1P3PA

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
100
structure length
100
Chain Sequence
KKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 100
sequence length 100
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3pA00
5E5AC 3WKJA 4H9QB 5DNMC 4LD9A 3W97A 3NQUA 5CPIB 3X1SD 1P3BA 5B0ZB 4E45A 1P3KB 4J8VD 4G91B 5GSUB 3AZIB 3MGSD 2BYKB 1BH9B 3WAAA 2AROC 5B2JC 2L5AA 2NZDB 3O62A 1P3LD 5GT3D 5CPID 3UTBA 5B0ZD 3LZ0A 3WTPE 2RVQC 5GSUD 3UTAB 3AV2A 3B6FA 5BO0B 4X23B 3A6ND 1P3AC 2NZDD 1P3FA 1M19C 2CV5B 3AZKD 1AOIB 4R8PA 5JRGA 3AYWD 1ID3C 3AZGC 2FJ7A 1N1JB 1M18C 3C1BC 3AV1C 1P3IB 3AFAB 3UTAD 3X1VC 5AY8A 4KUDA 3AZMB 4Z2MG 1P3PB 1JFIB 4XZQC 1U35A 3MGRB 1M1AA 2CV5D 1KX3A 1P3GC 5B32G 2PYOA 3W96B 4QLCC 5B1LB 3AFAD 5JA4B 4WU9C 4WV4B 5GT0B 3LZ0C 3AZMD 4J8XD 1P3PD 5BT1D 1TZYA 5E5AB 3MGRD 3MGQC 2HIOA 5AV6A 4ZUXD 3VH5T 3B0CT 3AZED 4HGAC 4R8PC 1A7WA 4KHAA 3WA9D 2FJ7C 4UUZA 2AROB 5B2JB 4J8WC 1P3LC 5AY8C 5BNVB 5E5AD 5DNMD 5B2IA 4YM6B 1U35C 1S32A 5B0ZC 3RELC 1P3KC 5B24A 3AZIC 5CPKA 1KX4A 3KUYA 2AROD 5B2JD 5AV8A 5B0YA 2BYMB 1M19B 4G92C 5AV9C 3AZLA 3AZGB 3TU4A 1TZYC 5G49A 4YS3A 3LELC 4LD9B 2HIOC 3W97B 2RVQD 3AN2A 3X1VB 4X23C 3B6GA 4Z2MH 3AZJA 1P3AD 5B31G 1P3OA 3WAAB 4XZQB 1M19D 1AOIC 4Z66A 3AZNA 5AVBA 5CP6A 3AZGD 1P3GB 2F8ND 5DNNA 3C1BD 1P3IC 3AZHA 3B0BA 4LD9D 4KGCA 3W97D 4WU9B 3X1VD 3UTBB 3LZ0B 5CPKC 3AZFA 1P3PC 3MVDC 3MGRC 4XZQD 3LJAA 2F8NH 1TAFA 3X1UA 3KXBA 1WWIA 1P3GD 3AZLC 4R8PB 3W96C 5JRGB 2FJ7B 3C1CA 4QLCD 5B1LC 3TU4C 2CWEA 1HQ3C 1ZLAA 3REIC 4WU9D 5GT0C 3UTBD 3LZ0D 3V9RA 3UT9A 5AY8B 4KUDB 3AZJC 5B1MC 3MGQD 1U35B 1P3MC 3RELB 1M1AB 4H9SC 5B40A 4R8PD 2FJ7D 2HUEB 1KX3B 4XUJA 4Z5TA 3B0CW 5CPJA 2PYOB 1P34A 4J8WD 4G92B 5AY8D 4KUDD 5AV9B 5B32C 4YM6C 1TZYB 1U35D 1P3KD 3RELD 3LELB 3AZID 2HIOB 4DRBA 5AV6B 2PYOD 4WNNA 3W98A 1F66A 5BNXA 2NQBA 5F99A 3WTPA 5AV9D 3REKA 3UT9C 5B31A 3WKJC 1TZYD 3LELD 4LD9C 4H9RA 3W97C 2HIOD 1S32B 1P3BC 5KDMB 1HTAA 4X23D 5CPKB 1KX4B 3KWQA 3KUYB 3WAAC 3MVDB 5BS7A 5AV8B 5B0YB 1P34C 1AOID 3O62C 4H9PA 2YFVA 3X1SA 3AZLB 4J8VA 3TU4B 1P3ID 3W99A 3MGSA 1HQ3B 3REIB 4YS3B 3UTBC 4AWLB 5CPKD 3AV2C 3AN2B 1BH8A 3B6FC 2YFWB 3MVDD 3B6GB 4NE6A 3AZJB 5AV8D 5B1MB 1P3FC 4H9QA 5GT3A 4CSRA 1P3MB 3AZNB 5JRGC 5CPIA 3AZLD 5AVBB 3W96D 5CP6B 3TU4D 5GSUA 5B1LD 1HQ3D 1BH9A 3REID 5B31C 3AZHB 5GT0D 3A6NA 2NZDA 3REJA 4KGCB 4KUDC 4CAYA 3X1TA 3AZKA 3VH5A 5C3IB 5AVCA 3KWQC 3AZJD 3AYWA 5B32B 5B1MD 3AZFB 4WU8A 1P3MD 3LJAB 1M1AC 1EQZA 4EO5C 1TAFB 2HUEC 3X1UB 1KX3C 2PYOC 3UTAA 4KGCD 3V9RB 2CV5A 4H9NA 3UT9B 5B32D 3MNNA 4YM6D 3WKJB 5AV6C 3NQUB 1P3BB 3X1UD 3AFAA 3AZMA 4J8XA 4Z5TB 5GXQA 4J8UA 1P34B 1R4VA 3O62B 3REJC 3UT9D 3LZ1A 4ZUXA 1BFMA 3AZEA 3X1TC 3WKJD 5B2IC 3WA9A 3NQJA 4NE3A 1S32C 5B33A 4WU8C 1P3BD 5B24C 1EQZC 1KX4C 3KUYC 3AV2B 2JSSA 3B6FB 3WAAD 5AV8C 4WNNB 5B0YC 3W98B 5CHLB 1P34D 1P3FB 5BNXB 5DNMA 3O62D 1KX5A 2NQBB 5F99B 4H9OA 3WTPB 1B67A 4YS3C 5B31B 5B2JA 4AWLC 4H9RB 3AN2C 3AV2D 1KU5A 3B6FD 3B6GC 5FUGA 3KWQB 3W98D 1P3OC 1P3FD 5BNVA 5GXQC 4Z66C 4J8UC 3AZNC 5AVBC 4ZBJB 5JRGD 5CP6C 4EO5B 3VH5W 3MGPA 4H9PB 2YFVB 5DNNC 3AZHC 5B31D 4J8VB 3W99B 3R45A 3MGSB 1P3AA 4KGCC 2BYMA 4NE5A 5C3IC 3VH6T 3KWQD 3AZFC 1ID3A 3AZGA 3LJAC 2F8NA 1M18A 1M1AD 3C1BA 3AV1A 3X1UC 5GT3B 4CSRB 3KXBC 1KX5C 1KX3D 3X1VA 4KHAB 3C1CC 4UUZB 3W99D 1ZLAC 3VH6A 4XZQA 3A6NB 5AV5A 1Q9CA 3REJB 4CAYB 3X1TB 3AZKB 5AVCB 1P3GA 4JJNA 3AYWB 5B2IB 5AV6D 4QLCA 4WU8B 5B24B 1EQZB 5B40C 4WU9A 4XUJC 4Z5TC 3MGPC 3REHA 5CPJC 3MGQA 1H3OA 3REJD 3X1TD 4H9NB 5AVCD 5B2ID 3MNNB 1F1EA 5G49B 1S32D 4WU8D 5B24D 1EQZD 1KX4D 3KUYD 4J8WA 1P3LA 3W98C 5B0YD 1F66C 1P3OB 4J8XB 1ULYA 2NQBC 5GXQB 4Z66B 5F99C 4J8UB 3KSYA 3WTPC 1P3KA 5B0ZA 5AV5C 3RELA 1B6WA 3REKC 3AZIA 3LZ1B 2BYKA 4ZUXB 3MNND 3AZEB 5DNNB 4YS3D 3B0DB 4JJNC 3WA9B 3NQJB 3AN2D 4E44A 5B33B 3B6GD 5AV9A 1P3OD 5BS7C 3REHC 5GXQD 4Z66D 4J8UD 3AZND 4ZBJC 5AVBD 5CP6D 3LELA 5DNMB 3KXBB 1KX5B 4NFTA 4WZSB 4H9OB 3LZ1D 3X1SC 5DNND 3W99C 3C1CB 5BO0A 4X23A 4J8VC 3AZHD 3MGSC 1ZLAB 2F8NG 4M6BA 5B33D 1AOIA 2F8NK 2IO5C 3AZFD 1N1JA 5FUGB 3LJAD 3VH6W 1P3IA 5GT3C 3KXBD 1KX5D 5CPIC 5B40B 5KDMA 4G91C 5GSUC 3C1CD 4XUJB 5CPJB 3MGPB 1ZLAD 1P3PA 1JFIA 3MVDA 3A6NC 3MGRA 3R45B 1P3AB 2NZDC 3AZKC 5AVCC 1WWSA 3AYWC 3W96A 1ID3B 5B1LA 1HQ3A 2F8NB 5JA4A 3REIA 1M18B 2LY8A 3C1BB 5B40D 3AV1B 5GT0A 3UTAC 4XUJD 4Z5TD 5CPJD 3MGPD 2YFWA 4DRAA 1F66B 5E5AA 5B1MA 1P3MA 5AV5B 2CV5C 3REKB 4H9SA 3MNNC 1ID3D 2AROA 4JJNB 1M18D 4QLCB 3AV1D 3AFAC 3AZMC 1F66D 4J8XC 3REHB 5B32A 2NQBD 5BT1C 5F99D 4YM6A 3WTPD 5AV5D 3MGQB 1H3OB 3REKD 3LZ1C 4ZUXC 3X1SB 3AZEC 3B0DC 4HGAB 3WA9C 4JJND 5B33C 1M19A 1BH8B 2IO5B 4J8WB 1P3LB 3REHD
chains in the Genus database with same CATH superfamily
5E5AC 3WKJA 4H9QB 5DNMC 4LD9A 3W97A 3NQUA 5CPIB 3X1SD 1P3BA 5B0ZB 4E45A 1P3KB 1W2EA 4J8VD 4G91B 5GSUB 3AZIB 3MGSD 2BYKB 2DQNC 1BH9B 3WAAA 2AROC 5B2JC 2L5AA 2NZDB 3O62A 1P3LD 5GT3D 5CPID 3UTBA 5B0ZD 3LZ0A 3WTPE 2RVQC 5GSUD 3UTAB 3AV2A 3B6FA 5BO0B 4X23B 3A6ND 1P3AC 2NZDD 1P3FA 1M19C 2CV5B 3AZKD 1AOIB 4R8PA 5JRGA 3AYWD 1ID3C 3AZGC 2FJ7A 1N1JB 1M18C 3C1BC 3AV1C 1P3IB 3AFAB 3UTAD 3X1VC 5AY8A 4KUDA 2JCHA 3AZMB 4Z2MG 1P3PB 1JFIB 4XZQC 1U35A 3MGRB 1M1AA 2CV5D 3P5JB 1KX3A 1P3GC 5B32G 2PYOA 3W96B 4QLCC 5B1LB 3AFAD 2G5IC 5JA4B 3H0MC 4WU9C 4WV4B 5GT0B 3LZ0C 3AZMD 4J8XD 1P3PD 5BT1D 1TZYA 5E5AB 3MGRD 3MGQC 2HIOA 5AV6A 4ZUXD 3VH5T 3B0CT 3AZED 2ZY3A 4HGAC 4R8PC 1A7WA 4KHAA 3WA9D 2FJ7C 4UUZA 2AROB 5B2JB 2Y2OA 4J8WC 1P3LC 5AY8C 5BNVB 5E5AD 5DNMD 5B2IA 4YM6B 1U35C 1S32A 5B0ZC 3RELC 1P3KC 5B24A 3AZIC 5CPKA 1KX4A 3KUYA 2Y2LA 2AROD 5B2JD 5AV8A 5B0YA 2BYMB 2ZY4A 1M19B 4G92C 2BG1A 5AV9C 3AZLA 3AZGB 3TU4A 1TZYC 5G49A 4YS3A 3LELC 4LD9B 3EPHA 2HIOC 3W97B 2RVQD 3AN2A 3X1VB 2ZY5A 4X23C 3B6GA 4Z2MH 3AZJA 1P3AD 5B31G 1P3OA 3WAAB 4XZQB 1M19D 1AOIC 4Z66A 3AZNA 5AVBA 5CP6A 3AZGD 1P3GB 2F8ND 5DNNA 3C1BD 1P3IC 3AZHA 3B0BA 4LD9D 4KGCA 3W97D 4WU9B 3X1VD 3UTBB 3LZ0B 5CPKC 3AZFA 1P3PC 3MVDC 3MGRC 4XZQD 3LJAA 3EPKA 3F6TA 2F8NH 1TAFA 3X1UA 3KXBA 1WWIA 1P3GD 3AZLC 4R8PB 3W96C 5JRGB 2FJ7B 3C1CA 4QLCD 5B1LC 3TU4C 2CWEA 1HQ3C 1ZLAA 3REIC 4WU9D 5GT0C 3UTBD 3LZ0D 3V9RA 3UT9A 5AY8B 4KUDB 2Y2PA 3AZJC 5B1MC 3MGQD 1U35B 1P3MC 3RELB 1M1AB 4H9SC 5B40A 4R8PD 2FJ7D 2HUEB 2J8PA 1KX3B 4XUJA 4Z5TA 3B0CW 5CPJA 2PYOB 1P34A 3EPLA 4J8WD 4G92B 5AY8D 4KUDD 5AV9B 1PZRA 5B32C 4YM6C 1TZYB 1U35D 1P3KD 3RELD 3LELB 3AZID 2HIOB 4DRBA 5AV6B 2PYOD 4WNNA 3W98A 1F66A 3A1IA 5BNXA 2NQBA 5F99A 3WTPA 5AV9D 3REKA 3UT9C 3EPJA 5B31A 3WKJC 1TZYD 3LELD 4LD9C 4H9RA 3W97C 2HIOD 1S32B 1P3BC 5KDMB 1HTAA 4X23D 5CPKB 1KX4B 3KWQA 3KUYB 3WAAC 3MVDB 5BS7A 3H0LC 5AV8B 5B0YB 1P34C 1AOID 3O62C 4H9PA 2YFVA 3X1SA 3AZLB 3IP4C 4J8VA 3TU4B 1P3ID 3W99A 3MGSA 1HQ3B 3REIB 4YS3B 3UTBC 4AWLB 5CPKD 3AV2C 3AN2B 1BH8A 3B6FC 2YFWB 3MVDD 3B6GB 4NE6A 3AZJB 5AV8D 5B1MB 1P3FC 4H9QA 5GT3A 4CSRA 1P3MB 3AZNB 5JRGC 5CPIA 3AZLD 5AVBB 3W96D 5CP6B 3TU4D 5GSUA 5B1LD 2Y2HA 1HQ3D 1BH9A 3REID 5B31C 2Y2MA 3AZHB 5GT0D 3A6NA 2NZDA 3REJA 4KGCB 4KUDC 4CAYA 2G5HC 3X1TA 3AZKA 3VH5A 5C3IB 5AVCA 3KWQC 3AZJD 3AYWA 5B32B 5B1MD 3AZFB 4WU8A 1P3MD 3LJAB 1M1AC 1EQZA 4EO5C 1TAFB 2HUEC 3X1UB 1KX3C 2PYOC 3UTAA 4KGCD 3V9RB 2CV5A 4H9NA 3UT9B 5B32D 3MNNA 4YM6D 3WKJB 2Y2KA 5AV6C 3NQUB 1P3BB 3X1UD 3AFAA 3AZMA 4J8XA 4Z5TB 2F2AC 5GXQA 4J8UA 1P34B 1R4VA 3O62B 3REJC 3UT9D 3H0RC 4ZUXA 3LZ1A 1BFMA 3AZEA 3X1TC 3EG5B 3WKJD 5B2IC 3WA9A 3NQJA 4NE3A 1S32C 5B33A 4WU8C 1P3BD 2Y2QA 5B24C 1EQZC 1KX4C 3KUYC 3AV2B 2JSSA 3B6FB 3WAAD 5AV8C 4WNNB 5B0YC 3W98B 3FDDA 5CHLB 1P34D 1P3FB 5BNXB 5DNMA 3O62D 1KX5A 2NQBB 5F99B 4H9OA 3WTPB 1B67A 4YS3C 5B31B 3KFUG 5B2JA 4AWLC 4H9RB 3AN2C 3AV2D 1KU5A 4WJ3C 3B6FD 3B6GC 5FUGA 3KWQB 3W98D 1P3OC 1P3FD 5BNVA 5GXQC 4Z66C 4J8UC 3AZNC 5AVBC 4ZBJB 5JRGD 5CP6C 4EO5B 3VH5W 3MGPA 4H9PB 2Y2GA 2YFVB 5DNNC 3AZHC 3A1KA 5B31D 4J8VB 3W99B 3R45A 3MGSB 1P3AA 4KGCC 2BYMA 4NE5A 5C3IC 3VH6T 2DF4C 3KWQD 3AZFC 1ID3A 3AZGA 3LJAC 2F8NA 1M18A 1M1AD 3C1BA 3AV1A 3X1UC 5GT3B 4CSRB 3KXBC 1KX5C 1KX3D 3X1VA 4KHAB 1T3UA 3C1CC 4UUZB 3W99D 1ZLAC 3VH6A 4XZQA 3A6NB 5AV5A 1Q9CA 2UWXA 3REJB 4CAYB 3X1TB 3AZKB 5AVCB 1P3GA 4JJNA 3AYWB 5B2IB 5AV6D 4QLCA 4WU8B 5B24B 1EQZB 5B40C 4WU9A 1Z2CB 4XUJC 2RIQA 4Z5TC 3MGPC 3REHA 5CPJC 2ZY2A 3MGQA 1H3OA 3REJD 3X1TD 4H9NB 5AVCD 5B2ID 3MNNB 1F1EA 5G49B 1S32D 4WU8D 5B24D 1EQZD 1KX4D 3KUYD 4J8WA 1P3LA 3W98C 5B0YD 1F66C 1P3OB 4J8XB 1ULYA 2NQBC 5GXQB 4Z66B 5F99C 4J8UB 3KSYA 3WTPC 1P3KA 5B0ZA 5AV5C 3RELA 1B6WA 2W8SA 3REKC 3AZIA 3LZ1B 2BYKA 4ZUXB 3MNND 3AZEB 2Y2JA 5DNNB 4YS3D 3B0DB 4JJNC 3WA9B 3NQJB 3AN2D 4E44A 2XD5A 5B33B 3B6GD 5AV9A 1P3OD 5BS7C 3REHC 5GXQD 4Z66D 4J8UD 3AZND 4ZBJC 5AVBD 5CP6D 3LELA 5DNMB 3KXBB 1KX5B 4NFTA 4WZSB 4H9OB 3LZ1D 3X1SC 5DNND 3W99C 3C1CB 5BO0A 4X23A 4J8VC 3AZHD 3MGSC 1ZLAB 2F8NG 2XD1A 2ZM5A 4M6BA 5B33D 1AOIA 2F8NK 2IO5C 3AZFD 1N1JA 5FUGB 3LJAD 3VH6W 1P3IA 5GT3C 3KXBD 1KX5D 5CPIC 5B40B 5KDMA 4G91C 5GSUC 3C1CD 4XUJB 5CPJB 3MGPB 1ZLAD 1P3PA 1JFIA 3MVDA 3A6NC 3MGRA 3R45B 1P3AB 2NZDC 2FFFB 3AL0C 3AZKC 5AVCC 1WWSA 3AYWC 3W96A 1ID3B 5B1LA 2JE5A 1HQ3A 2F8NB 5JA4A 3REIA 1M18B 2LY8A 3C1BB 5B40D 3AV1B 5GT0A 3UTAC 4XUJD 2Y2NA 4Z5TD 5CPJD 3MGPD 2YFWA 4DRAA 1F66B 5E5AA 5B1MA 1P3MA 5AV5B 2CV5C 3REKB 4H9SA 3MNNC 1ID3D 2AROA 4JJNB 1M18D 4QLCB 3AV1D 3AFAC 2Y2IA 3AZMC 1F66D 4J8XC 4DQYB 3REHB 5B32A 2NQBD 5BT1C 5F99D 4YM6A 3WTPD 5AV5D 3MGQB 1H3OB 3REKD 3LZ1C 4ZUXC 3X1SB 3AZEC 3B0DC 4HGAB 3WA9C 4JJND 4UPKA 5B33C 1M19A 1BH8B 2IO5B 4J8WB 1P3LB 3REHD 2VQRA
chains in the Genus database with same CATH topology
5E5AC 3WKJA 4H9QB 5DNMC 4LD9A 3W97A 3NQUA 5CPIB 3X1SD 1P3BA 5B0ZB 4E45A 1P3KB 1W2EA 4J8VD 4G91B 5GSUB 3AZIB 3MGSD 2BYKB 2DQNC 1BH9B 3WAAA 2AROC 5B2JC 2L5AA 2NZDB 3O62A 1P3LD 5GT3D 5CPID 3UTBA 5B0ZD 3LZ0A 3WTPE 2RVQC 5GSUD 3UTAB 3AV2A 3B6FA 5BO0B 4X23B 3A6ND 1P3AC 2NZDD 1P3FA 1M19C 2CV5B 3AZKD 1AOIB 4R8PA 5JRGA 3AYWD 1ID3C 3AZGC 2FJ7A 1N1JB 1M18C 3C1BC 3AV1C 1P3IB 3AFAB 3UTAD 3X1VC 5AY8A 4KUDA 2JCHA 3AZMB 4Z2MG 1P3PB 1JFIB 4XZQC 1U35A 3MGRB 1M1AA 2CV5D 3P5JB 1KX3A 1P3GC 5B32G 2PYOA 3W96B 4QLCC 5B1LB 3AFAD 2G5IC 5JA4B 3H0MC 4WU9C 4WV4B 5GT0B 3LZ0C 3AZMD 4J8XD 1P3PD 5BT1D 1TZYA 5E5AB 3MGRD 3MGQC 2HIOA 5AV6A 4ZUXD 3VH5T 3B0CT 3AZED 2ZY3A 4HGAC 4R8PC 1A7WA 4KHAA 3WA9D 2FJ7C 4UUZA 2AROB 5B2JB 2Y2OA 4J8WC 1P3LC 5AY8C 5BNVB 5E5AD 5DNMD 5B2IA 4YM6B 1U35C 1S32A 5B0ZC 3RELC 1P3KC 5B24A 3AZIC 5CPKA 1KX4A 3KUYA 2Y2LA 2AROD 5B2JD 5AV8A 5B0YA 2BYMB 2ZY4A 1M19B 4G92C 2BG1A 5AV9C 3AZLA 3AZGB 3TU4A 1TZYC 5G49A 4YS3A 3LELC 4LD9B 3EPHA 2HIOC 3W97B 2RVQD 3AN2A 3X1VB 2ZY5A 4X23C 3B6GA 4Z2MH 3AZJA 1P3AD 5B31G 1P3OA 3WAAB 4XZQB 1M19D 1AOIC 4Z66A 3AZNA 5AVBA 5CP6A 3AZGD 1P3GB 2F8ND 5DNNA 3C1BD 1P3IC 3AZHA 3B0BA 4LD9D 4KGCA 3W97D 4WU9B 3X1VD 3UTBB 3LZ0B 5CPKC 3AZFA 1P3PC 3MVDC 3MGRC 4XZQD 3LJAA 3EPKA 3F6TA 2F8NH 1TAFA 3X1UA 3KXBA 1WWIA 1P3GD 3AZLC 4R8PB 3W96C 5JRGB 2FJ7B 3C1CA 4QLCD 5B1LC 3TU4C 2CWEA 1HQ3C 1ZLAA 3REIC 4WU9D 5GT0C 3UTBD 3LZ0D 3V9RA 3UT9A 5AY8B 4KUDB 2Y2PA 3AZJC 5B1MC 3MGQD 1U35B 1P3MC 3RELB 1M1AB 4H9SC 5B40A 4R8PD 2FJ7D 2HUEB 2J8PA 1KX3B 4XUJA 4Z5TA 3B0CW 5CPJA 2PYOB 1P34A 3EPLA 4J8WD 4G92B 5AY8D 4KUDD 5AV9B 1PZRA 5B32C 4YM6C 1TZYB 1U35D 1P3KD 3RELD 3LELB 3AZID 2HIOB 4DRBA 5AV6B 2PYOD 4WNNA 3W98A 1F66A 3A1IA 5BNXA 2NQBA 5F99A 3WTPA 5AV9D 3REKA 3UT9C 3EPJA 5B31A 3WKJC 1TZYD 3LELD 4LD9C 4H9RA 3W97C 2HIOD 1S32B 1P3BC 5KDMB 1HTAA 4X23D 5CPKB 1KX4B 3KWQA 3KUYB 3WAAC 3MVDB 5BS7A 3H0LC 5AV8B 5B0YB 1P34C 1AOID 3O62C 4H9PA 2YFVA 3X1SA 3AZLB 3IP4C 4J8VA 3TU4B 1P3ID 3W99A 3MGSA 1HQ3B 3REIB 4YS3B 3UTBC 4AWLB 5CPKD 3AV2C 3AN2B 1BH8A 3B6FC 2YFWB 3MVDD 3B6GB 4NE6A 3AZJB 5AV8D 5B1MB 1P3FC 4H9QA 5GT3A 4CSRA 1P3MB 3AZNB 5JRGC 5CPIA 3AZLD 5AVBB 3W96D 5CP6B 3TU4D 5GSUA 5B1LD 2Y2HA 1HQ3D 1BH9A 3REID 5B31C 2Y2MA 3AZHB 5GT0D 3A6NA 2NZDA 3REJA 4KGCB 4KUDC 4CAYA 2G5HC 3X1TA 3AZKA 3VH5A 5C3IB 5AVCA 3KWQC 3AZJD 3AYWA 5B32B 5B1MD 3AZFB 4WU8A 1P3MD 3LJAB 1M1AC 1EQZA 4EO5C 1TAFB 2HUEC 3X1UB 1KX3C 2PYOC 3UTAA 4KGCD 3V9RB 2CV5A 4H9NA 3UT9B 5B32D 3MNNA 4YM6D 3WKJB 2Y2KA 5AV6C 3NQUB 1P3BB 3X1UD 3AFAA 3AZMA 4J8XA 4Z5TB 2F2AC 5GXQA 4J8UA 1P34B 1R4VA 3O62B 3REJC 3UT9D 3H0RC 4ZUXA 3LZ1A 1BFMA 3AZEA 3X1TC 3EG5B 3WKJD 5B2IC 3WA9A 3NQJA 4NE3A 1S32C 5B33A 4WU8C 1P3BD 2Y2QA 5B24C 1EQZC 1KX4C 3KUYC 3AV2B 2JSSA 3B6FB 3WAAD 5AV8C 4WNNB 5B0YC 3W98B 3FDDA 5CHLB 1P34D 1P3FB 5BNXB 5DNMA 3O62D 1KX5A 2NQBB 5F99B 4H9OA 3WTPB 1B67A 4YS3C 5B31B 3KFUG 5B2JA 4AWLC 4H9RB 3AN2C 3AV2D 1KU5A 4WJ3C 3B6FD 3B6GC 5FUGA 3KWQB 3W98D 1P3OC 1P3FD 5BNVA 5GXQC 4Z66C 4J8UC 3AZNC 5AVBC 4ZBJB 5JRGD 5CP6C 4EO5B 3VH5W 3MGPA 4H9PB 2Y2GA 2YFVB 5DNNC 3AZHC 3A1KA 5B31D 4J8VB 3W99B 3R45A 3MGSB 1P3AA 4KGCC 2BYMA 4NE5A 5C3IC 3VH6T 2DF4C 3KWQD 3AZFC 1ID3A 3AZGA 3LJAC 2F8NA 1M18A 1M1AD 3C1BA 3AV1A 3X1UC 5GT3B 4CSRB 3KXBC 1KX5C 1KX3D 3X1VA 4KHAB 1T3UA 3C1CC 4UUZB 3W99D 1ZLAC 3VH6A 4XZQA 3A6NB 5AV5A 1Q9CA 2UWXA 3REJB 4CAYB 3X1TB 3AZKB 5AVCB 1P3GA 4JJNA 3AYWB 5B2IB 5AV6D 4QLCA 4WU8B 5B24B 1EQZB 5B40C 4WU9A 1Z2CB 4XUJC 2RIQA 4Z5TC 3MGPC 3REHA 5CPJC 2ZY2A 3MGQA 1H3OA 3REJD 3X1TD 4H9NB 5AVCD 5B2ID 3MNNB 1F1EA 5G49B 1S32D 4WU8D 5B24D 1EQZD 1KX4D 3KUYD 4J8WA 1P3LA 3W98C 5B0YD 1F66C 1P3OB 4J8XB 1ULYA 2NQBC 5GXQB 4Z66B 5F99C 4J8UB 3KSYA 3WTPC 1P3KA 5B0ZA 5AV5C 3RELA 1B6WA 2W8SA 3REKC 3AZIA 3LZ1B 2BYKA 4ZUXB 3MNND 3AZEB 2Y2JA 5DNNB 4YS3D 3B0DB 4JJNC 3WA9B 3NQJB 3AN2D 4E44A 2XD5A 5B33B 3B6GD 5AV9A 1P3OD 5BS7C 3REHC 5GXQD 4Z66D 4J8UD 3AZND 4ZBJC 5AVBD 5CP6D 3LELA 5DNMB 3KXBB 1KX5B 4NFTA 4WZSB 4H9OB 3LZ1D 3X1SC 5DNND 3W99C 3C1CB 5BO0A 4X23A 4J8VC 3AZHD 3MGSC 1ZLAB 2F8NG 2XD1A 2ZM5A 4M6BA 5B33D 1AOIA 2F8NK 2IO5C 3AZFD 1N1JA 5FUGB 3LJAD 3VH6W 1P3IA 5GT3C 3KXBD 1KX5D 5CPIC 5B40B 5KDMA 4G91C 5GSUC 3C1CD 4XUJB 5CPJB 3MGPB 1ZLAD 1P3PA 1JFIA 3MVDA 3A6NC 3MGRA 3R45B 1P3AB 2NZDC 2FFFB 3AL0C 3AZKC 5AVCC 1WWSA 3AYWC 3W96A 1ID3B 5B1LA 2JE5A 1HQ3A 2F8NB 5JA4A 3REIA 1M18B 2LY8A 3C1BB 5B40D 3AV1B 5GT0A 3UTAC 4XUJD 2Y2NA 4Z5TD 5CPJD 3MGPD 2YFWA 4DRAA 1F66B 5E5AA 5B1MA 1P3MA 5AV5B 2CV5C 3REKB 4H9SA 3MNNC 1ID3D 2AROA 4JJNB 1M18D 4QLCB 3AV1D 3AFAC 2Y2IA 3AZMC 1F66D 4J8XC 4DQYB 3REHB 5B32A 2NQBD 5BT1C 5F99D 4YM6A 3WTPD 5AV5D 3MGQB 1H3OB 3REKD 3LZ1C 4ZUXC 3X1SB 3AZEC 3B0DC 4HGAB 3WA9C 4JJND 4UPKA 5B33C 1M19A 1BH8B 2IO5B 4J8WB 1P3LB 3REHD 2VQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E5A C;  3WKJ A;  4H9Q B;  5DNM C;  4LD9 A;  3W97 A;  3NQU A;  5CPI B;  3X1S D;  1P3B A;  5B0Z B;  4E45 A;  1P3K B;  4J8V D;  4G91 B;  5GSU B;  3AZI B;  3MGS D;  2BYK B;  1BH9 B;  3WAA A;  2ARO C;  5B2J C;  2L5A A;  2NZD B;  3O62 A;  1P3L D;  5GT3 D;  5CPI D;  3UTB A;  5B0Z D;  3LZ0 A;  3WTP E;  2RVQ C;  5GSU D;  3UTA B;  3AV2 A;  3B6F A;  5BO0 B;  4X23 B;  3A6N D;  1P3A C;  2NZD D;  1P3F A;  1M19 C;  2CV5 B;  3AZK D;  1AOI B;  4R8P A;  5JRG A;  3AYW D;  1ID3 C;  3AZG C;  2FJ7 A;  1N1J B;  1M18 C;  3C1B C;  3AV1 C;  1P3I B;  3AFA B;  3UTA D;  3X1V C;  5AY8 A;  4KUD A;  3AZM B;  4Z2M G;  1P3P B;  1JFI B;  4XZQ C;  1U35 A;  3MGR B;  1M1A A;  2CV5 D;  1KX3 A;  1P3G C;  5B32 G;  2PYO A;  3W96 B;  4QLC C;  5B1L B;  3AFA D;  5JA4 B;  4WU9 C;  4WV4 B;  5GT0 B;  3LZ0 C;  3AZM D;  4J8X D;  1P3P D;  5BT1 D;  1TZY A;  5E5A B;  3MGR D;  3MGQ C;  2HIO A;  5AV6 A;  4ZUX D;  3VH5 T;  3B0C T;  3AZE D;  4HGA C;  4R8P C;  1A7W A;  4KHA A;  3WA9 D;  2FJ7 C;  4UUZ A;  2ARO B;  5B2J B;  4J8W C;  1P3L C;  5AY8 C;  5BNV B;  5E5A D;  5DNM D;  5B2I A;  4YM6 B;  1U35 C;  1S32 A;  5B0Z C;  3REL C;  1P3K C;  5B24 A;  3AZI C;  5CPK A;  1KX4 A;  3KUY A;  2ARO D;  5B2J D;  5AV8 A;  5B0Y A;  2BYM B;  1M19 B;  4G92 C;  5AV9 C;  3AZL A;  3AZG B;  3TU4 A;  1TZY C;  5G49 A;  4YS3 A;  3LEL C;  4LD9 B;  2HIO C;  3W97 B;  2RVQ D;  3AN2 A;  3X1V B;  4X23 C;  3B6G A;  4Z2M H;  3AZJ A;  1P3A D;  5B31 G;  1P3O A;  3WAA B;  4XZQ B;  1M19 D;  1AOI C;  4Z66 A;  3AZN A;  5AVB A;  5CP6 A;  3AZG D;  1P3G B;  2F8N D;  5DNN A;  3C1B D;  1P3I C;  3AZH A;  3B0B A;  4LD9 D;  4KGC A;  3W97 D;  4WU9 B;  3X1V D;  3UTB B;  3LZ0 B;  5CPK C;  3AZF A;  1P3P C;  3MVD C;  3MGR C;  4XZQ D;  3LJA A;  2F8N H;  1TAF A;  3X1U A;  3KXB A;  1WWI A;  1P3G D;  3AZL C;  4R8P B;  3W96 C;  5JRG B;  2FJ7 B;  3C1C A;  4QLC D;  5B1L C;  3TU4 C;  2CWE A;  1HQ3 C;  1ZLA A;  3REI C;  4WU9 D;  5GT0 C;  3UTB D;  3LZ0 D;  3V9R A;  3UT9 A;  5AY8 B;  4KUD B;  3AZJ C;  5B1M C;  3MGQ D;  1U35 B;  1P3M C;  3REL B;  1M1A B;  4H9S C;  5B40 A;  4R8P D;  2FJ7 D;  2HUE B;  1KX3 B;  4XUJ A;  4Z5T A;  3B0C W;  5CPJ A;  2PYO B;  1P34 A;  4J8W D;  4G92 B;  5AY8 D;  4KUD D;  5AV9 B;  5B32 C;  4YM6 C;  1TZY B;  1U35 D;  1P3K D;  3REL D;  3LEL B;  3AZI D;  2HIO B;  4DRB A;  5AV6 B;  2PYO D;  4WNN A;  3W98 A;  1F66 A;  5BNX A;  2NQB A;  5F99 A;  3WTP A;  5AV9 D;  3REK A;  3UT9 C;  5B31 A;  3WKJ C;  1TZY D;  3LEL D;  4LD9 C;  4H9R A;  3W97 C;  2HIO D;  1S32 B;  1P3B C;  5KDM B;  1HTA A;  4X23 D;  5CPK B;  1KX4 B;  3KWQ A;  3KUY B;  3WAA C;  3MVD B;  5BS7 A;  5AV8 B;  5B0Y B;  1P34 C;  1AOI D;  3O62 C;  4H9P A;  2YFV A;  3X1S A;  3AZL B;  4J8V A;  3TU4 B;  1P3I D;  3W99 A;  3MGS A;  1HQ3 B;  3REI B;  4YS3 B;  3UTB C;  4AWL B;  5CPK D;  3AV2 C;  3AN2 B;  1BH8 A;  3B6F C;  2YFW B;  3MVD D;  3B6G B;  4NE6 A;  3AZJ B;  5AV8 D;  5B1M B;  1P3F C;  4H9Q A;  5GT3 A;  4CSR A;  1P3M B;  3AZN B;  5JRG C;  5CPI A;  3AZL D;  5AVB B;  3W96 D;  5CP6 B;  3TU4 D;  5GSU A;  5B1L D;  1HQ3 D;  1BH9 A;  3REI D;  5B31 C;  3AZH B;  5GT0 D;  3A6N A;  2NZD A;  3REJ A;  4KGC B;  4KUD C;  4CAY A;  3X1T A;  3AZK A;  3VH5 A;  5C3I B;  5AVC A;  3KWQ C;  3AZJ D;  3AYW A;  5B32 B;  5B1M D;  3AZF B;  4WU8 A;  1P3M D;  3LJA B;  1M1A C;  1EQZ A;  4EO5 C;  1TAF B;  2HUE C;  3X1U B;  1KX3 C;  2PYO C;  3UTA A;  4KGC D;  3V9R B;  2CV5 A;  4H9N A;  3UT9 B;  5B32 D;  3MNN A;  4YM6 D;  3WKJ B;  5AV6 C;  3NQU B;  1P3B B;  3X1U D;  3AFA A;  3AZM A;  4J8X A;  4Z5T B;  5GXQ A;  4J8U A;  1P34 B;  1R4V A;  3O62 B;  3REJ C;  3UT9 D;  3LZ1 A;  4ZUX A;  1BFM A;  3AZE A;  3X1T C;  3WKJ D;  5B2I C;  3WA9 A;  3NQJ A;  4NE3 A;  1S32 C;  5B33 A;  4WU8 C;  1P3B D;  5B24 C;  1EQZ C;  1KX4 C;  3KUY C;  3AV2 B;  2JSS A;  3B6F B;  3WAA D;  5AV8 C;  4WNN B;  5B0Y C;  3W98 B;  5CHL B;  1P34 D;  1P3F B;  5BNX B;  5DNM A;  3O62 D;  1KX5 A;  2NQB B;  5F99 B;  4H9O A;  3WTP B;  1B67 A;  4YS3 C;  5B31 B;  5B2J A;  4AWL C;  4H9R B;  3AN2 C;  3AV2 D;  1KU5 A;  3B6F D;  3B6G C;  5FUG A;  3KWQ B;  3W98 D;  1P3O C;  1P3F D;  5BNV A;  5GXQ C;  4Z66 C;  4J8U C;  3AZN C;  5AVB C;  4ZBJ B;  5JRG D;  5CP6 C;  4EO5 B;  3VH5 W;  3MGP A;  4H9P B;  2YFV B;  5DNN C;  3AZH C;  5B31 D;  4J8V B;  3W99 B;  3R45 A;  3MGS B;  1P3A A;  4KGC C;  2BYM A;  4NE5 A;  5C3I C;  3VH6 T;  3KWQ D;  3AZF C;  1ID3 A;  3AZG A;  3LJA C;  2F8N A;  1M18 A;  1M1A D;  3C1B A;  3AV1 A;  3X1U C;  5GT3 B;  4CSR B;  3KXB C;  1KX5 C;  1KX3 D;  3X1V A;  4KHA B;  3C1C C;  4UUZ B;  3W99 D;  1ZLA C;  3VH6 A;  4XZQ A;  3A6N B;  5AV5 A;  1Q9C A;  3REJ B;  4CAY B;  3X1T B;  3AZK B;  5AVC B;  1P3G A;  4JJN A;  3AYW B;  5B2I B;  5AV6 D;  4QLC A;  4WU8 B;  5B24 B;  1EQZ B;  5B40 C;  4WU9 A;  4XUJ C;  4Z5T C;  3MGP C;  3REH A;  5CPJ C;  3MGQ A;  1H3O A;  3REJ D;  3X1T D;  4H9N B;  5AVC D;  5B2I D;  3MNN B;  1F1E A;  5G49 B;  1S32 D;  4WU8 D;  5B24 D;  1EQZ D;  1KX4 D;  3KUY D;  4J8W A;  1P3L A;  3W98 C;  5B0Y D;  1F66 C;  1P3O B;  4J8X B;  1ULY A;  2NQB C;  5GXQ B;  4Z66 B;  5F99 C;  4J8U B;  3KSY A;  3WTP C;  1P3K A;  5B0Z A;  5AV5 C;  3REL A;  1B6W A;  3REK C;  3AZI A;  3LZ1 B;  2BYK A;  4ZUX B;  3MNN D;  3AZE B;  5DNN B;  4YS3 D;  3B0D B;  4JJN C;  3WA9 B;  3NQJ B;  3AN2 D;  4E44 A;  5B33 B;  3B6G D;  5AV9 A;  1P3O D;  5BS7 C;  3REH C;  5GXQ D;  4Z66 D;  4J8U D;  3AZN D;  4ZBJ C;  5AVB D;  5CP6 D;  3LEL A;  5DNM B;  3KXB B;  1KX5 B;  4NFT A;  4WZS B;  4H9O B;  3LZ1 D;  3X1S C;  5DNN D;  3W99 C;  3C1C B;  5BO0 A;  4X23 A;  4J8V C;  3AZH D;  3MGS C;  1ZLA B;  2F8N G;  4M6B A;  5B33 D;  1AOI A;  2F8N K;  2IO5 C;  3AZF D;  1N1J A;  5FUG B;  3LJA D;  3VH6 W;  1P3I A;  5GT3 C;  3KXB D;  1KX5 D;  5CPI C;  5B40 B;  5KDM A;  4G91 C;  5GSU C;  3C1C D;  4XUJ B;  5CPJ B;  3MGP B;  1ZLA D;  1P3P A;  1JFI A;  3MVD A;  3A6N C;  3MGR A;  3R45 B;  1P3A B;  2NZD C;  3AZK C;  5AVC C;  1WWS A;  3AYW C;  3W96 A;  1ID3 B;  5B1L A;  1HQ3 A;  2F8N B;  5JA4 A;  3REI A;  1M18 B;  2LY8 A;  3C1B B;  5B40 D;  3AV1 B;  5GT0 A;  3UTA C;  4XUJ D;  4Z5T D;  5CPJ D;  3MGP D;  2YFW A;  4DRA A;  1F66 B;  5E5A A;  5B1M A;  1P3M A;  5AV5 B;  2CV5 C;  3REK B;  4H9S A;  3MNN C;  1ID3 D;  2ARO A;  4JJN B;  1M18 D;  4QLC B;  3AV1 D;  3AFA C;  3AZM C;  1F66 D;  4J8X C;  3REH B;  5B32 A;  2NQB D;  5BT1 C;  5F99 D;  4YM6 A;  3WTP D;  5AV5 D;  3MGQ B;  1H3O B;  3REK D;  3LZ1 C;  4ZUX C;  3X1S B;  3AZE C;  3B0D C;  4HGA B;  3WA9 C;  4JJN D;  5B33 C;  1M19 A;  1BH8 B;  2IO5 B;  4J8W B;  1P3L B;  3REH D; 
#chains in the Genus database with same CATH topology
 5E5A C;  3WKJ A;  4H9Q B;  5DNM C;  4LD9 A;  3W97 A;  3NQU A;  5CPI B;  3X1S D;  1P3B A;  5B0Z B;  4E45 A;  1P3K B;  1W2E A;  4J8V D;  4G91 B;  5GSU B;  3AZI B;  3MGS D;  2BYK B;  2DQN C;  1BH9 B;  3WAA A;  2ARO C;  5B2J C;  2L5A A;  2NZD B;  3O62 A;  1P3L D;  5GT3 D;  5CPI D;  3UTB A;  5B0Z D;  3LZ0 A;  3WTP E;  2RVQ C;  5GSU D;  3UTA B;  3AV2 A;  3B6F A;  5BO0 B;  4X23 B;  3A6N D;  1P3A C;  2NZD D;  1P3F A;  1M19 C;  2CV5 B;  3AZK D;  1AOI B;  4R8P A;  5JRG A;  3AYW D;  1ID3 C;  3AZG C;  2FJ7 A;  1N1J B;  1M18 C;  3C1B C;  3AV1 C;  1P3I B;  3AFA B;  3UTA D;  3X1V C;  5AY8 A;  4KUD A;  2JCH A;  3AZM B;  4Z2M G;  1P3P B;  1JFI B;  4XZQ C;  1U35 A;  3MGR B;  1M1A A;  2CV5 D;  3P5J B;  1KX3 A;  1P3G C;  5B32 G;  2PYO A;  3W96 B;  4QLC C;  5B1L B;  3AFA D;  2G5I C;  5JA4 B;  3H0M C;  4WU9 C;  4WV4 B;  5GT0 B;  3LZ0 C;  3AZM D;  4J8X D;  1P3P D;  5BT1 D;  1TZY A;  5E5A B;  3MGR D;  3MGQ C;  2HIO A;  5AV6 A;  4ZUX D;  3VH5 T;  3B0C T;  3AZE D;  2ZY3 A;  4HGA C;  4R8P C;  1A7W A;  4KHA A;  3WA9 D;  2FJ7 C;  4UUZ A;  2ARO B;  5B2J B;  2Y2O A;  4J8W C;  1P3L C;  5AY8 C;  5BNV B;  5E5A D;  5DNM D;  5B2I A;  4YM6 B;  1U35 C;  1S32 A;  5B0Z C;  3REL C;  1P3K C;  5B24 A;  3AZI C;  5CPK A;  1KX4 A;  3KUY A;  2Y2L A;  2ARO D;  5B2J D;  5AV8 A;  5B0Y A;  2BYM B;  2ZY4 A;  1M19 B;  4G92 C;  2BG1 A;  5AV9 C;  3AZL A;  3AZG B;  3TU4 A;  1TZY C;  5G49 A;  4YS3 A;  3LEL C;  4LD9 B;  3EPH A;  2HIO C;  3W97 B;  2RVQ D;  3AN2 A;  3X1V B;  2ZY5 A;  4X23 C;  3B6G A;  4Z2M H;  3AZJ A;  1P3A D;  5B31 G;  1P3O A;  3WAA B;  4XZQ B;  1M19 D;  1AOI C;  4Z66 A;  3AZN A;  5AVB A;  5CP6 A;  3AZG D;  1P3G B;  2F8N D;  5DNN A;  3C1B D;  1P3I C;  3AZH A;  3B0B A;  4LD9 D;  4KGC A;  3W97 D;  4WU9 B;  3X1V D;  3UTB B;  3LZ0 B;  5CPK C;  3AZF A;  1P3P C;  3MVD C;  3MGR C;  4XZQ D;  3LJA A;  3EPK A;  3F6T A;  2F8N H;  1TAF A;  3X1U A;  3KXB A;  1WWI A;  1P3G D;  3AZL C;  4R8P B;  3W96 C;  5JRG B;  2FJ7 B;  3C1C A;  4QLC D;  5B1L C;  3TU4 C;  2CWE A;  1HQ3 C;  1ZLA A;  3REI C;  4WU9 D;  5GT0 C;  3UTB D;  3LZ0 D;  3V9R A;  3UT9 A;  5AY8 B;  4KUD B;  2Y2P A;  3AZJ C;  5B1M C;  3MGQ D;  1U35 B;  1P3M C;  3REL B;  1M1A B;  4H9S C;  5B40 A;  4R8P D;  2FJ7 D;  2HUE B;  2J8P A;  1KX3 B;  4XUJ A;  4Z5T A;  3B0C W;  5CPJ A;  2PYO B;  1P34 A;  3EPL A;  4J8W D;  4G92 B;  5AY8 D;  4KUD D;  5AV9 B;  1PZR A;  5B32 C;  4YM6 C;  1TZY B;  1U35 D;  1P3K D;  3REL D;  3LEL B;  3AZI D;  2HIO B;  4DRB A;  5AV6 B;  2PYO D;  4WNN A;  3W98 A;  1F66 A;  3A1I A;  5BNX A;  2NQB A;  5F99 A;  3WTP A;  5AV9 D;  3REK A;  3UT9 C;  3EPJ A;  5B31 A;  3WKJ C;  1TZY D;  3LEL D;  4LD9 C;  4H9R A;  3W97 C;  2HIO D;  1S32 B;  1P3B C;  5KDM B;  1HTA A;  4X23 D;  5CPK B;  1KX4 B;  3KWQ A;  3KUY B;  3WAA C;  3MVD B;  5BS7 A;  3H0L C;  5AV8 B;  5B0Y B;  1P34 C;  1AOI D;  3O62 C;  4H9P A;  2YFV A;  3X1S A;  3AZL B;  3IP4 C;  4J8V A;  3TU4 B;  1P3I D;  3W99 A;  3MGS A;  1HQ3 B;  3REI B;  4YS3 B;  3UTB C;  4AWL B;  5CPK D;  3AV2 C;  3AN2 B;  1BH8 A;  3B6F C;  2YFW B;  3MVD D;  3B6G B;  4NE6 A;  3AZJ B;  5AV8 D;  5B1M B;  1P3F C;  4H9Q A;  5GT3 A;  4CSR A;  1P3M B;  3AZN B;  5JRG C;  5CPI A;  3AZL D;  5AVB B;  3W96 D;  5CP6 B;  3TU4 D;  5GSU A;  5B1L D;  2Y2H A;  1HQ3 D;  1BH9 A;  3REI D;  5B31 C;  2Y2M A;  3AZH B;  5GT0 D;  3A6N A;  2NZD A;  3REJ A;  4KGC B;  4KUD C;  4CAY A;  2G5H C;  3X1T A;  3AZK A;  3VH5 A;  5C3I B;  5AVC A;  3KWQ C;  3AZJ D;  3AYW A;  5B32 B;  5B1M D;  3AZF B;  4WU8 A;  1P3M D;  3LJA B;  1M1A C;  1EQZ A;  4EO5 C;  1TAF B;  2HUE C;  3X1U B;  1KX3 C;  2PYO C;  3UTA A;  4KGC D;  3V9R B;  2CV5 A;  4H9N A;  3UT9 B;  5B32 D;  3MNN A;  4YM6 D;  3WKJ B;  2Y2K A;  5AV6 C;  3NQU B;  1P3B B;  3X1U D;  3AFA A;  3AZM A;  4J8X A;  4Z5T B;  2F2A C;  5GXQ A;  4J8U A;  1P34 B;  1R4V A;  3O62 B;  3REJ C;  3UT9 D;  3H0R C;  4ZUX A;  3LZ1 A;  1BFM A;  3AZE A;  3X1T C;  3EG5 B;  3WKJ D;  5B2I C;  3WA9 A;  3NQJ A;  4NE3 A;  1S32 C;  5B33 A;  4WU8 C;  1P3B D;  2Y2Q A;  5B24 C;  1EQZ C;  1KX4 C;  3KUY C;  3AV2 B;  2JSS A;  3B6F B;  3WAA D;  5AV8 C;  4WNN B;  5B0Y C;  3W98 B;  3FDD A;  5CHL B;  1P34 D;  1P3F B;  5BNX B;  5DNM A;  3O62 D;  1KX5 A;  2NQB B;  5F99 B;  4H9O A;  3WTP B;  1B67 A;  4YS3 C;  5B31 B;  3KFU G;  5B2J A;  4AWL C;  4H9R B;  3AN2 C;  3AV2 D;  1KU5 A;  4WJ3 C;  3B6F D;  3B6G C;  5FUG A;  3KWQ B;  3W98 D;  1P3O C;  1P3F D;  5BNV A;  5GXQ C;  4Z66 C;  4J8U C;  3AZN C;  5AVB C;  4ZBJ B;  5JRG D;  5CP6 C;  4EO5 B;  3VH5 W;  3MGP A;  4H9P B;  2Y2G A;  2YFV B;  5DNN C;  3AZH C;  3A1K A;  5B31 D;  4J8V B;  3W99 B;  3R45 A;  3MGS B;  1P3A A;  4KGC C;  2BYM A;  4NE5 A;  5C3I C;  3VH6 T;  2DF4 C;  3KWQ D;  3AZF C;  1ID3 A;  3AZG A;  3LJA C;  2F8N A;  1M18 A;  1M1A D;  3C1B A;  3AV1 A;  3X1U C;  5GT3 B;  4CSR B;  3KXB C;  1KX5 C;  1KX3 D;  3X1V A;  4KHA B;  1T3U A;  3C1C C;  4UUZ B;  3W99 D;  1ZLA C;  3VH6 A;  4XZQ A;  3A6N B;  5AV5 A;  1Q9C A;  2UWX A;  3REJ B;  4CAY B;  3X1T B;  3AZK B;  5AVC B;  1P3G A;  4JJN A;  3AYW B;  5B2I B;  5AV6 D;  4QLC A;  4WU8 B;  5B24 B;  1EQZ B;  5B40 C;  4WU9 A;  1Z2C B;  4XUJ C;  2RIQ A;  4Z5T C;  3MGP C;  3REH A;  5CPJ C;  2ZY2 A;  3MGQ A;  1H3O A;  3REJ D;  3X1T D;  4H9N B;  5AVC D;  5B2I D;  3MNN B;  1F1E A;  5G49 B;  1S32 D;  4WU8 D;  5B24 D;  1EQZ D;  1KX4 D;  3KUY D;  4J8W A;  1P3L A;  3W98 C;  5B0Y D;  1F66 C;  1P3O B;  4J8X B;  1ULY A;  2NQB C;  5GXQ B;  4Z66 B;  5F99 C;  4J8U B;  3KSY A;  3WTP C;  1P3K A;  5B0Z A;  5AV5 C;  3REL A;  1B6W A;  2W8S A;  3REK C;  3AZI A;  3LZ1 B;  2BYK A;  4ZUX B;  3MNN D;  3AZE B;  2Y2J A;  5DNN B;  4YS3 D;  3B0D B;  4JJN C;  3WA9 B;  3NQJ B;  3AN2 D;  4E44 A;  2XD5 A;  5B33 B;  3B6G D;  5AV9 A;  1P3O D;  5BS7 C;  3REH C;  5GXQ D;  4Z66 D;  4J8U D;  3AZN D;  4ZBJ C;  5AVB D;  5CP6 D;  3LEL A;  5DNM B;  3KXB B;  1KX5 B;  4NFT A;  4WZS B;  4H9O B;  3LZ1 D;  3X1S C;  5DNN D;  3W99 C;  3C1C B;  5BO0 A;  4X23 A;  4J8V C;  3AZH D;  3MGS C;  1ZLA B;  2F8N G;  2XD1 A;  2ZM5 A;  4M6B A;  5B33 D;  1AOI A;  2F8N K;  2IO5 C;  3AZF D;  1N1J A;  5FUG B;  3LJA D;  3VH6 W;  1P3I A;  5GT3 C;  3KXB D;  1KX5 D;  5CPI C;  5B40 B;  5KDM A;  4G91 C;  5GSU C;  3C1C D;  4XUJ B;  5CPJ B;  3MGP B;  1ZLA D;  1P3P A;  1JFI A;  3MVD A;  3A6N C;  3MGR A;  3R45 B;  1P3A B;  2NZD C;  2FFF B;  3AL0 C;  3AZK C;  5AVC C;  1WWS A;  3AYW C;  3W96 A;  1ID3 B;  5B1L A;  2JE5 A;  1HQ3 A;  2F8N B;  5JA4 A;  3REI A;  1M18 B;  2LY8 A;  3C1B B;  5B40 D;  3AV1 B;  5GT0 A;  3UTA C;  4XUJ D;  2Y2N A;  4Z5T D;  5CPJ D;  3MGP D;  2YFW A;  4DRA A;  1F66 B;  5E5A A;  5B1M A;  1P3M A;  5AV5 B;  2CV5 C;  3REK B;  4H9S A;  3MNN C;  1ID3 D;  2ARO A;  4JJN B;  1M18 D;  4QLC B;  3AV1 D;  3AFA C;  2Y2I A;  3AZM C;  1F66 D;  4J8X C;  4DQY B;  3REH B;  5B32 A;  2NQB D;  5BT1 C;  5F99 D;  4YM6 A;  3WTP D;  5AV5 D;  3MGQ B;  1H3O B;  3REK D;  3LZ1 C;  4ZUX C;  3X1S B;  3AZE C;  3B0D C;  4HGA B;  3WA9 C;  4JJN D;  4UPK A;  5B33 C;  1M19 A;  1BH8 B;  2IO5 B;  4J8W B;  1P3L B;  3REH D;  2VQR A; 
#chains in the Genus database with same CATH homology
 5E5A C;  3WKJ A;  4H9Q B;  5DNM C;  4LD9 A;  3W97 A;  3NQU A;  5CPI B;  3X1S D;  1P3B A;  5B0Z B;  4E45 A;  1P3K B;  1W2E A;  4J8V D;  4G91 B;  5GSU B;  3AZI B;  3MGS D;  2BYK B;  2DQN C;  1BH9 B;  3WAA A;  2ARO C;  5B2J C;  2L5A A;  2NZD B;  3O62 A;  1P3L D;  5GT3 D;  5CPI D;  3UTB A;  5B0Z D;  3LZ0 A;  3WTP E;  2RVQ C;  5GSU D;  3UTA B;  3AV2 A;  3B6F A;  5BO0 B;  4X23 B;  3A6N D;  1P3A C;  2NZD D;  1P3F A;  1M19 C;  2CV5 B;  3AZK D;  1AOI B;  4R8P A;  5JRG A;  3AYW D;  1ID3 C;  3AZG C;  2FJ7 A;  1N1J B;  1M18 C;  3C1B C;  3AV1 C;  1P3I B;  3AFA B;  3UTA D;  3X1V C;  5AY8 A;  4KUD A;  2JCH A;  3AZM B;  4Z2M G;  1P3P B;  1JFI B;  4XZQ C;  1U35 A;  3MGR B;  1M1A A;  2CV5 D;  3P5J B;  1KX3 A;  1P3G C;  5B32 G;  2PYO A;  3W96 B;  4QLC C;  5B1L B;  3AFA D;  2G5I C;  5JA4 B;  3H0M C;  4WU9 C;  4WV4 B;  5GT0 B;  3LZ0 C;  3AZM D;  4J8X D;  1P3P D;  5BT1 D;  1TZY A;  5E5A B;  3MGR D;  3MGQ C;  2HIO A;  5AV6 A;  4ZUX D;  3VH5 T;  3B0C T;  3AZE D;  2ZY3 A;  4HGA C;  4R8P C;  1A7W A;  4KHA A;  3WA9 D;  2FJ7 C;  4UUZ A;  2ARO B;  5B2J B;  2Y2O A;  4J8W C;  1P3L C;  5AY8 C;  5BNV B;  5E5A D;  5DNM D;  5B2I A;  4YM6 B;  1U35 C;  1S32 A;  5B0Z C;  3REL C;  1P3K C;  5B24 A;  3AZI C;  5CPK A;  1KX4 A;  3KUY A;  2Y2L A;  2ARO D;  5B2J D;  5AV8 A;  5B0Y A;  2BYM B;  2ZY4 A;  1M19 B;  4G92 C;  2BG1 A;  5AV9 C;  3AZL A;  3AZG B;  3TU4 A;  1TZY C;  5G49 A;  4YS3 A;  3LEL C;  4LD9 B;  3EPH A;  2HIO C;  3W97 B;  2RVQ D;  3AN2 A;  3X1V B;  2ZY5 A;  4X23 C;  3B6G A;  4Z2M H;  3AZJ A;  1P3A D;  5B31 G;  1P3O A;  3WAA B;  4XZQ B;  1M19 D;  1AOI C;  4Z66 A;  3AZN A;  5AVB A;  5CP6 A;  3AZG D;  1P3G B;  2F8N D;  5DNN A;  3C1B D;  1P3I C;  3AZH A;  3B0B A;  4LD9 D;  4KGC A;  3W97 D;  4WU9 B;  3X1V D;  3UTB B;  3LZ0 B;  5CPK C;  3AZF A;  1P3P C;  3MVD C;  3MGR C;  4XZQ D;  3LJA A;  3EPK A;  3F6T A;  2F8N H;  1TAF A;  3X1U A;  3KXB A;  1WWI A;  1P3G D;  3AZL C;  4R8P B;  3W96 C;  5JRG B;  2FJ7 B;  3C1C A;  4QLC D;  5B1L C;  3TU4 C;  2CWE A;  1HQ3 C;  1ZLA A;  3REI C;  4WU9 D;  5GT0 C;  3UTB D;  3LZ0 D;  3V9R A;  3UT9 A;  5AY8 B;  4KUD B;  2Y2P A;  3AZJ C;  5B1M C;  3MGQ D;  1U35 B;  1P3M C;  3REL B;  1M1A B;  4H9S C;  5B40 A;  4R8P D;  2FJ7 D;  2HUE B;  2J8P A;  1KX3 B;  4XUJ A;  4Z5T A;  3B0C W;  5CPJ A;  2PYO B;  1P34 A;  3EPL A;  4J8W D;  4G92 B;  5AY8 D;  4KUD D;  5AV9 B;  1PZR A;  5B32 C;  4YM6 C;  1TZY B;  1U35 D;  1P3K D;  3REL D;  3LEL B;  3AZI D;  2HIO B;  4DRB A;  5AV6 B;  2PYO D;  4WNN A;  3W98 A;  1F66 A;  3A1I A;  5BNX A;  2NQB A;  5F99 A;  3WTP A;  5AV9 D;  3REK A;  3UT9 C;  3EPJ A;  5B31 A;  3WKJ C;  1TZY D;  3LEL D;  4LD9 C;  4H9R A;  3W97 C;  2HIO D;  1S32 B;  1P3B C;  5KDM B;  1HTA A;  4X23 D;  5CPK B;  1KX4 B;  3KWQ A;  3KUY B;  3WAA C;  3MVD B;  5BS7 A;  3H0L C;  5AV8 B;  5B0Y B;  1P34 C;  1AOI D;  3O62 C;  4H9P A;  2YFV A;  3X1S A;  3AZL B;  3IP4 C;  4J8V A;  3TU4 B;  1P3I D;  3W99 A;  3MGS A;  1HQ3 B;  3REI B;  4YS3 B;  3UTB C;  4AWL B;  5CPK D;  3AV2 C;  3AN2 B;  1BH8 A;  3B6F C;  2YFW B;  3MVD D;  3B6G B;  4NE6 A;  3AZJ B;  5AV8 D;  5B1M B;  1P3F C;  4H9Q A;  5GT3 A;  4CSR A;  1P3M B;  3AZN B;  5JRG C;  5CPI A;  3AZL D;  5AVB B;  3W96 D;  5CP6 B;  3TU4 D;  5GSU A;  5B1L D;  2Y2H A;  1HQ3 D;  1BH9 A;  3REI D;  5B31 C;  2Y2M A;  3AZH B;  5GT0 D;  3A6N A;  2NZD A;  3REJ A;  4KGC B;  4KUD C;  4CAY A;  2G5H C;  3X1T A;  3AZK A;  3VH5 A;  5C3I B;  5AVC A;  3KWQ C;  3AZJ D;  3AYW A;  5B32 B;  5B1M D;  3AZF B;  4WU8 A;  1P3M D;  3LJA B;  1M1A C;  1EQZ A;  4EO5 C;  1TAF B;  2HUE C;  3X1U B;  1KX3 C;  2PYO C;  3UTA A;  4KGC D;  3V9R B;  2CV5 A;  4H9N A;  3UT9 B;  5B32 D;  3MNN A;  4YM6 D;  3WKJ B;  2Y2K A;  5AV6 C;  3NQU B;  1P3B B;  3X1U D;  3AFA A;  3AZM A;  4J8X A;  4Z5T B;  2F2A C;  5GXQ A;  4J8U A;  1P34 B;  1R4V A;  3O62 B;  3REJ C;  3UT9 D;  3H0R C;  4ZUX A;  3LZ1 A;  1BFM A;  3AZE A;  3X1T C;  3EG5 B;  3WKJ D;  5B2I C;  3WA9 A;  3NQJ A;  4NE3 A;  1S32 C;  5B33 A;  4WU8 C;  1P3B D;  2Y2Q A;  5B24 C;  1EQZ C;  1KX4 C;  3KUY C;  3AV2 B;  2JSS A;  3B6F B;  3WAA D;  5AV8 C;  4WNN B;  5B0Y C;  3W98 B;  3FDD A;  5CHL B;  1P34 D;  1P3F B;  5BNX B;  5DNM A;  3O62 D;  1KX5 A;  2NQB B;  5F99 B;  4H9O A;  3WTP B;  1B67 A;  4YS3 C;  5B31 B;  3KFU G;  5B2J A;  4AWL C;  4H9R B;  3AN2 C;  3AV2 D;  1KU5 A;  4WJ3 C;  3B6F D;  3B6G C;  5FUG A;  3KWQ B;  3W98 D;  1P3O C;  1P3F D;  5BNV A;  5GXQ C;  4Z66 C;  4J8U C;  3AZN C;  5AVB C;  4ZBJ B;  5JRG D;  5CP6 C;  4EO5 B;  3VH5 W;  3MGP A;  4H9P B;  2Y2G A;  2YFV B;  5DNN C;  3AZH C;  3A1K A;  5B31 D;  4J8V B;  3W99 B;  3R45 A;  3MGS B;  1P3A A;  4KGC C;  2BYM A;  4NE5 A;  5C3I C;  3VH6 T;  2DF4 C;  3KWQ D;  3AZF C;  1ID3 A;  3AZG A;  3LJA C;  2F8N A;  1M18 A;  1M1A D;  3C1B A;  3AV1 A;  3X1U C;  5GT3 B;  4CSR B;  3KXB C;  1KX5 C;  1KX3 D;  3X1V A;  4KHA B;  1T3U A;  3C1C C;  4UUZ B;  3W99 D;  1ZLA C;  3VH6 A;  4XZQ A;  3A6N B;  5AV5 A;  1Q9C A;  2UWX A;  3REJ B;  4CAY B;  3X1T B;  3AZK B;  5AVC B;  1P3G A;  4JJN A;  3AYW B;  5B2I B;  5AV6 D;  4QLC A;  4WU8 B;  5B24 B;  1EQZ B;  5B40 C;  4WU9 A;  1Z2C B;  4XUJ C;  2RIQ A;  4Z5T C;  3MGP C;  3REH A;  5CPJ C;  2ZY2 A;  3MGQ A;  1H3O A;  3REJ D;  3X1T D;  4H9N B;  5AVC D;  5B2I D;  3MNN B;  1F1E A;  5G49 B;  1S32 D;  4WU8 D;  5B24 D;  1EQZ D;  1KX4 D;  3KUY D;  4J8W A;  1P3L A;  3W98 C;  5B0Y D;  1F66 C;  1P3O B;  4J8X B;  1ULY A;  2NQB C;  5GXQ B;  4Z66 B;  5F99 C;  4J8U B;  3KSY A;  3WTP C;  1P3K A;  5B0Z A;  5AV5 C;  3REL A;  1B6W A;  2W8S A;  3REK C;  3AZI A;  3LZ1 B;  2BYK A;  4ZUX B;  3MNN D;  3AZE B;  2Y2J A;  5DNN B;  4YS3 D;  3B0D B;  4JJN C;  3WA9 B;  3NQJ B;  3AN2 D;  4E44 A;  2XD5 A;  5B33 B;  3B6G D;  5AV9 A;  1P3O D;  5BS7 C;  3REH C;  5GXQ D;  4Z66 D;  4J8U D;  3AZN D;  4ZBJ C;  5AVB D;  5CP6 D;  3LEL A;  5DNM B;  3KXB B;  1KX5 B;  4NFT A;  4WZS B;  4H9O B;  3LZ1 D;  3X1S C;  5DNN D;  3W99 C;  3C1C B;  5BO0 A;  4X23 A;  4J8V C;  3AZH D;  3MGS C;  1ZLA B;  2F8N G;  2XD1 A;  2ZM5 A;  4M6B A;  5B33 D;  1AOI A;  2F8N K;  2IO5 C;  3AZF D;  1N1J A;  5FUG B;  3LJA D;  3VH6 W;  1P3I A;  5GT3 C;  3KXB D;  1KX5 D;  5CPI C;  5B40 B;  5KDM A;  4G91 C;  5GSU C;  3C1C D;  4XUJ B;  5CPJ B;  3MGP B;  1ZLA D;  1P3P A;  1JFI A;  3MVD A;  3A6N C;  3MGR A;  3R45 B;  1P3A B;  2NZD C;  2FFF B;  3AL0 C;  3AZK C;  5AVC C;  1WWS A;  3AYW C;  3W96 A;  1ID3 B;  5B1L A;  2JE5 A;  1HQ3 A;  2F8N B;  5JA4 A;  3REI A;  1M18 B;  2LY8 A;  3C1B B;  5B40 D;  3AV1 B;  5GT0 A;  3UTA C;  4XUJ D;  2Y2N A;  4Z5T D;  5CPJ D;  3MGP D;  2YFW A;  4DRA A;  1F66 B;  5E5A A;  5B1M A;  1P3M A;  5AV5 B;  2CV5 C;  3REK B;  4H9S A;  3MNN C;  1ID3 D;  2ARO A;  4JJN B;  1M18 D;  4QLC B;  3AV1 D;  3AFA C;  2Y2I A;  3AZM C;  1F66 D;  4J8X C;  4DQY B;  3REH B;  5B32 A;  2NQB D;  5BT1 C;  5F99 D;  4YM6 A;  3WTP D;  5AV5 D;  3MGQ B;  1H3O B;  3REK D;  3LZ1 C;  4ZUX C;  3X1S B;  3AZE C;  3B0D C;  4HGA B;  3WA9 C;  4JJN D;  4UPK A;  5B33 C;  1M19 A;  1BH8 B;  2IO5 B;  4J8W B;  1P3L B;  3REH D;  2VQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...