3REKA

2.6 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b) derivatized with oxaliplatin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 31
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rekA00
5B0ZC 3O62C 3REHC 5CPKB 3B6FD 4JJND 3AZGA 2PYOD 5DNND 3AZEC 4R8PA 5GT3B 3A6NB 3MGRA 1ID3B 2F8NK 3NQJA 4EO5C 5AVCA 4R8PC 3MGRC 5BS7C 3C1CB 3W97C 3AYWD 3UT9D 3AZIC 5AVCC 3MGPD 1H3OB 5B0YB 4YS3A 1P3IA 4X23A 5B2IC 3LELB 5KDMA 1M18B 3LJAA 5CPIA 3AZLD 3VH5W 3AZNA 5F99B 5B33D 3LJAC 5CPJD 1U35C 4J8XA 2AROC 5B32A 3AZHB 2NZDA 3AZNC 5BNVB 5B1LB 3UTBA 4J8XC 3AV2D 5B32C 5AY8A 3LZ1B 4H9NB 3AZFB 1P3PB 5CP6A 2YFWB 3RELB 1F1EA 3B0DB 3AFAB 1KX3C 5AY8C 5AV9A 3O62D 1M1AA 1P3KA 1ULYA 3LZ0C 4WU9A 3WKJA 4H9RB 5B2JB 1AOIA 5AV9C 3AZMC 2NQBB 3MGQA 4J8UB 5GXQA 3AZED 3W96A 1R4VA 1BH9A 5DNMB 3WAAA 3X1VB 1P3GC 5AVBA 3MGQC 3AZKB 5AV8A 3W96C 4LD9D 3VH6A 3WAAC 4J8VC 3X1TC 3W97D 2F8NB 3AZID 5AV8C 1P3AC 3REKA 3W98B 5AV5B 4KGCB 1TZYA 1M19A 4QLCB 4WU8C 3X1UD 5B31G 5E5AB 3REKC 4KUDA 3TU4D 5B2ID 1TZYC 2HIOB 3KWQD 3REJC 5BNVA 5G49B 4Z66B 3AV1D 3B6FA 2BYKA 3NQUB 4JJNA 1U35D 5GSUB 3MVDD 2PYOA 5DNNA 4JJNC 3RELA 2PYOC 5DNNC 4AWLC 1P3BD 3AZGB 4H9RA 5AV6C 1KX3D 4EO5B 4R8PB 3MGPA 3MGRB 4HGAB 3LZ0D 3NQJB 4J8UA 3B6GD 4G91C 3AYWC 2CWEA 5JRGC 5AVCB 4E44A 3UT9C 3MGPC 1TAFA 1BH8A 1S32D 3KUYC 3WTPD 1EQZA 2HUEC 2FJ7D 1P3GD 4YS3B 3KSYA 4J8VD 4XUJC 5CPJA 3AZLC 1P3IB 4X23B 4ZUXC 1P3AD 5KDMB 3LJAB 5B33C 5CPIB 3UTAA 4H9OA 5GT0C 5CPJC 4Z5TC 1KX5D 3AZNB 5CPKD 4J8XB 5B32B 3AV2C 1WWIA 5B0ZA 2NZDB 3O62A 3REHA 5GT3D 3UTBB 5B40D 3WA9C 5AY8B 5CP6B 1KU5A 3AZEA 5AV9B 1M1AB 4G92B 1P3KB 4WU9B 3WKJB 5BS7A 4Z2MG 1AOIB 4LD9A 2F8NG 3W97A 5AV6D 3MGQB 3AZIA 5GXQB 3W96B 3LELD 1BH9B 4LD9C 3WAAB 4NE6A 4M6BA 5AVBB 5AV8B 5JRGD 5FUGB 3X1UA 3KXBD 5F99D 5B2IA 3KUYD 5B1MC 5JA4A 3X1UC 3REKB 4WV4B 3KWQA 3TU4C 1TZYB 1M19B 3AV1A 1U35A 1HQ3D 4XUJD 2AROA 4CSRA 3MVDA 1P3PD 4H9PA 3B0CW 4ZUXD 4YM6D 3KWQC 4KUDB 3AV1C 5GT0D 4J8WD 4Z5TD 3MVDC 3X1SD 4DRAA 1P3BA 3B6FB 2BYKB 3R45A 4JJNB 1KX3A 2PYOB 5DNNB 1P3BC 5B24C 3LZ0A 5DNMD 3AZJC 4NE5A 3WA9D 3AZMA 3B6GC 3VH6T 3MGPB 2FJ7A 1P3GA 1S32C 3WTPC 4J8VA 3X1TA 2FJ7C 1TAFB 1P3MD 4XZQC 1P3AA 1BH8B 5FUGA 1P3OD 1EQZB 3REID 1B67A 1KX5A 5B31C 4WU8A 1P3LD 4Z66D 3MNNC 5CPJB 5B32G 1F66D 5GSUD 5B1MD 1KX5C 5CPKC 4E45A 3REJA 3UTAB 4H9OB 3AN2D 5GT3C 1ID3C 5BO0A 5B0ZB 5B40C 3O62B 3REHB 2CV5D 2RVQD 5AV6A 3MGSD 3AZEB 5B24D 3REJD 3AZJD 3AYWA 5JRGA 3UT9A 3LELC 3KXBA 4YS3D 1M18C 2BYMA 1ZLAD 4LD9B 3W97B 3KUYA 3AZIB 3KXBC 3W99D 1P3FD 5F99C 3B0BA 1P34D 3AZHC 1HQ3A 4XUJA 3X1UB 3AZLA 4ZUXA 4XZQD 4YM6A 5B2IB 5B33A 2NZDD 1HQ3C 5JA4B 5GT0A 4J8WA 4Z5TA 1P3PC 3X1SA 3KWQB 5B31D 4YM6C 1KX4D 3C1BD 3VH5A 3B0DC 4UUZA 3MNND 3AFAC 3AV1B 1U35B 2AROB 3AV2A 4CSRB 3MVDB 4J8WC 4H9PB 4Z2MH 3X1SC 2F8NH 3WA9A 1P3KD 4WU9D 1P3BB 1JFIA 3R45B 3A6ND 5DNMC 1ID3D 1AOID 1KX3B 3X1VC 3VH6W 3AZKC 4H9QA 4H9SA 4CAYA 3LZ0B 4WNNB 3C1CD 3AZMB 4H9SC 1P3MA 1P3OA 5B0YD 4QLCC 2FJ7B 3REIA 4KHAA 1P3GB 1HTAA 1P3MC 1M19D 1P3OC 1M18D 4J8VB 2L5AA 3X1TB 1A7WA 1F66A 3REIC 5B1MA 4KUDD 1N1JA 4NFTA 1P3AB 1P3LC 4Z66C 4NE3A 3TU4A 5C3IC 1F66C 5GSUC 1KX5B 3AZHD 4WU8B 3V9RB 3AN2A 5B1LD 3LZ1D 3AZFD 3AN2C 5BNXA 3REJB 3RELD 2CV5A 3AZGC 5B40B 3AFAD 4ZBJC 3MGSA 4HGAC 5BO0B 2CV5C 2RVQC 5B24A 5B2JD 3AZJA 3MGSC 2NQBD 4AWLB 4J8UD 1ZLAA 4WNNA 3B6GA 2IO5C 5AV6B 3X1VD 2YFVA 3AZKD 4YS3C 1ZLAC 1P3FA 3W99A 1P34A 4G91B 3AYWB 1S32A 1P3IC 3WTPA 1EQZD 4X23C 5JRGB 3UT9B 2F8ND 3KXBB 2BYMB 3W99C 4XZQA 1P3FC 5AV5D 3W98D 5CPIC 1P34C 3KUYB 4KGCD 4QLCD 2HUEB 5E5AD 5B31A 1KX4A 3C1BA 3UTAD 3MNNA 1HQ3B 2NZDC 4XUJB 3AZLB 2HIOD 4ZUXB 4YM6B 1KX4C 5BT1D 3C1BC 3UTBC 5CPKA 3V9RA 5B0ZD 5B33B 2LY8A 5GT0B 4J8WB 4Z5TB 3REHD 3X1SB 5CP6C 4UUZB 5GT3A 3A6NA 1ID3A 1M1AC 3AV2B 4G92C 5B40A 1P3KC 4WU9C 3WKJC 3A6NC 1AOIC 3AZGD 3C1CA 3WA9B 5GXQC 4R8PD 1JFIB 3MGRD 1BFMA 1H3OA 3C1CC 5B0YA 5AVBC 4H9QB 5AVCD 4CAYB 3LELA 1M18A 5B0YC 1P3MB 1P3OB 1M19C 5F99A 3REIB 4KHAB 1P3ID 4X23D 3AZHA 1P3LB 4KUDC 3WTPE 3VH5T 5C3IB 3LJAD 5B1LA 3B0CT 2AROD 5CPID 1F66B 5B1MB 1N1JB 3AZND 3LZ1A 1B6WA 4H9NA 3AZFA 1P3PA 3B6FC 3TU4B 2YFWA 5B1LC 4J8XD 5B32D 3AFAA 4DRBA 3LZ1C 3AN2B 3AZFC 1Q9CA 3RELC 3UTBD 4ZBJB 5B2JA 5AY8D 2NQBA 5BNXB 5CP6D 2CV5B 5DNMA 5B2JC 5AV9D 3AZMD 1M1AD 3MGSB 3X1VA 2NQBC 4WZSB 3AZKA 4J8UC 3WKJD 5B24B 2IO5B 3AZJB 2F8NA 3MGQD 5GXQD 3W96D 1ZLAB 3B6GB 5AV5A 3X1TD 3WAAD 3W98A 1EQZC 2YFVB 4KGCA 5AVBD 5AV8D 4QLCA 1WWSA 5E5AA 1P3FB 3W99B 3W98C 5AV5C 1P34B 4KGCC 1S32B 3WTPB 4WU8D 2HIOA 5CHLB 4XZQB 5E5AC 3REKD 1P3LA 1TZYD 3UTAC 5G49A 4Z66A 3NQUA 2HIOC 5GSUA 1KX4B 5B31B 3C1BB 5BT1C 2JSSA 3MNNB
chains in the Genus database with same CATH superfamily
5B0ZC 3O62C 3REHC 5CPKB 2Y2HA 3B6FD 4JJND 3AZGA 2PYOD 5DNND 3AZEC 4R8PA 5GT3B 3A6NB 3MGRA 1ID3B 2F8NK 3NQJA 2Y2QA 4EO5C 5AVCA 4R8PC 3MGRC 5BS7C 3C1CB 3W97C 3AYWD 3UT9D 3AZIC 5AVCC 3MGPD 1H3OB 5B0YB 4YS3A 1P3IA 4X23A 5B2IC 3LELB 5KDMA 1M18B 3EPHA 3KFUG 3LJAA 5CPIA 3AZLD 3VH5W 3EPLA 3AZNA 5F99B 5B33D 3LJAC 5CPJD 1U35C 4J8XA 2AROC 5B32A 3AZHB 2NZDA 3AZNC 5BNVB 5B1LB 3UTBA 4J8XC 3AV2D 5B32C 5AY8A 3LZ1B 4H9NB 3AZFB 1P3PB 5CP6A 2YFWB 3RELB 1F1EA 3B0DB 3AFAB 1KX3C 5AY8C 5AV9A 3O62D 1M1AA 1P3KA 1ULYA 3LZ0C 4WU9A 3WKJA 4H9RB 5B2JB 1AOIA 5AV9C 3AZMC 2NQBB 3MGQA 4J8UB 5GXQA 3AZED 3W96A 1R4VA 1BH9A 5DNMB 3WAAA 3X1VB 1P3GC 5AVBA 3MGQC 3AZKB 5AV8A 2FFFB 3W96C 2J8PA 3VH6A 4LD9D 3WAAC 4J8VC 3X1TC 3W97D 2F8NB 3AZID 5AV8C 1P3AC 3REKA 3W98B 5AV5B 4KGCB 1TZYA 1M19A 4QLCB 4WU8C 3X1UD 5B31G 5E5AB 3REKC 4KUDA 3TU4D 5B2ID 1TZYC 2HIOB 3KWQD 1PZRA 5BNVA 3REJC 5G49B 4Z66B 3AV1D 3B6FA 2BYKA 3NQUB 4JJNA 1U35D 5GSUB 3MVDD 2PYOA 5DNNA 4JJNC 3RELA 3EPJA 2PYOC 5DNNC 4AWLC 1P3BD 3AZGB 4H9RA 5AV6C 1KX3D 4EO5B 4R8PB 3MGPA 3MGRB 4HGAB 3LZ0D 3NQJB 4J8UA 3B6GD 4G91C 3AYWC 2CWEA 5JRGC 5AVCB 4E44A 3UT9C 3MGPC 1TAFA 1BH8A 1S32D 3KUYC 3WTPD 1EQZA 2HUEC 2FJ7D 1P3GD 4YS3B 3F6TA 3KSYA 4XUJC 4J8VD 3AZLC 5CPJA 1P3IB 4X23B 4ZUXC 1P3AD 5KDMB 3LJAB 5B33C 5CPIB 3UTAA 4H9OA 5GT0C 5CPJC 4Z5TC 1KX5D 3AZNB 5CPKD 4J8XB 5B32B 3AV2C 1WWIA 5B0ZA 2NZDB 3O62A 3REHA 5GT3D 2Y2KA 3UTBB 5B40D 3WA9C 5AY8B 3AL0C 5CP6B 1KU5A 3AZEA 5AV9B 1M1AB 3P5JB 4G92B 1P3KB 4WU9B 3WKJB 3IP4C 5BS7A 4Z2MG 1AOIB 4LD9A 2F8NG 3W97A 5AV6D 3MGQB 3AZIA 5GXQB 4DQYB 3W96B 3LELD 1BH9B 4LD9C 3WAAB 4NE6A 4M6BA 5AVBB 5AV8B 5JRGD 5FUGB 3EG5B 3X1UA 3KXBD 2Y2GA 5F99D 5B2IA 3KUYD 5B1MC 5JA4A 3X1UC 3REKB 4WV4B 3KWQA 3TU4C 1TZYB 1M19B 3AV1A 1U35A 1HQ3D 4XUJD 2AROA 4CSRA 3MVDA 1P3PD 4H9PA 3B0CW 4ZUXD 4YM6D 3KWQC 4KUDB 3AV1C 2Y2LA 5GT0D 4J8WD 4Z5TD 3MVDC 2ZY2A 3X1SD 4DRAA 1P3BA 3B6FB 2BYKB 3R45A 4JJNB 1KX3A 2PYOB 5DNNB 1P3BC 5B24C 3LZ0A 5DNMD 3AZJC 4NE5A 3WA9D 4UPKA 3AZMA 3B6GC 3VH6T 3MGPB 2FJ7A 1P3GA 1S32C 3WTPC 4J8VA 3X1TA 2FJ7C 1TAFB 1P3MD 4XZQC 4WJ3C 1P3AA 1BH8B 5FUGA 1P3OD 1EQZB 3REID 1B67A 1KX5A 5B31C 4WU8A 1P3LD 4Z66D 3MNNC 5CPJB 5B32G 1F66D 5GSUD 5B1MD 1KX5C 2ZY3A 5CPKC 4E45A 3REJA 3UTAB 4H9OB 3AN2D 5GT3C 1ID3C 5BO0A 5B0ZB 5B40C 3O62B 3REHB 2CV5D 2RVQD 2Y2OA 5AV6A 3MGSD 2G5HC 3AZEB 2Y2NA 5B24D 3REJD 3AZJD 3AYWA 5JRGA 3UT9A 3LELC 3KXBA 4YS3D 1M18C 2BYMA 1ZLAD 4LD9B 3W97B 3KUYA 2Y2PA 3AZIB 3KXBC 3W99D 1P3FD 5F99C 3B0BA 1T3UA 3H0MC 1P34D 3AZHC 1HQ3A 4XUJA 3X1UB 3AZLA 4ZUXA 4XZQD 4YM6A 5B2IB 5B33A 2NZDD 1HQ3C 5JA4B 5GT0A 4J8WA 4Z5TA 1P3PC 3X1SA 3KWQB 3A1IA 5B31D 4YM6C 1KX4D 3C1BD 3VH5A 3B0DC 4UUZA 3MNND 3AFAC 3AV1B 1U35B 2AROB 3AV2A 4CSRB 3MVDB 4J8WC 4H9PB 4Z2MH 3X1SC 2F8NH 2ZM5A 3WA9A 1P3KD 4WU9D 1P3BB 2XD5A 1JFIA 3R45B 3A6ND 5DNMC 1ID3D 1AOID 1KX3B 3X1VC 3VH6W 3AZKC 4H9QA 4H9SA 4CAYA 3LZ0B 4WNNB 3C1CD 3AZMB 4H9SC 1P3MA 3EPKA 1P3OA 5B0YD 4QLCC 2FJ7B 3REIA 4KHAA 1P3GB 1HTAA 1P3MC 1M19D 1P3OC 1M18D 4J8VB 2L5AA 3X1TB 1A7WA 1F66A 3REIC 5B1MA 4KUDD 1N1JA 4NFTA 1P3AB 1P3LC 4Z66C 4NE3A 3TU4A 5C3IC 1F66C 5GSUC 1KX5B 3AZHD 4WU8B 3V9RB 3AN2A 5B1LD 2XD1A 3FDDA 3LZ1D 3AZFD 3AN2C 5BNXA 3REJB 3RELD 2CV5A 3AZGC 5B40B 3AFAD 4ZBJC 3MGSA 4HGAC 5BO0B 2CV5C 2RVQC 5B24A 5B2JD 3H0RC 3AZJA 3MGSC 2NQBD 4AWLB 4J8UD 2RIQA 1ZLAA 4WNNA 3B6GA 2IO5C 5AV6B 3X1VD 2ZY4A 2YFVA 2UWXA 2Y2JA 3AZKD 2G5IC 4YS3C 1ZLAC 1P3FA 3W99A 1P34A 4G91B 3AYWB 2BG1A 1S32A 3WTPA 1P3IC 4X23C 5JRGB 3UT9B 1EQZD 2F8ND 3KXBB 2BYMB 3W99C 4XZQA 1P3FC 5AV5D 2F2AC 5CPIC 1P34C 3KUYB 3W98D 4KGCD 2Y2MA 4QLCD 2HUEB 5E5AD 5B31A 1KX4A 3C1BA 2JCHA 3UTAD 3MNNA 1HQ3B 2NZDC 4XUJB 3AZLB 2HIOD 4ZUXB 4YM6B 1KX4C 5BT1D 3C1BC 3UTBC 5CPKA 2DF4C 3V9RA 5B0ZD 5B33B 2LY8A 5GT0B 1W2EA 4J8WB 4Z5TB 3REHD 2Y2IA 3X1SB 5CP6C 4UUZB 5GT3A 3A6NA 1ID3A 1M1AC 3AV2B 4G92C 5B40A 1P3KC 4WU9C 3WKJC 3A6NC 1AOIC 3AZGD 3C1CA 3WA9B 5GXQC 4R8PD 1JFIB 3MGRD 1BFMA 1H3OA 3C1CC 5B0YA 5AVBC 4H9QB 5AVCD 4CAYB 3LELA 1M18A 5B0YC 1P3MB 1P3OB 1M19C 5F99A 3REIB 4KHAB 1P3ID 4X23D 3AZHA 1P3LB 4KUDC 3WTPE 3VH5T 5C3IB 3LJAD 5B1LA 3B0CT 2AROD 5CPID 1F66B 5B1MB 1N1JB 3AZND 3LZ1A 1B6WA 4H9NA 2ZY5A 3AZFA 1P3PA 3B6FC 3TU4B 2YFWA 5B1LC 4J8XD 5B32D 3AFAA 4DRBA 3LZ1C 3AN2B 3AZFC 1Q9CA 3RELC 3UTBD 3A1KA 4ZBJB 5B2JA 5AY8D 2NQBA 5BNXB 5CP6D 2CV5B 2W8SA 5DNMA 5B2JC 5AV9D 1Z2CB 3AZMD 1M1AD 3MGSB 3X1VA 2NQBC 4WZSB 3AZKA 4J8UC 3WKJD 5B24B 2IO5B 2VQRA 3AZJB 2JE5A 2F8NA 3MGQD 5GXQD 3W96D 1ZLAB 3B6GB 5AV5A 3X1TD 3WAAD 3W98A 1EQZC 2YFVB 4KGCA 5AVBD 2DQNC 5AV8D 4QLCA 1WWSA 5E5AA 1P3FB 3W99B 3W98C 5AV5C 1P34B 4KGCC 1S32B 3WTPB 4WU8D 2HIOA 5CHLB 4XZQB 5E5AC 3REKD 3H0LC 1P3LA 1TZYD 3UTAC 5G49A 4Z66A 3NQUA 2HIOC 5GSUA 1KX4B 5B31B 3C1BB 5BT1C 2JSSA 3MNNB
chains in the Genus database with same CATH topology
5B0ZC 3O62C 3REHC 5CPKB 2Y2HA 3B6FD 4JJND 3AZGA 2PYOD 5DNND 3AZEC 4R8PA 5GT3B 3A6NB 3MGRA 1ID3B 2F8NK 3NQJA 2Y2QA 4EO5C 5AVCA 4R8PC 3MGRC 5BS7C 3C1CB 3W97C 3AYWD 3UT9D 3AZIC 5AVCC 3MGPD 1H3OB 5B0YB 4YS3A 1P3IA 4X23A 5B2IC 3LELB 5KDMA 1M18B 3EPHA 3KFUG 3LJAA 5CPIA 3AZLD 3VH5W 3EPLA 3AZNA 5F99B 5B33D 3LJAC 5CPJD 1U35C 4J8XA 2AROC 5B32A 3AZHB 2NZDA 3AZNC 5BNVB 5B1LB 3UTBA 4J8XC 3AV2D 5B32C 5AY8A 3LZ1B 4H9NB 3AZFB 1P3PB 5CP6A 2YFWB 3RELB 1F1EA 3B0DB 3AFAB 1KX3C 5AY8C 5AV9A 3O62D 1M1AA 1P3KA 1ULYA 3LZ0C 4WU9A 3WKJA 4H9RB 5B2JB 1AOIA 5AV9C 3AZMC 2NQBB 3MGQA 4J8UB 5GXQA 3AZED 3W96A 1R4VA 1BH9A 5DNMB 3WAAA 3X1VB 1P3GC 5AVBA 3MGQC 3AZKB 5AV8A 2FFFB 3W96C 2J8PA 3VH6A 4LD9D 3WAAC 4J8VC 3X1TC 3W97D 2F8NB 3AZID 5AV8C 1P3AC 3REKA 3W98B 5AV5B 4KGCB 1TZYA 1M19A 4QLCB 4WU8C 3X1UD 5B31G 5E5AB 3REKC 4KUDA 3TU4D 5B2ID 1TZYC 2HIOB 3KWQD 1PZRA 5BNVA 3REJC 5G49B 4Z66B 3AV1D 3B6FA 2BYKA 3NQUB 4JJNA 1U35D 5GSUB 3MVDD 2PYOA 5DNNA 4JJNC 3RELA 3EPJA 2PYOC 5DNNC 4AWLC 1P3BD 3AZGB 4H9RA 5AV6C 1KX3D 4EO5B 4R8PB 3MGPA 3MGRB 4HGAB 3LZ0D 3NQJB 4J8UA 3B6GD 4G91C 3AYWC 2CWEA 5JRGC 5AVCB 4E44A 3UT9C 3MGPC 1TAFA 1BH8A 1S32D 3KUYC 3WTPD 1EQZA 2HUEC 2FJ7D 1P3GD 4YS3B 3F6TA 3KSYA 4XUJC 4J8VD 3AZLC 5CPJA 1P3IB 4X23B 4ZUXC 1P3AD 5KDMB 3LJAB 5B33C 5CPIB 3UTAA 4H9OA 5GT0C 5CPJC 4Z5TC 1KX5D 3AZNB 5CPKD 4J8XB 5B32B 3AV2C 1WWIA 5B0ZA 2NZDB 3O62A 3REHA 5GT3D 2Y2KA 3UTBB 5B40D 3WA9C 5AY8B 3AL0C 5CP6B 1KU5A 3AZEA 5AV9B 1M1AB 3P5JB 4G92B 1P3KB 4WU9B 3WKJB 3IP4C 5BS7A 4Z2MG 1AOIB 4LD9A 2F8NG 3W97A 5AV6D 3MGQB 3AZIA 5GXQB 4DQYB 3W96B 3LELD 1BH9B 4LD9C 3WAAB 4NE6A 4M6BA 5AVBB 5AV8B 5JRGD 5FUGB 3EG5B 3X1UA 3KXBD 2Y2GA 5F99D 5B2IA 3KUYD 5B1MC 5JA4A 3X1UC 3REKB 4WV4B 3KWQA 3TU4C 1TZYB 1M19B 3AV1A 1U35A 1HQ3D 4XUJD 2AROA 4CSRA 3MVDA 1P3PD 4H9PA 3B0CW 4ZUXD 4YM6D 3KWQC 4KUDB 3AV1C 2Y2LA 5GT0D 4J8WD 4Z5TD 3MVDC 2ZY2A 3X1SD 4DRAA 1P3BA 3B6FB 2BYKB 3R45A 4JJNB 1KX3A 2PYOB 5DNNB 1P3BC 5B24C 3LZ0A 5DNMD 3AZJC 4NE5A 3WA9D 4UPKA 3AZMA 3B6GC 3VH6T 3MGPB 2FJ7A 1P3GA 1S32C 3WTPC 4J8VA 3X1TA 2FJ7C 1TAFB 1P3MD 4XZQC 4WJ3C 1P3AA 1BH8B 5FUGA 1P3OD 1EQZB 3REID 1B67A 1KX5A 5B31C 4WU8A 1P3LD 4Z66D 3MNNC 5CPJB 5B32G 1F66D 5GSUD 5B1MD 1KX5C 2ZY3A 5CPKC 4E45A 3REJA 3UTAB 4H9OB 3AN2D 5GT3C 1ID3C 5BO0A 5B0ZB 5B40C 3O62B 3REHB 2CV5D 2RVQD 2Y2OA 5AV6A 3MGSD 2G5HC 3AZEB 2Y2NA 5B24D 3REJD 3AZJD 3AYWA 5JRGA 3UT9A 3LELC 3KXBA 4YS3D 1M18C 2BYMA 1ZLAD 4LD9B 3W97B 3KUYA 2Y2PA 3AZIB 3KXBC 3W99D 1P3FD 5F99C 3B0BA 1T3UA 3H0MC 1P34D 3AZHC 1HQ3A 4XUJA 3X1UB 3AZLA 4ZUXA 4XZQD 4YM6A 5B2IB 5B33A 2NZDD 1HQ3C 5JA4B 5GT0A 4J8WA 4Z5TA 1P3PC 3X1SA 3KWQB 3A1IA 5B31D 4YM6C 1KX4D 3C1BD 3VH5A 3B0DC 4UUZA 3MNND 3AFAC 3AV1B 1U35B 2AROB 3AV2A 4CSRB 3MVDB 4J8WC 4H9PB 4Z2MH 3X1SC 2F8NH 2ZM5A 3WA9A 1P3KD 4WU9D 1P3BB 2XD5A 1JFIA 3R45B 3A6ND 5DNMC 1ID3D 1AOID 1KX3B 3X1VC 3VH6W 3AZKC 4H9QA 4H9SA 4CAYA 3LZ0B 4WNNB 3C1CD 3AZMB 4H9SC 1P3MA 3EPKA 1P3OA 5B0YD 4QLCC 2FJ7B 3REIA 4KHAA 1P3GB 1HTAA 1P3MC 1M19D 1P3OC 1M18D 4J8VB 2L5AA 3X1TB 1A7WA 1F66A 3REIC 5B1MA 4KUDD 1N1JA 4NFTA 1P3AB 1P3LC 4Z66C 4NE3A 3TU4A 5C3IC 1F66C 5GSUC 1KX5B 3AZHD 4WU8B 3V9RB 3AN2A 5B1LD 2XD1A 3FDDA 3LZ1D 3AZFD 3AN2C 5BNXA 3REJB 3RELD 2CV5A 3AZGC 5B40B 3AFAD 4ZBJC 3MGSA 4HGAC 5BO0B 2CV5C 2RVQC 5B24A 5B2JD 3H0RC 3AZJA 3MGSC 2NQBD 4AWLB 4J8UD 2RIQA 1ZLAA 4WNNA 3B6GA 2IO5C 5AV6B 3X1VD 2ZY4A 2YFVA 2UWXA 2Y2JA 3AZKD 2G5IC 4YS3C 1ZLAC 1P3FA 3W99A 1P34A 4G91B 3AYWB 2BG1A 1S32A 3WTPA 1P3IC 4X23C 5JRGB 3UT9B 1EQZD 2F8ND 3KXBB 2BYMB 3W99C 4XZQA 1P3FC 5AV5D 2F2AC 5CPIC 1P34C 3KUYB 3W98D 4KGCD 2Y2MA 4QLCD 2HUEB 5E5AD 5B31A 1KX4A 3C1BA 2JCHA 3UTAD 3MNNA 1HQ3B 2NZDC 4XUJB 3AZLB 2HIOD 4ZUXB 4YM6B 1KX4C 5BT1D 3C1BC 3UTBC 5CPKA 2DF4C 3V9RA 5B0ZD 5B33B 2LY8A 5GT0B 1W2EA 4J8WB 4Z5TB 3REHD 2Y2IA 3X1SB 5CP6C 4UUZB 5GT3A 3A6NA 1ID3A 1M1AC 3AV2B 4G92C 5B40A 1P3KC 4WU9C 3WKJC 3A6NC 1AOIC 3AZGD 3C1CA 3WA9B 5GXQC 4R8PD 1JFIB 3MGRD 1BFMA 1H3OA 3C1CC 5B0YA 5AVBC 4H9QB 5AVCD 4CAYB 3LELA 1M18A 5B0YC 1P3MB 1P3OB 1M19C 5F99A 3REIB 4KHAB 1P3ID 4X23D 3AZHA 1P3LB 4KUDC 3WTPE 3VH5T 5C3IB 3LJAD 5B1LA 3B0CT 2AROD 5CPID 1F66B 5B1MB 1N1JB 3AZND 3LZ1A 1B6WA 4H9NA 2ZY5A 3AZFA 1P3PA 3B6FC 3TU4B 2YFWA 5B1LC 4J8XD 5B32D 3AFAA 4DRBA 3LZ1C 3AN2B 3AZFC 1Q9CA 3RELC 3UTBD 3A1KA 4ZBJB 5B2JA 5AY8D 2NQBA 5BNXB 5CP6D 2CV5B 2W8SA 5DNMA 5B2JC 5AV9D 1Z2CB 3AZMD 1M1AD 3MGSB 3X1VA 2NQBC 4WZSB 3AZKA 4J8UC 3WKJD 5B24B 2IO5B 2VQRA 3AZJB 2JE5A 2F8NA 3MGQD 5GXQD 3W96D 1ZLAB 3B6GB 5AV5A 3X1TD 3WAAD 3W98A 1EQZC 2YFVB 4KGCA 5AVBD 2DQNC 5AV8D 4QLCA 1WWSA 5E5AA 1P3FB 3W99B 3W98C 5AV5C 1P34B 4KGCC 1S32B 3WTPB 4WU8D 2HIOA 5CHLB 4XZQB 5E5AC 3REKD 3H0LC 1P3LA 1TZYD 3UTAC 5G49A 4Z66A 3NQUA 2HIOC 5GSUA 1KX4B 5B31B 3C1BB 5BT1C 2JSSA 3MNNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0Z C;  3O62 C;  3REH C;  5CPK B;  3B6F D;  4JJN D;  3AZG A;  2PYO D;  5DNN D;  3AZE C;  4R8P A;  5GT3 B;  3A6N B;  3MGR A;  1ID3 B;  2F8N K;  3NQJ A;  4EO5 C;  5AVC A;  4R8P C;  3MGR C;  5BS7 C;  3C1C B;  3W97 C;  3AYW D;  3UT9 D;  3AZI C;  5AVC C;  3MGP D;  1H3O B;  5B0Y B;  4YS3 A;  1P3I A;  4X23 A;  5B2I C;  3LEL B;  5KDM A;  1M18 B;  3LJA A;  5CPI A;  3AZL D;  3VH5 W;  3AZN A;  5F99 B;  5B33 D;  3LJA C;  5CPJ D;  1U35 C;  4J8X A;  2ARO C;  5B32 A;  3AZH B;  2NZD A;  3AZN C;  5BNV B;  5B1L B;  3UTB A;  4J8X C;  3AV2 D;  5B32 C;  5AY8 A;  3LZ1 B;  4H9N B;  3AZF B;  1P3P B;  5CP6 A;  2YFW B;  3REL B;  1F1E A;  3B0D B;  3AFA B;  1KX3 C;  5AY8 C;  5AV9 A;  3O62 D;  1M1A A;  1P3K A;  1ULY A;  3LZ0 C;  4WU9 A;  3WKJ A;  4H9R B;  5B2J B;  1AOI A;  5AV9 C;  3AZM C;  2NQB B;  3MGQ A;  4J8U B;  5GXQ A;  3AZE D;  3W96 A;  1R4V A;  1BH9 A;  5DNM B;  3WAA A;  3X1V B;  1P3G C;  5AVB A;  3MGQ C;  3AZK B;  5AV8 A;  3W96 C;  4LD9 D;  3VH6 A;  3WAA C;  4J8V C;  3X1T C;  3W97 D;  2F8N B;  3AZI D;  5AV8 C;  1P3A C;  3REK A;  3W98 B;  5AV5 B;  4KGC B;  1TZY A;  1M19 A;  4QLC B;  4WU8 C;  3X1U D;  5B31 G;  5E5A B;  3REK C;  4KUD A;  3TU4 D;  5B2I D;  1TZY C;  2HIO B;  3KWQ D;  3REJ C;  5BNV A;  5G49 B;  4Z66 B;  3AV1 D;  3B6F A;  2BYK A;  3NQU B;  4JJN A;  1U35 D;  5GSU B;  3MVD D;  2PYO A;  5DNN A;  4JJN C;  3REL A;  2PYO C;  5DNN C;  4AWL C;  1P3B D;  3AZG B;  4H9R A;  5AV6 C;  1KX3 D;  4EO5 B;  4R8P B;  3MGP A;  3MGR B;  4HGA B;  3LZ0 D;  3NQJ B;  4J8U A;  3B6G D;  4G91 C;  3AYW C;  2CWE A;  5JRG C;  5AVC B;  4E44 A;  3UT9 C;  3MGP C;  1TAF A;  1BH8 A;  1S32 D;  3KUY C;  3WTP D;  1EQZ A;  2HUE C;  2FJ7 D;  1P3G D;  4YS3 B;  3KSY A;  4J8V D;  4XUJ C;  5CPJ A;  3AZL C;  1P3I B;  4X23 B;  4ZUX C;  1P3A D;  5KDM B;  3LJA B;  5B33 C;  5CPI B;  3UTA A;  4H9O A;  5GT0 C;  5CPJ C;  4Z5T C;  1KX5 D;  3AZN B;  5CPK D;  4J8X B;  5B32 B;  3AV2 C;  1WWI A;  5B0Z A;  2NZD B;  3O62 A;  3REH A;  5GT3 D;  3UTB B;  5B40 D;  3WA9 C;  5AY8 B;  5CP6 B;  1KU5 A;  3AZE A;  5AV9 B;  1M1A B;  4G92 B;  1P3K B;  4WU9 B;  3WKJ B;  5BS7 A;  4Z2M G;  1AOI B;  4LD9 A;  2F8N G;  3W97 A;  5AV6 D;  3MGQ B;  3AZI A;  5GXQ B;  3W96 B;  3LEL D;  1BH9 B;  4LD9 C;  3WAA B;  4NE6 A;  4M6B A;  5AVB B;  5AV8 B;  5JRG D;  5FUG B;  3X1U A;  3KXB D;  5F99 D;  5B2I A;  3KUY D;  5B1M C;  5JA4 A;  3X1U C;  3REK B;  4WV4 B;  3KWQ A;  3TU4 C;  1TZY B;  1M19 B;  3AV1 A;  1U35 A;  1HQ3 D;  4XUJ D;  2ARO A;  4CSR A;  3MVD A;  1P3P D;  4H9P A;  3B0C W;  4ZUX D;  4YM6 D;  3KWQ C;  4KUD B;  3AV1 C;  5GT0 D;  4J8W D;  4Z5T D;  3MVD C;  3X1S D;  4DRA A;  1P3B A;  3B6F B;  2BYK B;  3R45 A;  4JJN B;  1KX3 A;  2PYO B;  5DNN B;  1P3B C;  5B24 C;  3LZ0 A;  5DNM D;  3AZJ C;  4NE5 A;  3WA9 D;  3AZM A;  3B6G C;  3VH6 T;  3MGP B;  2FJ7 A;  1P3G A;  1S32 C;  3WTP C;  4J8V A;  3X1T A;  2FJ7 C;  1TAF B;  1P3M D;  4XZQ C;  1P3A A;  1BH8 B;  5FUG A;  1P3O D;  1EQZ B;  3REI D;  1B67 A;  1KX5 A;  5B31 C;  4WU8 A;  1P3L D;  4Z66 D;  3MNN C;  5CPJ B;  5B32 G;  1F66 D;  5GSU D;  5B1M D;  1KX5 C;  5CPK C;  4E45 A;  3REJ A;  3UTA B;  4H9O B;  3AN2 D;  5GT3 C;  1ID3 C;  5BO0 A;  5B0Z B;  5B40 C;  3O62 B;  3REH B;  2CV5 D;  2RVQ D;  5AV6 A;  3MGS D;  3AZE B;  5B24 D;  3REJ D;  3AZJ D;  3AYW A;  5JRG A;  3UT9 A;  3LEL C;  3KXB A;  4YS3 D;  1M18 C;  2BYM A;  1ZLA D;  4LD9 B;  3W97 B;  3KUY A;  3AZI B;  3KXB C;  3W99 D;  1P3F D;  5F99 C;  3B0B A;  1P34 D;  3AZH C;  1HQ3 A;  4XUJ A;  3X1U B;  3AZL A;  4ZUX A;  4XZQ D;  4YM6 A;  5B2I B;  5B33 A;  2NZD D;  1HQ3 C;  5JA4 B;  5GT0 A;  4J8W A;  4Z5T A;  1P3P C;  3X1S A;  3KWQ B;  5B31 D;  4YM6 C;  1KX4 D;  3C1B D;  3VH5 A;  3B0D C;  4UUZ A;  3MNN D;  3AFA C;  3AV1 B;  1U35 B;  2ARO B;  3AV2 A;  4CSR B;  3MVD B;  4J8W C;  4H9P B;  4Z2M H;  3X1S C;  2F8N H;  3WA9 A;  1P3K D;  4WU9 D;  1P3B B;  1JFI A;  3R45 B;  3A6N D;  5DNM C;  1ID3 D;  1AOI D;  1KX3 B;  3X1V C;  3VH6 W;  3AZK C;  4H9Q A;  4H9S A;  4CAY A;  3LZ0 B;  4WNN B;  3C1C D;  3AZM B;  4H9S C;  1P3M A;  1P3O A;  5B0Y D;  4QLC C;  2FJ7 B;  3REI A;  4KHA A;  1P3G B;  1HTA A;  1P3M C;  1M19 D;  1P3O C;  1M18 D;  4J8V B;  2L5A A;  3X1T B;  1A7W A;  1F66 A;  3REI C;  5B1M A;  4KUD D;  1N1J A;  4NFT A;  1P3A B;  1P3L C;  4Z66 C;  4NE3 A;  3TU4 A;  5C3I C;  1F66 C;  5GSU C;  1KX5 B;  3AZH D;  4WU8 B;  3V9R B;  3AN2 A;  5B1L D;  3LZ1 D;  3AZF D;  3AN2 C;  5BNX A;  3REJ B;  3REL D;  2CV5 A;  3AZG C;  5B40 B;  3AFA D;  4ZBJ C;  3MGS A;  4HGA C;  5BO0 B;  2CV5 C;  2RVQ C;  5B24 A;  5B2J D;  3AZJ A;  3MGS C;  2NQB D;  4AWL B;  4J8U D;  1ZLA A;  4WNN A;  3B6G A;  2IO5 C;  5AV6 B;  3X1V D;  2YFV A;  3AZK D;  4YS3 C;  1ZLA C;  1P3F A;  3W99 A;  1P34 A;  4G91 B;  3AYW B;  1S32 A;  1P3I C;  3WTP A;  1EQZ D;  4X23 C;  5JRG B;  3UT9 B;  2F8N D;  3KXB B;  2BYM B;  3W99 C;  4XZQ A;  1P3F C;  5AV5 D;  3W98 D;  5CPI C;  1P34 C;  3KUY B;  4KGC D;  4QLC D;  2HUE B;  5E5A D;  5B31 A;  1KX4 A;  3C1B A;  3UTA D;  3MNN A;  1HQ3 B;  2NZD C;  4XUJ B;  3AZL B;  2HIO D;  4ZUX B;  4YM6 B;  1KX4 C;  5BT1 D;  3C1B C;  3UTB C;  5CPK A;  3V9R A;  5B0Z D;  5B33 B;  2LY8 A;  5GT0 B;  4J8W B;  4Z5T B;  3REH D;  3X1S B;  5CP6 C;  4UUZ B;  5GT3 A;  3A6N A;  1ID3 A;  1M1A C;  3AV2 B;  4G92 C;  5B40 A;  1P3K C;  4WU9 C;  3WKJ C;  3A6N C;  1AOI C;  3AZG D;  3C1C A;  3WA9 B;  5GXQ C;  4R8P D;  1JFI B;  3MGR D;  1BFM A;  1H3O A;  3C1C C;  5B0Y A;  5AVB C;  4H9Q B;  5AVC D;  4CAY B;  3LEL A;  1M18 A;  5B0Y C;  1P3M B;  1P3O B;  1M19 C;  5F99 A;  3REI B;  4KHA B;  1P3I D;  4X23 D;  3AZH A;  1P3L B;  4KUD C;  3WTP E;  3VH5 T;  5C3I B;  3LJA D;  5B1L A;  3B0C T;  2ARO D;  5CPI D;  1F66 B;  5B1M B;  1N1J B;  3AZN D;  3LZ1 A;  1B6W A;  4H9N A;  3AZF A;  1P3P A;  3B6F C;  3TU4 B;  2YFW A;  5B1L C;  4J8X D;  5B32 D;  3AFA A;  4DRB A;  3LZ1 C;  3AN2 B;  3AZF C;  1Q9C A;  3REL C;  3UTB D;  4ZBJ B;  5B2J A;  5AY8 D;  2NQB A;  5BNX B;  5CP6 D;  2CV5 B;  5DNM A;  5B2J C;  5AV9 D;  3AZM D;  1M1A D;  3MGS B;  3X1V A;  2NQB C;  4WZS B;  3AZK A;  4J8U C;  3WKJ D;  5B24 B;  2IO5 B;  3AZJ B;  2F8N A;  3MGQ D;  5GXQ D;  3W96 D;  1ZLA B;  3B6G B;  5AV5 A;  3X1T D;  3WAA D;  3W98 A;  1EQZ C;  2YFV B;  4KGC A;  5AVB D;  5AV8 D;  4QLC A;  1WWS A;  5E5A A;  1P3F B;  3W99 B;  3W98 C;  5AV5 C;  1P34 B;  4KGC C;  1S32 B;  3WTP B;  4WU8 D;  2HIO A;  5CHL B;  4XZQ B;  5E5A C;  3REK D;  1P3L A;  1TZY D;  3UTA C;  5G49 A;  4Z66 A;  3NQU A;  2HIO C;  5GSU A;  1KX4 B;  5B31 B;  3C1B B;  5BT1 C;  2JSS A;  3MNN B; 
#chains in the Genus database with same CATH topology
 5B0Z C;  3O62 C;  3REH C;  5CPK B;  2Y2H A;  3B6F D;  4JJN D;  3AZG A;  2PYO D;  5DNN D;  3AZE C;  4R8P A;  5GT3 B;  3A6N B;  3MGR A;  1ID3 B;  2F8N K;  3NQJ A;  2Y2Q A;  4EO5 C;  5AVC A;  4R8P C;  3MGR C;  5BS7 C;  3C1C B;  3W97 C;  3AYW D;  3UT9 D;  3AZI C;  5AVC C;  3MGP D;  1H3O B;  5B0Y B;  4YS3 A;  1P3I A;  4X23 A;  5B2I C;  3LEL B;  5KDM A;  1M18 B;  3EPH A;  3KFU G;  3LJA A;  5CPI A;  3AZL D;  3VH5 W;  3EPL A;  3AZN A;  5F99 B;  5B33 D;  3LJA C;  5CPJ D;  1U35 C;  4J8X A;  2ARO C;  5B32 A;  3AZH B;  2NZD A;  3AZN C;  5BNV B;  5B1L B;  3UTB A;  4J8X C;  3AV2 D;  5B32 C;  5AY8 A;  3LZ1 B;  4H9N B;  3AZF B;  1P3P B;  5CP6 A;  2YFW B;  3REL B;  1F1E A;  3B0D B;  3AFA B;  1KX3 C;  5AY8 C;  5AV9 A;  3O62 D;  1M1A A;  1P3K A;  1ULY A;  3LZ0 C;  4WU9 A;  3WKJ A;  4H9R B;  5B2J B;  1AOI A;  5AV9 C;  3AZM C;  2NQB B;  3MGQ A;  4J8U B;  5GXQ A;  3AZE D;  3W96 A;  1R4V A;  1BH9 A;  5DNM B;  3WAA A;  3X1V B;  1P3G C;  5AVB A;  3MGQ C;  3AZK B;  5AV8 A;  2FFF B;  3W96 C;  2J8P A;  3VH6 A;  4LD9 D;  3WAA C;  4J8V C;  3X1T C;  3W97 D;  2F8N B;  3AZI D;  5AV8 C;  1P3A C;  3REK A;  3W98 B;  5AV5 B;  4KGC B;  1TZY A;  1M19 A;  4QLC B;  4WU8 C;  3X1U D;  5B31 G;  5E5A B;  3REK C;  4KUD A;  3TU4 D;  5B2I D;  1TZY C;  2HIO B;  3KWQ D;  1PZR A;  5BNV A;  3REJ C;  5G49 B;  4Z66 B;  3AV1 D;  3B6F A;  2BYK A;  3NQU B;  4JJN A;  1U35 D;  5GSU B;  3MVD D;  2PYO A;  5DNN A;  4JJN C;  3REL A;  3EPJ A;  2PYO C;  5DNN C;  4AWL C;  1P3B D;  3AZG B;  4H9R A;  5AV6 C;  1KX3 D;  4EO5 B;  4R8P B;  3MGP A;  3MGR B;  4HGA B;  3LZ0 D;  3NQJ B;  4J8U A;  3B6G D;  4G91 C;  3AYW C;  2CWE A;  5JRG C;  5AVC B;  4E44 A;  3UT9 C;  3MGP C;  1TAF A;  1BH8 A;  1S32 D;  3KUY C;  3WTP D;  1EQZ A;  2HUE C;  2FJ7 D;  1P3G D;  4YS3 B;  3F6T A;  3KSY A;  4XUJ C;  4J8V D;  3AZL C;  5CPJ A;  1P3I B;  4X23 B;  4ZUX C;  1P3A D;  5KDM B;  3LJA B;  5B33 C;  5CPI B;  3UTA A;  4H9O A;  5GT0 C;  5CPJ C;  4Z5T C;  1KX5 D;  3AZN B;  5CPK D;  4J8X B;  5B32 B;  3AV2 C;  1WWI A;  5B0Z A;  2NZD B;  3O62 A;  3REH A;  5GT3 D;  2Y2K A;  3UTB B;  5B40 D;  3WA9 C;  5AY8 B;  3AL0 C;  5CP6 B;  1KU5 A;  3AZE A;  5AV9 B;  1M1A B;  3P5J B;  4G92 B;  1P3K B;  4WU9 B;  3WKJ B;  3IP4 C;  5BS7 A;  4Z2M G;  1AOI B;  4LD9 A;  2F8N G;  3W97 A;  5AV6 D;  3MGQ B;  3AZI A;  5GXQ B;  4DQY B;  3W96 B;  3LEL D;  1BH9 B;  4LD9 C;  3WAA B;  4NE6 A;  4M6B A;  5AVB B;  5AV8 B;  5JRG D;  5FUG B;  3EG5 B;  3X1U A;  3KXB D;  2Y2G A;  5F99 D;  5B2I A;  3KUY D;  5B1M C;  5JA4 A;  3X1U C;  3REK B;  4WV4 B;  3KWQ A;  3TU4 C;  1TZY B;  1M19 B;  3AV1 A;  1U35 A;  1HQ3 D;  4XUJ D;  2ARO A;  4CSR A;  3MVD A;  1P3P D;  4H9P A;  3B0C W;  4ZUX D;  4YM6 D;  3KWQ C;  4KUD B;  3AV1 C;  2Y2L A;  5GT0 D;  4J8W D;  4Z5T D;  3MVD C;  2ZY2 A;  3X1S D;  4DRA A;  1P3B A;  3B6F B;  2BYK B;  3R45 A;  4JJN B;  1KX3 A;  2PYO B;  5DNN B;  1P3B C;  5B24 C;  3LZ0 A;  5DNM D;  3AZJ C;  4NE5 A;  3WA9 D;  4UPK A;  3AZM A;  3B6G C;  3VH6 T;  3MGP B;  2FJ7 A;  1P3G A;  1S32 C;  3WTP C;  4J8V A;  3X1T A;  2FJ7 C;  1TAF B;  1P3M D;  4XZQ C;  4WJ3 C;  1P3A A;  1BH8 B;  5FUG A;  1P3O D;  1EQZ B;  3REI D;  1B67 A;  1KX5 A;  5B31 C;  4WU8 A;  1P3L D;  4Z66 D;  3MNN C;  5CPJ B;  5B32 G;  1F66 D;  5GSU D;  5B1M D;  1KX5 C;  2ZY3 A;  5CPK C;  4E45 A;  3REJ A;  3UTA B;  4H9O B;  3AN2 D;  5GT3 C;  1ID3 C;  5BO0 A;  5B0Z B;  5B40 C;  3O62 B;  3REH B;  2CV5 D;  2RVQ D;  2Y2O A;  5AV6 A;  3MGS D;  2G5H C;  3AZE B;  2Y2N A;  5B24 D;  3REJ D;  3AZJ D;  3AYW A;  5JRG A;  3UT9 A;  3LEL C;  3KXB A;  4YS3 D;  1M18 C;  2BYM A;  1ZLA D;  4LD9 B;  3W97 B;  3KUY A;  2Y2P A;  3AZI B;  3KXB C;  3W99 D;  1P3F D;  5F99 C;  3B0B A;  1T3U A;  3H0M C;  1P34 D;  3AZH C;  1HQ3 A;  4XUJ A;  3X1U B;  3AZL A;  4ZUX A;  4XZQ D;  4YM6 A;  5B2I B;  5B33 A;  2NZD D;  1HQ3 C;  5JA4 B;  5GT0 A;  4J8W A;  4Z5T A;  1P3P C;  3X1S A;  3KWQ B;  3A1I A;  5B31 D;  4YM6 C;  1KX4 D;  3C1B D;  3VH5 A;  3B0D C;  4UUZ A;  3MNN D;  3AFA C;  3AV1 B;  1U35 B;  2ARO B;  3AV2 A;  4CSR B;  3MVD B;  4J8W C;  4H9P B;  4Z2M H;  3X1S C;  2F8N H;  2ZM5 A;  3WA9 A;  1P3K D;  4WU9 D;  1P3B B;  2XD5 A;  1JFI A;  3R45 B;  3A6N D;  5DNM C;  1ID3 D;  1AOI D;  1KX3 B;  3X1V C;  3VH6 W;  3AZK C;  4H9Q A;  4H9S A;  4CAY A;  3LZ0 B;  4WNN B;  3C1C D;  3AZM B;  4H9S C;  1P3M A;  3EPK A;  1P3O A;  5B0Y D;  4QLC C;  2FJ7 B;  3REI A;  4KHA A;  1P3G B;  1HTA A;  1P3M C;  1M19 D;  1P3O C;  1M18 D;  4J8V B;  2L5A A;  3X1T B;  1A7W A;  1F66 A;  3REI C;  5B1M A;  4KUD D;  1N1J A;  4NFT A;  1P3A B;  1P3L C;  4Z66 C;  4NE3 A;  3TU4 A;  5C3I C;  1F66 C;  5GSU C;  1KX5 B;  3AZH D;  4WU8 B;  3V9R B;  3AN2 A;  5B1L D;  2XD1 A;  3FDD A;  3LZ1 D;  3AZF D;  3AN2 C;  5BNX A;  3REJ B;  3REL D;  2CV5 A;  3AZG C;  5B40 B;  3AFA D;  4ZBJ C;  3MGS A;  4HGA C;  5BO0 B;  2CV5 C;  2RVQ C;  5B24 A;  5B2J D;  3H0R C;  3AZJ A;  3MGS C;  2NQB D;  4AWL B;  4J8U D;  2RIQ A;  1ZLA A;  4WNN A;  3B6G A;  2IO5 C;  5AV6 B;  3X1V D;  2ZY4 A;  2YFV A;  2UWX A;  2Y2J A;  3AZK D;  2G5I C;  4YS3 C;  1ZLA C;  1P3F A;  3W99 A;  1P34 A;  4G91 B;  3AYW B;  2BG1 A;  1S32 A;  3WTP A;  1P3I C;  4X23 C;  5JRG B;  3UT9 B;  1EQZ D;  2F8N D;  3KXB B;  2BYM B;  3W99 C;  4XZQ A;  1P3F C;  5AV5 D;  2F2A C;  5CPI C;  1P34 C;  3KUY B;  3W98 D;  4KGC D;  2Y2M A;  4QLC D;  2HUE B;  5E5A D;  5B31 A;  1KX4 A;  3C1B A;  2JCH A;  3UTA D;  3MNN A;  1HQ3 B;  2NZD C;  4XUJ B;  3AZL B;  2HIO D;  4ZUX B;  4YM6 B;  1KX4 C;  5BT1 D;  3C1B C;  3UTB C;  5CPK A;  2DF4 C;  3V9R A;  5B0Z D;  5B33 B;  2LY8 A;  5GT0 B;  1W2E A;  4J8W B;  4Z5T B;  3REH D;  2Y2I A;  3X1S B;  5CP6 C;  4UUZ B;  5GT3 A;  3A6N A;  1ID3 A;  1M1A C;  3AV2 B;  4G92 C;  5B40 A;  1P3K C;  4WU9 C;  3WKJ C;  3A6N C;  1AOI C;  3AZG D;  3C1C A;  3WA9 B;  5GXQ C;  4R8P D;  1JFI B;  3MGR D;  1BFM A;  1H3O A;  3C1C C;  5B0Y A;  5AVB C;  4H9Q B;  5AVC D;  4CAY B;  3LEL A;  1M18 A;  5B0Y C;  1P3M B;  1P3O B;  1M19 C;  5F99 A;  3REI B;  4KHA B;  1P3I D;  4X23 D;  3AZH A;  1P3L B;  4KUD C;  3WTP E;  3VH5 T;  5C3I B;  3LJA D;  5B1L A;  3B0C T;  2ARO D;  5CPI D;  1F66 B;  5B1M B;  1N1J B;  3AZN D;  3LZ1 A;  1B6W A;  4H9N A;  2ZY5 A;  3AZF A;  1P3P A;  3B6F C;  3TU4 B;  2YFW A;  5B1L C;  4J8X D;  5B32 D;  3AFA A;  4DRB A;  3LZ1 C;  3AN2 B;  3AZF C;  1Q9C A;  3REL C;  3UTB D;  3A1K A;  4ZBJ B;  5B2J A;  5AY8 D;  2NQB A;  5BNX B;  5CP6 D;  2CV5 B;  2W8S A;  5DNM A;  5B2J C;  5AV9 D;  1Z2C B;  3AZM D;  1M1A D;  3MGS B;  3X1V A;  2NQB C;  4WZS B;  3AZK A;  4J8U C;  3WKJ D;  5B24 B;  2IO5 B;  2VQR A;  3AZJ B;  2JE5 A;  2F8N A;  3MGQ D;  5GXQ D;  3W96 D;  1ZLA B;  3B6G B;  5AV5 A;  3X1T D;  3WAA D;  3W98 A;  1EQZ C;  2YFV B;  4KGC A;  5AVB D;  2DQN C;  5AV8 D;  4QLC A;  1WWS A;  5E5A A;  1P3F B;  3W99 B;  3W98 C;  5AV5 C;  1P34 B;  4KGC C;  1S32 B;  3WTP B;  4WU8 D;  2HIO A;  5CHL B;  4XZQ B;  5E5A C;  3REK D;  3H0L C;  1P3L A;  1TZY D;  3UTA C;  5G49 A;  4Z66 A;  3NQU A;  2HIO C;  5GSU A;  1KX4 B;  5B31 B;  3C1B B;  5BT1 C;  2JSS A;  3MNN B; 
#chains in the Genus database with same CATH homology
 5B0Z C;  3O62 C;  3REH C;  5CPK B;  2Y2H A;  3B6F D;  4JJN D;  3AZG A;  2PYO D;  5DNN D;  3AZE C;  4R8P A;  5GT3 B;  3A6N B;  3MGR A;  1ID3 B;  2F8N K;  3NQJ A;  2Y2Q A;  4EO5 C;  5AVC A;  4R8P C;  3MGR C;  5BS7 C;  3C1C B;  3W97 C;  3AYW D;  3UT9 D;  3AZI C;  5AVC C;  3MGP D;  1H3O B;  5B0Y B;  4YS3 A;  1P3I A;  4X23 A;  5B2I C;  3LEL B;  5KDM A;  1M18 B;  3EPH A;  3KFU G;  3LJA A;  5CPI A;  3AZL D;  3VH5 W;  3EPL A;  3AZN A;  5F99 B;  5B33 D;  3LJA C;  5CPJ D;  1U35 C;  4J8X A;  2ARO C;  5B32 A;  3AZH B;  2NZD A;  3AZN C;  5BNV B;  5B1L B;  3UTB A;  4J8X C;  3AV2 D;  5B32 C;  5AY8 A;  3LZ1 B;  4H9N B;  3AZF B;  1P3P B;  5CP6 A;  2YFW B;  3REL B;  1F1E A;  3B0D B;  3AFA B;  1KX3 C;  5AY8 C;  5AV9 A;  3O62 D;  1M1A A;  1P3K A;  1ULY A;  3LZ0 C;  4WU9 A;  3WKJ A;  4H9R B;  5B2J B;  1AOI A;  5AV9 C;  3AZM C;  2NQB B;  3MGQ A;  4J8U B;  5GXQ A;  3AZE D;  3W96 A;  1R4V A;  1BH9 A;  5DNM B;  3WAA A;  3X1V B;  1P3G C;  5AVB A;  3MGQ C;  3AZK B;  5AV8 A;  2FFF B;  3W96 C;  2J8P A;  3VH6 A;  4LD9 D;  3WAA C;  4J8V C;  3X1T C;  3W97 D;  2F8N B;  3AZI D;  5AV8 C;  1P3A C;  3REK A;  3W98 B;  5AV5 B;  4KGC B;  1TZY A;  1M19 A;  4QLC B;  4WU8 C;  3X1U D;  5B31 G;  5E5A B;  3REK C;  4KUD A;  3TU4 D;  5B2I D;  1TZY C;  2HIO B;  3KWQ D;  1PZR A;  5BNV A;  3REJ C;  5G49 B;  4Z66 B;  3AV1 D;  3B6F A;  2BYK A;  3NQU B;  4JJN A;  1U35 D;  5GSU B;  3MVD D;  2PYO A;  5DNN A;  4JJN C;  3REL A;  3EPJ A;  2PYO C;  5DNN C;  4AWL C;  1P3B D;  3AZG B;  4H9R A;  5AV6 C;  1KX3 D;  4EO5 B;  4R8P B;  3MGP A;  3MGR B;  4HGA B;  3LZ0 D;  3NQJ B;  4J8U A;  3B6G D;  4G91 C;  3AYW C;  2CWE A;  5JRG C;  5AVC B;  4E44 A;  3UT9 C;  3MGP C;  1TAF A;  1BH8 A;  1S32 D;  3KUY C;  3WTP D;  1EQZ A;  2HUE C;  2FJ7 D;  1P3G D;  4YS3 B;  3F6T A;  3KSY A;  4XUJ C;  4J8V D;  3AZL C;  5CPJ A;  1P3I B;  4X23 B;  4ZUX C;  1P3A D;  5KDM B;  3LJA B;  5B33 C;  5CPI B;  3UTA A;  4H9O A;  5GT0 C;  5CPJ C;  4Z5T C;  1KX5 D;  3AZN B;  5CPK D;  4J8X B;  5B32 B;  3AV2 C;  1WWI A;  5B0Z A;  2NZD B;  3O62 A;  3REH A;  5GT3 D;  2Y2K A;  3UTB B;  5B40 D;  3WA9 C;  5AY8 B;  3AL0 C;  5CP6 B;  1KU5 A;  3AZE A;  5AV9 B;  1M1A B;  3P5J B;  4G92 B;  1P3K B;  4WU9 B;  3WKJ B;  3IP4 C;  5BS7 A;  4Z2M G;  1AOI B;  4LD9 A;  2F8N G;  3W97 A;  5AV6 D;  3MGQ B;  3AZI A;  5GXQ B;  4DQY B;  3W96 B;  3LEL D;  1BH9 B;  4LD9 C;  3WAA B;  4NE6 A;  4M6B A;  5AVB B;  5AV8 B;  5JRG D;  5FUG B;  3EG5 B;  3X1U A;  3KXB D;  2Y2G A;  5F99 D;  5B2I A;  3KUY D;  5B1M C;  5JA4 A;  3X1U C;  3REK B;  4WV4 B;  3KWQ A;  3TU4 C;  1TZY B;  1M19 B;  3AV1 A;  1U35 A;  1HQ3 D;  4XUJ D;  2ARO A;  4CSR A;  3MVD A;  1P3P D;  4H9P A;  3B0C W;  4ZUX D;  4YM6 D;  3KWQ C;  4KUD B;  3AV1 C;  2Y2L A;  5GT0 D;  4J8W D;  4Z5T D;  3MVD C;  2ZY2 A;  3X1S D;  4DRA A;  1P3B A;  3B6F B;  2BYK B;  3R45 A;  4JJN B;  1KX3 A;  2PYO B;  5DNN B;  1P3B C;  5B24 C;  3LZ0 A;  5DNM D;  3AZJ C;  4NE5 A;  3WA9 D;  4UPK A;  3AZM A;  3B6G C;  3VH6 T;  3MGP B;  2FJ7 A;  1P3G A;  1S32 C;  3WTP C;  4J8V A;  3X1T A;  2FJ7 C;  1TAF B;  1P3M D;  4XZQ C;  4WJ3 C;  1P3A A;  1BH8 B;  5FUG A;  1P3O D;  1EQZ B;  3REI D;  1B67 A;  1KX5 A;  5B31 C;  4WU8 A;  1P3L D;  4Z66 D;  3MNN C;  5CPJ B;  5B32 G;  1F66 D;  5GSU D;  5B1M D;  1KX5 C;  2ZY3 A;  5CPK C;  4E45 A;  3REJ A;  3UTA B;  4H9O B;  3AN2 D;  5GT3 C;  1ID3 C;  5BO0 A;  5B0Z B;  5B40 C;  3O62 B;  3REH B;  2CV5 D;  2RVQ D;  2Y2O A;  5AV6 A;  3MGS D;  2G5H C;  3AZE B;  2Y2N A;  5B24 D;  3REJ D;  3AZJ D;  3AYW A;  5JRG A;  3UT9 A;  3LEL C;  3KXB A;  4YS3 D;  1M18 C;  2BYM A;  1ZLA D;  4LD9 B;  3W97 B;  3KUY A;  2Y2P A;  3AZI B;  3KXB C;  3W99 D;  1P3F D;  5F99 C;  3B0B A;  1T3U A;  3H0M C;  1P34 D;  3AZH C;  1HQ3 A;  4XUJ A;  3X1U B;  3AZL A;  4ZUX A;  4XZQ D;  4YM6 A;  5B2I B;  5B33 A;  2NZD D;  1HQ3 C;  5JA4 B;  5GT0 A;  4J8W A;  4Z5T A;  1P3P C;  3X1S A;  3KWQ B;  3A1I A;  5B31 D;  4YM6 C;  1KX4 D;  3C1B D;  3VH5 A;  3B0D C;  4UUZ A;  3MNN D;  3AFA C;  3AV1 B;  1U35 B;  2ARO B;  3AV2 A;  4CSR B;  3MVD B;  4J8W C;  4H9P B;  4Z2M H;  3X1S C;  2F8N H;  2ZM5 A;  3WA9 A;  1P3K D;  4WU9 D;  1P3B B;  2XD5 A;  1JFI A;  3R45 B;  3A6N D;  5DNM C;  1ID3 D;  1AOI D;  1KX3 B;  3X1V C;  3VH6 W;  3AZK C;  4H9Q A;  4H9S A;  4CAY A;  3LZ0 B;  4WNN B;  3C1C D;  3AZM B;  4H9S C;  1P3M A;  3EPK A;  1P3O A;  5B0Y D;  4QLC C;  2FJ7 B;  3REI A;  4KHA A;  1P3G B;  1HTA A;  1P3M C;  1M19 D;  1P3O C;  1M18 D;  4J8V B;  2L5A A;  3X1T B;  1A7W A;  1F66 A;  3REI C;  5B1M A;  4KUD D;  1N1J A;  4NFT A;  1P3A B;  1P3L C;  4Z66 C;  4NE3 A;  3TU4 A;  5C3I C;  1F66 C;  5GSU C;  1KX5 B;  3AZH D;  4WU8 B;  3V9R B;  3AN2 A;  5B1L D;  2XD1 A;  3FDD A;  3LZ1 D;  3AZF D;  3AN2 C;  5BNX A;  3REJ B;  3REL D;  2CV5 A;  3AZG C;  5B40 B;  3AFA D;  4ZBJ C;  3MGS A;  4HGA C;  5BO0 B;  2CV5 C;  2RVQ C;  5B24 A;  5B2J D;  3H0R C;  3AZJ A;  3MGS C;  2NQB D;  4AWL B;  4J8U D;  2RIQ A;  1ZLA A;  4WNN A;  3B6G A;  2IO5 C;  5AV6 B;  3X1V D;  2ZY4 A;  2YFV A;  2UWX A;  2Y2J A;  3AZK D;  2G5I C;  4YS3 C;  1ZLA C;  1P3F A;  3W99 A;  1P34 A;  4G91 B;  3AYW B;  2BG1 A;  1S32 A;  3WTP A;  1P3I C;  4X23 C;  5JRG B;  3UT9 B;  1EQZ D;  2F8N D;  3KXB B;  2BYM B;  3W99 C;  4XZQ A;  1P3F C;  5AV5 D;  2F2A C;  5CPI C;  1P34 C;  3KUY B;  3W98 D;  4KGC D;  2Y2M A;  4QLC D;  2HUE B;  5E5A D;  5B31 A;  1KX4 A;  3C1B A;  2JCH A;  3UTA D;  3MNN A;  1HQ3 B;  2NZD C;  4XUJ B;  3AZL B;  2HIO D;  4ZUX B;  4YM6 B;  1KX4 C;  5BT1 D;  3C1B C;  3UTB C;  5CPK A;  2DF4 C;  3V9R A;  5B0Z D;  5B33 B;  2LY8 A;  5GT0 B;  1W2E A;  4J8W B;  4Z5T B;  3REH D;  2Y2I A;  3X1S B;  5CP6 C;  4UUZ B;  5GT3 A;  3A6N A;  1ID3 A;  1M1A C;  3AV2 B;  4G92 C;  5B40 A;  1P3K C;  4WU9 C;  3WKJ C;  3A6N C;  1AOI C;  3AZG D;  3C1C A;  3WA9 B;  5GXQ C;  4R8P D;  1JFI B;  3MGR D;  1BFM A;  1H3O A;  3C1C C;  5B0Y A;  5AVB C;  4H9Q B;  5AVC D;  4CAY B;  3LEL A;  1M18 A;  5B0Y C;  1P3M B;  1P3O B;  1M19 C;  5F99 A;  3REI B;  4KHA B;  1P3I D;  4X23 D;  3AZH A;  1P3L B;  4KUD C;  3WTP E;  3VH5 T;  5C3I B;  3LJA D;  5B1L A;  3B0C T;  2ARO D;  5CPI D;  1F66 B;  5B1M B;  1N1J B;  3AZN D;  3LZ1 A;  1B6W A;  4H9N A;  2ZY5 A;  3AZF A;  1P3P A;  3B6F C;  3TU4 B;  2YFW A;  5B1L C;  4J8X D;  5B32 D;  3AFA A;  4DRB A;  3LZ1 C;  3AN2 B;  3AZF C;  1Q9C A;  3REL C;  3UTB D;  3A1K A;  4ZBJ B;  5B2J A;  5AY8 D;  2NQB A;  5BNX B;  5CP6 D;  2CV5 B;  2W8S A;  5DNM A;  5B2J C;  5AV9 D;  1Z2C B;  3AZM D;  1M1A D;  3MGS B;  3X1V A;  2NQB C;  4WZS B;  3AZK A;  4J8U C;  3WKJ D;  5B24 B;  2IO5 B;  2VQR A;  3AZJ B;  2JE5 A;  2F8N A;  3MGQ D;  5GXQ D;  3W96 D;  1ZLA B;  3B6G B;  5AV5 A;  3X1T D;  3WAA D;  3W98 A;  1EQZ C;  2YFV B;  4KGC A;  5AVB D;  2DQN C;  5AV8 D;  4QLC A;  1WWS A;  5E5A A;  1P3F B;  3W99 B;  3W98 C;  5AV5 C;  1P34 B;  4KGC C;  1S32 B;  3WTP B;  4WU8 D;  2HIO A;  5CHL B;  4XZQ B;  5E5A C;  3REK D;  3H0L C;  1P3L A;  1TZY D;  3UTA C;  5G49 A;  4Z66 A;  3NQU A;  2HIO C;  5GSU A;  1KX4 B;  5B31 B;  3C1B B;  5BT1 C;  2JSS A;  3MNN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...