5AVCC

Human nucleosome core particle
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 33
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5avcC00
2AROC 2HIOD 3TU4B 5CHLB 3AV2D 3AN2A 4H9PA 3LJAB 5B24B 4H9SC 1KU5A 4KHAA 3MNNB 4AWLB 3AZGD 3MGRD 3C1BB 5E5AC 3B0DC 1P34B 1F66D 4LD9D 3KWQA 4ZBJC 3X1SD 2F8NK 5B33C 5C3IB 1ZLAA 4KHAB 1TAFA 5B1MA 1B6WA 5CPIA 5DNMD 5AV8D 3KWQB 4J8WC 1ZLAC 5GXQB 3KXBA 1P3MA 4YS3D 4J8VA 3C1CB 4JJNC 1KX4C 3X1UC 4DRAA 3B6FC 5B2JA 5DNNB 3LZ1B 4Z2MG 1TZYD 4J8UA 1P3MC 5B2IB 3B6GC 4XZQD 2NZDC 1BFMA 3O62C 3AZJB 3KXBB 1P3OA 5BT1D 3UT9B 4J8VB 3LELC 1M19D 4DRBA 1U35C 1P3AC 3UTAC 3WAAD 1N1JA 5B40D 5F99C 3W97C 3REHA 3TU4D 3AZIB 3WA9B 4J8UB 1BH9A 4G91B 5JRGA 3LJAD 1ID3A 2BYKB 1P3PA 5B0YC 5B1LA 5BNVA 4QLCD 3MNND 5B32G 1N1JB 5B0ZC 1AOIC 5JRGC 3AZEB 3MGQC 1P3GC 1BH9B 4WV4B 3W99C 4ZUXA 5CP6C 3AN2D 3AZHA 3REKB 5B1LB 3UTBC 1KX3A 4R8PC 5BNVB 2JSSA 3A6NC 2NQBB 2HIOB 3KWQD 4ZUXB 1JFIB 5GT3A 5B32A 3RELB 4M6BA 1M1AA 5DNND 5JA4B 5B1MD 5CPID 2HUEC 3LZ1D 4WU8C 1P3LA 3V9RA 3AZGB 3MGRB 4WNNB 3KUYC 1M1AC 3MVDC 3AZJD 3WTPA 3KXBD 1F66B 4WU9C 4J8VD 1HQ3A 5B32B 3X1SB 3AZNA 5B2JD 4NE3A 2IO5B 3VH6W 4J8XA 3AZFA 5AV9C 3V9RB 3AZID 3WA9D 3WKJC 4J8UD 1P3IA 2PYOC 5AVBA 3AYWA 3AV1C 5AV8B 4X23C 1P3OD 5FUGA 1HQ3B 3MGSB 5G49A 3AZNB 4YM6A 4YS3B 3REIA 1P3FC 3AYWC 3AZED 5CPJA 3REHD 5GSUB 3LZ0C 1P3IB 5AVBB 4XUJA 1TZYB 5JRGD 1M18A 1ID3D 1P3PD 5B1LD 4XZQB 2AROA 4E44A 1F1EA 3X1TC 4YM6B 4H9RB 3AZMC 1M19B 1ULYA 5B40B 4Z5TC 3W98C 4H9SA 2FJ7A 4XUJB 4ZUXD 4HGAB 3AFAC 3AZHD 1P3BC 2F8NH 3MGPA 5AY8C 3RELD 5E5AA 1KX3D 5B31C 3R45A 2FJ7C 3AZKC 4Z66A 5AV6C 3B0CW 4QLCB 3VH5W 3MGPC 4NFTA 5B33A 1H3OA 3AN2B 4Z66C 5GT3D 5B32D 4H9PB 3B0DB 4NE5A 4J8WA 5B24C 2BYMA 1P3LD 1KX4A 4JJNA 3X1UA 3NQJA 3B6FA 4AWLC 2CV5A 3C1BC 3WTPD 2RVQC 1HQ3D 3MGSD 3AZND 3B6GA 4E45A 2NZDA 1EQZA 4J8XD 3O62A 1TAFB 3AZFD 2BYMB 2CV5C 1ZLAB 5GSUD 5B1MB 3AZLA 5CPIB 4JJNB 5AVBD 5AV5C 3X1UB 3LELA 1P3ID 1U35A 1P3AA 3UTAA 3VH6T 1EQZC 3W97A 5F99A 1P3MB 4YM6D 3AZLC 3REID 5GXQC 5B2JB 1R4VA 5CPJD 5B0YA 4XUJD 1M18D 5B0ZA 1AOIA 4EO5C 2YFWA 2AROD 3W97B 5B2IC 3MGQA 1P3OB 3X1VC 3KSYA 1P3GA 4G92C 3W99A 5CP6A 3UT9C 5GT0C 5B0YB 4KUDC 5CPKA 3UTBA 1WWIA 4R8PA 3REHB 5B0ZB 3MGPD 4KGCC 5JRGB 2YFWB 1ID3B 5E5AD 5BO0A 3A6NA 3W96A 3MGQB 1P3PB 5CPKC 4WZSB 1P3GB 4Z66D 5KDMA 3REJA 1KX5C 3UTBB 4CSRA 3W96C 5B33D 1P3KC 4Z2MH 3B0CT 5AVCA 4H9OA 3VH5T 4WU8A 3AZHB 3REJC 3KUYA 1KX3B 3REKC 4J8WD 1ZLAD 3MVDA 4WU9A 5AVCC 1KX4D 4JJND 1S32C 3X1UD 3B6FD 5AV9A 2NQBC 4WU8B 1P3MD 3WKJA 2HIOC 2PYOA 5GT3B 2L5AA 3B6GD 3AV1A 2NZDD 1BH8A 1M1AB 3AV2C 3O62D 4X23A 4WU9B 3AZLD 3LELD 1P3LB 1U35D 1P3AD 3UTAD 4LD9A 1P3FA 1HTAA 5B31G 3AZGC 5AV9B 5F99D 3MGRC 3WTPB 3W97D 3WKJB 3LZ0A 2PYOB 1F66C 4UUZA 3AV1B 4H9NA 4LD9C 5B0YD 4J8XB 3AZFB 2F8NG 2IO5C 3X1TA 3AZMA 5B0ZD 3AYWB 1AOID 2YFVA 3MGQD 4Z5TA 3W98A 5FUGB 3LZ0B 5DNMC 1P3GD 3W99D 5G49B 5BS7C 5CP6D 3AFAA 3REIB 1P3BA 5AY8A 5CPKD 3UTBD 4YS3C 5CPJB 4R8PD 5B31A 3AZKA 5AV6A 1M18B 3A6ND 3WAAA 1TZYC 4NE6A 2AROB 2F8NA 4XZQC 3AFAB 5AY8B 3REJD 3TU4A 4CAYA 5BT1C 5B31B 1M19C 3WAAC 2FJ7B 3LJAA 5B24A 4WU8D 3MGPB 2LY8A 3TU4C 4HGAC 5E5AB 3KUYD 3MNNA 1M1AD 3R45B 3MVDD 3C1BA 3LJAC 4WU9D 4Z66B 4ZBJB 4CAYB 1P34A 4QLCC 3MNNC 5B33B 1H3OB 5AV9D 3NQUA 3WKJD 2PYOD 5AV5A 1P34C 3AV1D 3AN2C 4X23D 4J8WB 5C3IC 1P3FD 3NQJB 5GXQA 3AYWD 3B6FB 2CV5B 3C1CA 3NQUB 3LZ0D 5DNNA 5AV5B 3KWQC 3B6GB 3LZ1A 2NZDB 1EQZB 3O62B 5B2IA 3C1CC 3X1TD 3AZMD 3X1VA 3AZLB 5DNNC 3LELB 3AZJA 1U35B 1P3AB 5BNXA 3UTAB 4H9QA 3UT9A 5B1MC 5CPIC 5GT0A 4KUDA 3LZ1C 4Z5TD 3W98D 5F99B 3AFAD 1P3BD 3AZJC 4KGCA 5AY8D 4EO5B 3KXBC 3AZIA 3WA9A 4J8VC 5B31D 3X1VB 5B2JC 2FJ7D 3AZKD 4G92B 2BYKA 5AV6D 5BNXB 4H9QB 5GT0B 1AOIB 4KUDB 1KX5A 3WA9C 3AZIC 4J8UC 1P3KA 2F8ND 4G91C 3AZEA 3W99B 4KGCB 5CP6B 1P3OC 5CPKB 4R8PB 3REKA 5B24D 3AZEC 1KX5B 1S32A 3REHC 5BO0B 3A6NB 3W96B 1P3KB 3C1BD 2RVQD 1ID3C 3VH6A 1P3PC 2NQBA 5B1LC 5KDMB 1P34D 2HIOA 3REJB 4CSRB 3AV2A 2CV5D 1JFIA 3RELA 5AVCB 4H9OB 2HUEB 1S32B 5AV5D 5JA4A 4ZUXC 3KUYB 1KX4B 3AZHC 1EQZD 3AZGA 3MVDB 3MGRA 1WWSA 4WNNA 3RELC 1KX3C 1A7WA 1F66A 5GXQD 3AV2B 3C1CD 3X1SA 1BH8B 1Q9CA 4X23B 5B2ID 5GT3C 5B32C 3X1SC 3X1VD 5DNMA 5AV8A 5BS7A 4LD9B 1P3FB 3UT9D 5GT0D 3B0BA 4KUDD 3MGSA 1P3LC 4YS3A 5AV8C 4UUZB 3WTPE 3WTPC 4H9NB 4KGCD 5GSUA 2CWEA 1HQ3C 3VH5A 3MGSC 3AZNC 1TZYA 5DNMB 3X1TB 1B67A 3AZMB 4XZQA 4J8XC 3AZFC 2YFVB 1KX5D 5GSUC 4H9RA 1P3IC 5AVBC 1P3KD 1M19A 3W96D 4Z5TB 3W98B 5B40A 1P3BB 4YM6C 3REIC 3REKD 3AZKB 5AVCD 5CPJC 5AV6B 1S32D 5B40C 4XUJC 3WAAB 4QLCA 1M18C 2F8NB 2NQBD
chains in the Genus database with same CATH superfamily
2AROC 2HIOD 3TU4B 3EPJA 5CHLB 3AV2D 3AN2A 4H9PA 3LJAB 5B24B 4H9SC 1KU5A 4KHAA 3MNNB 4AWLB 3AZGD 3MGRD 3C1BB 1PZRA 5E5AC 3B0DC 1P34B 1F66D 2JE5A 4LD9D 2Y2KA 3KWQA 1W2EA 4ZBJC 3X1SD 4DQYB 2F8NK 5B33C 5C3IB 1ZLAA 4KHAB 1TAFA 5B1MA 1B6WA 5CPIA 5DNMD 5AV8D 3KWQB 4J8WC 1ZLAC 5GXQB 3KXBA 1P3MA 4YS3D 4J8VA 3C1CB 4JJNC 1KX4C 3X1UC 2RIQA 4DRAA 3B6FC 5B2JA 5DNNB 3LZ1B 4Z2MG 1TZYD 4J8UA 2BG1A 1P3MC 5B2IB 3B6GC 4XZQD 2NZDC 1BFMA 3O62C 3AZJB 3KXBB 1P3OA 5BT1D 3UT9B 4J8VB 3LELC 2VQRA 1M19D 4DRBA 2FFFB 1U35C 3UTAC 1P3AC 3WAAD 1N1JA 5B40D 5F99C 3W97C 3P5JB 3REHA 3TU4D 3AZIB 3WA9B 4J8UB 1BH9A 4G91B 5JRGA 3LJAD 1ID3A 2BYKB 1P3PA 5B0YC 5B1LA 5BNVA 4QLCD 3MNND 5B32G 1N1JB 5B0ZC 1AOIC 5JRGC 3AZEB 3MGQC 1P3GC 1BH9B 4WV4B 3W99C 4ZUXA 5CP6C 3AN2D 3AZHA 3REKB 5B1LB 3UTBC 1KX3A 4R8PC 5BNVB 2JSSA 3A6NC 2NQBB 2HIOB 3KWQD 4ZUXB 2G5IC 1JFIB 5GT3A 5B32A 3RELB 4M6BA 1M1AA 5DNND 5JA4B 5B1MD 5CPID 2HUEC 3LZ1D 4WU8C 1P3LA 3V9RA 3AZGB 3MGRB 4WNNB 3KUYC 2Y2JA 1M1AC 3MVDC 3AZJD 3WTPA 3KXBD 1F66B 4WU9C 4J8VD 1HQ3A 5B32B 3X1SB 3AZNA 5B2JD 4NE3A 2IO5B 3VH6W 4J8XA 4WJ3C 3AZFA 5AV9C 3A1KA 3V9RB 3AZID 3WA9D 3WKJC 4J8UD 1P3IA 2PYOC 5AVBA 3AYWA 3AV1C 3H0MC 5AV8B 4X23C 1P3OD 2JCHA 5FUGA 1HQ3B 3MGSB 5G49A 3AZNB 4YM6A 4YS3B 3REIA 1P3FC 3AYWC 3AZED 5CPJA 3REHD 5GSUB 3LZ0C 1P3IB 5AVBB 4XUJA 1TZYB 5JRGD 1M18A 1ID3D 1P3PD 5B1LD 4XZQB 2AROA 3IP4C 4E44A 1F1EA 3X1TC 4YM6B 4H9RB 3AZMC 1M19B 1ULYA 3AL0C 3EG5B 5B40B 4Z5TC 3W98C 4H9SA 2FJ7A 4XUJB 4ZUXD 4HGAB 3AFAC 3AZHD 1P3BC 2F8NH 3MGPA 3H0LC 5AY8C 3RELD 5E5AA 1KX3D 3EPLA 5B31C 3R45A 2FJ7C 3AZKC 4Z66A 5AV6C 3B0CW 4QLCB 3VH5W 3MGPC 4NFTA 5B33A 1H3OA 3AN2B 4Z66C 5GT3D 5B32D 4H9PB 3B0DB 2Y2IA 4NE5A 4J8WA 2Y2MA 5B24C 2BYMA 1P3LD 1KX4A 4JJNA 3X1UA 3NQJA 3B6FA 4AWLC 2CV5A 3C1BC 3F6TA 3WTPD 2RVQC 1HQ3D 3MGSD 3AZND 3B6GA 2Y2PA 4E45A 2NZDA 1EQZA 4J8XD 3O62A 1TAFB 3AZFD 2BYMB 2CV5C 1ZLAB 5GSUD 5B1MB 3AZLA 5CPIB 4JJNB 5AVBD 5AV5C 3X1UB 3LELA 1P3ID 1U35A 1P3AA 3UTAA 3VH6T 3EPHA 2Y2OA 1EQZC 3W97A 5F99A 1P3MB 4YM6D 3AZLC 3REID 5GXQC 5B2JB 1R4VA 5CPJD 5B0YA 4XUJD 1M18D 5B0ZA 1AOIA 4EO5C 2YFWA 2AROD 3W97B 5B2IC 3MGQA 1P3OB 3X1VC 3KSYA 1P3GA 4G92C 3W99A 5CP6A 3UT9C 5GT0C 5B0YB 4KUDC 5CPKA 3UTBA 1WWIA 4R8PA 3REHB 5B0ZB 3MGPD 4KGCC 5JRGB 2YFWB 1ID3B 5E5AD 5BO0A 3A6NA 3W96A 3MGQB 1P3PB 5CPKC 4WZSB 1P3GB 4Z66D 2ZM5A 5KDMA 2J8PA 3REJA 1KX5C 3UTBB 4CSRA 2DF4C 3W96C 5B33D 1P3KC 4Z2MH 3B0CT 5AVCA 4H9OA 3VH5T 4WU8A 3AZHB 3REJC 3KUYA 1KX3B 3REKC 4J8WD 1ZLAD 3MVDA 4WU9A 5AVCC 1KX4D 4JJND 1S32C 3X1UD 3B6FD 5AV9A 2NQBC 4WU8B 1P3MD 3WKJA 2HIOC 2PYOA 5GT3B 2L5AA 3EPKA 3B6GD 3AV1A 2NZDD 1BH8A 1M1AB 3AV2C 3O62D 4X23A 4WU9B 3AZLD 3LELD 1P3LB 1U35D 1P3AD 3UTAD 4LD9A 1P3FA 1HTAA 5B31G 3AZGC 5AV9B 5F99D 3MGRC 3WTPB 3W97D 3WKJB 3LZ0A 2PYOB 1F66C 4UUZA 3AV1B 4H9NA 4LD9C 5B0YD 3FDDA 4J8XB 3AZFB 2F8NG 2IO5C 3X1TA 3AZMA 5B0ZD 3AYWB 1AOID 2YFVA 3MGQD 4Z5TA 3W98A 5FUGB 3LZ0B 5DNMC 2ZY2A 1P3GD 3W99D 5G49B 5BS7C 5CP6D 3AFAA 3REIB 1P3BA 5AY8A 5CPKD 3UTBD 4YS3C 5CPJB 4R8PD 5B31A 3AZKA 5AV6A 2DQNC 1M18B 3A6ND 2ZY3A 3WAAA 1TZYC 4NE6A 2AROB 2XD5A 2F8NA 4XZQC 3AFAB 5AY8B 3REJD 3TU4A 4CAYA 5BT1C 5B31B 1M19C 3WAAC 2FJ7B 3LJAA 5B24A 4WU8D 3MGPB 2LY8A 3TU4C 4HGAC 5E5AB 3KUYD 3MNNA 1M1AD 3R45B 3MVDD 3C1BA 3LJAC 2Y2QA 4WU9D 4Z66B 4ZBJB 4CAYB 1P34A 2W8SA 4QLCC 3MNNC 5B33B 1H3OB 5AV9D 3NQUA 3WKJD 2PYOD 5AV5A 1P34C 3AV1D 3AN2C 4X23D 4J8WB 5C3IC 1P3FD 3NQJB 5GXQA 3AYWD 3B6FB 2CV5B 3C1CA 3NQUB 3LZ0D 5DNNA 5AV5B 2Y2HA 3KWQC 3B6GB 3LZ1A 2NZDB 1Z2CB 1EQZB 3O62B 5B2IA 3C1CC 3X1TD 3AZMD 3X1VA 3AZLB 5DNNC 4UPKA 3LELB 3AZJA 1U35B 3A1IA 5BNXA 3UTAB 1P3AB 4H9QA 3UT9A 5B1MC 5CPIC 5GT0A 4KUDA 3LZ1C 4Z5TD 3W98D 5F99B 3AFAD 1P3BD 3AZJC 4KGCA 5AY8D 4EO5B 3KXBC 3AZIA 3WA9A 4J8VC 5B31D 3X1VB 5B2JC 2FJ7D 3AZKD 4G92B 2BYKA 3H0RC 5AV6D 5BNXB 4H9QB 5GT0B 1AOIB 4KUDB 1KX5A 3WA9C 3AZIC 4J8UC 2F2AC 1P3KA 2F8ND 1T3UA 4G91C 3AZEA 3W99B 4KGCB 5CP6B 1P3OC 2Y2LA 2XD1A 2UWXA 5CPKB 4R8PB 3REKA 5B24D 3AZEC 1KX5B 1S32A 3REHC 5BO0B 3A6NB 3W96B 1P3KB 3C1BD 2RVQD 1ID3C 3VH6A 1P3PC 2NQBA 5B1LC 5KDMB 1P34D 2HIOA 3REJB 4CSRB 3AV2A 2CV5D 1JFIA 3RELA 5AVCB 4H9OB 2HUEB 1S32B 5AV5D 2Y2NA 2ZY5A 5JA4A 4ZUXC 3KUYB 1KX4B 3AZHC 1EQZD 3AZGA 2ZY4A 3MVDB 3MGRA 1WWSA 4WNNA 3RELC 1KX3C 1A7WA 1F66A 5GXQD 3AV2B 3C1CD 3X1SA 1BH8B 1Q9CA 4X23B 5B2ID 5GT3C 5B32C 3X1SC 3X1VD 5DNMA 5AV8A 5BS7A 4LD9B 1P3FB 3UT9D 5GT0D 3B0BA 4KUDD 3MGSA 1P3LC 4YS3A 5AV8C 4UUZB 3WTPE 3WTPC 4H9NB 4KGCD 5GSUA 3KFUG 2CWEA 1HQ3C 3VH5A 3MGSC 3AZNC 1TZYA 5DNMB 3X1TB 1B67A 3AZMB 4XZQA 4J8XC 3AZFC 2YFVB 1KX5D 5GSUC 4H9RA 1P3IC 5AVBC 1P3KD 1M19A 3W96D 4Z5TB 3W98B 5B40A 1P3BB 2Y2GA 4YM6C 3REIC 3REKD 3AZKB 5AVCD 5CPJC 5AV6B 2G5HC 1S32D 5B40C 4XUJC 3WAAB 4QLCA 1M18C 2F8NB 2NQBD
chains in the Genus database with same CATH topology
2AROC 2HIOD 3TU4B 3EPJA 5CHLB 3AV2D 3AN2A 4H9PA 3LJAB 5B24B 4H9SC 1KU5A 4KHAA 3MNNB 4AWLB 3AZGD 3MGRD 3C1BB 1PZRA 5E5AC 3B0DC 1P34B 1F66D 2JE5A 4LD9D 2Y2KA 3KWQA 1W2EA 4ZBJC 3X1SD 4DQYB 2F8NK 5B33C 5C3IB 1ZLAA 4KHAB 1TAFA 5B1MA 1B6WA 5CPIA 5DNMD 5AV8D 3KWQB 4J8WC 1ZLAC 5GXQB 3KXBA 1P3MA 4YS3D 4J8VA 3C1CB 4JJNC 1KX4C 3X1UC 2RIQA 4DRAA 3B6FC 5B2JA 5DNNB 3LZ1B 4Z2MG 1TZYD 4J8UA 2BG1A 1P3MC 5B2IB 3B6GC 4XZQD 2NZDC 1BFMA 3O62C 3AZJB 3KXBB 1P3OA 5BT1D 3UT9B 4J8VB 3LELC 2VQRA 1M19D 4DRBA 2FFFB 1U35C 3UTAC 1P3AC 3WAAD 1N1JA 5B40D 5F99C 3W97C 3P5JB 3REHA 3TU4D 3AZIB 3WA9B 4J8UB 1BH9A 4G91B 5JRGA 3LJAD 1ID3A 2BYKB 1P3PA 5B0YC 5B1LA 5BNVA 4QLCD 3MNND 5B32G 1N1JB 5B0ZC 1AOIC 5JRGC 3AZEB 3MGQC 1P3GC 1BH9B 4WV4B 3W99C 4ZUXA 5CP6C 3AN2D 3AZHA 3REKB 5B1LB 3UTBC 1KX3A 4R8PC 5BNVB 2JSSA 3A6NC 2NQBB 2HIOB 3KWQD 4ZUXB 2G5IC 1JFIB 5GT3A 5B32A 3RELB 4M6BA 1M1AA 5DNND 5JA4B 5B1MD 5CPID 2HUEC 3LZ1D 4WU8C 1P3LA 3V9RA 3AZGB 3MGRB 4WNNB 3KUYC 2Y2JA 1M1AC 3MVDC 3AZJD 3WTPA 3KXBD 1F66B 4WU9C 4J8VD 1HQ3A 5B32B 3X1SB 3AZNA 5B2JD 4NE3A 2IO5B 3VH6W 4J8XA 4WJ3C 3AZFA 5AV9C 3A1KA 3V9RB 3AZID 3WA9D 3WKJC 4J8UD 1P3IA 2PYOC 5AVBA 3AYWA 3AV1C 3H0MC 5AV8B 4X23C 1P3OD 2JCHA 5FUGA 1HQ3B 3MGSB 5G49A 3AZNB 4YM6A 4YS3B 3REIA 1P3FC 3AYWC 3AZED 5CPJA 3REHD 5GSUB 3LZ0C 1P3IB 5AVBB 4XUJA 1TZYB 5JRGD 1M18A 1ID3D 1P3PD 5B1LD 4XZQB 2AROA 3IP4C 4E44A 1F1EA 3X1TC 4YM6B 4H9RB 3AZMC 1M19B 1ULYA 3AL0C 3EG5B 5B40B 4Z5TC 3W98C 4H9SA 2FJ7A 4XUJB 4ZUXD 4HGAB 3AFAC 3AZHD 1P3BC 2F8NH 3MGPA 3H0LC 5AY8C 3RELD 5E5AA 1KX3D 3EPLA 5B31C 3R45A 2FJ7C 3AZKC 4Z66A 5AV6C 3B0CW 4QLCB 3VH5W 3MGPC 4NFTA 5B33A 1H3OA 3AN2B 4Z66C 5GT3D 5B32D 4H9PB 3B0DB 2Y2IA 4NE5A 4J8WA 2Y2MA 5B24C 2BYMA 1P3LD 1KX4A 4JJNA 3X1UA 3NQJA 3B6FA 4AWLC 2CV5A 3C1BC 3F6TA 3WTPD 2RVQC 1HQ3D 3MGSD 3AZND 3B6GA 2Y2PA 4E45A 2NZDA 1EQZA 4J8XD 3O62A 1TAFB 3AZFD 2BYMB 2CV5C 1ZLAB 5GSUD 5B1MB 3AZLA 5CPIB 4JJNB 5AVBD 5AV5C 3X1UB 3LELA 1P3ID 1U35A 1P3AA 3UTAA 3VH6T 3EPHA 2Y2OA 1EQZC 3W97A 5F99A 1P3MB 4YM6D 3AZLC 3REID 5GXQC 5B2JB 1R4VA 5CPJD 5B0YA 4XUJD 1M18D 5B0ZA 1AOIA 4EO5C 2YFWA 2AROD 3W97B 5B2IC 3MGQA 1P3OB 3X1VC 3KSYA 1P3GA 4G92C 3W99A 5CP6A 3UT9C 5GT0C 5B0YB 4KUDC 5CPKA 3UTBA 1WWIA 4R8PA 3REHB 5B0ZB 3MGPD 4KGCC 5JRGB 2YFWB 1ID3B 5E5AD 5BO0A 3A6NA 3W96A 3MGQB 1P3PB 5CPKC 4WZSB 1P3GB 4Z66D 2ZM5A 5KDMA 2J8PA 3REJA 1KX5C 3UTBB 4CSRA 2DF4C 3W96C 5B33D 1P3KC 4Z2MH 3B0CT 5AVCA 4H9OA 3VH5T 4WU8A 3AZHB 3REJC 3KUYA 1KX3B 3REKC 4J8WD 1ZLAD 3MVDA 4WU9A 5AVCC 1KX4D 4JJND 1S32C 3X1UD 3B6FD 5AV9A 2NQBC 4WU8B 1P3MD 3WKJA 2HIOC 2PYOA 5GT3B 2L5AA 3EPKA 3B6GD 3AV1A 2NZDD 1BH8A 1M1AB 3AV2C 3O62D 4X23A 4WU9B 3AZLD 3LELD 1P3LB 1U35D 1P3AD 3UTAD 4LD9A 1P3FA 1HTAA 5B31G 3AZGC 5AV9B 5F99D 3MGRC 3WTPB 3W97D 3WKJB 3LZ0A 2PYOB 1F66C 4UUZA 3AV1B 4H9NA 4LD9C 5B0YD 3FDDA 4J8XB 3AZFB 2F8NG 2IO5C 3X1TA 3AZMA 5B0ZD 3AYWB 1AOID 2YFVA 3MGQD 4Z5TA 3W98A 5FUGB 3LZ0B 5DNMC 2ZY2A 1P3GD 3W99D 5G49B 5BS7C 5CP6D 3AFAA 3REIB 1P3BA 5AY8A 5CPKD 3UTBD 4YS3C 5CPJB 4R8PD 5B31A 3AZKA 5AV6A 2DQNC 1M18B 3A6ND 2ZY3A 3WAAA 1TZYC 4NE6A 2AROB 2XD5A 2F8NA 4XZQC 3AFAB 5AY8B 3REJD 3TU4A 4CAYA 5BT1C 5B31B 1M19C 3WAAC 2FJ7B 3LJAA 5B24A 4WU8D 3MGPB 2LY8A 3TU4C 4HGAC 5E5AB 3KUYD 3MNNA 1M1AD 3R45B 3MVDD 3C1BA 3LJAC 2Y2QA 4WU9D 4Z66B 4ZBJB 4CAYB 1P34A 2W8SA 4QLCC 3MNNC 5B33B 1H3OB 5AV9D 3NQUA 3WKJD 2PYOD 5AV5A 1P34C 3AV1D 3AN2C 4X23D 4J8WB 5C3IC 1P3FD 3NQJB 5GXQA 3AYWD 3B6FB 2CV5B 3C1CA 3NQUB 3LZ0D 5DNNA 5AV5B 2Y2HA 3KWQC 3B6GB 3LZ1A 2NZDB 1Z2CB 1EQZB 3O62B 5B2IA 3C1CC 3X1TD 3AZMD 3X1VA 3AZLB 5DNNC 4UPKA 3LELB 3AZJA 1U35B 3A1IA 5BNXA 3UTAB 1P3AB 4H9QA 3UT9A 5B1MC 5CPIC 5GT0A 4KUDA 3LZ1C 4Z5TD 3W98D 5F99B 3AFAD 1P3BD 3AZJC 4KGCA 5AY8D 4EO5B 3KXBC 3AZIA 3WA9A 4J8VC 5B31D 3X1VB 5B2JC 2FJ7D 3AZKD 4G92B 2BYKA 3H0RC 5AV6D 5BNXB 4H9QB 5GT0B 1AOIB 4KUDB 1KX5A 3WA9C 3AZIC 4J8UC 2F2AC 1P3KA 2F8ND 1T3UA 4G91C 3AZEA 3W99B 4KGCB 5CP6B 1P3OC 2Y2LA 2XD1A 2UWXA 5CPKB 4R8PB 3REKA 5B24D 3AZEC 1KX5B 1S32A 3REHC 5BO0B 3A6NB 3W96B 1P3KB 3C1BD 2RVQD 1ID3C 3VH6A 1P3PC 2NQBA 5B1LC 5KDMB 1P34D 2HIOA 3REJB 4CSRB 3AV2A 2CV5D 1JFIA 3RELA 5AVCB 4H9OB 2HUEB 1S32B 5AV5D 2Y2NA 2ZY5A 5JA4A 4ZUXC 3KUYB 1KX4B 3AZHC 1EQZD 3AZGA 2ZY4A 3MVDB 3MGRA 1WWSA 4WNNA 3RELC 1KX3C 1A7WA 1F66A 5GXQD 3AV2B 3C1CD 3X1SA 1BH8B 1Q9CA 4X23B 5B2ID 5GT3C 5B32C 3X1SC 3X1VD 5DNMA 5AV8A 5BS7A 4LD9B 1P3FB 3UT9D 5GT0D 3B0BA 4KUDD 3MGSA 1P3LC 4YS3A 5AV8C 4UUZB 3WTPE 3WTPC 4H9NB 4KGCD 5GSUA 3KFUG 2CWEA 1HQ3C 3VH5A 3MGSC 3AZNC 1TZYA 5DNMB 3X1TB 1B67A 3AZMB 4XZQA 4J8XC 3AZFC 2YFVB 1KX5D 5GSUC 4H9RA 1P3IC 5AVBC 1P3KD 1M19A 3W96D 4Z5TB 3W98B 5B40A 1P3BB 2Y2GA 4YM6C 3REIC 3REKD 3AZKB 5AVCD 5CPJC 5AV6B 2G5HC 1S32D 5B40C 4XUJC 3WAAB 4QLCA 1M18C 2F8NB 2NQBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ARO C;  2HIO D;  3TU4 B;  5CHL B;  3AV2 D;  3AN2 A;  4H9P A;  3LJA B;  5B24 B;  4H9S C;  1KU5 A;  4KHA A;  3MNN B;  4AWL B;  3AZG D;  3MGR D;  3C1B B;  5E5A C;  3B0D C;  1P34 B;  1F66 D;  4LD9 D;  3KWQ A;  4ZBJ C;  3X1S D;  2F8N K;  5B33 C;  5C3I B;  1ZLA A;  4KHA B;  1TAF A;  5B1M A;  1B6W A;  5CPI A;  5DNM D;  5AV8 D;  3KWQ B;  4J8W C;  1ZLA C;  5GXQ B;  3KXB A;  1P3M A;  4YS3 D;  4J8V A;  3C1C B;  4JJN C;  1KX4 C;  3X1U C;  4DRA A;  3B6F C;  5B2J A;  5DNN B;  3LZ1 B;  4Z2M G;  1TZY D;  4J8U A;  1P3M C;  5B2I B;  3B6G C;  4XZQ D;  2NZD C;  1BFM A;  3O62 C;  3AZJ B;  3KXB B;  1P3O A;  5BT1 D;  3UT9 B;  4J8V B;  3LEL C;  1M19 D;  4DRB A;  1U35 C;  1P3A C;  3UTA C;  3WAA D;  1N1J A;  5B40 D;  5F99 C;  3W97 C;  3REH A;  3TU4 D;  3AZI B;  3WA9 B;  4J8U B;  1BH9 A;  4G91 B;  5JRG A;  3LJA D;  1ID3 A;  2BYK B;  1P3P A;  5B0Y C;  5B1L A;  5BNV A;  4QLC D;  3MNN D;  5B32 G;  1N1J B;  5B0Z C;  1AOI C;  5JRG C;  3AZE B;  3MGQ C;  1P3G C;  1BH9 B;  4WV4 B;  3W99 C;  4ZUX A;  5CP6 C;  3AN2 D;  3AZH A;  3REK B;  5B1L B;  3UTB C;  1KX3 A;  4R8P C;  5BNV B;  2JSS A;  3A6N C;  2NQB B;  2HIO B;  3KWQ D;  4ZUX B;  1JFI B;  5GT3 A;  5B32 A;  3REL B;  4M6B A;  1M1A A;  5DNN D;  5JA4 B;  5B1M D;  5CPI D;  2HUE C;  3LZ1 D;  4WU8 C;  1P3L A;  3V9R A;  3AZG B;  3MGR B;  4WNN B;  3KUY C;  1M1A C;  3MVD C;  3AZJ D;  3WTP A;  3KXB D;  1F66 B;  4WU9 C;  4J8V D;  1HQ3 A;  5B32 B;  3X1S B;  3AZN A;  5B2J D;  4NE3 A;  2IO5 B;  3VH6 W;  4J8X A;  3AZF A;  5AV9 C;  3V9R B;  3AZI D;  3WA9 D;  3WKJ C;  4J8U D;  1P3I A;  2PYO C;  5AVB A;  3AYW A;  3AV1 C;  5AV8 B;  4X23 C;  1P3O D;  5FUG A;  1HQ3 B;  3MGS B;  5G49 A;  3AZN B;  4YM6 A;  4YS3 B;  3REI A;  1P3F C;  3AYW C;  3AZE D;  5CPJ A;  3REH D;  5GSU B;  3LZ0 C;  1P3I B;  5AVB B;  4XUJ A;  1TZY B;  5JRG D;  1M18 A;  1ID3 D;  1P3P D;  5B1L D;  4XZQ B;  2ARO A;  4E44 A;  1F1E A;  3X1T C;  4YM6 B;  4H9R B;  3AZM C;  1M19 B;  1ULY A;  5B40 B;  4Z5T C;  3W98 C;  4H9S A;  2FJ7 A;  4XUJ B;  4ZUX D;  4HGA B;  3AFA C;  3AZH D;  1P3B C;  2F8N H;  3MGP A;  5AY8 C;  3REL D;  5E5A A;  1KX3 D;  5B31 C;  3R45 A;  2FJ7 C;  3AZK C;  4Z66 A;  5AV6 C;  3B0C W;  4QLC B;  3VH5 W;  3MGP C;  4NFT A;  5B33 A;  1H3O A;  3AN2 B;  4Z66 C;  5GT3 D;  5B32 D;  4H9P B;  3B0D B;  4NE5 A;  4J8W A;  5B24 C;  2BYM A;  1P3L D;  1KX4 A;  4JJN A;  3X1U A;  3NQJ A;  3B6F A;  4AWL C;  2CV5 A;  3C1B C;  3WTP D;  2RVQ C;  1HQ3 D;  3MGS D;  3AZN D;  3B6G A;  4E45 A;  2NZD A;  1EQZ A;  4J8X D;  3O62 A;  1TAF B;  3AZF D;  2BYM B;  2CV5 C;  1ZLA B;  5GSU D;  5B1M B;  3AZL A;  5CPI B;  4JJN B;  5AVB D;  5AV5 C;  3X1U B;  3LEL A;  1P3I D;  1U35 A;  1P3A A;  3UTA A;  3VH6 T;  1EQZ C;  3W97 A;  5F99 A;  1P3M B;  4YM6 D;  3AZL C;  3REI D;  5GXQ C;  5B2J B;  1R4V A;  5CPJ D;  5B0Y A;  4XUJ D;  1M18 D;  5B0Z A;  1AOI A;  4EO5 C;  2YFW A;  2ARO D;  3W97 B;  5B2I C;  3MGQ A;  1P3O B;  3X1V C;  3KSY A;  1P3G A;  4G92 C;  3W99 A;  5CP6 A;  3UT9 C;  5GT0 C;  5B0Y B;  4KUD C;  5CPK A;  3UTB A;  1WWI A;  4R8P A;  3REH B;  5B0Z B;  3MGP D;  4KGC C;  5JRG B;  2YFW B;  1ID3 B;  5E5A D;  5BO0 A;  3A6N A;  3W96 A;  3MGQ B;  1P3P B;  5CPK C;  4WZS B;  1P3G B;  4Z66 D;  5KDM A;  3REJ A;  1KX5 C;  3UTB B;  4CSR A;  3W96 C;  5B33 D;  1P3K C;  4Z2M H;  3B0C T;  5AVC A;  4H9O A;  3VH5 T;  4WU8 A;  3AZH B;  3REJ C;  3KUY A;  1KX3 B;  3REK C;  4J8W D;  1ZLA D;  3MVD A;  4WU9 A;  5AVC C;  1KX4 D;  4JJN D;  1S32 C;  3X1U D;  3B6F D;  5AV9 A;  2NQB C;  4WU8 B;  1P3M D;  3WKJ A;  2HIO C;  2PYO A;  5GT3 B;  2L5A A;  3B6G D;  3AV1 A;  2NZD D;  1BH8 A;  1M1A B;  3AV2 C;  3O62 D;  4X23 A;  4WU9 B;  3AZL D;  3LEL D;  1P3L B;  1U35 D;  1P3A D;  3UTA D;  4LD9 A;  1P3F A;  1HTA A;  5B31 G;  3AZG C;  5AV9 B;  5F99 D;  3MGR C;  3WTP B;  3W97 D;  3WKJ B;  3LZ0 A;  2PYO B;  1F66 C;  4UUZ A;  3AV1 B;  4H9N A;  4LD9 C;  5B0Y D;  4J8X B;  3AZF B;  2F8N G;  2IO5 C;  3X1T A;  3AZM A;  5B0Z D;  3AYW B;  1AOI D;  2YFV A;  3MGQ D;  4Z5T A;  3W98 A;  5FUG B;  3LZ0 B;  5DNM C;  1P3G D;  3W99 D;  5G49 B;  5BS7 C;  5CP6 D;  3AFA A;  3REI B;  1P3B A;  5AY8 A;  5CPK D;  3UTB D;  4YS3 C;  5CPJ B;  4R8P D;  5B31 A;  3AZK A;  5AV6 A;  1M18 B;  3A6N D;  3WAA A;  1TZY C;  4NE6 A;  2ARO B;  2F8N A;  4XZQ C;  3AFA B;  5AY8 B;  3REJ D;  3TU4 A;  4CAY A;  5BT1 C;  5B31 B;  1M19 C;  3WAA C;  2FJ7 B;  3LJA A;  5B24 A;  4WU8 D;  3MGP B;  2LY8 A;  3TU4 C;  4HGA C;  5E5A B;  3KUY D;  3MNN A;  1M1A D;  3R45 B;  3MVD D;  3C1B A;  3LJA C;  4WU9 D;  4Z66 B;  4ZBJ B;  4CAY B;  1P34 A;  4QLC C;  3MNN C;  5B33 B;  1H3O B;  5AV9 D;  3NQU A;  3WKJ D;  2PYO D;  5AV5 A;  1P34 C;  3AV1 D;  3AN2 C;  4X23 D;  4J8W B;  5C3I C;  1P3F D;  3NQJ B;  5GXQ A;  3AYW D;  3B6F B;  2CV5 B;  3C1C A;  3NQU B;  3LZ0 D;  5DNN A;  5AV5 B;  3KWQ C;  3B6G B;  3LZ1 A;  2NZD B;  1EQZ B;  3O62 B;  5B2I A;  3C1C C;  3X1T D;  3AZM D;  3X1V A;  3AZL B;  5DNN C;  3LEL B;  3AZJ A;  1U35 B;  1P3A B;  5BNX A;  3UTA B;  4H9Q A;  3UT9 A;  5B1M C;  5CPI C;  5GT0 A;  4KUD A;  3LZ1 C;  4Z5T D;  3W98 D;  5F99 B;  3AFA D;  1P3B D;  3AZJ C;  4KGC A;  5AY8 D;  4EO5 B;  3KXB C;  3AZI A;  3WA9 A;  4J8V C;  5B31 D;  3X1V B;  5B2J C;  2FJ7 D;  3AZK D;  4G92 B;  2BYK A;  5AV6 D;  5BNX B;  4H9Q B;  5GT0 B;  1AOI B;  4KUD B;  1KX5 A;  3WA9 C;  3AZI C;  4J8U C;  1P3K A;  2F8N D;  4G91 C;  3AZE A;  3W99 B;  4KGC B;  5CP6 B;  1P3O C;  5CPK B;  4R8P B;  3REK A;  5B24 D;  3AZE C;  1KX5 B;  1S32 A;  3REH C;  5BO0 B;  3A6N B;  3W96 B;  1P3K B;  3C1B D;  2RVQ D;  1ID3 C;  3VH6 A;  1P3P C;  2NQB A;  5B1L C;  5KDM B;  1P34 D;  2HIO A;  3REJ B;  4CSR B;  3AV2 A;  2CV5 D;  1JFI A;  3REL A;  5AVC B;  4H9O B;  2HUE B;  1S32 B;  5AV5 D;  5JA4 A;  4ZUX C;  3KUY B;  1KX4 B;  3AZH C;  1EQZ D;  3AZG A;  3MVD B;  3MGR A;  1WWS A;  4WNN A;  3REL C;  1KX3 C;  1A7W A;  1F66 A;  5GXQ D;  3AV2 B;  3C1C D;  3X1S A;  1BH8 B;  1Q9C A;  4X23 B;  5B2I D;  5GT3 C;  5B32 C;  3X1S C;  3X1V D;  5DNM A;  5AV8 A;  5BS7 A;  4LD9 B;  1P3F B;  3UT9 D;  5GT0 D;  3B0B A;  4KUD D;  3MGS A;  1P3L C;  4YS3 A;  5AV8 C;  4UUZ B;  3WTP E;  3WTP C;  4H9N B;  4KGC D;  5GSU A;  2CWE A;  1HQ3 C;  3VH5 A;  3MGS C;  3AZN C;  1TZY A;  5DNM B;  3X1T B;  1B67 A;  3AZM B;  4XZQ A;  4J8X C;  3AZF C;  2YFV B;  1KX5 D;  5GSU C;  4H9R A;  1P3I C;  5AVB C;  1P3K D;  1M19 A;  3W96 D;  4Z5T B;  3W98 B;  5B40 A;  1P3B B;  4YM6 C;  3REI C;  3REK D;  3AZK B;  5AVC D;  5CPJ C;  5AV6 B;  1S32 D;  5B40 C;  4XUJ C;  3WAA B;  4QLC A;  1M18 C;  2F8N B;  2NQB D; 
#chains in the Genus database with same CATH topology
 2ARO C;  2HIO D;  3TU4 B;  3EPJ A;  5CHL B;  3AV2 D;  3AN2 A;  4H9P A;  3LJA B;  5B24 B;  4H9S C;  1KU5 A;  4KHA A;  3MNN B;  4AWL B;  3AZG D;  3MGR D;  3C1B B;  1PZR A;  5E5A C;  3B0D C;  1P34 B;  1F66 D;  2JE5 A;  4LD9 D;  2Y2K A;  3KWQ A;  1W2E A;  4ZBJ C;  3X1S D;  4DQY B;  2F8N K;  5B33 C;  5C3I B;  1ZLA A;  4KHA B;  1TAF A;  5B1M A;  1B6W A;  5CPI A;  5DNM D;  5AV8 D;  3KWQ B;  4J8W C;  1ZLA C;  5GXQ B;  3KXB A;  1P3M A;  4YS3 D;  4J8V A;  3C1C B;  4JJN C;  1KX4 C;  3X1U C;  2RIQ A;  4DRA A;  3B6F C;  5B2J A;  5DNN B;  3LZ1 B;  4Z2M G;  1TZY D;  4J8U A;  2BG1 A;  1P3M C;  5B2I B;  3B6G C;  4XZQ D;  2NZD C;  1BFM A;  3O62 C;  3AZJ B;  3KXB B;  1P3O A;  5BT1 D;  3UT9 B;  4J8V B;  3LEL C;  2VQR A;  1M19 D;  4DRB A;  2FFF B;  1U35 C;  3UTA C;  1P3A C;  3WAA D;  1N1J A;  5B40 D;  5F99 C;  3W97 C;  3P5J B;  3REH A;  3TU4 D;  3AZI B;  3WA9 B;  4J8U B;  1BH9 A;  4G91 B;  5JRG A;  3LJA D;  1ID3 A;  2BYK B;  1P3P A;  5B0Y C;  5B1L A;  5BNV A;  4QLC D;  3MNN D;  5B32 G;  1N1J B;  5B0Z C;  1AOI C;  5JRG C;  3AZE B;  3MGQ C;  1P3G C;  1BH9 B;  4WV4 B;  3W99 C;  4ZUX A;  5CP6 C;  3AN2 D;  3AZH A;  3REK B;  5B1L B;  3UTB C;  1KX3 A;  4R8P C;  5BNV B;  2JSS A;  3A6N C;  2NQB B;  2HIO B;  3KWQ D;  4ZUX B;  2G5I C;  1JFI B;  5GT3 A;  5B32 A;  3REL B;  4M6B A;  1M1A A;  5DNN D;  5JA4 B;  5B1M D;  5CPI D;  2HUE C;  3LZ1 D;  4WU8 C;  1P3L A;  3V9R A;  3AZG B;  3MGR B;  4WNN B;  3KUY C;  2Y2J A;  1M1A C;  3MVD C;  3AZJ D;  3WTP A;  3KXB D;  1F66 B;  4WU9 C;  4J8V D;  1HQ3 A;  5B32 B;  3X1S B;  3AZN A;  5B2J D;  4NE3 A;  2IO5 B;  3VH6 W;  4J8X A;  4WJ3 C;  3AZF A;  5AV9 C;  3A1K A;  3V9R B;  3AZI D;  3WA9 D;  3WKJ C;  4J8U D;  1P3I A;  2PYO C;  5AVB A;  3AYW A;  3AV1 C;  3H0M C;  5AV8 B;  4X23 C;  1P3O D;  2JCH A;  5FUG A;  1HQ3 B;  3MGS B;  5G49 A;  3AZN B;  4YM6 A;  4YS3 B;  3REI A;  1P3F C;  3AYW C;  3AZE D;  5CPJ A;  3REH D;  5GSU B;  3LZ0 C;  1P3I B;  5AVB B;  4XUJ A;  1TZY B;  5JRG D;  1M18 A;  1ID3 D;  1P3P D;  5B1L D;  4XZQ B;  2ARO A;  3IP4 C;  4E44 A;  1F1E A;  3X1T C;  4YM6 B;  4H9R B;  3AZM C;  1M19 B;  1ULY A;  3AL0 C;  3EG5 B;  5B40 B;  4Z5T C;  3W98 C;  4H9S A;  2FJ7 A;  4XUJ B;  4ZUX D;  4HGA B;  3AFA C;  3AZH D;  1P3B C;  2F8N H;  3MGP A;  3H0L C;  5AY8 C;  3REL D;  5E5A A;  1KX3 D;  3EPL A;  5B31 C;  3R45 A;  2FJ7 C;  3AZK C;  4Z66 A;  5AV6 C;  3B0C W;  4QLC B;  3VH5 W;  3MGP C;  4NFT A;  5B33 A;  1H3O A;  3AN2 B;  4Z66 C;  5GT3 D;  5B32 D;  4H9P B;  3B0D B;  2Y2I A;  4NE5 A;  4J8W A;  2Y2M A;  5B24 C;  2BYM A;  1P3L D;  1KX4 A;  4JJN A;  3X1U A;  3NQJ A;  3B6F A;  4AWL C;  2CV5 A;  3C1B C;  3F6T A;  3WTP D;  2RVQ C;  1HQ3 D;  3MGS D;  3AZN D;  3B6G A;  2Y2P A;  4E45 A;  2NZD A;  1EQZ A;  4J8X D;  3O62 A;  1TAF B;  3AZF D;  2BYM B;  2CV5 C;  1ZLA B;  5GSU D;  5B1M B;  3AZL A;  5CPI B;  4JJN B;  5AVB D;  5AV5 C;  3X1U B;  3LEL A;  1P3I D;  1U35 A;  1P3A A;  3UTA A;  3VH6 T;  3EPH A;  2Y2O A;  1EQZ C;  3W97 A;  5F99 A;  1P3M B;  4YM6 D;  3AZL C;  3REI D;  5GXQ C;  5B2J B;  1R4V A;  5CPJ D;  5B0Y A;  4XUJ D;  1M18 D;  5B0Z A;  1AOI A;  4EO5 C;  2YFW A;  2ARO D;  3W97 B;  5B2I C;  3MGQ A;  1P3O B;  3X1V C;  3KSY A;  1P3G A;  4G92 C;  3W99 A;  5CP6 A;  3UT9 C;  5GT0 C;  5B0Y B;  4KUD C;  5CPK A;  3UTB A;  1WWI A;  4R8P A;  3REH B;  5B0Z B;  3MGP D;  4KGC C;  5JRG B;  2YFW B;  1ID3 B;  5E5A D;  5BO0 A;  3A6N A;  3W96 A;  3MGQ B;  1P3P B;  5CPK C;  4WZS B;  1P3G B;  4Z66 D;  2ZM5 A;  5KDM A;  2J8P A;  3REJ A;  1KX5 C;  3UTB B;  4CSR A;  2DF4 C;  3W96 C;  5B33 D;  1P3K C;  4Z2M H;  3B0C T;  5AVC A;  4H9O A;  3VH5 T;  4WU8 A;  3AZH B;  3REJ C;  3KUY A;  1KX3 B;  3REK C;  4J8W D;  1ZLA D;  3MVD A;  4WU9 A;  5AVC C;  1KX4 D;  4JJN D;  1S32 C;  3X1U D;  3B6F D;  5AV9 A;  2NQB C;  4WU8 B;  1P3M D;  3WKJ A;  2HIO C;  2PYO A;  5GT3 B;  2L5A A;  3EPK A;  3B6G D;  3AV1 A;  2NZD D;  1BH8 A;  1M1A B;  3AV2 C;  3O62 D;  4X23 A;  4WU9 B;  3AZL D;  3LEL D;  1P3L B;  1U35 D;  1P3A D;  3UTA D;  4LD9 A;  1P3F A;  1HTA A;  5B31 G;  3AZG C;  5AV9 B;  5F99 D;  3MGR C;  3WTP B;  3W97 D;  3WKJ B;  3LZ0 A;  2PYO B;  1F66 C;  4UUZ A;  3AV1 B;  4H9N A;  4LD9 C;  5B0Y D;  3FDD A;  4J8X B;  3AZF B;  2F8N G;  2IO5 C;  3X1T A;  3AZM A;  5B0Z D;  3AYW B;  1AOI D;  2YFV A;  3MGQ D;  4Z5T A;  3W98 A;  5FUG B;  3LZ0 B;  5DNM C;  2ZY2 A;  1P3G D;  3W99 D;  5G49 B;  5BS7 C;  5CP6 D;  3AFA A;  3REI B;  1P3B A;  5AY8 A;  5CPK D;  3UTB D;  4YS3 C;  5CPJ B;  4R8P D;  5B31 A;  3AZK A;  5AV6 A;  2DQN C;  1M18 B;  3A6N D;  2ZY3 A;  3WAA A;  1TZY C;  4NE6 A;  2ARO B;  2XD5 A;  2F8N A;  4XZQ C;  3AFA B;  5AY8 B;  3REJ D;  3TU4 A;  4CAY A;  5BT1 C;  5B31 B;  1M19 C;  3WAA C;  2FJ7 B;  3LJA A;  5B24 A;  4WU8 D;  3MGP B;  2LY8 A;  3TU4 C;  4HGA C;  5E5A B;  3KUY D;  3MNN A;  1M1A D;  3R45 B;  3MVD D;  3C1B A;  3LJA C;  2Y2Q A;  4WU9 D;  4Z66 B;  4ZBJ B;  4CAY B;  1P34 A;  2W8S A;  4QLC C;  3MNN C;  5B33 B;  1H3O B;  5AV9 D;  3NQU A;  3WKJ D;  2PYO D;  5AV5 A;  1P34 C;  3AV1 D;  3AN2 C;  4X23 D;  4J8W B;  5C3I C;  1P3F D;  3NQJ B;  5GXQ A;  3AYW D;  3B6F B;  2CV5 B;  3C1C A;  3NQU B;  3LZ0 D;  5DNN A;  5AV5 B;  2Y2H A;  3KWQ C;  3B6G B;  3LZ1 A;  2NZD B;  1Z2C B;  1EQZ B;  3O62 B;  5B2I A;  3C1C C;  3X1T D;  3AZM D;  3X1V A;  3AZL B;  5DNN C;  4UPK A;  3LEL B;  3AZJ A;  1U35 B;  3A1I A;  5BNX A;  3UTA B;  1P3A B;  4H9Q A;  3UT9 A;  5B1M C;  5CPI C;  5GT0 A;  4KUD A;  3LZ1 C;  4Z5T D;  3W98 D;  5F99 B;  3AFA D;  1P3B D;  3AZJ C;  4KGC A;  5AY8 D;  4EO5 B;  3KXB C;  3AZI A;  3WA9 A;  4J8V C;  5B31 D;  3X1V B;  5B2J C;  2FJ7 D;  3AZK D;  4G92 B;  2BYK A;  3H0R C;  5AV6 D;  5BNX B;  4H9Q B;  5GT0 B;  1AOI B;  4KUD B;  1KX5 A;  3WA9 C;  3AZI C;  4J8U C;  2F2A C;  1P3K A;  2F8N D;  1T3U A;  4G91 C;  3AZE A;  3W99 B;  4KGC B;  5CP6 B;  1P3O C;  2Y2L A;  2XD1 A;  2UWX A;  5CPK B;  4R8P B;  3REK A;  5B24 D;  3AZE C;  1KX5 B;  1S32 A;  3REH C;  5BO0 B;  3A6N B;  3W96 B;  1P3K B;  3C1B D;  2RVQ D;  1ID3 C;  3VH6 A;  1P3P C;  2NQB A;  5B1L C;  5KDM B;  1P34 D;  2HIO A;  3REJ B;  4CSR B;  3AV2 A;  2CV5 D;  1JFI A;  3REL A;  5AVC B;  4H9O B;  2HUE B;  1S32 B;  5AV5 D;  2Y2N A;  2ZY5 A;  5JA4 A;  4ZUX C;  3KUY B;  1KX4 B;  3AZH C;  1EQZ D;  3AZG A;  2ZY4 A;  3MVD B;  3MGR A;  1WWS A;  4WNN A;  3REL C;  1KX3 C;  1A7W A;  1F66 A;  5GXQ D;  3AV2 B;  3C1C D;  3X1S A;  1BH8 B;  1Q9C A;  4X23 B;  5B2I D;  5GT3 C;  5B32 C;  3X1S C;  3X1V D;  5DNM A;  5AV8 A;  5BS7 A;  4LD9 B;  1P3F B;  3UT9 D;  5GT0 D;  3B0B A;  4KUD D;  3MGS A;  1P3L C;  4YS3 A;  5AV8 C;  4UUZ B;  3WTP E;  3WTP C;  4H9N B;  4KGC D;  5GSU A;  3KFU G;  2CWE A;  1HQ3 C;  3VH5 A;  3MGS C;  3AZN C;  1TZY A;  5DNM B;  3X1T B;  1B67 A;  3AZM B;  4XZQ A;  4J8X C;  3AZF C;  2YFV B;  1KX5 D;  5GSU C;  4H9R A;  1P3I C;  5AVB C;  1P3K D;  1M19 A;  3W96 D;  4Z5T B;  3W98 B;  5B40 A;  1P3B B;  2Y2G A;  4YM6 C;  3REI C;  3REK D;  3AZK B;  5AVC D;  5CPJ C;  5AV6 B;  2G5H C;  1S32 D;  5B40 C;  4XUJ C;  3WAA B;  4QLC A;  1M18 C;  2F8N B;  2NQB D; 
#chains in the Genus database with same CATH homology
 2ARO C;  2HIO D;  3TU4 B;  3EPJ A;  5CHL B;  3AV2 D;  3AN2 A;  4H9P A;  3LJA B;  5B24 B;  4H9S C;  1KU5 A;  4KHA A;  3MNN B;  4AWL B;  3AZG D;  3MGR D;  3C1B B;  1PZR A;  5E5A C;  3B0D C;  1P34 B;  1F66 D;  2JE5 A;  4LD9 D;  2Y2K A;  3KWQ A;  1W2E A;  4ZBJ C;  3X1S D;  4DQY B;  2F8N K;  5B33 C;  5C3I B;  1ZLA A;  4KHA B;  1TAF A;  5B1M A;  1B6W A;  5CPI A;  5DNM D;  5AV8 D;  3KWQ B;  4J8W C;  1ZLA C;  5GXQ B;  3KXB A;  1P3M A;  4YS3 D;  4J8V A;  3C1C B;  4JJN C;  1KX4 C;  3X1U C;  2RIQ A;  4DRA A;  3B6F C;  5B2J A;  5DNN B;  3LZ1 B;  4Z2M G;  1TZY D;  4J8U A;  2BG1 A;  1P3M C;  5B2I B;  3B6G C;  4XZQ D;  2NZD C;  1BFM A;  3O62 C;  3AZJ B;  3KXB B;  1P3O A;  5BT1 D;  3UT9 B;  4J8V B;  3LEL C;  2VQR A;  1M19 D;  4DRB A;  2FFF B;  1U35 C;  3UTA C;  1P3A C;  3WAA D;  1N1J A;  5B40 D;  5F99 C;  3W97 C;  3P5J B;  3REH A;  3TU4 D;  3AZI B;  3WA9 B;  4J8U B;  1BH9 A;  4G91 B;  5JRG A;  3LJA D;  1ID3 A;  2BYK B;  1P3P A;  5B0Y C;  5B1L A;  5BNV A;  4QLC D;  3MNN D;  5B32 G;  1N1J B;  5B0Z C;  1AOI C;  5JRG C;  3AZE B;  3MGQ C;  1P3G C;  1BH9 B;  4WV4 B;  3W99 C;  4ZUX A;  5CP6 C;  3AN2 D;  3AZH A;  3REK B;  5B1L B;  3UTB C;  1KX3 A;  4R8P C;  5BNV B;  2JSS A;  3A6N C;  2NQB B;  2HIO B;  3KWQ D;  4ZUX B;  2G5I C;  1JFI B;  5GT3 A;  5B32 A;  3REL B;  4M6B A;  1M1A A;  5DNN D;  5JA4 B;  5B1M D;  5CPI D;  2HUE C;  3LZ1 D;  4WU8 C;  1P3L A;  3V9R A;  3AZG B;  3MGR B;  4WNN B;  3KUY C;  2Y2J A;  1M1A C;  3MVD C;  3AZJ D;  3WTP A;  3KXB D;  1F66 B;  4WU9 C;  4J8V D;  1HQ3 A;  5B32 B;  3X1S B;  3AZN A;  5B2J D;  4NE3 A;  2IO5 B;  3VH6 W;  4J8X A;  4WJ3 C;  3AZF A;  5AV9 C;  3A1K A;  3V9R B;  3AZI D;  3WA9 D;  3WKJ C;  4J8U D;  1P3I A;  2PYO C;  5AVB A;  3AYW A;  3AV1 C;  3H0M C;  5AV8 B;  4X23 C;  1P3O D;  2JCH A;  5FUG A;  1HQ3 B;  3MGS B;  5G49 A;  3AZN B;  4YM6 A;  4YS3 B;  3REI A;  1P3F C;  3AYW C;  3AZE D;  5CPJ A;  3REH D;  5GSU B;  3LZ0 C;  1P3I B;  5AVB B;  4XUJ A;  1TZY B;  5JRG D;  1M18 A;  1ID3 D;  1P3P D;  5B1L D;  4XZQ B;  2ARO A;  3IP4 C;  4E44 A;  1F1E A;  3X1T C;  4YM6 B;  4H9R B;  3AZM C;  1M19 B;  1ULY A;  3AL0 C;  3EG5 B;  5B40 B;  4Z5T C;  3W98 C;  4H9S A;  2FJ7 A;  4XUJ B;  4ZUX D;  4HGA B;  3AFA C;  3AZH D;  1P3B C;  2F8N H;  3MGP A;  3H0L C;  5AY8 C;  3REL D;  5E5A A;  1KX3 D;  3EPL A;  5B31 C;  3R45 A;  2FJ7 C;  3AZK C;  4Z66 A;  5AV6 C;  3B0C W;  4QLC B;  3VH5 W;  3MGP C;  4NFT A;  5B33 A;  1H3O A;  3AN2 B;  4Z66 C;  5GT3 D;  5B32 D;  4H9P B;  3B0D B;  2Y2I A;  4NE5 A;  4J8W A;  2Y2M A;  5B24 C;  2BYM A;  1P3L D;  1KX4 A;  4JJN A;  3X1U A;  3NQJ A;  3B6F A;  4AWL C;  2CV5 A;  3C1B C;  3F6T A;  3WTP D;  2RVQ C;  1HQ3 D;  3MGS D;  3AZN D;  3B6G A;  2Y2P A;  4E45 A;  2NZD A;  1EQZ A;  4J8X D;  3O62 A;  1TAF B;  3AZF D;  2BYM B;  2CV5 C;  1ZLA B;  5GSU D;  5B1M B;  3AZL A;  5CPI B;  4JJN B;  5AVB D;  5AV5 C;  3X1U B;  3LEL A;  1P3I D;  1U35 A;  1P3A A;  3UTA A;  3VH6 T;  3EPH A;  2Y2O A;  1EQZ C;  3W97 A;  5F99 A;  1P3M B;  4YM6 D;  3AZL C;  3REI D;  5GXQ C;  5B2J B;  1R4V A;  5CPJ D;  5B0Y A;  4XUJ D;  1M18 D;  5B0Z A;  1AOI A;  4EO5 C;  2YFW A;  2ARO D;  3W97 B;  5B2I C;  3MGQ A;  1P3O B;  3X1V C;  3KSY A;  1P3G A;  4G92 C;  3W99 A;  5CP6 A;  3UT9 C;  5GT0 C;  5B0Y B;  4KUD C;  5CPK A;  3UTB A;  1WWI A;  4R8P A;  3REH B;  5B0Z B;  3MGP D;  4KGC C;  5JRG B;  2YFW B;  1ID3 B;  5E5A D;  5BO0 A;  3A6N A;  3W96 A;  3MGQ B;  1P3P B;  5CPK C;  4WZS B;  1P3G B;  4Z66 D;  2ZM5 A;  5KDM A;  2J8P A;  3REJ A;  1KX5 C;  3UTB B;  4CSR A;  2DF4 C;  3W96 C;  5B33 D;  1P3K C;  4Z2M H;  3B0C T;  5AVC A;  4H9O A;  3VH5 T;  4WU8 A;  3AZH B;  3REJ C;  3KUY A;  1KX3 B;  3REK C;  4J8W D;  1ZLA D;  3MVD A;  4WU9 A;  5AVC C;  1KX4 D;  4JJN D;  1S32 C;  3X1U D;  3B6F D;  5AV9 A;  2NQB C;  4WU8 B;  1P3M D;  3WKJ A;  2HIO C;  2PYO A;  5GT3 B;  2L5A A;  3EPK A;  3B6G D;  3AV1 A;  2NZD D;  1BH8 A;  1M1A B;  3AV2 C;  3O62 D;  4X23 A;  4WU9 B;  3AZL D;  3LEL D;  1P3L B;  1U35 D;  1P3A D;  3UTA D;  4LD9 A;  1P3F A;  1HTA A;  5B31 G;  3AZG C;  5AV9 B;  5F99 D;  3MGR C;  3WTP B;  3W97 D;  3WKJ B;  3LZ0 A;  2PYO B;  1F66 C;  4UUZ A;  3AV1 B;  4H9N A;  4LD9 C;  5B0Y D;  3FDD A;  4J8X B;  3AZF B;  2F8N G;  2IO5 C;  3X1T A;  3AZM A;  5B0Z D;  3AYW B;  1AOI D;  2YFV A;  3MGQ D;  4Z5T A;  3W98 A;  5FUG B;  3LZ0 B;  5DNM C;  2ZY2 A;  1P3G D;  3W99 D;  5G49 B;  5BS7 C;  5CP6 D;  3AFA A;  3REI B;  1P3B A;  5AY8 A;  5CPK D;  3UTB D;  4YS3 C;  5CPJ B;  4R8P D;  5B31 A;  3AZK A;  5AV6 A;  2DQN C;  1M18 B;  3A6N D;  2ZY3 A;  3WAA A;  1TZY C;  4NE6 A;  2ARO B;  2XD5 A;  2F8N A;  4XZQ C;  3AFA B;  5AY8 B;  3REJ D;  3TU4 A;  4CAY A;  5BT1 C;  5B31 B;  1M19 C;  3WAA C;  2FJ7 B;  3LJA A;  5B24 A;  4WU8 D;  3MGP B;  2LY8 A;  3TU4 C;  4HGA C;  5E5A B;  3KUY D;  3MNN A;  1M1A D;  3R45 B;  3MVD D;  3C1B A;  3LJA C;  2Y2Q A;  4WU9 D;  4Z66 B;  4ZBJ B;  4CAY B;  1P34 A;  2W8S A;  4QLC C;  3MNN C;  5B33 B;  1H3O B;  5AV9 D;  3NQU A;  3WKJ D;  2PYO D;  5AV5 A;  1P34 C;  3AV1 D;  3AN2 C;  4X23 D;  4J8W B;  5C3I C;  1P3F D;  3NQJ B;  5GXQ A;  3AYW D;  3B6F B;  2CV5 B;  3C1C A;  3NQU B;  3LZ0 D;  5DNN A;  5AV5 B;  2Y2H A;  3KWQ C;  3B6G B;  3LZ1 A;  2NZD B;  1Z2C B;  1EQZ B;  3O62 B;  5B2I A;  3C1C C;  3X1T D;  3AZM D;  3X1V A;  3AZL B;  5DNN C;  4UPK A;  3LEL B;  3AZJ A;  1U35 B;  3A1I A;  5BNX A;  3UTA B;  1P3A B;  4H9Q A;  3UT9 A;  5B1M C;  5CPI C;  5GT0 A;  4KUD A;  3LZ1 C;  4Z5T D;  3W98 D;  5F99 B;  3AFA D;  1P3B D;  3AZJ C;  4KGC A;  5AY8 D;  4EO5 B;  3KXB C;  3AZI A;  3WA9 A;  4J8V C;  5B31 D;  3X1V B;  5B2J C;  2FJ7 D;  3AZK D;  4G92 B;  2BYK A;  3H0R C;  5AV6 D;  5BNX B;  4H9Q B;  5GT0 B;  1AOI B;  4KUD B;  1KX5 A;  3WA9 C;  3AZI C;  4J8U C;  2F2A C;  1P3K A;  2F8N D;  1T3U A;  4G91 C;  3AZE A;  3W99 B;  4KGC B;  5CP6 B;  1P3O C;  2Y2L A;  2XD1 A;  2UWX A;  5CPK B;  4R8P B;  3REK A;  5B24 D;  3AZE C;  1KX5 B;  1S32 A;  3REH C;  5BO0 B;  3A6N B;  3W96 B;  1P3K B;  3C1B D;  2RVQ D;  1ID3 C;  3VH6 A;  1P3P C;  2NQB A;  5B1L C;  5KDM B;  1P34 D;  2HIO A;  3REJ B;  4CSR B;  3AV2 A;  2CV5 D;  1JFI A;  3REL A;  5AVC B;  4H9O B;  2HUE B;  1S32 B;  5AV5 D;  2Y2N A;  2ZY5 A;  5JA4 A;  4ZUX C;  3KUY B;  1KX4 B;  3AZH C;  1EQZ D;  3AZG A;  2ZY4 A;  3MVD B;  3MGR A;  1WWS A;  4WNN A;  3REL C;  1KX3 C;  1A7W A;  1F66 A;  5GXQ D;  3AV2 B;  3C1C D;  3X1S A;  1BH8 B;  1Q9C A;  4X23 B;  5B2I D;  5GT3 C;  5B32 C;  3X1S C;  3X1V D;  5DNM A;  5AV8 A;  5BS7 A;  4LD9 B;  1P3F B;  3UT9 D;  5GT0 D;  3B0B A;  4KUD D;  3MGS A;  1P3L C;  4YS3 A;  5AV8 C;  4UUZ B;  3WTP E;  3WTP C;  4H9N B;  4KGC D;  5GSU A;  3KFU G;  2CWE A;  1HQ3 C;  3VH5 A;  3MGS C;  3AZN C;  1TZY A;  5DNM B;  3X1T B;  1B67 A;  3AZM B;  4XZQ A;  4J8X C;  3AZF C;  2YFV B;  1KX5 D;  5GSU C;  4H9R A;  1P3I C;  5AVB C;  1P3K D;  1M19 A;  3W96 D;  4Z5T B;  3W98 B;  5B40 A;  1P3B B;  2Y2G A;  4YM6 C;  3REI C;  3REK D;  3AZK B;  5AVC D;  5CPJ C;  5AV6 B;  2G5H C;  1S32 D;  5B40 C;  4XUJ C;  3WAA B;  4QLC A;  1M18 C;  2F8N B;  2NQB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...