;  1HQ3 B;  3AZL D;  2Y2P A;  3AZJ B;  3REH B;  1M19 B;  1Q9C A;  4YS3 B;  1M1A C;  5AV6 D;  2F8N K;  3REI A;  4WU9 B;  1P3F A;  3AZF B;  5DNN C;  1ULY A;  3X1S D;  5CPJ A;  3AYW B;  2FJ7 A;  5CP6 B;  3O62 B;  3LEL C;  4R8P B;  4H9S A;  3MGP A;  3KXB A;  3AZK A;  5AVC A;  4ZUX D;  4LD9 D;  2Y2J A;  5KDM B;  5B0Y B;  3AZH B;  1P3P D;  4H9R B;  5GT3 B;  3LZ0 D;  4NE3 A;  5B1M D;  4EO5 B;  3A6N A;  1KU5 A;  3A1I A;  3KSY A;  2NQB C;  1KX4 A;  1ID3 D;  4J8V C;  5C3I B;  5B2I C;  1B6W A;  1P3O B;  3AZI B;  3LJA B;  3W97 C;  5GSU C;  2NZD D;  3W96 C;  4Z5T B;  3AZG C;  2DQN C;  3X1V A;  5GXQ B;  3VH6 T;  1AOI B;  3IP4 C;  3TU4 A;  3MGR D;  5GT0 B;  1ZLA A;  4KUD C;  3B6G A;  1P3K C;  4YM6 B;  5AV5 D;  3B0D C;  3REK C;  2RVQ C;  2HIO B;  3C1C B;  1HQ3 C;  4Z66 A;  4X23 D;  5FUG A;  3WKJ B;  3AZJ C;  3REH C;  1M19 C;  4YS3 C;  5AY8 C;  5BO0 B;  4WU9 C;  3REL B;  3AZF C;  1BFM A;  3A1K A;  5AV8 D;  2CV5 D;  1TZY B;  4XZQ A;  5BNV B;  3O62 C;  3MGS B;  4R8P C;  2PYO D;  3P5J B;  1P3A D;  4KHA A;  5B2J C;  5B0Y C;  3AZH C;  4H9P A;  3REJ B;  5GT3 C;  4J8X A;  1B67 A;  4NE6 A;  4EO5 C;  5BT1 D;  3AZN B;  1P3I C;  3KWQ B;  5AV9 B;  5CPI B;  5C3I C;  3R45 B;  5E5A A;  4CAY A;  3AZI C;  3LJA C;  4J8W D;  2BYK A;  4Z5T C;  5B33 A;  1U35 A;  5B31 B;  1P34 C;  1M1A A;  2Y2M A;  5GXQ C;  3UTB D;  1AOI C;  4XUJ B;  5GT0 C;  2VQR A;  3X1U D;  1PZR A;  4YM6 C;  3AZE A;  2HIO C;  2ZY2 A;  3AZM D;  3WKJ C;  1P3L D;  3MNN D;  3V9R B;  5B24 D;  5AVC C;  2ZY4 A;  3REL C;  2RIQ A;  2NQB A;  1TZY C;  1EQZ B;  1BH9 B;  3MGS C;  4J8V A;  5B2I A;  4G92 B;  4QLC D;  3W97 A;  3REJ C;  3W98 D;  4CAY B;  4E44 A;  1P3G D;  3AV1 A;  1S32 D;  3AZG A;  2IO5 B;  3AZN C;  1M18 D;  5JRG D;  3KWQ C;  2YFW A;  3AZL B;  1U35 B;  5AV9 C;  1P3K A;  3TU4 C;  4CSR B;  3NQU B;  3REK A;  1N1J B;  2J8P A;  1F1E A;  3EPH A;  3X1S B;  1HQ3 A;  3AZE B;  3AZJ A;  3REH A;  1M19 A;  4YS3 A;  5F99 D;  4XUJ C;  4WU9 A;  4ZUX B;  4LD9 B;  1R4V A;  3AZF A;  3H0M C;  1P3P B;  3LZ0 B;  2Y2N A;  4H9O A;  3AYW A;  5B1M B;  5CP6 A;  3O62 A;  4R8P A;  5B40 D;  4XZQ C;  2JE5 A;  5KDM A;  5B0Y A;  1ID3 B;  4H9R A;  5GT3 A;  2Y2G A;  3WA9 D;  5CPK D;  2NZD B;  3UTA D;  1EQZ C;  3B6F D;  1P3M D;  1TAF B;  4NFT A;  1P3O A;  3AZI A;  4G92 C;  5BS7 C;  3UT9 D;  3MGR B;  1F66 D;  1P3B D;  4Z5T A;  5AV5 B;  2IO5 C;  3LZ1 D;  5GXQ A;  3AFA D;  1AOI A;  3AZL C;  5B33 C;  4X23 B;  5GT0 A;  1U35 C;  2XD1 A;  4YM6 A;  2HIO A;  4H9O B;  4DRB A;  3C1C A;  3AV2 D;  3X1S C;  5AV8 B;  3WKJ A;  2CV5 B;  3AZE C;  4Z2M G;  5AVB D;  2PYO B;  5BO0 A;  2ZY3 A;  4J8U D;  4ZUX C;  3REL A;  1HTA A;  3LZ0 C;  1TZY A;  1W2E A;  5BNV A;  3MGS A;  4AWL B;  2LY8 A;  2BYM B;  3REJ A;  3WAA D;  2Y2K A;  3AZN A;  4DQY B;  4J8W B;  4HGA B;  5DNN D;  5B31 G;  3KWQ A;  3AV1 C;  2NZD C;  4WU8 D;  5AV9 A;  5CPI A;  3LEL D;  5B32 D;  3R45 A;  3UTB B;  3MGR C;  1KX5 A;  3X1U B;  5AV5 C;  5B31 A;  3EPK A;  3AZM B;  4XUJ A;  1KX3 D;  1P3L B;  3C1B D;  2F8N D;  3WTP A;  4G91 B;  3VH6 A;  5B24 B;  3MNN B;  4KGC D;  3B0C T;  4H9N B;  3B0B A;  5B0Z D;  3AYW C;  5GSU D;  3W99 A;  5AV8 C;  5CP6 C;  2CV5 C;  3KFU G;  3W96 D;  2G5I C;  1A7W A;  1H3O B;  3V9R A;  4Z2M H;  4QLC B;  4KUD D;  1P3G B;  1EQZ A;  1S32 B;  1BH9 A;  4AWL C;  1M18 B;  3VH6 W;  3AL0 C;  5JRG B;  5BS7 A;  3MGQ D;  5B1L D;  1P3O C;  5DNM D;  2ARO D;  5AY8 D;  1KX5 B;  3AZL A;  4JJN D;  2UWX A;  5F99 B;  5AV6 A;  3UTB C;  4CSR A;  3NQU A;  3B0C W;  1N1J A;  2HUE B;  5B2J D;  3AZH D;  3WTP B;  3X1S A;  3AN2 D;  3C1C C;  3W99 B;  3AZM C;  5B40 B;  1P3I D;  4ZUX A;  4LD9 A;  1P3L C;  1P3P A;  3LZ0 A;  3MNN C;  5B1M A;  3MVD D;  3WA9 B;  2L5A A;  3LJA D;  3KUY D;  5CPK B;  3UTA B;  1ID3 A;  3VH5 T;  3B6F B;  3X1T D;  1P3M B;  5B32 G;  1BH8 B;  3H0R C;  1P34 D;  1AOI D;  2JSS A;  4QLC C;  3UT9 B;  1F66 B;  3NQJ B;  2NZD A;  1P3B B;  1P3G C;  3REI D;  2YFV B;  1P3F D;  1M18 C;  1TAF A;  5CPJ D;  5JRG C;  2XD5 A;  3AFA B;  2FJ7 D;  5CPI C;  3MGR A;  2F8N G;  4WNN B;  3VH5 A;  3MGP D;  3AZK D;  3KXB D;  5AV6 B;  2Y2I A;  5AVC D;  5AV5 A;  1KX5 C;  3AV2 B; 
#chains in the Genus database with same CATH homology
 3A6N D;  4X23 A;  5B31 C;  5AVB B;  3MGS D;  5F99 C;  1KX4 D;  4J8U B;  2HUE C;  3EPL A;  3WTP C;  5AV8 A;  2CV5 A;  3WTP E;  3VH5 W;  2JCH A;  2PYO A;  3W99 C;  3WAA B;  3X1V D;  3TU4 D;  1ZLA D;  3B6G D;  5CPK C;  2BYM A;  3UTA C;  4WU8 B;  3B6F C;  1P3M C;  4Z66 D;  5B32 B;  3UT9 C;  1F66 C;  4J8W A;  1P3B C;  3AFA C;  3UTB A;  4NE5 A;  1KX3 B;  4XZQ D;  3C1B B;  3F6T A;  3X1U A;  2F8N B;  2F8N H;  4M6B A;  5AV6 C;  4KGC B;  2Y2O A;  4J8X D;  5B0Z B;  3AZM A;  2F2A C;  3AV2 C;  1JFI B;  1P3L A;  1P3A B;  5AVB C;  3MNN A;  5B24 A;  4LD9 C;  1P3P C;  4H9N A;  4J8U C;  3H0L C;  4H9Q B;  5B1M C;  5E5A D;  1H3O A;  1ID3 C;  3EPJ A;  4QLC A;  5B33 D;  3MGQ B;  3WAA C;  1U35 D;  1M1A D;  5B1L B;  3W98 A;  1P3G A;  5DNM B;  1S32 A;  2ARO B;  5AY8 B;  1M18 A;  5JRG A;  3AZE D;  4WU8 C;  4JJN B;  4UUZ B;  5B32 C;  5B2J B;  2ZY5 A;  2W8S A;  3AN2 B;  1WWS A;  5G49 B;  4WV4 B;  2NQB D;  5F99 A;  4X23 C;  1P3I B;  1KX3 C;  5BNX B;  5JA4 A;  3C1B C;  4J8V D;  5B2I D;  4KGC C;  3MVD B;  3W97 D;  5B0Z C;  5B40 A;  3KUY B;  3AV1 D;  3AZG D;  2PYO C;  1P3A C;  3X1T B;  1P34 B;  3WA9 A;  3W98 B;  5BT1 C;  5CPK A;  1P3K D;  3UTA A;  4E45 A;  3REK D;  2RVQ D;  3B6F A;  3REI B;  2Y2H A;  1P3F B;  1P3M A;  1BH8 A;  5CPJ B;  1HQ3 D;  2ZM5 A;  2FJ7 B;  3AZJ D;  3MGQ C;  3UT9 A;  3REH D;  1M19 D;  1F66 A;  3NQJ A;  4YS3 D;  3MGP B;  5B1L C;  3AZK B;  3KXB B;  1P3B A;  5DNM C;  2ARO C;  5AVC B;  2YFV A;  4WU9 D;  4J8W C;  3AZF D;  4HGA C;  3LZ1 A;  3AFA A;  3AYW D;  3A6N B;  5CP6 D;  4WNN A;  3O62 D;  4JJN C;  4R8P D;  1KX4 B;  5JA4 B;  5B0Y D;  5CHL B;  5GT3 D;  3X1U C;  3AV2 A;  3AN2 C;  5AVB A;  4J8U A;  4G91 C;  5B24 C;  3X1V B;  1P3O D;  3AZI D;  3MVD C;  3TU4 B;  1ZLA B;  3KUY C;  3B6G B;  2Y2Q A;  4Z5T D;  3WAA A;  1WWI A;  3X1T C;  5GXQ D;  4Z66 B;  5FUG B;  5GT0 D;  4ZBJ B;  3W98 C;  5DNN A;  4YM6 D;  1S32 C;  4WU8 A;  3REI C;  1P3F C;  2HIO D;  3LZ1 B;  3LEL A;  3C1C D;  5CPJ C;  5B32 A;  2FJ7 C;  3WKJ D;  4XZQ B;  3MGP C;  4H9S C;  3AZK C;  3KXB C;  4KHA B;  3REL D;  4H9P B;  4J8X B;  1KX3 A;  1TZY D;  3A6N C;  2FFF B;  3C1B A;  2F8N A;  2DF4 C;  1KX4 C;  4KGC A;  3REJ D;  1Z2C B;  5B0Z A;  5GSU A;  1JFI A;  4WJ3 C;  3W96 A;  5E5A B;  3AZN D;  2G5H C;  2BG1 A;  4WZS B;  1P3A A;  5B40 C;  2BYK B;  3KWQ D;  5AV9 D;  5B33 B;  5CPI D;  4H9Q A;  3X1V C;  1M1A B;  4KUD A;  3WA9 C;  3FDD A;  1KX5 D;  1ZLA C;  5DNN B;  3B6G C;  3MGQ A;  5B31 D;  3LEL B;  5B1L A;  4XUJ D;  5DNM A;  2ARO A;  4Z66 C;  5AY8 A;  4ZBJ C;  3WTP D;  2CWE A;  4UPK A;  2Y2L A;  4JJN A;  3LZ1 C;  4UUZ A;  3W99 D;  2NQB B;  5B2J A;  3AZH A;  4J8V B;  5B2I B;  3AN2 A;  3W97 B;  5G49 A;  5GSU B;  4J8X C;  1P3I A;  3W96 B;  5BNX A;  3AV1 B;  1EQZ D;  3AZG B;  3MVD A;  2YFW B;  3EG5 B;  3LJA A;  1T3U A;  4KUD B;  3KUY A;  1P3K B;  4DRA A;  3B0D B;  5E5A C;  3REK B;  3X1T A;  1P34 A;  1HQ3 B;  3AZL D;  2Y2P A;  3AZJ B;  3REH B;  1M19 B;  1Q9C A;  4YS3 B;  1M1A C;  5AV6 D;  2F8N K;  3REI A;  4WU9 B;  1P3F A;  3AZF B;  5DNN C;  1ULY A;  3X1S D;  5CPJ A;  3AYW B;  2FJ7 A;  5CP6 B;  3O62 B;  3LEL C;  4R8P B;  4H9S A;  3MGP A;  3KXB A;  3AZK A;  5AVC A;  4ZUX D;  4LD9 D;  2Y2J A;  5KDM B;  5B0Y B;  3AZH B;  1P3P D;  4H9R B;  5GT3 B;  3LZ0 D;  4NE3 A;  5B1M D;  4EO5 B;  3A6N A;  1KU5 A;  3A1I A;  3KSY A;  2NQB C;  1KX4 A;  1ID3 D;  4J8V C;  5C3I B;  5B2I C;  1B6W A;  1P3O B;  3AZI B;  3LJA B;  3W97 C;  5GSU C;  2NZD D;  3W96 C;  4Z5T B;  3AZG C;  2DQN C;  3X1V A;  5GXQ B;  3VH6 T;  1AOI B;  3IP4 C;  3TU4 A;  3MGR D;  5GT0 B;  1ZLA A;  4KUD C;  3B6G A;  1P3K C;  4YM6 B;  5AV5 D;  3B0D C;  3REK C;  2RVQ C;  2HIO B;  3C1C B;  1HQ3 C;  4Z66 A;  4X23 D;  5FUG A;  3WKJ B;  3AZJ C;  3REH C;  1M19 C;  4YS3 C;  5AY8 C;  5BO0 B;  4WU9 C;  3REL B;  3AZF C;  1BFM A;  3A1K A;  5AV8 D;  2CV5 D;  1TZY B;  4XZQ A;  5BNV B;  3O62 C;  3MGS B;  4R8P C;  2PYO D;  3P5J B;  1P3A D;  4KHA A;  5B2J C;  5B0Y C;  3AZH C;  4H9P A;  3REJ B;  5GT3 C;  4J8X A;  1B67 A;  4NE6 A;  4EO5 C;  5BT1 D;  3AZN B;  1P3I C;  3KWQ B;  5AV9 B;  5CPI B;  5C3I C;  3R45 B;  5E5A A;  4CAY A;  3AZI C;  3LJA C;  4J8W D;  2BYK A;  4Z5T C;  5B33 A;  1U35 A;  5B31 B;  1P34 C;  1M1A A;  2Y2M A;  5GXQ C;  3UTB D;  1AOI C;  4XUJ B;  5GT0 C;  2VQR A;  3X1U D;  1PZR A;  4YM6 C;  3AZE A;  2HIO C;  2ZY2 A;  3AZM D;  3WKJ C;  1P3L D;  3MNN D;  3V9R B;  5B24 D;  5AVC C;  2ZY4 A;  3REL C;  2RIQ A;  2NQB A;  1TZY C;  1EQZ B;  1BH9 B;  3MGS C;  4J8V A;  5B2I A;  4G92 B;  4QLC D;  3W97 A;  3REJ C;  3W98 D;  4CAY B;  4E44 A;  1P3G D;  3AV1 A;  1S32 D;  3AZG A;  2IO5 B;  3AZN C;  1M18 D;  5JRG D;  3KWQ C;  2YFW A;  3AZL B;  1U35 B;  5AV9 C;  1P3K A;  3TU4 C;  4CSR B;  3NQU B;  3REK A;  1N1J B;  2J8P A;  1F1E A;  3EPH A;  3X1S B;  1HQ3 A;  3AZE B;  3AZJ A;  3REH A;  1M19 A;  4YS3 A;  5F99 D;  4XUJ C;  4WU9 A;  4ZUX B;  4LD9 B;  1R4V A;  3AZF A;  3H0M C;  1P3P B;  3LZ0 B;  2Y2N A;  4H9O A;  3AYW A;  5B1M B;  5CP6 A;  3O62 A;  4R8P A;  5B40 D;  4XZQ C;  2JE5 A;  5KDM A;  5B0Y A;  1ID3 B;  4H9R A;  5GT3 A;  2Y2G A;  3WA9 D;  5CPK D;  2NZD B;  3UTA D;  1EQZ C;  3B6F D;  1P3M D;  1TAF B;  4NFT A;  1P3O A;  3AZI A;  4G92 C;  5BS7 C;  3UT9 D;  3MGR B;  1F66 D;  1P3B D;  4Z5T A;  5AV5 B;  2IO5 C;  3LZ1 D;  5GXQ A;  3AFA D;  1AOI A;  3AZL C;  5B33 C;  4X23 B;  5GT0 A;  1U35 C;  2XD1 A;  4YM6 A;  2HIO A;  4H9O B;  4DRB A;  3C1C A;  3AV2 D;  3X1S C;  5AV8 B;  3WKJ A;  2CV5 B;  3AZE C;  4Z2M G;  5AVB D;  2PYO B;  5BO0 A;  2ZY3 A;  4J8U D;  4ZUX C;  3REL A;  1HTA A;  3LZ0 C;  1TZY A;  1W2E A;  5BNV A;  3MGS A;  4AWL B;  2LY8 A;  2BYM B;  3REJ A;  3WAA D;  2Y2K A;  3AZN A;  4DQY B;  4J8W B;  4HGA B;  5DNN D;  5B31 G;  3KWQ A;  3AV1 C;  2NZD C;  4WU8 D;  5AV9 A;  5CPI A;  3LEL D;  5B32 D;  3R45 A;  3UTB B;  3MGR C;  1KX5 A;  3X1U B;  5AV5 C;  5B31 A;  3EPK A;  3AZM B;  4XUJ A;  1KX3 D;  1P3L B;  3C1B D;  2F8N D;  3WTP A;  4G91 B;  3VH6 A;  5B24 B;  3MNN B;  4KGC D;  3B0C T;  4H9N B;  3B0B A;  5B0Z D;  3AYW C;  5GSU D;  3W99 A;  5AV8 C;  5CP6 C;  2CV5 C;  3KFU G;  3W96 D;  2G5I C;  1A7W A;  1H3O B;  3V9R A;  4Z2M H;  4QLC B;  4KUD D;  1P3G B;  1EQZ A;  1S32 B;  1BH9 A;  4AWL C;  1M18 B;  3VH6 W;  3AL0 C;  5JRG B;  5BS7 A;  3MGQ D;  5B1L D;  1P3O C;  5DNM D;  2ARO D;  5AY8 D;  1KX5 B;  3AZL A;  4JJN D;  2UWX A;  5F99 B;  5AV6 A;  3UTB C;  4CSR A;  3NQU A;  3B0C W;  1N1J A;  2HUE B;  5B2J D;  3AZH D;  3WTP B;  3X1S A;  3AN2 D;  3C1C C;  3W99 B;  3AZM C;  5B40 B;  1P3I D;  4ZUX A;  4LD9 A;  1P3L C;  1P3P A;  3LZ0 A;  3MNN C;  5B1M A;  3MVD D;  3WA9 B;  2L5A A;  3LJA D;  3KUY D;  5CPK B;  3UTA B;  1ID3 A;  3VH5 T;  3B6F B;  3X1T D;  1P3M B;  5B32 G;  1BH8 B;  3H0R C;  1P34 D;  1AOI D;  2JSS A;  4QLC C;  3UT9 B;  1F66 B;  3NQJ B;  2NZD A;  1P3B B;  1P3G C;  3REI D;  2YFV B;  1P3F D;  1M18 C;  1TAF A;  5CPJ D;  5JRG C;  2XD5 A;  3AFA B;  2FJ7 D;  5CPI C;  3MGR A;  2F8N G;  4WNN B;  3VH5 A;  3MGP D;  3AZK D;  3KXB D;  5AV6 B;  2Y2I A;  5AVC D;  5AV5 A;  1KX5 C;  3AV2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...