3REKA

2.6 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b) derivatized with oxaliplatin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
total genus 31
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rekA00
3C1BC 3AZIC 3X1VA 4J8VA 3AZLC 3B0CT 4J8VB 4XZQA 5CP6C 4XZQB 5JA4A 5JA4B 3C1CC 3TU4A 4WU8A 3TU4B 5BT1C 4WU8B 1M1AB 5BS7A 3AN2A 1KX4D 4YM6D 3KUYA 3KUYB 1TZYB 4KHAA 1F66A 4KHAB 1F66B 4JJNA 4JJNB 3REKA 5B0YA 5B0YB 2F8NA 1KX4C 2F8NB 4YM6C 5AV6C 3MNNA 1WWSA 5GT0D 3MNNB 4Z5TD 1M19C 3AZMD 1P3KA 4KUDA 4KUDB 5C3IC 3X1VD 4J8VD 3AZMC 2BYMB 2FJ7D 2AROA 2AROB 5B31G 1P3PA 3W99A 1P3PB 3AN2D 3X1VC 4J8VC 4XZQC 3TU4C 3R45A 3R45B 4WU8C 5BS7C 2LY8A 5GSUA 3KWQD 4JJND 3REKD 5B0YD 5DNNA 3AN2C 5DNNB 3WAAA 3WAAB 3MNND 3LELD 2CV5D 3KUYC 3UT9D 5B1LD 1P3KD 1F66C 4JJNC 3REKC 3MGRA 4EO5B 5B0YC 3MGRB 1P3FA 1EQZA 1EQZB 3MNNC 4H9NA 4H9NB 5BNXB 2PYOA 1P3KC 5B40A 2PYOB 5B40B 2AROD 4KUDC 3AFAA 3W99D 3AFAB 1P3MD 3A6ND 4Z2MG 2AROC 1JFIA 1JFIB 1BFMA 3W99C 5GSUD 1P3PC 3WTPE 5DNND 3WAAD 5B1MA 5B1MB 4J8WA 4J8WB 5F99A 3W97A 1P3GA 3W97B 3MGSB 4DRAA 5DNNC 3WAAC 4Z66D 1P3FD 1EQZD 4E45A 3V9RA 4CAYA 3LJAB 4CAYB 3UTAD 5AVCD 2PYOD 5B40D 1M18A 1M18B 4EO5C 3MGRC 3MVDA 1BH8A 3MVDB 1ULYA 1P3FC 1EQZC 3AZFA 3AZFB 4QLCA 2RVQD 2PYOC 5B40C 4J8UD 3C1BB 4NE6A 5AV9A 5AV9B 3AFAC 2YFVA 2YFVB 2RVQC 4KGCA 5B1MD 4WZSB 1Q9CA 3REHA 5F99D 4G92C 1P3GD 3X1TD 3NQJB 2BYKA 5B1MC 2BYKB 1ID3D 4J8WC 4J8XD 3AYWA 1M18D 5F99C 4YM6B 1P3GC 3W97C 3AZFD 4QLCD 4M6BA 3AZED 4HGAB 1M18C 5GT0A 3MVDC 5GT0B 5AV9D 4Z5TA 3AZFC 4Z5TB 4QLCC 4KGCD 4AWLB 2CWEA 3W96A 3LZ0A 5AV9C 3LZ0B 3REHD 4NFTA 2FJ7A 2FJ7B 4WNNA 4KGCC 3KXBA 3LZ1A 3KXBB 3LZ1B 4ZUXD 4H9OA 5FUGA 3AN2B 3AYWD 3REHC 1AOIA 5G49A 5G49B 3KWQA 3KWQB 1P34A 3REKB 3AYWC 4YS3A 3LELA 2CV5A 3LELB 2CV5B 2IO5B 3UT9A 5B1LA 3UT9B 5B1LB 1P3KB 2YFWA 2YFWB 2JSSA 4HGAC 1P3AD 3X1UA 5GT0C 3W96D 3LZ0D 4Z5TC 3AZHD 4XUJA 4XUJB 4AWLC 2F8NH 3KXBD 3LZ1D 1U35A 3O62D 1P3MA 3W99B 3LZ0C 1P3MB 3A6NA 1AOID 3A6NB 2FJ7C 5BNVA 5BNVB 3KXBC 1BH9A 4CSRA 3LZ1C 5CPKA 5CPKB 1KX5D 5GSUB 1P34D 3B0BA 1AOIC 4YS3D 3KWQC 1P34C 4Z66A 4Z66B 1P3FB 5B24A 1P3LD 5B24B 5AV5A 5AV5B 5AY8A 3X1UD 5AY8B 2IO5C 3LELC 2CV5C 3UTAA 5AVCA 5B32A 5AVCB 5B1LC 5B32B 3UT9C 3UTAB 1P3BD 4ZBJB 4XUJD 3AV2A 3AV2B 1U35D 3X1UC 5GXQD 5B2IA 5B2IB 4J8UA 4J8UB 4XUJC 5AV8A 5CPKD 3B6GA 1U35C 3B6GB 4G92B 1P3MC 5BO0A 5BO0B 3A6NC 5CPKC 5B0ZA 5GSUC 5B0ZB 5F99B 1P3GB 3X1TA 3X1TB 5B24D 5AVBD 3VH6A 5AV5D 1ID3A 5AY8D 3V9RB 1ID3B 5KDMA 5KDMB 5B32D 4J8XA 4J8XB 5B2JD 4Z66C 5E5AA 1BH8B 3AV2D 5B24C 3WA9D 5AV5C 5AY8C 2L5AA 4QLCB 3AZGD 3UTAC 5AVCC 5B32C 3AZEA 3AZEB 1TAFA 1TAFB 5B2ID 4ZBJC 5AV8D 3AV2C 3B6GD 3W98A 3W98B 5B31A 4R8PD 5B31B 4KGCB 5B2IC 2F8NG 4J8UC 5AV8C 5B0ZD 3REHB 3B6GC 3AZNA 5JRGA 3VH5T 4ZUXA 4ZUXB 3B0DB 3REJA 3REJB 4NE5A 5B33D 5B0ZC 3AYWB 4X23D 3X1TC 5E5AD 1KU5A 1ID3C 4J8XC 3REIA 3REIB 5CPJA 5CPJB 4H9QA 4H9QB 5E5AC 3MGQA 3MGQB 1HTAA 3W98D 3VH5A 5B31D 4G91B 3AZEC 1P3AA 1P3AB 3UTBD 3B6FA 3B6FB 3X1SA 3W96B 3AZHA 3AZHB 3W98C 1B6WA 5B31C 3AZND 4WNNB 5JRGD 1S32B 1S32A 2HIOA 3O62A 3O62B 4H9OB 3REJD 5FUGB 3VH5W 1ZLAD 3WKJA 3WKJB 3AV1A 1AOIB 3AZNC 5JRGC 1KX5A 1KX5B 3AZID 4ZUXC 2NZDA 2NZDB 3B0DC 3AZLD 3REJC 3REID 5CP6D 1P34B 5CPJD 1P3OA 1P3OB 4YS3B 3MGQD 3REIC 3X1VB 5CPJC 1P3LA 1P3LB 3B6FD 1M1AA 3X1UB 3KSYA 3X1SD 3MGQC 4H9SA 1P3BA 1P3BB 4G91C 5AV6D 1P3AC 1S32D 3B6FC 2HIOD 1U35B 3W96C 1TZYA 3X1SC 1M19D 3WKJD 3AZHC 3AV1D 5GXQA 4WU9A 5GXQB 4WU9B 1H3OA 1H3OB 1S32C 1BH9B 4CSRB 2NZDD 2HIOC 3O62C 5GT3A 5GT3B 3WKJC 3AV1C 1P3OD 4UUZA 4UUZB 3AZKA 3AZKB 1KX5C 2NZDC 4DRBA 2BYMA 4XZQD 3TU4D 3WTPA 3WTPB 5AVBA 5AVBB 4WU8D 1P3OC 4YS3C 1M1AD 3B0CW 5B2JA 5B2JB 5DNMA 5DNMB 3WA9A 1B67A 3KUYD 1P3LC 3WA9B 1M1AC 3MGPA 1A7WA 1TZYD 3VH6T 3MGPB 3AZGA 3AZGB 1F66D 4H9SC 1P3BC 4WU9D 2HUEB 2F8ND 3RELA 5AV8B 3RELB 1TZYC 5GT3D 4R8PA 4R8PB 5GXQC 4WU9C 4KUDD 4E44A 3AZKD 5BNXA 5CPIA 5CPIB 5GT3C 3WTPD 1F1EA 1P3IA 1P3IB 2NQBA 2NQBB 1P3PD 3AZKC 4WV4B 5B33A 5B33B 5DNMD 4X23A 4X23B 5E5AB 3WTPC 5AVBC 4LD9A 1N1JA 3AZJA 1N1JB 3AZJB 4LD9B 3MGPD 4NE3A 5B2JC 3VH6W 5DNMC 3RELD 3WA9C 1HQ3A 3MGPC 1HQ3B 3AZGC 3MGSA 3MGRD 2HUEC 3UTBA 3UTBB 3RELC 3LJAA 5CPID 4R8PC 3AZNB 5JRGB 1P3ID 2NQBD 3AFAD 1KX3A 1KX3B 2F8NK 1ZLAA 1ZLAB 5CPIC 4H9PA 3C1BA 4H9PB 4LD9D 3AZJD 1WWIA 3AZIA 3AZIB 1P3IC 2NQBC 3AZLA 3AZLB 5CP6A 3C1CA 5CP6B 3C1CB 5B33C 3NQUA 3NQUB 4X23C 4LD9C 3AZJC 4J8WD 1HQ3D 1R4VA 3W97D 3MGSD 3NQJA 3LJAD 3X1SB 1HQ3C 5CHLB 1KX4A 4YM6A 1KX4B 3MGSC 5AV6A 4H9RA 5AV6B 4H9RB 3MVDD 3UTBC 1M19A 2HIOB 3LJAC 1M19B 1KX3D 3AV1B 5B32G 5C3IB 3C1BD 3AZMA 1KX3C 3AZMB 3C1CD 1ZLAC 5BT1D 4Z2MH
chains in the Genus database with same CATH superfamily
3C1BC 3AZIC 3X1VA 4J8VA 3AZLC 3B0CT 4J8VB 4XZQA 5CP6C 4XZQB 5JA4A 5JA4B 3C1CC 3TU4A 4WU8A 3TU4B 5BT1C 4WU8B 1M1AB 5BS7A 2Y2PA 3AN2A 1KX4D 4YM6D 3KUYA 3KUYB 1TZYB 4KHAA 1F66A 4KHAB 1F66B 4JJNA 4JJNB 3REKA 2DQNC 5B0YA 5B0YB 2F8NA 1KX4C 2F8NB 3FDDA 4YM6C 5AV6C 3MNNA 1WWSA 5GT0D 3MNNB 4Z5TD 1M19C 3AZMD 1P3KA 4KUDA 4KUDB 5C3IC 3X1VD 4J8VD 3AZMC 2BYMB 2FJ7D 2AROA 2AROB 5B31G 1P3PA 3W99A 1P3PB 3AN2D 3X1VC 4J8VC 4XZQC 3TU4C 3R45A 3R45B 4WU8C 5BS7C 2LY8A 5GSUA 3KWQD 4JJND 3REKD 5B0YD 5DNNA 3AN2C 5DNNB 3WAAA 3WAAB 3MNND 3LELD 2CV5D 3KUYC 3UT9D 5B1LD 1P3KD 1F66C 4JJNC 3REKC 3MGRA 4EO5B 5B0YC 3MGRB 1P3FA 1EQZA 1EQZB 3MNNC 4H9NA 4H9NB 5BNXB 4DQYB 2PYOA 1P3KC 5B40A 2PYOB 5B40B 2AROD 4KUDC 3AFAA 3W99D 3AFAB 1P3MD 3A6ND 2RIQA 4Z2MG 2AROC 1JFIA 2ZY5A 1JFIB 1BFMA 3W99C 5GSUD 1P3PC 3WTPE 5DNND 3WAAD 5B1MA 5B1MB 2W8SA 4J8WA 4J8WB 5F99A 3W97A 1P3GA 3W97B 3MGSB 4DRAA 5DNNC 3WAAC 4Z66D 1P3FD 1EQZD 4E45A 3V9RA 3H0MC 4CAYA 3LJAB 4CAYB 2JCHA 3UTAD 5AVCD 2PYOD 5B40D 1M18A 1M18B 4EO5C 3MGRC 3MVDA 1BH8A 2Y2JA 1ULYA 3MVDB 1P3FC 1EQZC 3AZFA 3AZFB 4QLCA 2RVQD 2PYOC 5B40C 4J8UD 3C1BB 4NE6A 5AV9A 5AV9B 3AFAC 2YFVA 2YFVB 2RVQC 2BG1A 4KGCA 5B1MD 3KFUG 4WZSB 1Q9CA 1Z2CB 3REHA 5F99D 4G92C 1P3GD 3X1TD 3EPJA 3NQJB 2BYKA 5B1MC 2BYKB 1ID3D 3H0LC 4J8WC 4J8XD 3AYWA 1M18D 5F99C 4YM6B 1P3GC 3W97C 2F2AC 3AZFD 4QLCD 4M6BA 3AZED 4HGAB 1M18C 5GT0A 3MVDC 5GT0B 3EPKA 5AV9D 4Z5TA 3AZFC 4Z5TB 4QLCC 2DF4C 3EPLA 1W2EA 2ZY4A 4KGCD 4AWLB 2CWEA 3W96A 3LZ0A 5AV9C 3LZ0B 3REHD 4NFTA 2FJ7A 2FJ7B 4WNNA 4KGCC 3KXBA 3LZ1A 3KXBB 3LZ1B 4ZUXD 4H9OA 5FUGA 2UWXA 3AN2B 3AYWD 3REHC 1AOIA 5G49A 5G49B 3KWQA 3KWQB 1P34A 3REKB 3AYWC 4YS3A 3LELA 2CV5A 3LELB 2CV5B 2IO5B 2Y2OA 3UT9A 5B1LA 3UT9B 5B1LB 1P3KB 2YFWA 2JSSA 2YFWB 4HGAC 1P3AD 3AL0C 3X1UA 5GT0C 3W96D 3LZ0D 4Z5TC 3AZHD 2ZY3A 4XUJA 3EG5B 4XUJB 4AWLC 2F8NH 3KXBD 3LZ1D 1U35A 3O62D 1P3MA 3W99B 3LZ0C 1P3MB 3A6NA 1AOID 3A6NB 3IP4C 2FJ7C 5BNVA 5BNVB 3KXBC 1BH9A 4CSRA 3LZ1C 5CPKA 5CPKB 1KX5D 5GSUB 1P34D 3B0BA 1AOIC 4YS3D 3F6TA 3KWQC 1P34C 4Z66A 4Z66B 1P3FB 5B24A 1P3LD 5B24B 5AV5A 5AV5B 5AY8A 3X1UD 5AY8B 2IO5C 3LELC 2CV5C 3UTAA 5AVCA 5B32A 5AVCB 5B1LC 5B32B 3UT9C 3UTAB 1P3BD 4ZBJB 4XUJD 3AV2A 3AV2B 1U35D 3X1UC 5GXQD 5B2IA 5B2IB 4J8UA 4J8UB 4XUJC 5AV8A 5CPKD 2Y2HA 3B6GA 1U35C 3B6GB 4G92B 1P3MC 5BO0A 5BO0B 3A6NC 2JE5A 5CPKC 5B0ZA 5GSUC 5B0ZB 5F99B 1P3GB 3X1TA 3X1TB 5B24D 5AVBD 3VH6A 5AV5D 1ID3A 5AY8D 3V9RB 1ID3B 5KDMA 5KDMB 5B32D 4J8XA 4J8XB 5B2JD 4Z66C 5E5AA 1BH8B 3AV2D 5B24C 3WA9D 5AV5C 5AY8C 2L5AA 4QLCB 3AZGD 2Y2KA 3UTAC 5AVCC 5B32C 3AZEA 3AZEB 1TAFA 1TAFB 5B2ID 4ZBJC 5AV8D 3AV2C 3B6GD 3W98A 3W98B 3A1KA 2XD1A 5B31A 5B31B 4R8PD 4KGCB 5B2IC 2F8NG 4J8UC 5AV8C 5B0ZD 3REHB 3B6GC 3AZNA 5JRGA 3VH5T 4ZUXA 4ZUXB 3B0DB 3REJA 3REJB 4NE5A 5B33D 5B0ZC 3AYWB 4X23D 3X1TC 5E5AD 1KU5A 1ID3C 4J8XC 3REIA 3REIB 5CPJA 5CPJB 4H9QA 4H9QB 5E5AC 3MGQA 3P5JB 3MGQB 1HTAA 3W98D 3VH5A 5B31D 4G91B 3AZEC 1P3AA 1P3AB 3UTBD 3B6FA 3B6FB 3X1SA 3W96B 2Y2QA 3AZHA 3AZHB 3W98C 1B6WA 5B31C 3AZND 4WNNB 5JRGD 1S32B 1S32A 2Y2LA 2HIOA 3O62A 3O62B 4H9OB 2J8PA 5FUGB 3VH5W 3REJD 1ZLAD 3WKJA 3WKJB 3AV1A 1AOIB 3AZNC 5JRGC 1KX5A 1KX5B 3AZID 4ZUXC 2NZDA 2NZDB 2Y2GA 3B0DC 3AZLD 3REJC 3REID 5CP6D 1P34B 5CPJD 1P3OA 2Y2MA 4YS3B 1P3OB 3MGQD 2Y2NA 3REIC 3X1VB 5CPJC 1P3LA 1P3LB 3B6FD 1M1AA 3KSYA 3X1SD 3X1UB 3MGQC 4H9SA 1P3BA 1P3BB 4G91C 5AV6D 1P3AC 1S32D 4WJ3C 3B6FC 2HIOD 1U35B 3W96C 1TZYA 3X1SC 1M19D 3WKJD 3AZHC 3AV1D 5GXQA 4WU9A 5GXQB 4WU9B 1H3OA 1H3OB 1S32C 1BH9B 4CSRB 2NZDD 2HIOC 3O62C 5GT3A 5GT3B 3WKJC 3AV1C 2ZY2A 1T3UA 1P3OD 4UUZA 4UUZB 3AZKA 3AZKB 1KX5C 2NZDC 4DRBA 2BYMA 4XZQD 3TU4D 3WTPA 3WTPB 5AVBA 5AVBB 4WU8D 1P3OC 4YS3C 1M1AD 3B0CW 5B2JA 5B2JB 5DNMA 5DNMB 3WA9A 1B67A 3KUYD 1P3LC 3WA9B 1M1AC 3MGPA 1A7WA 1TZYD 3VH6T 3MGPB 3AZGA 3AZGB 1F66D 4H9SC 1P3BC 4WU9D 2HUEB 2F8ND 3RELA 5AV8B 3RELB 1TZYC 5GT3D 4R8PA 4R8PB 5GXQC 4WU9C 4KUDD 4E44A 3AZKD 2XD5A 5BNXA 5CPIA 5CPIB 5GT3C 3WTPD 1F1EA 2VQRA 1P3IA 1P3IB 2NQBA 2NQBB 1P3PD 3AZKC 1PZRA 4WV4B 5B33A 5B33B 5DNMD 4X23A 4X23B 5E5AB 3WTPC 5AVBC 4LD9A 1N1JA 3AZJA 1N1JB 3AZJB 4LD9B 3MGPD 4NE3A 5B2JC 4UPKA 3VH6W 5DNMC 3RELD 3WA9C 1HQ3A 3MGPC 1HQ3B 3AZGC 3MGSA 3MGRD 2HUEC 3UTBA 3UTBB 3RELC 3LJAA 5CPID 3H0RC 4R8PC 3AZNB 5JRGB 1P3ID 2Y2IA 2NQBD 3AFAD 1KX3A 1KX3B 2F8NK 1ZLAA 1ZLAB 3A1IA 5CPIC 2G5HC 4H9PA 3C1BA 4H9PB 4LD9D 3AZJD 1WWIA 3AZIA 3AZIB 1P3IC 2NQBC 3AZLA 3AZLB 5CP6A 3C1CA 5CP6B 3C1CB 5B33C 3NQUA 3NQUB 4X23C 4LD9C 3AZJC 4J8WD 1HQ3D 1R4VA 3W97D 3MGSD 2FFFB 3NQJA 3LJAD 3X1SB 3EPHA 1HQ3C 5CHLB 1KX4A 4YM6A 1KX4B 3MGSC 5AV6A 4H9RA 5AV6B 4H9RB 3MVDD 3UTBC 1M19A 2HIOB 3LJAC 1M19B 1KX3D 3AV1B 2G5IC 5B32G 5C3IB 3C1BD 2ZM5A 3AZMA 1KX3C 3AZMB 3C1CD 1ZLAC 5BT1D 4Z2MH
chains in the Genus database with same CATH topology
3C1BC 3AZIC 3X1VA 4J8VA 3AZLC 3B0CT 4J8VB 4XZQA 5CP6C 4XZQB 5JA4A 5JA4B 3C1CC 3TU4A 4WU8A 3TU4B 5BT1C 4WU8B 1M1AB 5BS7A 2Y2PA 3AN2A 1KX4D 4YM6D 3KUYA 3KUYB 1TZYB 4KHAA 1F66A 4KHAB 1F66B 4JJNA 4JJNB 3REKA 2DQNC 5B0YA 5B0YB 2F8NA 1KX4C 2F8NB 3FDDA 4YM6C 5AV6C 3MNNA 1WWSA 5GT0D 3MNNB 4Z5TD 1M19C 3AZMD 1P3KA 4KUDA 4KUDB 5C3IC 3X1VD 4J8VD 3AZMC 2BYMB 2FJ7D 2AROA 2AROB 5B31G 1P3PA 3W99A 1P3PB 3AN2D 3X1VC 4J8VC 4XZQC 3TU4C 3R45A 3R45B 4WU8C 5BS7C 2LY8A 5GSUA 3KWQD 4JJND 3REKD 5B0YD 5DNNA 3AN2C 5DNNB 3WAAA 3WAAB 3MNND 3LELD 2CV5D 3KUYC 3UT9D 5B1LD 1P3KD 1F66C 4JJNC 3REKC 3MGRA 4EO5B 5B0YC 3MGRB 1P3FA 1EQZA 1EQZB 3MNNC 4H9NA 4H9NB 5BNXB 4DQYB 2PYOA 1P3KC 5B40A 2PYOB 5B40B 2AROD 4KUDC 3AFAA 3W99D 3AFAB 1P3MD 3A6ND 2RIQA 4Z2MG 2AROC 1JFIA 2ZY5A 1JFIB 1BFMA 3W99C 5GSUD 1P3PC 3WTPE 5DNND 3WAAD 5B1MA 5B1MB 2W8SA 4J8WA 4J8WB 5F99A 3W97A 1P3GA 3W97B 3MGSB 4DRAA 5DNNC 3WAAC 4Z66D 1P3FD 1EQZD 4E45A 3V9RA 3H0MC 4CAYA 3LJAB 4CAYB 2JCHA 3UTAD 5AVCD 2PYOD 5B40D 1M18A 1M18B 4EO5C 3MGRC 3MVDA 1BH8A 2Y2JA 1ULYA 3MVDB 1P3FC 1EQZC 3AZFA 3AZFB 4QLCA 2RVQD 2PYOC 5B40C 4J8UD 3C1BB 4NE6A 5AV9A 5AV9B 3AFAC 2YFVA 2YFVB 2RVQC 2BG1A 4KGCA 5B1MD 3KFUG 4WZSB 1Q9CA 1Z2CB 3REHA 5F99D 4G92C 1P3GD 3X1TD 3EPJA 3NQJB 2BYKA 5B1MC 2BYKB 1ID3D 3H0LC 4J8WC 4J8XD 3AYWA 1M18D 5F99C 4YM6B 1P3GC 3W97C 2F2AC 3AZFD 4QLCD 4M6BA 3AZED 4HGAB 1M18C 5GT0A 3MVDC 5GT0B 3EPKA 5AV9D 4Z5TA 3AZFC 4Z5TB 4QLCC 2DF4C 3EPLA 1W2EA 2ZY4A 4KGCD 4AWLB 2CWEA 3W96A 3LZ0A 5AV9C 3LZ0B 3REHD 4NFTA 2FJ7A 2FJ7B 4WNNA 4KGCC 3KXBA 3LZ1A 3KXBB 3LZ1B 4ZUXD 4H9OA 5FUGA 2UWXA 3AN2B 3AYWD 3REHC 1AOIA 5G49A 5G49B 3KWQA 3KWQB 1P34A 3REKB 3AYWC 4YS3A 3LELA 2CV5A 3LELB 2CV5B 2IO5B 2Y2OA 3UT9A 5B1LA 3UT9B 5B1LB 1P3KB 2YFWA 2JSSA 2YFWB 4HGAC 1P3AD 3AL0C 3X1UA 5GT0C 3W96D 3LZ0D 4Z5TC 3AZHD 2ZY3A 4XUJA 3EG5B 4XUJB 4AWLC 2F8NH 3KXBD 3LZ1D 1U35A 3O62D 1P3MA 3W99B 3LZ0C 1P3MB 3A6NA 1AOID 3A6NB 3IP4C 2FJ7C 5BNVA 5BNVB 3KXBC 1BH9A 4CSRA 3LZ1C 5CPKA 5CPKB 1KX5D 5GSUB 1P34D 3B0BA 1AOIC 4YS3D 3F6TA 3KWQC 1P34C 4Z66A 4Z66B 1P3FB 5B24A 1P3LD 5B24B 5AV5A 5AV5B 5AY8A 3X1UD 5AY8B 2IO5C 3LELC 2CV5C 3UTAA 5AVCA 5B32A 5AVCB 5B1LC 5B32B 3UT9C 3UTAB 1P3BD 4ZBJB 4XUJD 3AV2A 3AV2B 1U35D 3X1UC 5GXQD 5B2IA 5B2IB 4J8UA 4J8UB 4XUJC 5AV8A 5CPKD 2Y2HA 3B6GA 1U35C 3B6GB 4G92B 1P3MC 5BO0A 5BO0B 3A6NC 2JE5A 5CPKC 5B0ZA 5GSUC 5B0ZB 5F99B 1P3GB 3X1TA 3X1TB 5B24D 5AVBD 3VH6A 5AV5D 1ID3A 5AY8D 3V9RB 1ID3B 5KDMA 5KDMB 5B32D 4J8XA 4J8XB 5B2JD 4Z66C 5E5AA 1BH8B 3AV2D 5B24C 3WA9D 5AV5C 5AY8C 2L5AA 4QLCB 3AZGD 2Y2KA 3UTAC 5AVCC 5B32C 3AZEA 3AZEB 1TAFA 1TAFB 5B2ID 4ZBJC 5AV8D 3AV2C 3B6GD 3W98A 3W98B 3A1KA 2XD1A 5B31A 5B31B 4R8PD 4KGCB 5B2IC 2F8NG 4J8UC 5AV8C 5B0ZD 3REHB 3B6GC 3AZNA 5JRGA 3VH5T 4ZUXA 4ZUXB 3B0DB 3REJA 3REJB 4NE5A 5B33D 5B0ZC 3AYWB 4X23D 3X1TC 5E5AD 1KU5A 1ID3C 4J8XC 3REIA 3REIB 5CPJA 5CPJB 4H9QA 4H9QB 5E5AC 3MGQA 3P5JB 3MGQB 1HTAA 3W98D 3VH5A 5B31D 4G91B 3AZEC 1P3AA 1P3AB 3UTBD 3B6FA 3B6FB 3X1SA 3W96B 2Y2QA 3AZHA 3AZHB 3W98C 1B6WA 5B31C 3AZND 4WNNB 5JRGD 1S32B 1S32A 2Y2LA 2HIOA 3O62A 3O62B 4H9OB 2J8PA 5FUGB 3VH5W 3REJD 1ZLAD 3WKJA 3WKJB 3AV1A 1AOIB 3AZNC 5JRGC 1KX5A 1KX5B 3AZID 4ZUXC 2NZDA 2NZDB 2Y2GA 3B0DC 3AZLD 3REJC 3REID 5CP6D 1P34B 5CPJD 1P3OA 2Y2MA 4YS3B 1P3OB 3MGQD 2Y2NA 3REIC 3X1VB 5CPJC 1P3LA 1P3LB 3B6FD 1M1AA 3KSYA 3X1SD 3X1UB 3MGQC 4H9SA 1P3BA 1P3BB 4G91C 5AV6D 1P3AC 1S32D 4WJ3C 3B6FC 2HIOD 1U35B 3W96C 1TZYA 3X1SC 1M19D 3WKJD 3AZHC 3AV1D 5GXQA 4WU9A 5GXQB 4WU9B 1H3OA 1H3OB 1S32C 1BH9B 4CSRB 2NZDD 2HIOC 3O62C 5GT3A 5GT3B 3WKJC 3AV1C 2ZY2A 1T3UA 1P3OD 4UUZA 4UUZB 3AZKA 3AZKB 1KX5C 2NZDC 4DRBA 2BYMA 4XZQD 3TU4D 3WTPA 3WTPB 5AVBA 5AVBB 4WU8D 1P3OC 4YS3C 1M1AD 3B0CW 5B2JA 5B2JB 5DNMA 5DNMB 3WA9A 1B67A 3KUYD 1P3LC 3WA9B 1M1AC 3MGPA 1A7WA 1TZYD 3VH6T 3MGPB 3AZGA 3AZGB 1F66D 4H9SC 1P3BC 4WU9D 2HUEB 2F8ND 3RELA 5AV8B 3RELB 1TZYC 5GT3D 4R8PA 4R8PB 5GXQC 4WU9C 4KUDD 4E44A 3AZKD 2XD5A 5BNXA 5CPIA 5CPIB 5GT3C 3WTPD 1F1EA 2VQRA 1P3IA 1P3IB 2NQBA 2NQBB 1P3PD 3AZKC 1PZRA 4WV4B 5B33A 5B33B 5DNMD 4X23A 4X23B 5E5AB 3WTPC 5AVBC 4LD9A 1N1JA 3AZJA 1N1JB 3AZJB 4LD9B 3MGPD 4NE3A 5B2JC 4UPKA 3VH6W 5DNMC 3RELD 3WA9C 1HQ3A 3MGPC 1HQ3B 3AZGC 3MGSA 3MGRD 2HUEC 3UTBA 3UTBB 3RELC 3LJAA 5CPID 3H0RC 4R8PC 3AZNB 5JRGB 1P3ID 2Y2IA 2NQBD 3AFAD 1KX3A 1KX3B 2F8NK 1ZLAA 1ZLAB 3A1IA 5CPIC 2G5HC 4H9PA 3C1BA 4H9PB 4LD9D 3AZJD 1WWIA 3AZIA 3AZIB 1P3IC 2NQBC 3AZLA 3AZLB 5CP6A 3C1CA 5CP6B 3C1CB 5B33C 3NQUA 3NQUB 4X23C 4LD9C 3AZJC 4J8WD 1HQ3D 1R4VA 3W97D 3MGSD 2FFFB 3NQJA 3LJAD 3X1SB 3EPHA 1HQ3C 5CHLB 1KX4A 4YM6A 1KX4B 3MGSC 5AV6A 4H9RA 5AV6B 4H9RB 3MVDD 3UTBC 1M19A 2HIOB 3LJAC 1M19B 1KX3D 3AV1B 2G5IC 5B32G 5C3IB 3C1BD 2ZM5A 3AZMA 1KX3C 3AZMB 3C1CD 1ZLAC 5BT1D 4Z2MH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1B C;  3AZI C;  3X1V A;  4J8V A;  3AZL C;  3B0C T;  4J8V B;  4XZQ A;  5CP6 C;  4XZQ B;  5JA4 A;  5JA4 B;  3C1C C;  3TU4 A;  4WU8 A;  3TU4 B;  5BT1 C;  4WU8 B;  1M1A B;  5BS7 A;  3AN2 A;  1KX4 D;  4YM6 D;  3KUY A;  3KUY B;  1TZY B;  4KHA A;  1F66 A;  4KHA B;  1F66 B;  4JJN A;  4JJN B;  3REK A;  5B0Y A;  5B0Y B;  2F8N A;  1KX4 C;  2F8N B;  4YM6 C;  5AV6 C;  3MNN A;  1WWS A;  5GT0 D;  3MNN B;  4Z5T D;  1M19 C;  3AZM D;  1P3K A;  4KUD A;  4KUD B;  5C3I C;  3X1V D;  4J8V D;  3AZM C;  2BYM B;  2FJ7 D;  2ARO A;  2ARO B;  5B31 G;  1P3P A;  3W99 A;  1P3P B;  3AN2 D;  3X1V C;  4J8V C;  4XZQ C;  3TU4 C;  3R45 A;  3R45 B;  4WU8 C;  5BS7 C;  2LY8 A;  5GSU A;  3KWQ D;  4JJN D;  3REK D;  5B0Y D;  5DNN A;  3AN2 C;  5DNN B;  3WAA A;  3WAA B;  3MNN D;  3LEL D;  2CV5 D;  3KUY C;  3UT9 D;  5B1L D;  1P3K D;  1F66 C;  4JJN C;  3REK C;  3MGR A;  4EO5 B;  5B0Y C;  3MGR B;  1P3F A;  1EQZ A;  1EQZ B;  3MNN C;  4H9N A;  4H9N B;  5BNX B;  2PYO A;  1P3K C;  5B40 A;  2PYO B;  5B40 B;  2ARO D;  4KUD C;  3AFA A;  3W99 D;  3AFA B;  1P3M D;  3A6N D;  4Z2M G;  2ARO C;  1JFI A;  1JFI B;  1BFM A;  3W99 C;  5GSU D;  1P3P C;  3WTP E;  5DNN D;  3WAA D;  5B1M A;  5B1M B;  4J8W A;  4J8W B;  5F99 A;  3W97 A;  1P3G A;  3W97 B;  3MGS B;  4DRA A;  5DNN C;  3WAA C;  4Z66 D;  1P3F D;  1EQZ D;  4E45 A;  3V9R A;  4CAY A;  3LJA B;  4CAY B;  3UTA D;  5AVC D;  2PYO D;  5B40 D;  1M18 A;  1M18 B;  4EO5 C;  3MGR C;  3MVD A;  1BH8 A;  3MVD B;  1ULY A;  1P3F C;  1EQZ C;  3AZF A;  3AZF B;  4QLC A;  2RVQ D;  2PYO C;  5B40 C;  4J8U D;  3C1B B;  4NE6 A;  5AV9 A;  5AV9 B;  3AFA C;  2YFV A;  2YFV B;  2RVQ C;  4KGC A;  5B1M D;  4WZS B;  1Q9C A;  3REH A;  5F99 D;  4G92 C;  1P3G D;  3X1T D;  3NQJ B;  2BYK A;  5B1M C;  2BYK B;  1ID3 D;  4J8W C;  4J8X D;  3AYW A;  1M18 D;  5F99 C;  4YM6 B;  1P3G C;  3W97 C;  3AZF D;  4QLC D;  4M6B A;  3AZE D;  4HGA B;  1M18 C;  5GT0 A;  3MVD C;  5GT0 B;  5AV9 D;  4Z5T A;  3AZF C;  4Z5T B;  4QLC C;  4KGC D;  4AWL B;  2CWE A;  3W96 A;  3LZ0 A;  5AV9 C;  3LZ0 B;  3REH D;  4NFT A;  2FJ7 A;  2FJ7 B;  4WNN A;  4KGC C;  3KXB A;  3LZ1 A;  3KXB B;  3LZ1 B;  4ZUX D;  4H9O A;  5FUG A;  3AN2 B;  3AYW D;  3REH C;  1AOI A;  5G49 A;  5G49 B;  3KWQ A;  3KWQ B;  1P34 A;  3REK B;  3AYW C;  4YS3 A;  3LEL A;  2CV5 A;  3LEL B;  2CV5 B;  2IO5 B;  3UT9 A;  5B1L A;  3UT9 B;  5B1L B;  1P3K B;  2YFW A;  2YFW B;  2JSS A;  4HGA C;  1P3A D;  3X1U A;  5GT0 C;  3W96 D;  3LZ0 D;  4Z5T C;  3AZH D;  4XUJ A;  4XUJ B;  4AWL C;  2F8N H;  3KXB D;  3LZ1 D;  1U35 A;  3O62 D;  1P3M A;  3W99 B;  3LZ0 C;  1P3M B;  3A6N A;  1AOI D;  3A6N B;  2FJ7 C;  5BNV A;  5BNV B;  3KXB C;  1BH9 A;  4CSR A;  3LZ1 C;  5CPK A;  5CPK B;  1KX5 D;  5GSU B;  1P34 D;  3B0B A;  1AOI C;  4YS3 D;  3KWQ C;  1P34 C;  4Z66 A;  4Z66 B;  1P3F B;  5B24 A;  1P3L D;  5B24 B;  5AV5 A;  5AV5 B;  5AY8 A;  3X1U D;  5AY8 B;  2IO5 C;  3LEL C;  2CV5 C;  3UTA A;  5AVC A;  5B32 A;  5AVC B;  5B1L C;  5B32 B;  3UT9 C;  3UTA B;  1P3B D;  4ZBJ B;  4XUJ D;  3AV2 A;  3AV2 B;  1U35 D;  3X1U C;  5GXQ D;  5B2I A;  5B2I B;  4J8U A;  4J8U B;  4XUJ C;  5AV8 A;  5CPK D;  3B6G A;  1U35 C;  3B6G B;  4G92 B;  1P3M C;  5BO0 A;  5BO0 B;  3A6N C;  5CPK C;  5B0Z A;  5GSU C;  5B0Z B;  5F99 B;  1P3G B;  3X1T A;  3X1T B;  5B24 D;  5AVB D;  3VH6 A;  5AV5 D;  1ID3 A;  5AY8 D;  3V9R B;  1ID3 B;  5KDM A;  5KDM B;  5B32 D;  4J8X A;  4J8X B;  5B2J D;  4Z66 C;  5E5A A;  1BH8 B;  3AV2 D;  5B24 C;  3WA9 D;  5AV5 C;  5AY8 C;  2L5A A;  4QLC B;  3AZG D;  3UTA C;  5AVC C;  5B32 C;  3AZE A;  3AZE B;  1TAF A;  1TAF B;  5B2I D;  4ZBJ C;  5AV8 D;  3AV2 C;  3B6G D;  3W98 A;  3W98 B;  5B31 A;  4R8P D;  5B31 B;  4KGC B;  5B2I C;  2F8N G;  4J8U C;  5AV8 C;  5B0Z D;  3REH B;  3B6G C;  3AZN A;  5JRG A;  3VH5 T;  4ZUX A;  4ZUX B;  3B0D B;  3REJ A;  3REJ B;  4NE5 A;  5B33 D;  5B0Z C;  3AYW B;  4X23 D;  3X1T C;  5E5A D;  1KU5 A;  1ID3 C;  4J8X C;  3REI A;  3REI B;  5CPJ A;  5CPJ B;  4H9Q A;  4H9Q B;  5E5A C;  3MGQ A;  3MGQ B;  1HTA A;  3W98 D;  3VH5 A;  5B31 D;  4G91 B;  3AZE C;  1P3A A;  1P3A B;  3UTB D;  3B6F A;  3B6F B;  3X1S A;  3W96 B;  3AZH A;  3AZH B;  3W98 C;  1B6W A;  5B31 C;  3AZN D;  4WNN B;  5JRG D;  1S32 B;  1S32 A;  2HIO A;  3O62 A;  3O62 B;  4H9O B;  3REJ D;  5FUG B;  3VH5 W;  1ZLA D;  3WKJ A;  3WKJ B;  3AV1 A;  1AOI B;  3AZN C;  5JRG C;  1KX5 A;  1KX5 B;  3AZI D;  4ZUX C;  2NZD A;  2NZD B;  3B0D C;  3AZL D;  3REJ C;  3REI D;  5CP6 D;  1P34 B;  5CPJ D;  1P3O A;  1P3O B;  4YS3 B;  3MGQ D;  3REI C;  3X1V B;  5CPJ C;  1P3L A;  1P3L B;  3B6F D;  1M1A A;  3X1U B;  3KSY A;  3X1S D;  3MGQ C;  4H9S A;  1P3B A;  1P3B B;  4G91 C;  5AV6 D;  1P3A C;  1S32 D;  3B6F C;  2HIO D;  1U35 B;  3W96 C;  1TZY A;  3X1S C;  1M19 D;  3WKJ D;  3AZH C;  3AV1 D;  5GXQ A;  4WU9 A;  5GXQ B;  4WU9 B;  1H3O A;  1H3O B;  1S32 C;  1BH9 B;  4CSR B;  2NZD D;  2HIO C;  3O62 C;  5GT3 A;  5GT3 B;  3WKJ C;  3AV1 C;  1P3O D;  4UUZ A;  4UUZ B;  3AZK A;  3AZK B;  1KX5 C;  2NZD C;  4DRB A;  2BYM A;  4XZQ D;  3TU4 D;  3WTP A;  3WTP B;  5AVB A;  5AVB B;  4WU8 D;  1P3O C;  4YS3 C;  1M1A D;  3B0C W;  5B2J A;  5B2J B;  5DNM A;  5DNM B;  3WA9 A;  1B67 A;  3KUY D;  1P3L C;  3WA9 B;  1M1A C;  3MGP A;  1A7W A;  1TZY D;  3VH6 T;  3MGP B;  3AZG A;  3AZG B;  1F66 D;  4H9S C;  1P3B C;  4WU9 D;  2HUE B;  2F8N D;  3REL A;  5AV8 B;  3REL B;  1TZY C;  5GT3 D;  4R8P A;  4R8P B;  5GXQ C;  4WU9 C;  4KUD D;  4E44 A;  3AZK D;  5BNX A;  5CPI A;  5CPI B;  5GT3 C;  3WTP D;  1F1E A;  1P3I A;  1P3I B;  2NQB A;  2NQB B;  1P3P D;  3AZK C;  4WV4 B;  5B33 A;  5B33 B;  5DNM D;  4X23 A;  4X23 B;  5E5A B;  3WTP C;  5AVB C;  4LD9 A;  1N1J A;  3AZJ A;  1N1J B;  3AZJ B;  4LD9 B;  3MGP D;  4NE3 A;  5B2J C;  3VH6 W;  5DNM C;  3REL D;  3WA9 C;  1HQ3 A;  3MGP C;  1HQ3 B;  3AZG C;  3MGS A;  3MGR D;  2HUE C;  3UTB A;  3UTB B;  3REL C;  3LJA A;  5CPI D;  4R8P C;  3AZN B;  5JRG B;  1P3I D;  2NQB D;  3AFA D;  1KX3 A;  1KX3 B;  2F8N K;  1ZLA A;  1ZLA B;  5CPI C;  4H9P A;  3C1B A;  4H9P B;  4LD9 D;  3AZJ D;  1WWI A;  3AZI A;  3AZI B;  1P3I C;  2NQB C;  3AZL A;  3AZL B;  5CP6 A;  3C1C A;  5CP6 B;  3C1C B;  5B33 C;  3NQU A;  3NQU B;  4X23 C;  4LD9 C;  3AZJ C;  4J8W D;  1HQ3 D;  1R4V A;  3W97 D;  3MGS D;  3NQJ A;  3LJA D;  3X1S B;  1HQ3 C;  5CHL B;  1KX4 A;  4YM6 A;  1KX4 B;  3MGS C;  5AV6 A;  4H9R A;  5AV6 B;  4H9R B;  3MVD D;  3UTB C;  1M19 A;  2HIO B;  3LJA C;  1M19 B;  1KX3 D;  3AV1 B;  5B32 G;  5C3I B;  3C1B D;  3AZM A;  1KX3 C;  3AZM B;  3C1C D;  1ZLA C;  5BT1 D;  4Z2M H; 
#chains in the Genus database with same CATH topology
 3C1B C;  3AZI C;  3X1V A;  4J8V A;  3AZL C;  3B0C T;  4J8V B;  4XZQ A;  5CP6 C;  4XZQ B;  5JA4 A;  5JA4 B;  3C1C C;  3TU4 A;  4WU8 A;  3TU4 B;  5BT1 C;  4WU8 B;  1M1A B;  5BS7 A;  2Y2P A;  3AN2 A;  1KX4 D;  4YM6 D;  3KUY A;  3KUY B;  1TZY B;  4KHA A;  1F66 A;  4KHA B;  1F66 B;  4JJN A;  4JJN B;  3REK A;  2DQN C;  5B0Y A;  5B0Y B;  2F8N A;  1KX4 C;  2F8N B;  3FDD A;  4YM6 C;  5AV6 C;  3MNN A;  1WWS A;  5GT0 D;  3MNN B;  4Z5T D;  1M19 C;  3AZM D;  1P3K A;  4KUD A;  4KUD B;  5C3I C;  3X1V D;  4J8V D;  3AZM C;  2BYM B;  2FJ7 D;  2ARO A;  2ARO B;  5B31 G;  1P3P A;  3W99 A;  1P3P B;  3AN2 D;  3X1V C;  4J8V C;  4XZQ C;  3TU4 C;  3R45 A;  3R45 B;  4WU8 C;  5BS7 C;  2LY8 A;  5GSU A;  3KWQ D;  4JJN D;  3REK D;  5B0Y D;  5DNN A;  3AN2 C;  5DNN B;  3WAA A;  3WAA B;  3MNN D;  3LEL D;  2CV5 D;  3KUY C;  3UT9 D;  5B1L D;  1P3K D;  1F66 C;  4JJN C;  3REK C;  3MGR A;  4EO5 B;  5B0Y C;  3MGR B;  1P3F A;  1EQZ A;  1EQZ B;  3MNN C;  4H9N A;  4H9N B;  5BNX B;  4DQY B;  2PYO A;  1P3K C;  5B40 A;  2PYO B;  5B40 B;  2ARO D;  4KUD C;  3AFA A;  3W99 D;  3AFA B;  1P3M D;  3A6N D;  2RIQ A;  4Z2M G;  2ARO C;  1JFI A;  2ZY5 A;  1JFI B;  1BFM A;  3W99 C;  5GSU D;  1P3P C;  3WTP E;  5DNN D;  3WAA D;  5B1M A;  5B1M B;  2W8S A;  4J8W A;  4J8W B;  5F99 A;  3W97 A;  1P3G A;  3W97 B;  3MGS B;  4DRA A;  5DNN C;  3WAA C;  4Z66 D;  1P3F D;  1EQZ D;  4E45 A;  3V9R A;  3H0M C;  4CAY A;  3LJA B;  4CAY B;  2JCH A;  3UTA D;  5AVC D;  2PYO D;  5B40 D;  1M18 A;  1M18 B;  4EO5 C;  3MGR C;  3MVD A;  1BH8 A;  2Y2J A;  1ULY A;  3MVD B;  1P3F C;  1EQZ C;  3AZF A;  3AZF B;  4QLC A;  2RVQ D;  2PYO C;  5B40 C;  4J8U D;  3C1B B;  4NE6 A;  5AV9 A;  5AV9 B;  3AFA C;  2YFV A;  2YFV B;  2RVQ C;  2BG1 A;  4KGC A;  5B1M D;  3KFU G;  4WZS B;  1Q9C A;  1Z2C B;  3REH A;  5F99 D;  4G92 C;  1P3G D;  3X1T D;  3EPJ A;  3NQJ B;  2BYK A;  5B1M C;  2BYK B;  1ID3 D;  3H0L C;  4J8W C;  4J8X D;  3AYW A;  1M18 D;  5F99 C;  4YM6 B;  1P3G C;  3W97 C;  2F2A C;  3AZF D;  4QLC D;  4M6B A;  3AZE D;  4HGA B;  1M18 C;  5GT0 A;  3MVD C;  5GT0 B;  3EPK A;  5AV9 D;  4Z5T A;  3AZF C;  4Z5T B;  4QLC C;  2DF4 C;  3EPL A;  1W2E A;  2ZY4 A;  4KGC D;  4AWL B;  2CWE A;  3W96 A;  3LZ0 A;  5AV9 C;  3LZ0 B;  3REH D;  4NFT A;  2FJ7 A;  2FJ7 B;  4WNN A;  4KGC C;  3KXB A;  3LZ1 A;  3KXB B;  3LZ1 B;  4ZUX D;  4H9O A;  5FUG A;  2UWX A;  3AN2 B;  3AYW D;  3REH C;  1AOI A;  5G49 A;  5G49 B;  3KWQ A;  3KWQ B;  1P34 A;  3REK B;  3AYW C;  4YS3 A;  3LEL A;  2CV5 A;  3LEL B;  2CV5 B;  2IO5 B;  2Y2O A;  3UT9 A;  5B1L A;  3UT9 B;  5B1L B;  1P3K B;  2YFW A;  2JSS A;  2YFW B;  4HGA C;  1P3A D;  3AL0 C;  3X1U A;  5GT0 C;  3W96 D;  3LZ0 D;  4Z5T C;  3AZH D;  2ZY3 A;  4XUJ A;  3EG5 B;  4XUJ B;  4AWL C;  2F8N H;  3KXB D;  3LZ1 D;  1U35 A;  3O62 D;  1P3M A;  3W99 B;  3LZ0 C;  1P3M B;  3A6N A;  1AOI D;  3A6N B;  3IP4 C;  2FJ7 C;  5BNV A;  5BNV B;  3KXB C;  1BH9 A;  4CSR A;  3LZ1 C;  5CPK A;  5CPK B;  1KX5 D;  5GSU B;  1P34 D;  3B0B A;  1AOI C;  4YS3 D;  3F6T A;  3KWQ C;  1P34 C;  4Z66 A;  4Z66 B;  1P3F B;  5B24 A;  1P3L D;  5B24 B;  5AV5 A;  5AV5 B;  5AY8 A;  3X1U D;  5AY8 B;  2IO5 C;  3LEL C;  2CV5 C;  3UTA A;  5AVC A;  5B32 A;  5AVC B;  5B1L C;  5B32 B;  3UT9 C;  3UTA B;  1P3B D;  4ZBJ B;  4XUJ D;  3AV2 A;  3AV2 B;  1U35 D;  3X1U C;  5GXQ D;  5B2I A;  5B2I B;  4J8U A;  4J8U B;  4XUJ C;  5AV8 A;  5CPK D;  2Y2H A;  3B6G A;  1U35 C;  3B6G B;  4G92 B;  1P3M C;  5BO0 A;  5BO0 B;  3A6N C;  2JE5 A;  5CPK C;  5B0Z A;  5GSU C;  5B0Z B;  5F99 B;  1P3G B;  3X1T A;  3X1T B;  5B24 D;  5AVB D;  3VH6 A;  5AV5 D;  1ID3 A;  5AY8 D;  3V9R B;  1ID3 B;  5KDM A;  5KDM B;  5B32 D;  4J8X A;  4J8X B;  5B2J D;  4Z66 C;  5E5A A;  1BH8 B;  3AV2 D;  5B24 C;  3WA9 D;  5AV5 C;  5AY8 C;  2L5A A;  4QLC B;  3AZG D;  2Y2K A;  3UTA C;  5AVC C;  5B32 C;  3AZE A;  3AZE B;  1TAF A;  1TAF B;  5B2I D;  4ZBJ C;  5AV8 D;  3AV2 C;  3B6G D;  3W98 A;  3W98 B;  3A1K A;  2XD1 A;  5B31 A;  5B31 B;  4R8P D;  4KGC B;  5B2I C;  2F8N G;  4J8U C;  5AV8 C;  5B0Z D;  3REH B;  3B6G C;  3AZN A;  5JRG A;  3VH5 T;  4ZUX A;  4ZUX B;  3B0D B;  3REJ A;  3REJ B;  4NE5 A;  5B33 D;  5B0Z C;  3AYW B;  4X23 D;  3X1T C;  5E5A D;  1KU5 A;  1ID3 C;  4J8X C;  3REI A;  3REI B;  5CPJ A;  5CPJ B;  4H9Q A;  4H9Q B;  5E5A C;  3MGQ A;  3P5J B;  3MGQ B;  1HTA A;  3W98 D;  3VH5 A;  5B31 D;  4G91 B;  3AZE C;  1P3A A;  1P3A B;  3UTB D;  3B6F A;  3B6F B;  3X1S A;  3W96 B;  2Y2Q A;  3AZH A;  3AZH B;  3W98 C;  1B6W A;  5B31 C;  3AZN D;  4WNN B;  5JRG D;  1S32 B;  1S32 A;  2Y2L A;  2HIO A;  3O62 A;  3O62 B;  4H9O B;  2J8P A;  5FUG B;  3VH5 W;  3REJ D;  1ZLA D;  3WKJ A;  3WKJ B;  3AV1 A;  1AOI B;  3AZN C;  5JRG C;  1KX5 A;  1KX5 B;  3AZI D;  4ZUX C;  2NZD A;  2NZD B;  2Y2G A;  3B0D C;  3AZL D;  3REJ C;  3REI D;  5CP6 D;  1P34 B;  5CPJ D;  1P3O A;  2Y2M A;  4YS3 B;  1P3O B;  3MGQ D;  2Y2N A;  3REI C;  3X1V B;  5CPJ C;  1P3L A;  1P3L B;  3B6F D;  1M1A A;  3KSY A;  3X1S D;  3X1U B;  3MGQ C;  4H9S A;  1P3B A;  1P3B B;  4G91 C;  5AV6 D;  1P3A C;  1S32 D;  4WJ3 C;  3B6F C;  2HIO D;  1U35 B;  3W96 C;  1TZY A;  3X1S C;  1M19 D;  3WKJ D;  3AZH C;  3AV1 D;  5GXQ A;  4WU9 A;  5GXQ B;  4WU9 B;  1H3O A;  1H3O B;  1S32 C;  1BH9 B;  4CSR B;  2NZD D;  2HIO C;  3O62 C;  5GT3 A;  5GT3 B;  3WKJ C;  3AV1 C;  2ZY2 A;  1T3U A;  1P3O D;  4UUZ A;  4UUZ B;  3AZK A;  3AZK B;  1KX5 C;  2NZD C;  4DRB A;  2BYM A;  4XZQ D;  3TU4 D;  3WTP A;  3WTP B;  5AVB A;  5AVB B;  4WU8 D;  1P3O C;  4YS3 C;  1M1A D;  3B0C W;  5B2J A;  5B2J B;  5DNM A;  5DNM B;  3WA9 A;  1B67 A;  3KUY D;  1P3L C;  3WA9 B;  1M1A C;  3MGP A;  1A7W A;  1TZY D;  3VH6 T;  3MGP B;  3AZG A;  3AZG B;  1F66 D;  4H9S C;  1P3B C;  4WU9 D;  2HUE B;  2F8N D;  3REL A;  5AV8 B;  3REL B;  1TZY C;  5GT3 D;  4R8P A;  4R8P B;  5GXQ C;  4WU9 C;  4KUD D;  4E44 A;  3AZK D;  2XD5 A;  5BNX A;  5CPI A;  5CPI B;  5GT3 C;  3WTP D;  1F1E A;  2VQR A;  1P3I A;  1P3I B;  2NQB A;  2NQB B;  1P3P D;  3AZK C;  1PZR A;  4WV4 B;  5B33 A;  5B33 B;  5DNM D;  4X23 A;  4X23 B;  5E5A B;  3WTP C;  5AVB C;  4LD9 A;  1N1J A;  3AZJ A;  1N1J B;  3AZJ B;  4LD9 B;  3MGP D;  4NE3 A;  5B2J C;  4UPK A;  3VH6 W;  5DNM C;  3REL D;  3WA9 C;  1HQ3 A;  3MGP C;  1HQ3 B;  3AZG C;  3MGS A;  3MGR D;  2HUE C;  3UTB A;  3UTB B;  3REL C;  3LJA A;  5CPI D;  3H0R C;  4R8P C;  3AZN B;  5JRG B;  1P3I D;  2Y2I A;  2NQB D;  3AFA D;  1KX3 A;  1KX3 B;  2F8N K;  1ZLA A;  1ZLA B;  3A1I A;  5CPI C;  2G5H C;  4H9P A;  3C1B A;  4H9P B;  4LD9 D;  3AZJ D;  1WWI A;  3AZI A;  3AZI B;  1P3I C;  2NQB C;  3AZL A;  3AZL B;  5CP6 A;  3C1C A;  5CP6 B;  3C1C B;  5B33 C;  3NQU A;  3NQU B;  4X23 C;  4LD9 C;  3AZJ C;  4J8W D;  1HQ3 D;  1R4V A;  3W97 D;  3MGS D;  2FFF B;  3NQJ A;  3LJA D;  3X1S B;  3EPH A;  1HQ3 C;  5CHL B;  1KX4 A;  4YM6 A;  1KX4 B;  3MGS C;  5AV6 A;  4H9R A;  5AV6 B;  4H9R B;  3MVD D;  3UTB C;  1M19 A;  2HIO B;  3LJA C;  1M19 B;  1KX3 D;  3AV1 B;  2G5I C;  5B32 G;  5C3I B;  3C1B D;  2ZM5 A;  3AZM A;  1KX3 C;  3AZM B;  3C1C D;  1ZLA C;  5BT1 D;  4Z2M H; 
#chains in the Genus database with same CATH homology
 3C1B C;  3AZI C;  3X1V A;  4J8V A;  3AZL C;  3B0C T;  4J8V B;  4XZQ A;  5CP6 C;  4XZQ B;  5JA4 A;  5JA4 B;  3C1C C;  3TU4 A;  4WU8 A;  3TU4 B;  5BT1 C;  4WU8 B;  1M1A B;  5BS7 A;  2Y2P A;  3AN2 A;  1KX4 D;  4YM6 D;  3KUY A;  3KUY B;  1TZY B;  4KHA A;  1F66 A;  4KHA B;  1F66 B;  4JJN A;  4JJN B;  3REK A;  2DQN C;  5B0Y A;  5B0Y B;  2F8N A;  1KX4 C;  2F8N B;  3FDD A;  4YM6 C;  5AV6 C;  3MNN A;  1WWS A;  5GT0 D;  3MNN B;  4Z5T D;  1M19 C;  3AZM D;  1P3K A;  4KUD A;  4KUD B;  5C3I C;  3X1V D;  4J8V D;  3AZM C;  2BYM B;  2FJ7 D;  2ARO A;  2ARO B;  5B31 G;  1P3P A;  3W99 A;  1P3P B;  3AN2 D;  3X1V C;  4J8V C;  4XZQ C;  3TU4 C;  3R45 A;  3R45 B;  4WU8 C;  5BS7 C;  2LY8 A;  5GSU A;  3KWQ D;  4JJN D;  3REK D;  5B0Y D;  5DNN A;  3AN2 C;  5DNN B;  3WAA A;  3WAA B;  3MNN D;  3LEL D;  2CV5 D;  3KUY C;  3UT9 D;  5B1L D;  1P3K D;  1F66 C;  4JJN C;  3REK C;  3MGR A;  4EO5 B;  5B0Y C;  3MGR B;  1P3F A;  1EQZ A;  1EQZ B;  3MNN C;  4H9N A;  4H9N B;  5BNX B;  4DQY B;  2PYO A;  1P3K C;  5B40 A;  2PYO B;  5B40 B;  2ARO D;  4KUD C;  3AFA A;  3W99 D;  3AFA B;  1P3M D;  3A6N D;  2RIQ A;  4Z2M G;  2ARO C;  1JFI A;  2ZY5 A;  1JFI B;  1BFM A;  3W99 C;  5GSU D;  1P3P C;  3WTP E;  5DNN D;  3WAA D;  5B1M A;  5B1M B;  2W8S A;  4J8W A;  4J8W B;  5F99 A;  3W97 A;  1P3G A;  3W97 B;  3MGS B;  4DRA A;  5DNN C;  3WAA C;  4Z66 D;  1P3F D;  1EQZ D;  4E45 A;  3V9R A;  3H0M C;  4CAY A;  3LJA B;  4CAY B;  2JCH A;  3UTA D;  5AVC D;  2PYO D;  5B40 D;  1M18 A;  1M18 B;  4EO5 C;  3MGR C;  3MVD A;  1BH8 A;  2Y2J A;  1ULY A;  3MVD B;  1P3F C;  1EQZ C;  3AZF A;  3AZF B;  4QLC A;  2RVQ D;  2PYO C;  5B40 C;  4J8U D;  3C1B B;  4NE6 A;  5AV9 A;  5AV9 B;  3AFA C;  2YFV A;  2YFV B;  2RVQ C;  2BG1 A;  4KGC A;  5B1M D;  3KFU G;  4WZS B;  1Q9C A;  1Z2C B;  3REH A;  5F99 D;  4G92 C;  1P3G D;  3X1T D;  3EPJ A;  3NQJ B;  2BYK A;  5B1M C;  2BYK B;  1ID3 D;  3H0L C;  4J8W C;  4J8X D;  3AYW A;  1M18 D;  5F99 C;  4YM6 B;  1P3G C;  3W97 C;  2F2A C;  3AZF D;  4QLC D;  4M6B A;  3AZE D;  4HGA B;  1M18 C;  5GT0 A;  3MVD C;  5GT0 B;  3EPK A;  5AV9 D;  4Z5T A;  3AZF C;  4Z5T B;  4QLC C;  2DF4 C;  3EPL A;  1W2E A;  2ZY4 A;  4KGC D;  4AWL B;  2CWE A;  3W96 A;  3LZ0 A;  5AV9 C;  3LZ0 B;  3REH D;  4NFT A;  2FJ7 A;  2FJ7 B;  4WNN A;  4KGC C;  3KXB A;  3LZ1 A;  3KXB B;  3LZ1 B;  4ZUX D;  4H9O A;  5FUG A;  2UWX A;  3AN2 B;  3AYW D;  3REH C;  1AOI A;  5G49 A;  5G49 B;  3KWQ A;  3KWQ B;  1P34 A;  3REK B;  3AYW C;  4YS3 A;  3LEL A;  2CV5 A;  3LEL B;  2CV5 B;  2IO5 B;  2Y2O A;  3UT9 A;  5B1L A;  3UT9 B;  5B1L B;  1P3K B;  2YFW A;  2JSS A;  2YFW B;  4HGA C;  1P3A D;  3AL0 C;  3X1U A;  5GT0 C;  3W96 D;  3LZ0 D;  4Z5T C;  3AZH D;  2ZY3 A;  4XUJ A;  3EG5 B;  4XUJ B;  4AWL C;  2F8N H;  3KXB D;  3LZ1 D;  1U35 A;  3O62 D;  1P3M A;  3W99 B;  3LZ0 C;  1P3M B;  3A6N A;  1AOI D;  3A6N B;  3IP4 C;  2FJ7 C;  5BNV A;  5BNV B;  3KXB C;  1BH9 A;  4CSR A;  3LZ1 C;  5CPK A;  5CPK B;  1KX5 D;  5GSU B;  1P34 D;  3B0B A;  1AOI C;  4YS3 D;  3F6T A;  3KWQ C;  1P34 C;  4Z66 A;  4Z66 B;  1P3F B;  5B24 A;  1P3L D;  5B24 B;  5AV5 A;  5AV5 B;  5AY8 A;  3X1U D;  5AY8 B;  2IO5 C;  3LEL C;  2CV5 C;  3UTA A;  5AVC A;  5B32 A;  5AVC B;  5B1L C;  5B32 B;  3UT9 C;  3UTA B;  1P3B D;  4ZBJ B;  4XUJ D;  3AV2 A;  3AV2 B;  1U35 D;  3X1U C;  5GXQ D;  5B2I A;  5B2I B;  4J8U A;  4J8U B;  4XUJ C;  5AV8 A;  5CPK D;  2Y2H A;  3B6G A;  1U35 C;  3B6G B;  4G92 B;  1P3M C;  5BO0 A;  5BO0 B;  3A6N C;  2JE5 A;  5CPK C;  5B0Z A;  5GSU C;  5B0Z B;  5F99 B;  1P3G B;  3X1T A;  3X1T B;  5B24 D;  5AVB D;  3VH6 A;  5AV5 D;  1ID3 A;  5AY8 D;  3V9R B;  1ID3 B;  5KDM A;  5KDM B;  5B32 D;  4J8X A;  4J8X B;  5B2J D;  4Z66 C;  5E5A A;  1BH8 B;  3AV2 D;  5B24 C;  3WA9 D;  5AV5 C;  5AY8 C;  2L5A A;  4QLC B;  3AZG D;  2Y2K A;  3UTA C;  5AVC C;  5B32 C;  3AZE A;  3AZE B;  1TAF A;  1TAF B;  5B2I D;  4ZBJ C;  5AV8 D;  3AV2 C;  3B6G D;  3W98 A;  3W98 B;  3A1K A;  2XD1 A;  5B31 A;  5B31 B;  4R8P D;  4KGC B;  5B2I C;  2F8N G;  4J8U C;  5AV8 C;  5B0Z D;  3REH B;  3B6G C;  3AZN A;  5JRG A;  3VH5 T;  4ZUX A;  4ZUX B;  3B0D B;  3REJ A;  3REJ B;  4NE5 A;  5B33 D;  5B0Z C;  3AYW B;  4X23 D;  3X1T C;  5E5A D;  1KU5 A;  1ID3 C;  4J8X C;  3REI A;  3REI B;  5CPJ A;  5CPJ B;  4H9Q A;  4H9Q B;  5E5A C;  3MGQ A;  3P5J B;  3MGQ B;  1HTA A;  3W98 D;  3VH5 A;  5B31 D;  4G91 B;  3AZE C;  1P3A A;  1P3A B;  3UTB D;  3B6F A;  3B6F B;  3X1S A;  3W96 B;  2Y2Q A;  3AZH A;  3AZH B;  3W98 C;  1B6W A;  5B31 C;  3AZN D;  4WNN B;  5JRG D;  1S32 B;  1S32 A;  2Y2L A;  2HIO A;  3O62 A;  3O62 B;  4H9O B;  2J8P A;  5FUG B;  3VH5 W;  3REJ D;  1ZLA D;  3WKJ A;  3WKJ B;  3AV1 A;  1AOI B;  3AZN C;  5JRG C;  1KX5 A;  1KX5 B;  3AZI D;  4ZUX C;  2NZD A;  2NZD B;  2Y2G A;  3B0D C;  3AZL D;  3REJ C;  3REI D;  5CP6 D;  1P34 B;  5CPJ D;  1P3O A;  2Y2M A;  4YS3 B;  1P3O B;  3MGQ D;  2Y2N A;  3REI C;  3X1V B;  5CPJ C;  1P3L A;  1P3L B;  3B6F D;  1M1A A;  3KSY A;  3X1S D;  3X1U B;  3MGQ C;  4H9S A;  1P3B A;  1P3B B;  4G91 C;  5AV6 D;  1P3A C;  1S32 D;  4WJ3 C;  3B6F C;  2HIO D;  1U35 B;  3W96 C;  1TZY A;  3X1S C;  1M19 D;  3WKJ D;  3AZH C;  3AV1 D;  5GXQ A;  4WU9 A;  5GXQ B;  4WU9 B;  1H3O A;  1H3O B;  1S32 C;  1BH9 B;  4CSR B;  2NZD D;  2HIO C;  3O62 C;  5GT3 A;  5GT3 B;  3WKJ C;  3AV1 C;  2ZY2 A;  1T3U A;  1P3O D;  4UUZ A;  4UUZ B;  3AZK A;  3AZK B;  1KX5 C;  2NZD C;  4DRB A;  2BYM A;  4XZQ D;  3TU4 D;  3WTP A;  3WTP B;  5AVB A;  5AVB B;  4WU8 D;  1P3O C;  4YS3 C;  1M1A D;  3B0C W;  5B2J A;  5B2J B;  5DNM A;  5DNM B;  3WA9 A;  1B67 A;  3KUY D;  1P3L C;  3WA9 B;  1M1A C;  3MGP A;  1A7W A;  1TZY D;  3VH6 T;  3MGP B;  3AZG A;  3AZG B;  1F66 D;  4H9S C;  1P3B C;  4WU9 D;  2HUE B;  2F8N D;  3REL A;  5AV8 B;  3REL B;  1TZY C;  5GT3 D;  4R8P A;  4R8P B;  5GXQ C;  4WU9 C;  4KUD D;  4E44 A;  3AZK D;  2XD5 A;  5BNX A;  5CPI A;  5CPI B;  5GT3 C;  3WTP D;  1F1E A;  2VQR A;  1P3I A;  1P3I B;  2NQB A;  2NQB B;  1P3P D;  3AZK C;  1PZR A;  4WV4 B;  5B33 A;  5B33 B;  5DNM D;  4X23 A;  4X23 B;  5E5A B;  3WTP C;  5AVB C;  4LD9 A;  1N1J A;  3AZJ A;  1N1J B;  3AZJ B;  4LD9 B;  3MGP D;  4NE3 A;  5B2J C;  4UPK A;  3VH6 W;  5DNM C;  3REL D;  3WA9 C;  1HQ3 A;  3MGP C;  1HQ3 B;  3AZG C;  3MGS A;  3MGR D;  2HUE C;  3UTB A;  3UTB B;  3REL C;  3LJA A;  5CPI D;  3H0R C;  4R8P C;  3AZN B;  5JRG B;  1P3I D;  2Y2I A;  2NQB D;  3AFA D;  1KX3 A;  1KX3 B;  2F8N K;  1ZLA A;  1ZLA B;  3A1I A;  5CPI C;  2G5H C;  4H9P A;  3C1B A;  4H9P B;  4LD9 D;  3AZJ D;  1WWI A;  3AZI A;  3AZI B;  1P3I C;  2NQB C;  3AZL A;  3AZL B;  5CP6 A;  3C1C A;  5CP6 B;  3C1C B;  5B33 C;  3NQU A;  3NQU B;  4X23 C;  4LD9 C;  3AZJ C;  4J8W D;  1HQ3 D;  1R4V A;  3W97 D;  3MGS D;  2FFF B;  3NQJ A;  3LJA D;  3X1S B;  3EPH A;  1HQ3 C;  5CHL B;  1KX4 A;  4YM6 A;  1KX4 B;  3MGS C;  5AV6 A;  4H9R A;  5AV6 B;  4H9R B;  3MVD D;  3UTB C;  1M19 A;  2HIO B;  3LJA C;  1M19 B;  1KX3 D;  3AV1 B;  2G5I C;  5B32 G;  5C3I B;  3C1B D;  2ZM5 A;  3AZM A;  1KX3 C;  3AZM B;  3C1C D;  1ZLA C;  5BT1 D;  4Z2M H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...