5AVCC

Human nucleosome core particle
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5avcC00
1HQ3C 5GXQB 4H9QA 1M18C 4KUDA 2L5AA 5AV9C 3REJD 1P3MD 3B6GC 5GXQC 5FUGA 4Z66D 5GT0A 5BNVB 1P3MB 3REKD 1P3IC 4Z66B 2PYOD 3WAAA 3A6NC 2PYOB 2HIOD 4XZQA 3MGPA 5DNMC 2NZDD 4KGCA 2PYOC 2HIOB 1P3GC 3B6FC 3MNND 2NZDB 3WKJD 3AV1D 3RELA 1BH9B 4EO5B 1U35A 3MNNB 2HIOC 5B1LD 1M18A 3WKJB 3AV1B 3W99A 5GSUC 4ZUXA 5GXQA 2CV5B 3LZ1B 3NQUB 3LELD 3LELB 2CV5C 4E44A 4R8PD 3LZ1C 5B31B 5BNVA 3REJA 1P3MA 3UTAD 4Z66A 4R8PB 4J8XD 3LELC 5BS7C 4WU9D 5B31C 5B2JD 3REKA 3UTAB 1B6WA 4J8XB 1ZLAD 4R8PC 4WU9B 2PYOA 5B2JB 5CP6D 3UTAC 1ZLAB 5CP6B 3C1CD 5B2JC 2HIOA 2NZDA 3C1BB 5B1MD 5KDMB 3C1CB 1BH9A 3MNNA 3WKJA 5B1MB 4Z5TD 1F66D 3AV1A 3C1BC 1H3OB 1P3FD 5B1LA 5B2ID 4Z5TB 1A7WA 3REHD 3VH5W 1F66B 5E5AD 1P3FB 3WA9C 4J8UD 3AZHD 3REHB 1F1EA 5G49B 5E5AB 1KX5A 4Z5TC 3LELA 1F66C 4J8UB 3AZHB 5GT3D 3MGRD 4R8PA 4J8UC 5GT3B 3AZJD 3MGRB 4HGAB 2BYMA 4JJND 3KXBD 3VH5T 4J8XA 3AZJB 4WU9A 5B2JA 4J8WD 4JJNB 3KXBB 3MGRC 4HGAC 3AZKD 5JRGD 1ZLAA 1P34B 5CP6A 1TAFB 4J8WB 3AZKB 4NE3A 5JRGB 4G92C 5B33C 5KDMA 4M6BA 3LJAD 3C1CA 1P34C 4ZBJC 4J8WC 5AV8C 5B1MA 3AZEB 4YM6D 1H3OA 1BFMA 5F99D 1P3LD 2HUEB 4Z5TA 5BNXB 1F66A 4YM6B 5F99B 2LY8A 3AZEC 1P3LB 1P3FA 5CPJC 5B2IA 4J8VB 3REHA 5G49A 5E5AA 2HUEC 4J8UA 2AROD 3AZHA 4CAYB 4J8VC 3W97D 1TZYD 2AROB 3AZLD 5GT3A 3MGRA 3W97B 1TZYB 3AZLB 4UUZB 3AZJA 1AOID 3TU4D 4JJNA 3KXBA 3W97C 3WTPD 1AOIB 3TU4B 1P3BC 4J8WA 1TAFA 3AZKA 5JRGA 3WTPB 2NQBC 3W98D 4YS3D 5AVBC 3LJAA 3AN2D 3O62D 1HQ3D 3W98B 4YS3B 4YM6A 3AN2B 3O62B 5F99A 1HQ3B 4Z2MH 1P3LA 5AV9D 3B6GD 3MVDD 5AV9B 3O62C 5AVCD 3B6GB 4CAYA 3MVDB 1P3ID 3AZIC 2AROA 5AVCB 1P3IB 3W97A 3MVDC 1TZYA 3A6ND 3AZLA 4UUZA 4H9SC 5AVCC 3X1UC 3X1SC 2FJ7C 3W96D 3A6NB 5DNMD 3UTBC 1AOIA 3UT9A 3TU4A 3W96B 1P3GD 3REIC 3B6FD 5DNMB 4Z2MG 3WTPA 5AY8D 1ULYA 3AFAC 1P3GB 3B6FB 5CPKC 3W96C 1JFIB 4LD9D 5AY8B 5GSUD 3W98A 4LD9B 1M1AD 4YS3A 3AZMC 3AN2A 5AY8C 5GSUB 3O62A 1HQ3A 5JA4B 1M1AB 1KX3D 4LD9C 2CV5D 5CHLB 3LZ1D 3KUYC 5AV9A 1ID3B 3B6GA 1KX3B 3MVDA 1M1AC 5AVCA 5B0ZC 5B31D 1P3IA 1ID3C 1KX3C 3A6NA 5AV6C 3W96A 5DNMA 1P3GA 3B6FA 5BT1D 1JFIA 2RVQD 5AY8A 3C1BD 3AV2D 4LD9A 3AV2B 5GSUA 3WA9D 5JA4A 5BT1C 1M1AA 4DRAA 2RVQC 3WA9B 3AV2C 4XUJC 2IO5C 1KX3A 2CV5A 3LZ1A 3NQUA 1M19C 5B31G 5BS7A 5B31A 3X1VD 5BO0B 3VH6A 3AZFC 3X1VB 1Q9CA 3UTAA 2F8ND 4KHAB 5B33D 1P34D 3X1VC 5AV8D 2F8NK 3AZNC 4G92B 2F8NB 5B33B 4ZBJB 5AV8B 4QLCD 5B40D 3LZ0D 3AZGC 3C1BA 5CPID 1N1JB 4QLCB 3AZED 3AV2A 5CPJD 5B40B 3LZ0B 3X1TB 5CPIB 2F8NH 4WV4B 3WA9A 5CPJB 3R45B 4QLCC 5B40C 3LZ0C 4J8VD 3NQJB 3X1TC 5CPIC 5BO0A 3X1VA 1P3PD 1P3BD 4WNNB 1S32D 1P3OC 1P3PB 1P3BB 2NQBD 1B67A 1S32B 2F8NG 2F8NA 5B33A 5AVBD 1P34A 4H9NB 2NQBB 1P3PC 1KX4B 5AV8A 1S32C 2JSSA 5AVBB 1N1JA 4QLCA 5B0YC 4AWLC 5B40A 1KX4C 3LZ0A 1WWSA 4X23B 3AYWD 5CPIA 3AZEA 4WU8D 5CPJA 3R45A 1BH8B 3AYWB 4X23C 3NQJA 5BNXA 3AZID 4WU8B 4J8VA 3AZIB 3AYWC 1P3KD 4WU8C 2BYKB 4KUDC 3X1UD 3X1SD 5B32D 1P3KB 2FJ7D 4NFTA 3UTBD 5GT0C 3X1UB 3X1SB 5B32B 4WNNA 3KWQD 2FJ7B 3REID 3UTBB 1P3KC 2YFWB 1P3BA 3AFAD 1P3PA 3KWQB 1S32A 3REIB 5B32C 5CPKD 3WAAC 3AFAB 2NQBA 3KWQC 5CPKB 3MGPC 3B0BA 5AVBA 3AZMD 2CWEA 4KGCC 3AZMB 4H9OB 4ZUXB 3KUYD 3RELC 1U35C 1BH8A 3AYWA 4WU8A 3W99C 3KUYB 5B0ZD 4ZUXC 1ID3D 3AZIA 4H9PB 5B0ZB 3REJB 2BYKA 3WTPE 1P3KA 4H9SA 5B32G 5AV6D 3X1UA 3X1SA 5B32A 3REJC 3REKB 3MGSD 1WWIA 1P3MC 2FJ7A 3V9RB 3UTBA 4Z66C 5AV6B 2YFWA 3KWQA 3MGSB 3REIA 3REKC 3AFAA 3MGSC 5CPKA 5DNND 3VH6W 5AV5D 5DNNB 3AZMA 4H9OA 5AV5B 2NZDC 5B1LB 4XUJD 4EO5C 3MNNC 5DNNC 3WKJC 1KX5D 5AV5C 3KUYA 3AV1C 4XUJB 2IO5B 5B1LC 1KX5B 4CSRB 1M19D 3VH6T 4H9PA 5B0ZA 1P3AD 1ID3A 1M19B 3AZFD 1KX5C 1P3AB 2BYMB 3AZFB 3V9RA 5C3IB 5AV6A 1P3AC 3MGSA 3AZND 1R4VA 4J8XC 1KU5A 4NE5A 5C3IC 4WU9C 3AZNB 3AZGD 1ZLAC 4NE6A 3KSYA 5CP6C 5DNNA 3AZGB 5AV5A 3C1CC 3X1TD 5B1MC 5B24D 4XUJA 5B2IB 5B24B 4CSRA 2YFVB 1P3FC 5B2IC 1M19A 3REHC 5E5AC 5B24C 1P3AA 3AZHC 1P3OD 4E45A 3AZFA 1P3OB 5GT3C 3AZJC 3AZNA 4JJNC 1HTAA 4G91B 3KXBC 4KHAA 1EQZD 5B0YD 1KX4D 3B0CW 3AZKC 3VH5A 3MGQD 5JRGC 3AZGA 4G91C 1EQZB 3LJAB 5B0YB 4AWLB 3MGQB 4H9RB 4X23D 1EQZC 3LJAC 3MGQC 3X1TA 5B24A 2YFVA 4YM6C 5F99C 1P3LC 4KUDD 3B0CT 4H9QB 3B0DB 4KUDB 5GT0D 5FUGB 5GT0B 2AROC 3B0DC 3UT9D 1P3OA 4WZSB 3WAAD 3W99B 1TZYC 3AZLC 3UT9B 3WAAB 4XZQD 3MGPD 4DRBA 1AOIC 3UT9C 3TU4C 4KGCD 4XZQB 3MGPB 1EQZA 3WTPC 4KGCB 4H9NA 5B0YA 1KX4A 3RELD 3MGQA 1U35D 4H9RA 4XZQC 1M18D 3W99D 3RELB 4ZUXD 1U35B 1M18B 5GXQD 4X23A 3W98C 4YS3C 3AN2C
chains in the Genus database with same CATH superfamily
3H0MC 1HQ3C 5GXQB 4H9QA 2Y2HA 1M18C 2JCHA 4KUDA 2L5AA 5AV9C 3REJD 1P3MD 3B6GC 5GXQC 5FUGA 4Z66D 5GT0A 5BNVB 1P3MB 3REKD 1P3IC 4Z66B 2PYOD 3WAAA 3A6NC 2PYOB 2Y2OA 2HIOD 4XZQA 3MGPA 5DNMC 2NZDD 4KGCA 2PYOC 2HIOB 1P3GC 3B6FC 3MNND 2NZDB 3WKJD 3AV1D 3EPKA 3RELA 1BH9B 2JE5A 2Y2KA 4EO5B 2HIOC 3MNNB 5B1LD 1U35A 1M18A 3WKJB 3AV1B 3W99A 5GSUC 4ZUXA 5GXQA 2CV5B 3LZ1B 3NQUB 3LELD 3LELB 2CV5C 4E44A 4R8PD 3LZ1C 5B31B 5BNVA 3REJA 1P3MA 2DQNC 3UTAD 4Z66A 4R8PB 4J8XD 3LELC 5BS7C 4WU9D 5B31C 5B2JD 3REKA 3UTAB 1B6WA 4J8XB 2Y2GA 1ZLAD 4R8PC 4WU9B 2PYOA 5B2JB 5CP6D 3UTAC 1ZLAB 5CP6B 3C1CD 5B2JC 2HIOA 2NZDA 3C1BB 5B1MD 5KDMB 3C1CB 1BH9A 3MNNA 3WKJA 5B1MB 4Z5TD 1F66D 3AV1A 3C1BC 1H3OB 1P3FD 5B1LA 5B2ID 4Z5TB 1A7WA 3REHD 3VH5W 1F66B 5E5AD 1P3FB 3WA9C 4J8UD 3AZHD 3REHB 1F1EA 2Y2JA 5G49B 5E5AB 3IP4C 4Z5TC 1KX5A 3LELA 1F66C 4J8UB 3AZHB 2ZY2A 5GT3D 3MGRD 2Y2QA 4R8PA 4J8UC 5GT3B 3AZJD 3MGRB 4HGAB 2BYMA 4JJND 3KXBD 3VH5T 4J8XA 3AZJB 4WU9A 5B2JA 4J8WD 4JJNB 3KXBB 3MGRC 4HGAC 3AZKD 5JRGD 1ZLAA 1P34B 5CP6A 1TAFB 4J8WB 3AZKB 4NE3A 5JRGB 4G92C 5B33C 5KDMA 4M6BA 3LJAD 3C1CA 1P34C 4ZBJC 4J8WC 5AV8C 1W2EA 5B1MA 3AZEB 4YM6D 1H3OA 1BFMA 5F99D 1P3LD 2HUEB 4Z5TA 5BNXB 1F66A 4YM6B 5F99B 2LY8A 3AZEC 1P3LB 1P3FA 5CPJC 5B2IA 4J8VB 3REHA 5G49A 5E5AA 2HUEC 4J8UA 2AROD 3AZHA 4CAYB 4J8VC 3W97D 2ZY3A 1TZYD 2AROB 3AZLD 5GT3A 3MGRA 3W97B 1TZYB 3AZLB 4UUZB 3AZJA 1AOID 3TU4D 4JJNA 2XD1A 3KXBA 1Z2CB 3W97C 3WTPD 1AOIB 3TU4B 1P3BC 4J8WA 1TAFA 3AZKA 5JRGA 3WTPB 2NQBC 3W98D 4YS3D 5AVBC 3LJAA 3AN2D 3O62D 1HQ3D 3W98B 2ZY4A 4YS3B 4YM6A 3AN2B 3O62B 1PZRA 5F99A 1HQ3B 4Z2MH 1P3LA 5AV9D 3B6GD 3MVDD 5AV9B 3O62C 5AVCD 3B6GB 4CAYA 3MVDB 1P3ID 3AZIC 2AROA 5AVCB 1P3IB 3W97A 3MVDC 1TZYA 3A6ND 3AZLA 4UUZA 4H9SC 5AVCC 3X1UC 3X1SC 2FJ7C 3W96D 3A6NB 2FFFB 5DNMD 3UTBC 1AOIA 3UT9A 3TU4A 2Y2LA 1P3GD 3REIC 3B6FD 5DNMB 4Z2MG 3W96B 3WTPA 5AY8D 1ULYA 3AFAC 1P3GB 3B6FB 5CPKC 3W96C 1JFIB 4LD9D 5AY8B 5GSUD 3W98A 4LD9B 1M1AD 4YS3A 3AZMC 3AN2A 5AY8C 5GSUB 3O62A 1HQ3A 5JA4B 1M1AB 2DF4C 1KX3D 4LD9C 2CV5D 5CHLB 3LZ1D 2VQRA 5AV9A 3KUYC 1ID3B 3B6GA 1KX3B 3MVDA 1M1AC 5AVCA 5B0ZC 5B31D 1P3IA 1ID3C 1KX3C 3EPJA 3A6NA 5AV6C 3W96A 5DNMA 1P3GA 3B6FA 5BT1D 3FDDA 1JFIA 2RVQD 5AY8A 3C1BD 3AV2D 4LD9A 3AV2B 5GSUA 3WA9D 5JA4A 5BT1C 1M1AA 4DRAA 2RVQC 3WA9B 2UWXA 3AV2C 4XUJC 2IO5C 1KX3A 2CV5A 3LZ1A 3NQUA 1M19C 5B31G 5BS7A 5B31A 3X1VD 5BO0B 3VH6A 3AL0C 3AZFC 3H0LC 3X1VB 1Q9CA 3UTAA 2F8ND 4KHAB 5B33D 1P34D 3X1VC 5AV8D 2F8NK 3AZNC 4G92B 2F8NB 5B33B 4ZBJB 5AV8B 4QLCD 5B40D 3LZ0D 3AZGC 3C1BA 5CPID 1N1JB 4QLCB 3AZED 3AV2A 5CPJD 5B40B 3LZ0B 3X1TB 5CPIB 2F8NH 4WV4B 3WA9A 5CPJB 3R45B 4QLCC 5B40C 3LZ0C 4J8VD 3NQJB 3X1TC 5CPIC 3A1KA 5BO0A 4DQYB 2G5IC 3X1VA 1P3BD 1P3PD 2G5HC 4WNNB 1S32D 1P3OC 1P3PB 1P3BB 2NQBD 1B67A 1S32B 2F8NG 2F8NA 5B33A 5AVBD 1P34A 4H9NB 2Y2MA 1P3PC 1KX4B 2NQBB 5AV8A 1S32C 2JSSA 5AVBB 1N1JA 4QLCA 5B0YC 4AWLC 5B40A 1KX4C 3LZ0A 1WWSA 4X23B 3AYWD 5CPIA 3AZEA 4WU8D 5CPJA 3R45A 1BH8B 3AYWB 4X23C 3NQJA 5BNXA 3AZID 4WU8B 2W8SA 4J8VA 3AZIB 3AYWC 1P3KD 4WU8C 2BYKB 4KUDC 2J8PA 3X1UD 3X1SD 5B32D 1P3KB 2FJ7D 4NFTA 3UTBD 2Y2PA 5GT0C 3X1SB 5B32B 4WNNA 2XD5A 3X1UB 3KWQD 3F6TA 3REID 2FJ7B 3UTBB 1P3KC 2YFWB 1P3BA 3AFAD 1P3PA 3KWQB 1S32A 3REIB 5B32C 5CPKD 3WAAC 3AFAB 2NQBA 3KWQC 5CPKB 3MGPC 3B0BA 5AVBA 3AZMD 2CWEA 4KGCC 3AZMB 4H9OB 4ZUXB 3KUYD 3RELC 1U35C 1BH8A 3EG5B 3AYWA 3A1IA 2BG1A 4WU8A 3W99C 3KUYB 5B0ZD 4ZUXC 1ID3D 2ZY5A 3AZIA 4H9PB 5B0ZB 3REJB 2BYKA 3WTPE 2Y2NA 1P3KA 2F2AC 4H9SA 5B32G 5AV6D 3X1UA 3X1SA 5B32A 3REJC 3REKB 3MGSD 1WWIA 1P3MC 2FJ7A 3V9RB 3UTBA 4Z66C 5AV6B 2YFWA 3KWQA 3MGSB 3REIA 3REKC 3AFAA 3MGSC 5CPKA 5DNND 3VH6W 5AV5D 5DNNB 3AZMA 4H9OA 5AV5B 2NZDC 5B1LB 4XUJD 4EO5C 3MNNC 5DNNC 1T3UA 3WKJC 1KX5D 5AV5C 3KUYA 3AV1C 4XUJB 2IO5B 5B1LC 2ZM5A 4CSRB 1M19D 1KX5B 3VH6T 4H9PA 5B0ZA 1P3AD 1ID3A 1M19B 3AZFD 1KX5C 1P3AB 2BYMB 3AZFB 3V9RA 5C3IB 5AV6A 1P3AC 3MGSA 3AZND 1R4VA 4J8XC 1KU5A 4NE5A 5C3IC 4WU9C 3AZNB 3EPHA 3AZGD 1ZLAC 4NE6A 3KSYA 5CP6C 5DNNA 3AZGB 5AV5A 3C1CC 3X1TD 5B1MC 5B24D 4XUJA 5B2IB 5B24B 4CSRA 2YFVB 1P3FC 5B2IC 1M19A 3REHC 5E5AC 5B24C 1P3AA 3AZHC 1P3OD 4E45A 3AZFA 1P3OB 5GT3C 3AZJC 3AZNA 4JJNC 1HTAA 4G91B 3KXBC 4KHAA 1EQZD 2RIQA 5B0YD 1KX4D 3B0CW 3AZKC 3VH5A 3MGQD 5JRGC 3AZGA 4G91C 1EQZB 3LJAB 5B0YB 4AWLB 3MGQB 4H9RB 4X23D 3KFUG 1EQZC 3LJAC 3MGQC 3X1TA 5B24A 2YFVA 4YM6C 5F99C 1P3LC 4KUDD 3B0CT 4H9QB 3B0DB 4KUDB 5GT0D 5FUGB 5GT0B 2AROC 3B0DC 2Y2IA 3UT9D 1P3OA 4WZSB 3WAAD 3W99B 1TZYC 3AZLC 3UT9B 3WAAB 4XZQD 3MGPD 4WJ3C 4DRBA 1AOIC 3UT9C 3TU4C 4KGCD 3H0RC 4XZQB 3P5JB 3MGPB 1EQZA 3WTPC 4KGCB 4H9NA 5B0YA 1KX4A 3RELD 3MGQA 1U35D 4H9RA 4XZQC 1M18D 3W99D 3RELB 4ZUXD 1U35B 1M18B 5GXQD 4X23A 3W98C 4YS3C 4UPKA 3EPLA 3AN2C
chains in the Genus database with same CATH topology
3H0MC 1HQ3C 5GXQB 4H9QA 2Y2HA 1M18C 2JCHA 4KUDA 2L5AA 5AV9C 3REJD 1P3MD 3B6GC 5GXQC 5FUGA 4Z66D 5GT0A 5BNVB 1P3MB 3REKD 1P3IC 4Z66B 2PYOD 3WAAA 3A6NC 2PYOB 2Y2OA 2HIOD 4XZQA 3MGPA 5DNMC 2NZDD 4KGCA 2PYOC 2HIOB 1P3GC 3B6FC 3MNND 2NZDB 3WKJD 3AV1D 3EPKA 3RELA 1BH9B 2JE5A 2Y2KA 4EO5B 2HIOC 3MNNB 5B1LD 1U35A 1M18A 3WKJB 3AV1B 3W99A 5GSUC 4ZUXA 5GXQA 2CV5B 3LZ1B 3NQUB 3LELD 3LELB 2CV5C 4E44A 4R8PD 3LZ1C 5B31B 5BNVA 3REJA 1P3MA 2DQNC 3UTAD 4Z66A 4R8PB 4J8XD 3LELC 5BS7C 4WU9D 5B31C 5B2JD 3REKA 3UTAB 1B6WA 4J8XB 2Y2GA 1ZLAD 4R8PC 4WU9B 2PYOA 5B2JB 5CP6D 3UTAC 1ZLAB 5CP6B 3C1CD 5B2JC 2HIOA 2NZDA 3C1BB 5B1MD 5KDMB 3C1CB 1BH9A 3MNNA 3WKJA 5B1MB 4Z5TD 1F66D 3AV1A 3C1BC 1H3OB 1P3FD 5B1LA 5B2ID 4Z5TB 1A7WA 3REHD 3VH5W 1F66B 5E5AD 1P3FB 3WA9C 4J8UD 3AZHD 3REHB 1F1EA 2Y2JA 5G49B 5E5AB 3IP4C 4Z5TC 1KX5A 3LELA 1F66C 4J8UB 3AZHB 2ZY2A 5GT3D 3MGRD 2Y2QA 4R8PA 4J8UC 5GT3B 3AZJD 3MGRB 4HGAB 2BYMA 4JJND 3KXBD 3VH5T 4J8XA 3AZJB 4WU9A 5B2JA 4J8WD 4JJNB 3KXBB 3MGRC 4HGAC 3AZKD 5JRGD 1ZLAA 1P34B 5CP6A 1TAFB 4J8WB 3AZKB 4NE3A 5JRGB 4G92C 5B33C 5KDMA 4M6BA 3LJAD 3C1CA 1P34C 4ZBJC 4J8WC 5AV8C 1W2EA 5B1MA 3AZEB 4YM6D 1H3OA 1BFMA 5F99D 1P3LD 2HUEB 4Z5TA 5BNXB 1F66A 4YM6B 5F99B 2LY8A 3AZEC 1P3LB 1P3FA 5CPJC 5B2IA 4J8VB 3REHA 5G49A 5E5AA 2HUEC 4J8UA 2AROD 3AZHA 4CAYB 4J8VC 3W97D 2ZY3A 1TZYD 2AROB 3AZLD 5GT3A 3MGRA 3W97B 1TZYB 3AZLB 4UUZB 3AZJA 1AOID 3TU4D 4JJNA 2XD1A 3KXBA 1Z2CB 3W97C 3WTPD 1AOIB 3TU4B 1P3BC 4J8WA 1TAFA 3AZKA 5JRGA 3WTPB 2NQBC 3W98D 4YS3D 5AVBC 3LJAA 3AN2D 3O62D 1HQ3D 3W98B 2ZY4A 4YS3B 4YM6A 3AN2B 3O62B 1PZRA 5F99A 1HQ3B 4Z2MH 1P3LA 5AV9D 3B6GD 3MVDD 5AV9B 3O62C 5AVCD 3B6GB 4CAYA 3MVDB 1P3ID 3AZIC 2AROA 5AVCB 1P3IB 3W97A 3MVDC 1TZYA 3A6ND 3AZLA 4UUZA 4H9SC 5AVCC 3X1UC 3X1SC 2FJ7C 3W96D 3A6NB 2FFFB 5DNMD 3UTBC 1AOIA 3UT9A 3TU4A 2Y2LA 1P3GD 3REIC 3B6FD 5DNMB 4Z2MG 3W96B 3WTPA 5AY8D 1ULYA 3AFAC 1P3GB 3B6FB 5CPKC 3W96C 1JFIB 4LD9D 5AY8B 5GSUD 3W98A 4LD9B 1M1AD 4YS3A 3AZMC 3AN2A 5AY8C 5GSUB 3O62A 1HQ3A 5JA4B 1M1AB 2DF4C 1KX3D 4LD9C 2CV5D 5CHLB 3LZ1D 2VQRA 5AV9A 3KUYC 1ID3B 3B6GA 1KX3B 3MVDA 1M1AC 5AVCA 5B0ZC 5B31D 1P3IA 1ID3C 1KX3C 3EPJA 3A6NA 5AV6C 3W96A 5DNMA 1P3GA 3B6FA 5BT1D 3FDDA 1JFIA 2RVQD 5AY8A 3C1BD 3AV2D 4LD9A 3AV2B 5GSUA 3WA9D 5JA4A 5BT1C 1M1AA 4DRAA 2RVQC 3WA9B 2UWXA 3AV2C 4XUJC 2IO5C 1KX3A 2CV5A 3LZ1A 3NQUA 1M19C 5B31G 5BS7A 5B31A 3X1VD 5BO0B 3VH6A 3AL0C 3AZFC 3H0LC 3X1VB 1Q9CA 3UTAA 2F8ND 4KHAB 5B33D 1P34D 3X1VC 5AV8D 2F8NK 3AZNC 4G92B 2F8NB 5B33B 4ZBJB 5AV8B 4QLCD 5B40D 3LZ0D 3AZGC 3C1BA 5CPID 1N1JB 4QLCB 3AZED 3AV2A 5CPJD 5B40B 3LZ0B 3X1TB 5CPIB 2F8NH 4WV4B 3WA9A 5CPJB 3R45B 4QLCC 5B40C 3LZ0C 4J8VD 3NQJB 3X1TC 5CPIC 3A1KA 5BO0A 4DQYB 2G5IC 3X1VA 1P3BD 1P3PD 2G5HC 4WNNB 1S32D 1P3OC 1P3PB 1P3BB 2NQBD 1B67A 1S32B 2F8NG 2F8NA 5B33A 5AVBD 1P34A 4H9NB 2Y2MA 1P3PC 1KX4B 2NQBB 5AV8A 1S32C 2JSSA 5AVBB 1N1JA 4QLCA 5B0YC 4AWLC 5B40A 1KX4C 3LZ0A 1WWSA 4X23B 3AYWD 5CPIA 3AZEA 4WU8D 5CPJA 3R45A 1BH8B 3AYWB 4X23C 3NQJA 5BNXA 3AZID 4WU8B 2W8SA 4J8VA 3AZIB 3AYWC 1P3KD 4WU8C 2BYKB 4KUDC 2J8PA 3X1UD 3X1SD 5B32D 1P3KB 2FJ7D 4NFTA 3UTBD 2Y2PA 5GT0C 3X1SB 5B32B 4WNNA 2XD5A 3X1UB 3KWQD 3F6TA 3REID 2FJ7B 3UTBB 1P3KC 2YFWB 1P3BA 3AFAD 1P3PA 3KWQB 1S32A 3REIB 5B32C 5CPKD 3WAAC 3AFAB 2NQBA 3KWQC 5CPKB 3MGPC 3B0BA 5AVBA 3AZMD 2CWEA 4KGCC 3AZMB 4H9OB 4ZUXB 3KUYD 3RELC 1U35C 1BH8A 3EG5B 3AYWA 3A1IA 2BG1A 4WU8A 3W99C 3KUYB 5B0ZD 4ZUXC 1ID3D 2ZY5A 3AZIA 4H9PB 5B0ZB 3REJB 2BYKA 3WTPE 2Y2NA 1P3KA 2F2AC 4H9SA 5B32G 5AV6D 3X1UA 3X1SA 5B32A 3REJC 3REKB 3MGSD 1WWIA 1P3MC 2FJ7A 3V9RB 3UTBA 4Z66C 5AV6B 2YFWA 3KWQA 3MGSB 3REIA 3REKC 3AFAA 3MGSC 5CPKA 5DNND 3VH6W 5AV5D 5DNNB 3AZMA 4H9OA 5AV5B 2NZDC 5B1LB 4XUJD 4EO5C 3MNNC 5DNNC 1T3UA 3WKJC 1KX5D 5AV5C 3KUYA 3AV1C 4XUJB 2IO5B 5B1LC 2ZM5A 4CSRB 1M19D 1KX5B 3VH6T 4H9PA 5B0ZA 1P3AD 1ID3A 1M19B 3AZFD 1KX5C 1P3AB 2BYMB 3AZFB 3V9RA 5C3IB 5AV6A 1P3AC 3MGSA 3AZND 1R4VA 4J8XC 1KU5A 4NE5A 5C3IC 4WU9C 3AZNB 3EPHA 3AZGD 1ZLAC 4NE6A 3KSYA 5CP6C 5DNNA 3AZGB 5AV5A 3C1CC 3X1TD 5B1MC 5B24D 4XUJA 5B2IB 5B24B 4CSRA 2YFVB 1P3FC 5B2IC 1M19A 3REHC 5E5AC 5B24C 1P3AA 3AZHC 1P3OD 4E45A 3AZFA 1P3OB 5GT3C 3AZJC 3AZNA 4JJNC 1HTAA 4G91B 3KXBC 4KHAA 1EQZD 2RIQA 5B0YD 1KX4D 3B0CW 3AZKC 3VH5A 3MGQD 5JRGC 3AZGA 4G91C 1EQZB 3LJAB 5B0YB 4AWLB 3MGQB 4H9RB 4X23D 3KFUG 1EQZC 3LJAC 3MGQC 3X1TA 5B24A 2YFVA 4YM6C 5F99C 1P3LC 4KUDD 3B0CT 4H9QB 3B0DB 4KUDB 5GT0D 5FUGB 5GT0B 2AROC 3B0DC 2Y2IA 3UT9D 1P3OA 4WZSB 3WAAD 3W99B 1TZYC 3AZLC 3UT9B 3WAAB 4XZQD 3MGPD 4WJ3C 4DRBA 1AOIC 3UT9C 3TU4C 4KGCD 3H0RC 4XZQB 3P5JB 3MGPB 1EQZA 3WTPC 4KGCB 4H9NA 5B0YA 1KX4A 3RELD 3MGQA 1U35D 4H9RA 4XZQC 1M18D 3W99D 3RELB 4ZUXD 1U35B 1M18B 5GXQD 4X23A 3W98C 4YS3C 4UPKA 3EPLA 3AN2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQ3 C;  5GXQ B;  4H9Q A;  1M18 C;  4KUD A;  2L5A A;  5AV9 C;  3REJ D;  1P3M D;  3B6G C;  5GXQ C;  5FUG A;  4Z66 D;  5GT0 A;  5BNV B;  1P3M B;  3REK D;  1P3I C;  4Z66 B;  2PYO D;  3WAA A;  3A6N C;  2PYO B;  2HIO D;  4XZQ A;  3MGP A;  5DNM C;  2NZD D;  4KGC A;  2PYO C;  2HIO B;  1P3G C;  3B6F C;  3MNN D;  2NZD B;  3WKJ D;  3AV1 D;  3REL A;  1BH9 B;  4EO5 B;  1U35 A;  3MNN B;  2HIO C;  5B1L D;  1M18 A;  3WKJ B;  3AV1 B;  3W99 A;  5GSU C;  4ZUX A;  5GXQ A;  2CV5 B;  3LZ1 B;  3NQU B;  3LEL D;  3LEL B;  2CV5 C;  4E44 A;  4R8P D;  3LZ1 C;  5B31 B;  5BNV A;  3REJ A;  1P3M A;  3UTA D;  4Z66 A;  4R8P B;  4J8X D;  3LEL C;  5BS7 C;  4WU9 D;  5B31 C;  5B2J D;  3REK A;  3UTA B;  1B6W A;  4J8X B;  1ZLA D;  4R8P C;  4WU9 B;  2PYO A;  5B2J B;  5CP6 D;  3UTA C;  1ZLA B;  5CP6 B;  3C1C D;  5B2J C;  2HIO A;  2NZD A;  3C1B B;  5B1M D;  5KDM B;  3C1C B;  1BH9 A;  3MNN A;  3WKJ A;  5B1M B;  4Z5T D;  1F66 D;  3AV1 A;  3C1B C;  1H3O B;  1P3F D;  5B1L A;  5B2I D;  4Z5T B;  1A7W A;  3REH D;  3VH5 W;  1F66 B;  5E5A D;  1P3F B;  3WA9 C;  4J8U D;  3AZH D;  3REH B;  1F1E A;  5G49 B;  5E5A B;  1KX5 A;  4Z5T C;  3LEL A;  1F66 C;  4J8U B;  3AZH B;  5GT3 D;  3MGR D;  4R8P A;  4J8U C;  5GT3 B;  3AZJ D;  3MGR B;  4HGA B;  2BYM A;  4JJN D;  3KXB D;  3VH5 T;  4J8X A;  3AZJ B;  4WU9 A;  5B2J A;  4J8W D;  4JJN B;  3KXB B;  3MGR C;  4HGA C;  3AZK D;  5JRG D;  1ZLA A;  1P34 B;  5CP6 A;  1TAF B;  4J8W B;  3AZK B;  4NE3 A;  5JRG B;  4G92 C;  5B33 C;  5KDM A;  4M6B A;  3LJA D;  3C1C A;  1P34 C;  4ZBJ C;  4J8W C;  5AV8 C;  5B1M A;  3AZE B;  4YM6 D;  1H3O A;  1BFM A;  5F99 D;  1P3L D;  2HUE B;  4Z5T A;  5BNX B;  1F66 A;  4YM6 B;  5F99 B;  2LY8 A;  3AZE C;  1P3L B;  1P3F A;  5CPJ C;  5B2I A;  4J8V B;  3REH A;  5G49 A;  5E5A A;  2HUE C;  4J8U A;  2ARO D;  3AZH A;  4CAY B;  4J8V C;  3W97 D;  1TZY D;  2ARO B;  3AZL D;  5GT3 A;  3MGR A;  3W97 B;  1TZY B;  3AZL B;  4UUZ B;  3AZJ A;  1AOI D;  3TU4 D;  4JJN A;  3KXB A;  3W97 C;  3WTP D;  1AOI B;  3TU4 B;  1P3B C;  4J8W A;  1TAF A;  3AZK A;  5JRG A;  3WTP B;  2NQB C;  3W98 D;  4YS3 D;  5AVB C;  3LJA A;  3AN2 D;  3O62 D;  1HQ3 D;  3W98 B;  4YS3 B;  4YM6 A;  3AN2 B;  3O62 B;  5F99 A;  1HQ3 B;  4Z2M H;  1P3L A;  5AV9 D;  3B6G D;  3MVD D;  5AV9 B;  3O62 C;  5AVC D;  3B6G B;  4CAY A;  3MVD B;  1P3I D;  3AZI C;  2ARO A;  5AVC B;  1P3I B;  3W97 A;  3MVD C;  1TZY A;  3A6N D;  3AZL A;  4UUZ A;  4H9S C;  5AVC C;  3X1U C;  3X1S C;  2FJ7 C;  3W96 D;  3A6N B;  5DNM D;  3UTB C;  1AOI A;  3UT9 A;  3TU4 A;  3W96 B;  1P3G D;  3REI C;  3B6F D;  5DNM B;  4Z2M G;  3WTP A;  5AY8 D;  1ULY A;  3AFA C;  1P3G B;  3B6F B;  5CPK C;  3W96 C;  1JFI B;  4LD9 D;  5AY8 B;  5GSU D;  3W98 A;  4LD9 B;  1M1A D;  4YS3 A;  3AZM C;  3AN2 A;  5AY8 C;  5GSU B;  3O62 A;  1HQ3 A;  5JA4 B;  1M1A B;  1KX3 D;  4LD9 C;  2CV5 D;  5CHL B;  3LZ1 D;  3KUY C;  5AV9 A;  1ID3 B;  3B6G A;  1KX3 B;  3MVD A;  1M1A C;  5AVC A;  5B0Z C;  5B31 D;  1P3I A;  1ID3 C;  1KX3 C;  3A6N A;  5AV6 C;  3W96 A;  5DNM A;  1P3G A;  3B6F A;  5BT1 D;  1JFI A;  2RVQ D;  5AY8 A;  3C1B D;  3AV2 D;  4LD9 A;  3AV2 B;  5GSU A;  3WA9 D;  5JA4 A;  5BT1 C;  1M1A A;  4DRA A;  2RVQ C;  3WA9 B;  3AV2 C;  4XUJ C;  2IO5 C;  1KX3 A;  2CV5 A;  3LZ1 A;  3NQU A;  1M19 C;  5B31 G;  5BS7 A;  5B31 A;  3X1V D;  5BO0 B;  3VH6 A;  3AZF C;  3X1V B;  1Q9C A;  3UTA A;  2F8N D;  4KHA B;  5B33 D;  1P34 D;  3X1V C;  5AV8 D;  2F8N K;  3AZN C;  4G92 B;  2F8N B;  5B33 B;  4ZBJ B;  5AV8 B;  4QLC D;  5B40 D;  3LZ0 D;  3AZG C;  3C1B A;  5CPI D;  1N1J B;  4QLC B;  3AZE D;  3AV2 A;  5CPJ D;  5B40 B;  3LZ0 B;  3X1T B;  5CPI B;  2F8N H;  4WV4 B;  3WA9 A;  5CPJ B;  3R45 B;  4QLC C;  5B40 C;  3LZ0 C;  4J8V D;  3NQJ B;  3X1T C;  5CPI C;  5BO0 A;  3X1V A;  1P3P D;  1P3B D;  4WNN B;  1S32 D;  1P3O C;  1P3P B;  1P3B B;  2NQB D;  1B67 A;  1S32 B;  2F8N G;  2F8N A;  5B33 A;  5AVB D;  1P34 A;  4H9N B;  2NQB B;  1P3P C;  1KX4 B;  5AV8 A;  1S32 C;  2JSS A;  5AVB B;  1N1J A;  4QLC A;  5B0Y C;  4AWL C;  5B40 A;  1KX4 C;  3LZ0 A;  1WWS A;  4X23 B;  3AYW D;  5CPI A;  3AZE A;  4WU8 D;  5CPJ A;  3R45 A;  1BH8 B;  3AYW B;  4X23 C;  3NQJ A;  5BNX A;  3AZI D;  4WU8 B;  4J8V A;  3AZI B;  3AYW C;  1P3K D;  4WU8 C;  2BYK B;  4KUD C;  3X1U D;  3X1S D;  5B32 D;  1P3K B;  2FJ7 D;  4NFT A;  3UTB D;  5GT0 C;  3X1U B;  3X1S B;  5B32 B;  4WNN A;  3KWQ D;  2FJ7 B;  3REI D;  3UTB B;  1P3K C;  2YFW B;  1P3B A;  3AFA D;  1P3P A;  3KWQ B;  1S32 A;  3REI B;  5B32 C;  5CPK D;  3WAA C;  3AFA B;  2NQB A;  3KWQ C;  5CPK B;  3MGP C;  3B0B A;  5AVB A;  3AZM D;  2CWE A;  4KGC C;  3AZM B;  4H9O B;  4ZUX B;  3KUY D;  3REL C;  1U35 C;  1BH8 A;  3AYW A;  4WU8 A;  3W99 C;  3KUY B;  5B0Z D;  4ZUX C;  1ID3 D;  3AZI A;  4H9P B;  5B0Z B;  3REJ B;  2BYK A;  3WTP E;  1P3K A;  4H9S A;  5B32 G;  5AV6 D;  3X1U A;  3X1S A;  5B32 A;  3REJ C;  3REK B;  3MGS D;  1WWI A;  1P3M C;  2FJ7 A;  3V9R B;  3UTB A;  4Z66 C;  5AV6 B;  2YFW A;  3KWQ A;  3MGS B;  3REI A;  3REK C;  3AFA A;  3MGS C;  5CPK A;  5DNN D;  3VH6 W;  5AV5 D;  5DNN B;  3AZM A;  4H9O A;  5AV5 B;  2NZD C;  5B1L B;  4XUJ D;  4EO5 C;  3MNN C;  5DNN C;  3WKJ C;  1KX5 D;  5AV5 C;  3KUY A;  3AV1 C;  4XUJ B;  2IO5 B;  5B1L C;  1KX5 B;  4CSR B;  1M19 D;  3VH6 T;  4H9P A;  5B0Z A;  1P3A D;  1ID3 A;  1M19 B;  3AZF D;  1KX5 C;  1P3A B;  2BYM B;  3AZF B;  3V9R A;  5C3I B;  5AV6 A;  1P3A C;  3MGS A;  3AZN D;  1R4V A;  4J8X C;  1KU5 A;  4NE5 A;  5C3I C;  4WU9 C;  3AZN B;  3AZG D;  1ZLA C;  4NE6 A;  3KSY A;  5CP6 C;  5DNN A;  3AZG B;  5AV5 A;  3C1C C;  3X1T D;  5B1M C;  5B24 D;  4XUJ A;  5B2I B;  5B24 B;  4CSR A;  2YFV B;  1P3F C;  5B2I C;  1M19 A;  3REH C;  5E5A C;  5B24 C;  1P3A A;  3AZH C;  1P3O D;  4E45 A;  3AZF A;  1P3O B;  5GT3 C;  3AZJ C;  3AZN A;  4JJN C;  1HTA A;  4G91 B;  3KXB C;  4KHA A;  1EQZ D;  5B0Y D;  1KX4 D;  3B0C W;  3AZK C;  3VH5 A;  3MGQ D;  5JRG C;  3AZG A;  4G91 C;  1EQZ B;  3LJA B;  5B0Y B;  4AWL B;  3MGQ B;  4H9R B;  4X23 D;  1EQZ C;  3LJA C;  3MGQ C;  3X1T A;  5B24 A;  2YFV A;  4YM6 C;  5F99 C;  1P3L C;  4KUD D;  3B0C T;  4H9Q B;  3B0D B;  4KUD B;  5GT0 D;  5FUG B;  5GT0 B;  2ARO C;  3B0D C;  3UT9 D;  1P3O A;  4WZS B;  3WAA D;  3W99 B;  1TZY C;  3AZL C;  3UT9 B;  3WAA B;  4XZQ D;  3MGP D;  4DRB A;  1AOI C;  3UT9 C;  3TU4 C;  4KGC D;  4XZQ B;  3MGP B;  1EQZ A;  3WTP C;  4KGC B;  4H9N A;  5B0Y A;  1KX4 A;  3REL D;  3MGQ A;  1U35 D;  4H9R A;  4XZQ C;  1M18 D;  3W99 D;  3REL B;  4ZUX D;  1U35 B;  1M18 B;  5GXQ D;  4X23 A;  3W98 C;  4YS3 C;  3AN2 C; 
#chains in the Genus database with same CATH topology
 3H0M C;  1HQ3 C;  5GXQ B;  4H9Q A;  2Y2H A;  1M18 C;  2JCH A;  4KUD A;  2L5A A;  5AV9 C;  3REJ D;  1P3M D;  3B6G C;  5GXQ C;  5FUG A;  4Z66 D;  5GT0 A;  5BNV B;  1P3M B;  3REK D;  1P3I C;  4Z66 B;  2PYO D;  3WAA A;  3A6N C;  2PYO B;  2Y2O A;  2HIO D;  4XZQ A;  3MGP A;  5DNM C;  2NZD D;  4KGC A;  2PYO C;  2HIO B;  1P3G C;  3B6F C;  3MNN D;  2NZD B;  3WKJ D;  3AV1 D;  3EPK A;  3REL A;  1BH9 B;  2JE5 A;  2Y2K A;  4EO5 B;  2HIO C;  3MNN B;  5B1L D;  1U35 A;  1M18 A;  3WKJ B;  3AV1 B;  3W99 A;  5GSU C;  4ZUX A;  5GXQ A;  2CV5 B;  3LZ1 B;  3NQU B;  3LEL D;  3LEL B;  2CV5 C;  4E44 A;  4R8P D;  3LZ1 C;  5B31 B;  5BNV A;  3REJ A;  1P3M A;  2DQN C;  3UTA D;  4Z66 A;  4R8P B;  4J8X D;  3LEL C;  5BS7 C;  4WU9 D;  5B31 C;  5B2J D;  3REK A;  3UTA B;  1B6W A;  4J8X B;  2Y2G A;  1ZLA D;  4R8P C;  4WU9 B;  2PYO A;  5B2J B;  5CP6 D;  3UTA C;  1ZLA B;  5CP6 B;  3C1C D;  5B2J C;  2HIO A;  2NZD A;  3C1B B;  5B1M D;  5KDM B;  3C1C B;  1BH9 A;  3MNN A;  3WKJ A;  5B1M B;  4Z5T D;  1F66 D;  3AV1 A;  3C1B C;  1H3O B;  1P3F D;  5B1L A;  5B2I D;  4Z5T B;  1A7W A;  3REH D;  3VH5 W;  1F66 B;  5E5A D;  1P3F B;  3WA9 C;  4J8U D;  3AZH D;  3REH B;  1F1E A;  2Y2J A;  5G49 B;  5E5A B;  3IP4 C;  4Z5T C;  1KX5 A;  3LEL A;  1F66 C;  4J8U B;  3AZH B;  2ZY2 A;  5GT3 D;  3MGR D;  2Y2Q A;  4R8P A;  4J8U C;  5GT3 B;  3AZJ D;  3MGR B;  4HGA B;  2BYM A;  4JJN D;  3KXB D;  3VH5 T;  4J8X A;  3AZJ B;  4WU9 A;  5B2J A;  4J8W D;  4JJN B;  3KXB B;  3MGR C;  4HGA C;  3AZK D;  5JRG D;  1ZLA A;  1P34 B;  5CP6 A;  1TAF B;  4J8W B;  3AZK B;  4NE3 A;  5JRG B;  4G92 C;  5B33 C;  5KDM A;  4M6B A;  3LJA D;  3C1C A;  1P34 C;  4ZBJ C;  4J8W C;  5AV8 C;  1W2E A;  5B1M A;  3AZE B;  4YM6 D;  1H3O A;  1BFM A;  5F99 D;  1P3L D;  2HUE B;  4Z5T A;  5BNX B;  1F66 A;  4YM6 B;  5F99 B;  2LY8 A;  3AZE C;  1P3L B;  1P3F A;  5CPJ C;  5B2I A;  4J8V B;  3REH A;  5G49 A;  5E5A A;  2HUE C;  4J8U A;  2ARO D;  3AZH A;  4CAY B;  4J8V C;  3W97 D;  2ZY3 A;  1TZY D;  2ARO B;  3AZL D;  5GT3 A;  3MGR A;  3W97 B;  1TZY B;  3AZL B;  4UUZ B;  3AZJ A;  1AOI D;  3TU4 D;  4JJN A;  2XD1 A;  3KXB A;  1Z2C B;  3W97 C;  3WTP D;  1AOI B;  3TU4 B;  1P3B C;  4J8W A;  1TAF A;  3AZK A;  5JRG A;  3WTP B;  2NQB C;  3W98 D;  4YS3 D;  5AVB C;  3LJA A;  3AN2 D;  3O62 D;  1HQ3 D;  3W98 B;  2ZY4 A;  4YS3 B;  4YM6 A;  3AN2 B;  3O62 B;  1PZR A;  5F99 A;  1HQ3 B;  4Z2M H;  1P3L A;  5AV9 D;  3B6G D;  3MVD D;  5AV9 B;  3O62 C;  5AVC D;  3B6G B;  4CAY A;  3MVD B;  1P3I D;  3AZI C;  2ARO A;  5AVC B;  1P3I B;  3W97 A;  3MVD C;  1TZY A;  3A6N D;  3AZL A;  4UUZ A;  4H9S C;  5AVC C;  3X1U C;  3X1S C;  2FJ7 C;  3W96 D;  3A6N B;  2FFF B;  5DNM D;  3UTB C;  1AOI A;  3UT9 A;  3TU4 A;  2Y2L A;  1P3G D;  3REI C;  3B6F D;  5DNM B;  4Z2M G;  3W96 B;  3WTP A;  5AY8 D;  1ULY A;  3AFA C;  1P3G B;  3B6F B;  5CPK C;  3W96 C;  1JFI B;  4LD9 D;  5AY8 B;  5GSU D;  3W98 A;  4LD9 B;  1M1A D;  4YS3 A;  3AZM C;  3AN2 A;  5AY8 C;  5GSU B;  3O62 A;  1HQ3 A;  5JA4 B;  1M1A B;  2DF4 C;  1KX3 D;  4LD9 C;  2CV5 D;  5CHL B;  3LZ1 D;  2VQR A;  5AV9 A;  3KUY C;  1ID3 B;  3B6G A;  1KX3 B;  3MVD A;  1M1A C;  5AVC A;  5B0Z C;  5B31 D;  1P3I A;  1ID3 C;  1KX3 C;  3EPJ A;  3A6N A;  5AV6 C;  3W96 A;  5DNM A;  1P3G A;  3B6F A;  5BT1 D;  3FDD A;  1JFI A;  2RVQ D;  5AY8 A;  3C1B D;  3AV2 D;  4LD9 A;  3AV2 B;  5GSU A;  3WA9 D;  5JA4 A;  5BT1 C;  1M1A A;  4DRA A;  2RVQ C;  3WA9 B;  2UWX A;  3AV2 C;  4XUJ C;  2IO5 C;  1KX3 A;  2CV5 A;  3LZ1 A;  3NQU A;  1M19 C;  5B31 G;  5BS7 A;  5B31 A;  3X1V D;  5BO0 B;  3VH6 A;  3AL0 C;  3AZF C;  3H0L C;  3X1V B;  1Q9C A;  3UTA A;  2F8N D;  4KHA B;  5B33 D;  1P34 D;  3X1V C;  5AV8 D;  2F8N K;  3AZN C;  4G92 B;  2F8N B;  5B33 B;  4ZBJ B;  5AV8 B;  4QLC D;  5B40 D;  3LZ0 D;  3AZG C;  3C1B A;  5CPI D;  1N1J B;  4QLC B;  3AZE D;  3AV2 A;  5CPJ D;  5B40 B;  3LZ0 B;  3X1T B;  5CPI B;  2F8N H;  4WV4 B;  3WA9 A;  5CPJ B;  3R45 B;  4QLC C;  5B40 C;  3LZ0 C;  4J8V D;  3NQJ B;  3X1T C;  5CPI C;  3A1K A;  5BO0 A;  4DQY B;  2G5I C;  3X1V A;  1P3B D;  1P3P D;  2G5H C;  4WNN B;  1S32 D;  1P3O C;  1P3P B;  1P3B B;  2NQB D;  1B67 A;  1S32 B;  2F8N G;  2F8N A;  5B33 A;  5AVB D;  1P34 A;  4H9N B;  2Y2M A;  1P3P C;  1KX4 B;  2NQB B;  5AV8 A;  1S32 C;  2JSS A;  5AVB B;  1N1J A;  4QLC A;  5B0Y C;  4AWL C;  5B40 A;  1KX4 C;  3LZ0 A;  1WWS A;  4X23 B;  3AYW D;  5CPI A;  3AZE A;  4WU8 D;  5CPJ A;  3R45 A;  1BH8 B;  3AYW B;  4X23 C;  3NQJ A;  5BNX A;  3AZI D;  4WU8 B;  2W8S A;  4J8V A;  3AZI B;  3AYW C;  1P3K D;  4WU8 C;  2BYK B;  4KUD C;  2J8P A;  3X1U D;  3X1S D;  5B32 D;  1P3K B;  2FJ7 D;  4NFT A;  3UTB D;  2Y2P A;  5GT0 C;  3X1S B;  5B32 B;  4WNN A;  2XD5 A;  3X1U B;  3KWQ D;  3F6T A;  3REI D;  2FJ7 B;  3UTB B;  1P3K C;  2YFW B;  1P3B A;  3AFA D;  1P3P A;  3KWQ B;  1S32 A;  3REI B;  5B32 C;  5CPK D;  3WAA C;  3AFA B;  2NQB A;  3KWQ C;  5CPK B;  3MGP C;  3B0B A;  5AVB A;  3AZM D;  2CWE A;  4KGC C;  3AZM B;  4H9O B;  4ZUX B;  3KUY D;  3REL C;  1U35 C;  1BH8 A;  3EG5 B;  3AYW A;  3A1I A;  2BG1 A;  4WU8 A;  3W99 C;  3KUY B;  5B0Z D;  4ZUX C;  1ID3 D;  2ZY5 A;  3AZI A;  4H9P B;  5B0Z B;  3REJ B;  2BYK A;  3WTP E;  2Y2N A;  1P3K A;  2F2A C;  4H9S A;  5B32 G;  5AV6 D;  3X1U A;  3X1S A;  5B32 A;  3REJ C;  3REK B;  3MGS D;  1WWI A;  1P3M C;  2FJ7 A;  3V9R B;  3UTB A;  4Z66 C;  5AV6 B;  2YFW A;  3KWQ A;  3MGS B;  3REI A;  3REK C;  3AFA A;  3MGS C;  5CPK A;  5DNN D;  3VH6 W;  5AV5 D;  5DNN B;  3AZM A;  4H9O A;  5AV5 B;  2NZD C;  5B1L B;  4XUJ D;  4EO5 C;  3MNN C;  5DNN C;  1T3U A;  3WKJ C;  1KX5 D;  5AV5 C;  3KUY A;  3AV1 C;  4XUJ B;  2IO5 B;  5B1L C;  2ZM5 A;  4CSR B;  1M19 D;  1KX5 B;  3VH6 T;  4H9P A;  5B0Z A;  1P3A D;  1ID3 A;  1M19 B;  3AZF D;  1KX5 C;  1P3A B;  2BYM B;  3AZF B;  3V9R A;  5C3I B;  5AV6 A;  1P3A C;  3MGS A;  3AZN D;  1R4V A;  4J8X C;  1KU5 A;  4NE5 A;  5C3I C;  4WU9 C;  3AZN B;  3EPH A;  3AZG D;  1ZLA C;  4NE6 A;  3KSY A;  5CP6 C;  5DNN A;  3AZG B;  5AV5 A;  3C1C C;  3X1T D;  5B1M C;  5B24 D;  4XUJ A;  5B2I B;  5B24 B;  4CSR A;  2YFV B;  1P3F C;  5B2I C;  1M19 A;  3REH C;  5E5A C;  5B24 C;  1P3A A;  3AZH C;  1P3O D;  4E45 A;  3AZF A;  1P3O B;  5GT3 C;  3AZJ C;  3AZN A;  4JJN C;  1HTA A;  4G91 B;  3KXB C;  4KHA A;  1EQZ D;  2RIQ A;  5B0Y D;  1KX4 D;  3B0C W;  3AZK C;  3VH5 A;  3MGQ D;  5JRG C;  3AZG A;  4G91 C;  1EQZ B;  3LJA B;  5B0Y B;  4AWL B;  3MGQ B;  4H9R B;  4X23 D;  3KFU G;  1EQZ C;  3LJA C;  3MGQ C;  3X1T A;  5B24 A;  2YFV A;  4YM6 C;  5F99 C;  1P3L C;  4KUD D;  3B0C T;  4H9Q B;  3B0D B;  4KUD B;  5GT0 D;  5FUG B;  5GT0 B;  2ARO C;  3B0D C;  2Y2I A;  3UT9 D;  1P3O A;  4WZS B;  3WAA D;  3W99 B;  1TZY C;  3AZL C;  3UT9 B;  3WAA B;  4XZQ D;  3MGP D;  4WJ3 C;  4DRB A;  1AOI C;  3UT9 C;  3TU4 C;  4KGC D;  3H0R C;  4XZQ B;  3P5J B;  3MGP B;  1EQZ A;  3WTP C;  4KGC B;  4H9N A;  5B0Y A;  1KX4 A;  3REL D;  3MGQ A;  1U35 D;  4H9R A;  4XZQ C;  1M18 D;  3W99 D;  3REL B;  4ZUX D;  1U35 B;  1M18 B;  5GXQ D;  4X23 A;  3W98 C;  4YS3 C;  4UPK A;  3EPL A;  3AN2 C; 
#chains in the Genus database with same CATH homology
 3H0M C;  1HQ3 C;  5GXQ B;  4H9Q A;  2Y2H A;  1M18 C;  2JCH A;  4KUD A;  2L5A A;  5AV9 C;  3REJ D;  1P3M D;  3B6G C;  5GXQ C;  5FUG A;  4Z66 D;  5GT0 A;  5BNV B;  1P3M B;  3REK D;  1P3I C;  4Z66 B;  2PYO D;  3WAA A;  3A6N C;  2PYO B;  2Y2O A;  2HIO D;  4XZQ A;  3MGP A;  5DNM C;  2NZD D;  4KGC A;  2PYO C;  2HIO B;  1P3G C;  3B6F C;  3MNN D;  2NZD B;  3WKJ D;  3AV1 D;  3EPK A;  3REL A;  1BH9 B;  2JE5 A;  2Y2K A;  4EO5 B;  2HIO C;  3MNN B;  5B1L D;  1U35 A;  1M18 A;  3WKJ B;  3AV1 B;  3W99 A;  5GSU C;  4ZUX A;  5GXQ A;  2CV5 B;  3LZ1 B;  3NQU B;  3LEL D;  3LEL B;  2CV5 C;  4E44 A;  4R8P D;  3LZ1 C;  5B31 B;  5BNV A;  3REJ A;  1P3M A;  2DQN C;  3UTA D;  4Z66 A;  4R8P B;  4J8X D;  3LEL C;  5BS7 C;  4WU9 D;  5B31 C;  5B2J D;  3REK A;  3UTA B;  1B6W A;  4J8X B;  2Y2G A;  1ZLA D;  4R8P C;  4WU9 B;  2PYO A;  5B2J B;  5CP6 D;  3UTA C;  1ZLA B;  5CP6 B;  3C1C D;  5B2J C;  2HIO A;  2NZD A;  3C1B B;  5B1M D;  5KDM B;  3C1C B;  1BH9 A;  3MNN A;  3WKJ A;  5B1M B;  4Z5T D;  1F66 D;  3AV1 A;  3C1B C;  1H3O B;  1P3F D;  5B1L A;  5B2I D;  4Z5T B;  1A7W A;  3REH D;  3VH5 W;  1F66 B;  5E5A D;  1P3F B;  3WA9 C;  4J8U D;  3AZH D;  3REH B;  1F1E A;  2Y2J A;  5G49 B;  5E5A B;  3IP4 C;  4Z5T C;  1KX5 A;  3LEL A;  1F66 C;  4J8U B;  3AZH B;  2ZY2 A;  5GT3 D;  3MGR D;  2Y2Q A;  4R8P A;  4J8U C;  5GT3 B;  3AZJ D;  3MGR B;  4HGA B;  2BYM A;  4JJN D;  3KXB D;  3VH5 T;  4J8X A;  3AZJ B;  4WU9 A;  5B2J A;  4J8W D;  4JJN B;  3KXB B;  3MGR C;  4HGA C;  3AZK D;  5JRG D;  1ZLA A;  1P34 B;  5CP6 A;  1TAF B;  4J8W B;  3AZK B;  4NE3 A;  5JRG B;  4G92 C;  5B33 C;  5KDM A;  4M6B A;  3LJA D;  3C1C A;  1P34 C;  4ZBJ C;  4J8W C;  5AV8 C;  1W2E A;  5B1M A;  3AZE B;  4YM6 D;  1H3O A;  1BFM A;  5F99 D;  1P3L D;  2HUE B;  4Z5T A;  5BNX B;  1F66 A;  4YM6 B;  5F99 B;  2LY8 A;  3AZE C;  1P3L B;  1P3F A;  5CPJ C;  5B2I A;  4J8V B;  3REH A;  5G49 A;  5E5A A;  2HUE C;  4J8U A;  2ARO D;  3AZH A;  4CAY B;  4J8V C;  3W97 D;  2ZY3 A;  1TZY D;  2ARO B;  3AZL D;  5GT3 A;  3MGR A;  3W97 B;  1TZY B;  3AZL B;  4UUZ B;  3AZJ A;  1AOI D;  3TU4 D;  4JJN A;  2XD1 A;  3KXB A;  1Z2C B;  3W97 C;  3WTP D;  1AOI B;  3TU4 B;  1P3B C;  4J8W A;  1TAF A;  3AZK A;  5JRG A;  3WTP B;  2NQB C;  3W98 D;  4YS3 D;  5AVB C;  3LJA A;  3AN2 D;  3O62 D;  1HQ3 D;  3W98 B;  2ZY4 A;  4YS3 B;  4YM6 A;  3AN2 B;  3O62 B;  1PZR A;  5F99 A;  1HQ3 B;  4Z2M H;  1P3L A;  5AV9 D;  3B6G D;  3MVD D;  5AV9 B;  3O62 C;  5AVC D;  3B6G B;  4CAY A;  3MVD B;  1P3I D;  3AZI C;  2ARO A;  5AVC B;  1P3I B;  3W97 A;  3MVD C;  1TZY A;  3A6N D;  3AZL A;  4UUZ A;  4H9S C;  5AVC C;  3X1U C;  3X1S C;  2FJ7 C;  3W96 D;  3A6N B;  2FFF B;  5DNM D;  3UTB C;  1AOI A;  3UT9 A;  3TU4 A;  2Y2L A;  1P3G D;  3REI C;  3B6F D;  5DNM B;  4Z2M G;  3W96 B;  3WTP A;  5AY8 D;  1ULY A;  3AFA C;  1P3G B;  3B6F B;  5CPK C;  3W96 C;  1JFI B;  4LD9 D;  5AY8 B;  5GSU D;  3W98 A;  4LD9 B;  1M1A D;  4YS3 A;  3AZM C;  3AN2 A;  5AY8 C;  5GSU B;  3O62 A;  1HQ3 A;  5JA4 B;  1M1A B;  2DF4 C;  1KX3 D;  4LD9 C;  2CV5 D;  5CHL B;  3LZ1 D;  2VQR A;  5AV9 A;  3KUY C;  1ID3 B;  3B6G A;  1KX3 B;  3MVD A;  1M1A C;  5AVC A;  5B0Z C;  5B31 D;  1P3I A;  1ID3 C;  1KX3 C;  3EPJ A;  3A6N A;  5AV6 C;  3W96 A;  5DNM A;  1P3G A;  3B6F A;  5BT1 D;  3FDD A;  1JFI A;  2RVQ D;  5AY8 A;  3C1B D;  3AV2 D;  4LD9 A;  3AV2 B;  5GSU A;  3WA9 D;  5JA4 A;  5BT1 C;  1M1A A;  4DRA A;  2RVQ C;  3WA9 B;  2UWX A;  3AV2 C;  4XUJ C;  2IO5 C;  1KX3 A;  2CV5 A;  3LZ1 A;  3NQU A;  1M19 C;  5B31 G;  5BS7 A;  5B31 A;  3X1V D;  5BO0 B;  3VH6 A;  3AL0 C;  3AZF C;  3H0L C;  3X1V B;  1Q9C A;  3UTA A;  2F8N D;  4KHA B;  5B33 D;  1P34 D;  3X1V C;  5AV8 D;  2F8N K;  3AZN C;  4G92 B;  2F8N B;  5B33 B;  4ZBJ B;  5AV8 B;  4QLC D;  5B40 D;  3LZ0 D;  3AZG C;  3C1B A;  5CPI D;  1N1J B;  4QLC B;  3AZE D;  3AV2 A;  5CPJ D;  5B40 B;  3LZ0 B;  3X1T B;  5CPI B;  2F8N H;  4WV4 B;  3WA9 A;  5CPJ B;  3R45 B;  4QLC C;  5B40 C;  3LZ0 C;  4J8V D;  3NQJ B;  3X1T C;  5CPI C;  3A1K A;  5BO0 A;  4DQY B;  2G5I C;  3X1V A;  1P3B D;  1P3P D;  2G5H C;  4WNN B;  1S32 D;  1P3O C;  1P3P B;  1P3B B;  2NQB D;  1B67 A;  1S32 B;  2F8N G;  2F8N A;  5B33 A;  5AVB D;  1P34 A;  4H9N B;  2Y2M A;  1P3P C;  1KX4 B;  2NQB B;  5AV8 A;  1S32 C;  2JSS A;  5AVB B;  1N1J A;  4QLC A;  5B0Y C;  4AWL C;  5B40 A;  1KX4 C;  3LZ0 A;  1WWS A;  4X23 B;  3AYW D;  5CPI A;  3AZE A;  4WU8 D;  5CPJ A;  3R45 A;  1BH8 B;  3AYW B;  4X23 C;  3NQJ A;  5BNX A;  3AZI D;  4WU8 B;  2W8S A;  4J8V A;  3AZI B;  3AYW C;  1P3K D;  4WU8 C;  2BYK B;  4KUD C;  2J8P A;  3X1U D;  3X1S D;  5B32 D;  1P3K B;  2FJ7 D;  4NFT A;  3UTB D;  2Y2P A;  5GT0 C;  3X1S B;  5B32 B;  4WNN A;  2XD5 A;  3X1U B;  3KWQ D;  3F6T A;  3REI D;  2FJ7 B;  3UTB B;  1P3K C;  2YFW B;  1P3B A;  3AFA D;  1P3P A;  3KWQ B;  1S32 A;  3REI B;  5B32 C;  5CPK D;  3WAA C;  3AFA B;  2NQB A;  3KWQ C;  5CPK B;  3MGP C;  3B0B A;  5AVB A;  3AZM D;  2CWE A;  4KGC C;  3AZM B;  4H9O B;  4ZUX B;  3KUY D;  3REL C;  1U35 C;  1BH8 A;  3EG5 B;  3AYW A;  3A1I A;  2BG1 A;  4WU8 A;  3W99 C;  3KUY B;  5B0Z D;  4ZUX C;  1ID3 D;  2ZY5 A;  3AZI A;  4H9P B;  5B0Z B;  3REJ B;  2BYK A;  3WTP E;  2Y2N A;  1P3K A;  2F2A C;  4H9S A;  5B32 G;  5AV6 D;  3X1U A;  3X1S A;  5B32 A;  3REJ C;  3REK B;  3MGS D;  1WWI A;  1P3M C;  2FJ7 A;  3V9R B;  3UTB A;  4Z66 C;  5AV6 B;  2YFW A;  3KWQ A;  3MGS B;  3REI A;  3REK C;  3AFA A;  3MGS C;  5CPK A;  5DNN D;  3VH6 W;  5AV5 D;  5DNN B;  3AZM A;  4H9O A;  5AV5 B;  2NZD C;  5B1L B;  4XUJ D;  4EO5 C;  3MNN C;  5DNN C;  1T3U A;  3WKJ C;  1KX5 D;  5AV5 C;  3KUY A;  3AV1 C;  4XUJ B;  2IO5 B;  5B1L C;  2ZM5 A;  4CSR B;  1M19 D;  1KX5 B;  3VH6 T;  4H9P A;  5B0Z A;  1P3A D;  1ID3 A;  1M19 B;  3AZF D;  1KX5 C;  1P3A B;  2BYM B;  3AZF B;  3V9R A;  5C3I B;  5AV6 A;  1P3A C;  3MGS A;  3AZN D;  1R4V A;  4J8X C;  1KU5 A;  4NE5 A;  5C3I C;  4WU9 C;  3AZN B;  3EPH A;  3AZG D;  1ZLA C;  4NE6 A;  3KSY A;  5CP6 C;  5DNN A;  3AZG B;  5AV5 A;  3C1C C;  3X1T D;  5B1M C;  5B24 D;  4XUJ A;  5B2I B;  5B24 B;  4CSR A;  2YFV B;  1P3F C;  5B2I C;  1M19 A;  3REH C;  5E5A C;  5B24 C;  1P3A A;  3AZH C;  1P3O D;  4E45 A;  3AZF A;  1P3O B;  5GT3 C;  3AZJ C;  3AZN A;  4JJN C;  1HTA A;  4G91 B;  3KXB C;  4KHA A;  1EQZ D;  2RIQ A;  5B0Y D;  1KX4 D;  3B0C W;  3AZK C;  3VH5 A;  3MGQ D;  5JRG C;  3AZG A;  4G91 C;  1EQZ B;  3LJA B;  5B0Y B;  4AWL B;  3MGQ B;  4H9R B;  4X23 D;  3KFU G;  1EQZ C;  3LJA C;  3MGQ C;  3X1T A;  5B24 A;  2YFV A;  4YM6 C;  5F99 C;  1P3L C;  4KUD D;  3B0C T;  4H9Q B;  3B0D B;  4KUD B;  5GT0 D;  5FUG B;  5GT0 B;  2ARO C;  3B0D C;  2Y2I A;  3UT9 D;  1P3O A;  4WZS B;  3WAA D;  3W99 B;  1TZY C;  3AZL C;  3UT9 B;  3WAA B;  4XZQ D;  3MGP D;  4WJ3 C;  4DRB A;  1AOI C;  3UT9 C;  3TU4 C;  4KGC D;  3H0R C;  4XZQ B;  3P5J B;  3MGP B;  1EQZ A;  3WTP C;  4KGC B;  4H9N A;  5B0Y A;  1KX4 A;  3REL D;  3MGQ A;  1U35 D;  4H9R A;  4XZQ C;  1M18 D;  3W99 D;  3REL B;  4ZUX D;  1U35 B;  1M18 B;  5GXQ D;  4X23 A;  3W98 C;  4YS3 C;  4UPK A;  3EPL A;  3AN2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...