4YM6B

Crystal structure of the human nucleosome containing 6-4pp (outside)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural basis of pyrimidine-pyrimidone (6-4) photoproduct recognition by UV-DDB in the nucleosome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 28
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ym6B00
3B6GA 5CHLB 1P3OB 4Z66D 2HIOA 4H9RB 5F99C 3TU4D 3WA9C 1KX5B 1WWIA 5G49B 4NFTA 4Z66C 3AZFB 3LZ1D 5BNXB 3TU4C 5CPKD 3AV1A 5CP6B 3LZ1C 1S32D 5JRGD 5CPKC 4UUZA 5B0YB 1S32C 4KUDB 1BFMA 5JRGC 4QLCB 2AROB 3AV1D 3MNNA 2BYMB 1U35A 1P3AD 3WKJB 3VH5A 1M1AA 5BO0A 3X1VB 3UTBA 2YFWB 1P3AC 3A6ND 3AZNB 5B2IA 4WU9B 3MNND 4J8WA 5CPJA 3R45B 1P3PB 1B6WA 3B6GB 3A6NC 1KX3A 2HIOB 3O62D 1P3IA 4G91C 3X1TD 2FJ7D 3AV2D 4H9SC 3O62C 3X1TC 2FJ7C 2YFVA 3B0CT 3AV2C 3MGPD 1M19C 3AV1B 3UT9D 3MGPC 4H9QA 3UT9C 1R4VA 4J8XA 5AV5A 3MGQD 4Z5TA 1HQ3A 3VH6T 2F8NG 1P34A 4H9NA 2F8NA 4YM6A 1U35B 3RELB 1P3MD 3MGQC 1M1AB 5BO0B 3UTBB 5E5AB 2NZDB 4J8VD 5CPIC 1P3MC 1N1JA 5B2IB 3X1UA 2F8ND 4J8WB 5CPJB 5DNND 3NQUA 3KXBC 5AY8D 4J8VC 5B1LA 1KX3B 3WAAD 1P3IB 1P3GC 5DNNC 2NQBD 5AY8C 3AFAD 3REID 4YS3A 4AWLC 3WAAC 3C1BD 3AZJD 3MGSD 1KX4A 2RVQD 3LZ0A 2NQBC 2YFVB 3AFAC 3REIC 3AZGD 3C1BC 3AZJC 1AOID 3AZKC 3MGSC 3MVDD 4ZBJB 2F8NH 3W98A 3AZGC 4HGAC 1ZLAD 5BS7C 1AOIC 3LZ0D 3MVDC 4G92C 5GT0D 4WNNA 5B0ZA 5AVCD 5AV5B 4J8XB 3AZHD 1BH8A 1ZLAC 4Z5TB 1HQ3B 1P34B 4H9NB 5DNMD 5AV9D 4YM6B 5GT0C 5AVCC 5B2JA 3AZHC 3AN2D 5JA4A 5DNMC 5AV9C 3W97D 4KGCA 1N1JB 3X1UB 3AN2C 3VH5W 3W97C 3NQUB 4JJNA 5B2JD 5GT3D 1P3FD 5BNVA 5B33D 5B1LB 5AV8C 1WWSA 4EO5C 3LJAD 5GT3C 1P3FC 4YS3B 4LD9D 1KX4B 4JJND 3LZ0B 3LJAC 3C1CC 5F99A 3AYWD 5GSUD 2HUEC 3WA9A 4WV4B 4Z66A 4LD9C 4WU8D 4E44A 3AYWC 5GSUC 3TU4A 3W98B 3AZED 4WU8C 3LZ1A 1P3LD 4WNNB 5B0ZB 4R8PD 4NE6A 3REJB 5CPKA 1BH8B 3AZEC 1S32A 1P3LC 4XUJD 5JRGA 4R8PC 4E45A 2JSSA 5JA4B 3WTPD 4KGCB 4XUJC 5AV6D 3MGRD 3KSYA 3WTPC 2IO5C 1P3AA 5AV6C 5BNVB 3KWQD 3MGRC 4X23C 3B6FD 2CWEA 3AZID 5GXQD 4KUDC 5KDMA 3A6NA 3KWQC 3B6FC 1Q9CA 5B1MD 3AZIC 5GXQC 5F99B 3WA9B 4H9SA 4Z66B 3O62A 5B1MC 3X1TA 2FJ7A 3TU4B 3AV2A 1M19A 3LZ1B 3MGPA 5CPKB 3V9RA 1S32B 3UT9A 5JRGB 1M19D 1M18D 4DRAA 4XZQD 2LY8A 1TZYD 3NQJA 3MGQA 1M18C 5C3IB 3W99D 4XZQC 1P3AB 5CPIA 1P3MA 1TZYC 4UUZB 2PYOD 1HTAA 3VH5T 5KDMB 3W99C 3KXBA 4J8VA 3REKD 3A6NB 2PYOC 1F66D 3MNNB 4ZUXD 4G91B 1P3GA 3RELC 5DNNA 5B32D 3REKC 5AY8A 5CPID 5BT1D 3WAAA 1F66C 3O62B 3AZLD 1EQZD 5E5AC 4ZUXC 5B24D 2NZDC 3KXBD 3X1TB 3W96D 5B32C 2NQBA 2FJ7B 3AFAA 3REIA 3AV2B 3LELD 5BT1C 3C1BA 3AZJA 3AZLC 5AVBD 3AZKA 5B24C 1P3GD 3MGSA 1EQZC 4NE5A 3W96C 5FUGA 3MGPB 3AZGA 3LELC 5BS7A 4J8UD 1AOIA 3V9RB 5AVBC 5B31G 3MVDA 3UT9B 1ZLAA 4J8UC 3AZKD 2BYKA 5GT0A 5AVCA 3AZHA 3NQJB 3MGQB 2CV5D 5DNMA 5AV9A 5B31D 1B67A 5CPIB 1P3MB 3AN2A 2CV5C 3WTPE 4H9QB 1P3KD 4H9OA 3W97A 5B31C 5AV5C 4J8VB 4NE3A 2F8NB 5AV8A 3KUYD 1ID3D 1P3KC 5DNNB 1BH9A 5AY8B 5GT3A 1P3FA 5B33A 4AWLB 3WAAB 3X1SD 3KUYC 1ID3C 3LJAA 3C1CA 2NQBB 3AFAB 3REIB 4DRBA 5AV8D 2L5AA 3C1BB 3AZJB 4LD9A 3X1SC 3MGSB 3AYWA 5FUGB 5GSUA 3AZGB 4HGAB 3AZMD 1P3BD 1AOIB 4WU8A 3B0DC 3C1CD 3MVDB 4G92B 1ZLAB 3AZEA 5B40D 4Z2MG 3AZMC 1P3BC 3REHD 1P3LA 3UTAD 5GT0B 5AVCB 4R8PA 3AZHB 5B40C 1KU5A 5DNMB 5AV9B 3REHC 3UTAC 1P3OD 4XUJA 3AN2B 3WTPA 4H9OB 3W97B 1P3OC 3REJC 1KX5D 5AV6A 3MGRA 3AZFD 4X23A 4EO5B 4KUDA 1KX5C 5B2JB 4KHAA 5GT3B 5CP6D 1P3FB 5B33B 3KWQA 3AZFC 3B6FA 4CSRA 1F1EA 5GXQA 3LJAB 3AZIA 3C1CB 4H9PA 5CP6C 4X23D 5B0YD 4LD9B 5B1MA 4KUDD 4QLCD 4JJNB 2AROD 3AYWB 5GSUB 4Z2MH 5B0YC 4WU8B 3WKJD 4QLCC 2AROC 3X1VD 3AZEB 3WKJC 1P3LB 3AZND 4WU9D 4R8PB 3X1VC 1H3OA 1P3PD 3B6GD 3AZNC 4XUJB 2HIOD 4WU9C 1M18A 1P3PC 3WTPB 2IO5B 4XZQA 3B6GC 5AV6B 2HIOC 1TZYA 3MGRB 4X23B 3W99A 4KHAB 3KWQB 2PYOA 3B6FB 4CSRB 3AZIB 5GXQB 3RELA 4H9PB 3REKA 3AV1C 5C3IC 1F66A 5B1MB 5E5AA 4ZUXA 2NZDA 3VH6A 5B32A 5B32G 1U35D 3AZLA 1EQZA 5B24A 3RELD 3W96A 1M1AD 3UTBD 3LELA 4CAYA 3MNNC 5E5AD 1U35C 2NZDD 5AVBA 5B2ID 1M1AC 1H3OB 3B0BA 5CPJD 4J8WD 4J8UA 3UTBC 1JFIA 2F8NK 1P3PA 5B2IC 1KX3D 1P3ID 1M19B 4J8WC 5CPJC 1M18B 4XZQB 1KX3C 1TZYB 1P3IC 2CV5A 5B31A 1TAFA 3W99B 2PYOB 1P3KA 3REKB 1F66B 3KUYA 1ID3A 4ZUXB 4J8XD 4ZBJC 5AV5D 5B32B 4Z5TD 1HQ3D 1P34D 4YM6D 3X1SA 3AZLB 1EQZB 5B24B 4M6BA 3KXBB 4J8XC 3W96B 4Z5TC 1HQ3C 3LELB 1P34C 4CAYB 4YM6C 5AVBB 1P3GB 3X1UD 1JFIB 4J8UB 3AZMA 1P3BA 1A7WA 4WZSB 3X1UC 5B1LD 1ULYA 3AZKB 5B40A 2RVQC 3REHA 3UTAA 4YS3D 5B1LC 1KX4D 2CV5B 5B31B 1TAFB 1P3OA 3REJA 4YS3C 4H9RA 1KX4C 3LZ0C 1P3KB 3B0CW 3W98D 2BYKB 1KX5A 5G49A 3AZFA 5BNXA 3KUYB 1ID3B 5B0ZD 3REJD 3W98C 5CP6A 3X1SB 5B0ZC 3VH6W 5AV8B 5B0YA 4KGCD 3B0DB 4QLCA 2AROA 1BH9B 5B2JC 5B33C 2BYMA 3AZMB 1P3BB 4KGCC 3WKJA 2HUEB 3X1VA 2YFWA 5B40B 4JJNC 3REHB 3UTAB 3AZNA 4WU9A 3R45A 5F99D 3WA9D
chains in the Genus database with same CATH superfamily
3B6GA 5CHLB 1P3OB 4Z66D 2HIOA 4H9RB 5F99C 3TU4D 3WA9C 1KX5B 1WWIA 5G49B 4NFTA 4Z66C 3AZFB 3LZ1D 5BNXB 3TU4C 5CPKD 3AV1A 5CP6B 3LZ1C 1S32D 5JRGD 5CPKC 4UUZA 5B0YB 1S32C 4KUDB 1PZRA 1BFMA 5JRGC 4QLCB 2AROB 3AV1D 3MNNA 2BYMB 1U35A 1P3AD 2G5IC 3WKJB 3VH5A 1M1AA 5BO0A 3X1VB 3UTBA 2YFWB 1P3AC 3A6ND 3AZNB 5B2IA 4WU9B 3MNND 4J8WA 5CPJA 3R45B 1P3PB 1B6WA 3B6GB 3A6NC 1KX3A 2HIOB 3O62D 1P3IA 4G91C 3X1TD 2FJ7D 3AV2D 4H9SC 3O62C 2ZY3A 3X1TC 2FJ7C 2YFVA 3B0CT 3AV2C 3MGPD 3EPHA 1M19C 3AV1B 3UT9D 3MGPC 4H9QA 3UT9C 1R4VA 4J8XA 5AV5A 3MGQD 4Z5TA 1HQ3A 3VH6T 2F8NG 1P34A 2BG1A 4H9NA 2F8NA 4YM6A 2ZY5A 1U35B 3RELB 1P3MD 2UWXA 2ZM5A 3MGQC 1M1AB 5BO0B 3UTBB 2FFFB 5E5AB 2NZDB 4J8VD 5CPIC 1P3MC 1N1JA 5B2IB 3X1UA 2F8ND 3KFUG 4J8WB 5CPJB 5DNND 3NQUA 3KXBC 5AY8D 4J8VC 5B1LA 1KX3B 3WAAD 1P3IB 1P3GC 5DNNC 2NQBD 5AY8C 3AFAD 3REID 4YS3A 4AWLC 3WAAC 3C1BD 3AZJD 2ZY4A 2Y2HA 3MGSD 1KX4A 2RVQD 3LZ0A 2NQBC 2YFVB 3AFAC 3REIC 3AZGD 3C1BC 3AZJC 1AOID 3AZKC 3MGSC 3MVDD 4ZBJB 2F8NH 3W98A 3AZGC 4HGAC 1ZLAD 5BS7C 1AOIC 3LZ0D 3MVDC 4G92C 5GT0D 4WNNA 5B0ZA 5AVCD 5AV5B 4J8XB 3AZHD 1BH8A 1ZLAC 4Z5TB 1HQ3B 1P34B 4H9NB 5DNMD 5AV9D 4YM6B 2Y2NA 5GT0C 5AVCC 5B2JA 3AZHC 3AN2D 2Y2PA 5JA4A 5DNMC 5AV9C 3A1KA 3W97D 4KGCA 1N1JB 3X1UB 3AN2C 3VH5W 2Y2KA 3W97C 3NQUB 3A1IA 5B2JD 4JJNA 5GT3D 1P3FD 5BNVA 5B33D 5B1LB 5AV8C 1WWSA 4EO5C 3LJAD 5GT3C 1P3FC 4YS3B 4LD9D 1KX4B 4JJND 3LZ0B 3LJAC 3C1CC 5F99A 3AYWD 5GSUD 2HUEC 3WA9A 4WV4B 2W8SA 4Z66A 4LD9C 4WU8D 4E44A 3AYWC 2Y2LA 5GSUC 3TU4A 3W98B 3AZED 4WU8C 3LZ1A 1P3LD 4WNNB 5B0ZB 4R8PD 4NE6A 3REJB 5CPKA 1BH8B 3AZEC 1T3UA 1S32A 1P3LC 4XUJD 5JRGA 4R8PC 2J8PA 4E45A 3AL0C 2JSSA 5JA4B 3WTPD 4KGCB 4XUJC 5AV6D 3MGRD 3KSYA 3WTPC 2IO5C 1P3AA 5AV6C 5BNVB 3KWQD 3MGRC 4X23C 3B6FD 2JE5A 2CWEA 3AZID 5GXQD 4KUDC 5KDMA 3A6NA 3KWQC 3B6FC 1Q9CA 2Y2IA 5B1MD 3AZIC 5GXQC 5F99B 3WA9B 4H9SA 4Z66B 3O62A 5B1MC 3X1TA 2FJ7A 3TU4B 3AV2A 1M19A 3LZ1B 3EG5B 3H0LC 3MGPA 3H0MC 5CPKB 3V9RA 1S32B 3UT9A 5JRGB 1M19D 1M18D 4DRAA 4XZQD 2LY8A 4UPKA 1TZYD 3NQJA 3MGQA 3EPJA 1M18C 5C3IB 3W99D 4XZQC 1P3AB 5CPIA 1P3MA 1TZYC 4UUZB 2PYOD 1HTAA 3VH5T 5KDMB 3W99C 3KXBA 4J8VA 3REKD 3A6NB 2PYOC 1F66D 3MNNB 4ZUXD 4G91B 1P3GA 3RELC 5DNNA 5B32D 1Z2CB 5AY8A 3REKC 5CPID 5BT1D 3WAAA 1F66C 3O62B 3AZLD 1EQZD 5E5AC 4ZUXC 5B24D 2NZDC 3KXBD 3X1TB 3W96D 5B32C 2NQBA 2FJ7B 3AFAA 3REIA 3AV2B 3LELD 5BT1C 3C1BA 3AZJA 2Y2MA 3AZLC 5AVBD 3AZKA 5B24C 1P3GD 3MGSA 1EQZC 4NE5A 3W96C 5FUGA 3MGPB 3AZGA 3LELC 5BS7A 4J8UD 1AOIA 3V9RB 5AVBC 5B31G 3MVDA 3UT9B 2Y2GA 1ZLAA 4J8UC 3AZKD 2BYKA 5GT0A 5AVCA 3AZHA 3NQJB 3MGQB 2CV5D 5DNMA 5AV9A 5B31D 1B67A 5CPIB 1P3MB 3AN2A 2CV5C 3WTPE 4H9QB 1P3KD 4H9OA 3W97A 5B31C 5AV5C 4J8VB 4NE3A 2F8NB 5AV8A 3KUYD 1ID3D 1P3KC 5DNNB 1BH9A 5AY8B 5GT3A 1P3FA 5B33A 4AWLB 3WAAB 3X1SD 3KUYC 1ID3C 3LJAA 3C1CA 2NQBB 2VQRA 3AFAB 1W2EA 4DRBA 3REIB 5AV8D 2L5AA 3C1BB 3AZJB 4LD9A 3X1SC 3MGSB 3AYWA 5FUGB 5GSUA 3AZGB 4HGAB 3AZMD 1P3BD 1AOIB 4WU8A 3B0DC 3C1CD 3MVDB 4G92B 1ZLAB 3AZEA 5B40D 4Z2MG 3AZMC 1P3BC 3REHD 1P3LA 3UTAD 5GT0B 5AVCB 4R8PA 3AZHB 5B40C 1KU5A 5DNMB 5AV9B 3REHC 3UTAC 1P3OD 4XUJA 3AN2B 3WTPA 4H9OB 3W97B 1P3OC 3REJC 1KX5D 5AV6A 3MGRA 3AZFD 4X23A 4EO5B 4KUDA 2DF4C 3EPLA 1KX5C 5B2JB 4KHAA 5GT3B 5CP6D 1P3FB 5B33B 3KWQA 3AZFC 3B6FA 4CSRA 1F1EA 5GXQA 3LJAB 3AZIA 3C1CB 4H9PA 5CP6C 4X23D 5B0YD 4LD9B 5B1MA 4KUDD 4QLCD 4JJNB 2AROD 3AYWB 5GSUB 4Z2MH 3P5JB 5B0YC 4WU8B 3WKJD 4QLCC 2AROC 4WJ3C 3X1VD 3AZEB 3WKJC 1P3LB 3AZND 4WU9D 4R8PB 3X1VC 1H3OA 1P3PD 3B6GD 3AZNC 4XUJB 2HIOD 4WU9C 1M18A 2F2AC 1P3PC 3WTPB 2IO5B 4XZQA 3B6GC 5AV6B 2HIOC 1TZYA 3MGRB 4X23B 3F6TA 3W99A 4KHAB 3KWQB 2PYOA 3B6FB 4CSRB 3AZIB 5GXQB 3RELA 4H9PB 3REKA 3AV1C 5C3IC 1F66A 5B1MB 5E5AA 4ZUXA 2NZDA 3VH6A 5B32A 5B32G 1U35D 3AZLA 1EQZA 5B24A 3RELD 3W96A 1M1AD 3UTBD 3LELA 4CAYA 3MNNC 5E5AD 1U35C 2NZDD 5AVBA 5B2ID 1M1AC 1H3OB 3B0BA 5CPJD 4J8WD 4J8UA 3UTBC 1JFIA 2F8NK 1P3PA 5B2IC 1KX3D 1P3ID 1M19B 4J8WC 5CPJC 1M18B 4XZQB 1KX3C 1TZYB 1P3IC 4DQYB 2CV5A 5B31A 1TAFA 3W99B 2PYOB 1P3KA 3REKB 1F66B 3KUYA 1ID3A 4ZUXB 4J8XD 4ZBJC 5AV5D 5B32B 4Z5TD 1HQ3D 2Y2OA 1P34D 4YM6D 3X1SA 3AZLB 1EQZB 5B24B 4M6BA 3KXBB 4J8XC 3W96B 4Z5TC 1HQ3C 3LELB 1P34C 4CAYB 4YM6C 5AVBB 1P3GB 3X1UD 1JFIB 2DQNC 4J8UB 3AZMA 1P3BA 1A7WA 4WZSB 3X1UC 5B1LD 1ULYA 3AZKB 5B40A 2RVQC 3REHA 3UTAA 4YS3D 5B1LC 1KX4D 3H0RC 2CV5B 2Y2QA 5B31B 1TAFB 1P3OA 2Y2JA 4YS3C 3REJA 4H9RA 1KX4C 3LZ0C 1P3KB 3B0CW 3W98D 2BYKB 1KX5A 5G49A 3AZFA 5BNXA 3KUYB 1ID3B 5B0ZD 3REJD 3W98C 2G5HC 5CP6A 2XD5A 3EPKA 3X1SB 2JCHA 5B0ZC 2RIQA 3VH6W 2XD1A 5AV8B 5B0YA 4KGCD 3B0DB 4QLCA 2AROA 1BH9B 5B2JC 5B33C 2BYMA 3AZMB 1P3BB 4KGCC 3WKJA 2HUEB 3FDDA 3X1VA 2YFWA 3IP4C 5B40B 4JJNC 3REHB 2ZY2A 3UTAB 3AZNA 4WU9A 3R45A 5F99D 3WA9D
chains in the Genus database with same CATH topology
3B6GA 5CHLB 1P3OB 4Z66D 2HIOA 4H9RB 5F99C 3TU4D 3WA9C 1KX5B 1WWIA 5G49B 4NFTA 4Z66C 3AZFB 3LZ1D 5BNXB 3TU4C 5CPKD 3AV1A 5CP6B 3LZ1C 1S32D 5JRGD 5CPKC 4UUZA 5B0YB 1S32C 4KUDB 1PZRA 1BFMA 5JRGC 4QLCB 2AROB 3AV1D 3MNNA 2BYMB 1U35A 1P3AD 2G5IC 3WKJB 3VH5A 1M1AA 5BO0A 3X1VB 3UTBA 2YFWB 1P3AC 3A6ND 3AZNB 5B2IA 4WU9B 3MNND 4J8WA 5CPJA 3R45B 1P3PB 1B6WA 3B6GB 3A6NC 1KX3A 2HIOB 3O62D 1P3IA 4G91C 3X1TD 2FJ7D 3AV2D 4H9SC 3O62C 2ZY3A 3X1TC 2FJ7C 2YFVA 3B0CT 3AV2C 3MGPD 3EPHA 1M19C 3AV1B 3UT9D 3MGPC 4H9QA 3UT9C 1R4VA 4J8XA 5AV5A 3MGQD 4Z5TA 1HQ3A 3VH6T 2F8NG 1P34A 2BG1A 4H9NA 2F8NA 4YM6A 2ZY5A 1U35B 3RELB 1P3MD 2UWXA 2ZM5A 3MGQC 1M1AB 5BO0B 3UTBB 2FFFB 5E5AB 2NZDB 4J8VD 5CPIC 1P3MC 1N1JA 5B2IB 3X1UA 2F8ND 3KFUG 4J8WB 5CPJB 5DNND 3NQUA 3KXBC 5AY8D 4J8VC 5B1LA 1KX3B 3WAAD 1P3IB 1P3GC 5DNNC 2NQBD 5AY8C 3AFAD 3REID 4YS3A 4AWLC 3WAAC 3C1BD 3AZJD 2ZY4A 2Y2HA 3MGSD 1KX4A 2RVQD 3LZ0A 2NQBC 2YFVB 3AFAC 3REIC 3AZGD 3C1BC 3AZJC 1AOID 3AZKC 3MGSC 3MVDD 4ZBJB 2F8NH 3W98A 3AZGC 4HGAC 1ZLAD 5BS7C 1AOIC 3LZ0D 3MVDC 4G92C 5GT0D 4WNNA 5B0ZA 5AVCD 5AV5B 4J8XB 3AZHD 1BH8A 1ZLAC 4Z5TB 1HQ3B 1P34B 4H9NB 5DNMD 5AV9D 4YM6B 2Y2NA 5GT0C 5AVCC 5B2JA 3AZHC 3AN2D 2Y2PA 5JA4A 5DNMC 5AV9C 3A1KA 3W97D 4KGCA 1N1JB 3X1UB 3AN2C 3VH5W 2Y2KA 3W97C 3NQUB 3A1IA 5B2JD 4JJNA 5GT3D 1P3FD 5BNVA 5B33D 5B1LB 5AV8C 1WWSA 4EO5C 3LJAD 5GT3C 1P3FC 4YS3B 4LD9D 1KX4B 4JJND 3LZ0B 3LJAC 3C1CC 5F99A 3AYWD 5GSUD 2HUEC 3WA9A 4WV4B 2W8SA 4Z66A 4LD9C 4WU8D 4E44A 3AYWC 2Y2LA 5GSUC 3TU4A 3W98B 3AZED 4WU8C 3LZ1A 1P3LD 4WNNB 5B0ZB 4R8PD 4NE6A 3REJB 5CPKA 1BH8B 3AZEC 1T3UA 1S32A 1P3LC 4XUJD 5JRGA 4R8PC 2J8PA 4E45A 3AL0C 2JSSA 5JA4B 3WTPD 4KGCB 4XUJC 5AV6D 3MGRD 3KSYA 3WTPC 2IO5C 1P3AA 5AV6C 5BNVB 3KWQD 3MGRC 4X23C 3B6FD 2JE5A 2CWEA 3AZID 5GXQD 4KUDC 5KDMA 3A6NA 3KWQC 3B6FC 1Q9CA 2Y2IA 5B1MD 3AZIC 5GXQC 5F99B 3WA9B 4H9SA 4Z66B 3O62A 5B1MC 3X1TA 2FJ7A 3TU4B 3AV2A 1M19A 3LZ1B 3EG5B 3H0LC 3MGPA 3H0MC 5CPKB 3V9RA 1S32B 3UT9A 5JRGB 1M19D 1M18D 4DRAA 4XZQD 2LY8A 4UPKA 1TZYD 3NQJA 3MGQA 3EPJA 1M18C 5C3IB 3W99D 4XZQC 1P3AB 5CPIA 1P3MA 1TZYC 4UUZB 2PYOD 1HTAA 3VH5T 5KDMB 3W99C 3KXBA 4J8VA 3REKD 3A6NB 2PYOC 1F66D 3MNNB 4ZUXD 4G91B 1P3GA 3RELC 5DNNA 5B32D 1Z2CB 5AY8A 3REKC 5CPID 5BT1D 3WAAA 1F66C 3O62B 3AZLD 1EQZD 5E5AC 4ZUXC 5B24D 2NZDC 3KXBD 3X1TB 3W96D 5B32C 2NQBA 2FJ7B 3AFAA 3REIA 3AV2B 3LELD 5BT1C 3C1BA 3AZJA 2Y2MA 3AZLC 5AVBD 3AZKA 5B24C 1P3GD 3MGSA 1EQZC 4NE5A 3W96C 5FUGA 3MGPB 3AZGA 3LELC 5BS7A 4J8UD 1AOIA 3V9RB 5AVBC 5B31G 3MVDA 3UT9B 2Y2GA 1ZLAA 4J8UC 3AZKD 2BYKA 5GT0A 5AVCA 3AZHA 3NQJB 3MGQB 2CV5D 5DNMA 5AV9A 5B31D 1B67A 5CPIB 1P3MB 3AN2A 2CV5C 3WTPE 4H9QB 1P3KD 4H9OA 3W97A 5B31C 5AV5C 4J8VB 4NE3A 2F8NB 5AV8A 3KUYD 1ID3D 1P3KC 5DNNB 1BH9A 5AY8B 5GT3A 1P3FA 5B33A 4AWLB 3WAAB 3X1SD 3KUYC 1ID3C 3LJAA 3C1CA 2NQBB 2VQRA 3AFAB 1W2EA 4DRBA 3REIB 5AV8D 2L5AA 3C1BB 3AZJB 4LD9A 3X1SC 3MGSB 3AYWA 5FUGB 5GSUA 3AZGB 4HGAB 3AZMD 1P3BD 1AOIB 4WU8A 3B0DC 3C1CD 3MVDB 4G92B 1ZLAB 3AZEA 5B40D 4Z2MG 3AZMC 1P3BC 3REHD 1P3LA 3UTAD 5GT0B 5AVCB 4R8PA 3AZHB 5B40C 1KU5A 5DNMB 5AV9B 3REHC 3UTAC 1P3OD 4XUJA 3AN2B 3WTPA 4H9OB 3W97B 1P3OC 3REJC 1KX5D 5AV6A 3MGRA 3AZFD 4X23A 4EO5B 4KUDA 2DF4C 3EPLA 1KX5C 5B2JB 4KHAA 5GT3B 5CP6D 1P3FB 5B33B 3KWQA 3AZFC 3B6FA 4CSRA 1F1EA 5GXQA 3LJAB 3AZIA 3C1CB 4H9PA 5CP6C 4X23D 5B0YD 4LD9B 5B1MA 4KUDD 4QLCD 4JJNB 2AROD 3AYWB 5GSUB 4Z2MH 3P5JB 5B0YC 4WU8B 3WKJD 4QLCC 2AROC 4WJ3C 3X1VD 3AZEB 3WKJC 1P3LB 3AZND 4WU9D 4R8PB 3X1VC 1H3OA 1P3PD 3B6GD 3AZNC 4XUJB 2HIOD 4WU9C 1M18A 2F2AC 1P3PC 3WTPB 2IO5B 4XZQA 3B6GC 5AV6B 2HIOC 1TZYA 3MGRB 4X23B 3F6TA 3W99A 4KHAB 3KWQB 2PYOA 3B6FB 4CSRB 3AZIB 5GXQB 3RELA 4H9PB 3REKA 3AV1C 5C3IC 1F66A 5B1MB 5E5AA 4ZUXA 2NZDA 3VH6A 5B32A 5B32G 1U35D 3AZLA 1EQZA 5B24A 3RELD 3W96A 1M1AD 3UTBD 3LELA 4CAYA 3MNNC 5E5AD 1U35C 2NZDD 5AVBA 5B2ID 1M1AC 1H3OB 3B0BA 5CPJD 4J8WD 4J8UA 3UTBC 1JFIA 2F8NK 1P3PA 5B2IC 1KX3D 1P3ID 1M19B 4J8WC 5CPJC 1M18B 4XZQB 1KX3C 1TZYB 1P3IC 4DQYB 2CV5A 5B31A 1TAFA 3W99B 2PYOB 1P3KA 3REKB 1F66B 3KUYA 1ID3A 4ZUXB 4J8XD 4ZBJC 5AV5D 5B32B 4Z5TD 1HQ3D 2Y2OA 1P34D 4YM6D 3X1SA 3AZLB 1EQZB 5B24B 4M6BA 3KXBB 4J8XC 3W96B 4Z5TC 1HQ3C 3LELB 1P34C 4CAYB 4YM6C 5AVBB 1P3GB 3X1UD 1JFIB 2DQNC 4J8UB 3AZMA 1P3BA 1A7WA 4WZSB 3X1UC 5B1LD 1ULYA 3AZKB 5B40A 2RVQC 3REHA 3UTAA 4YS3D 5B1LC 1KX4D 3H0RC 2CV5B 2Y2QA 5B31B 1TAFB 1P3OA 2Y2JA 4YS3C 3REJA 4H9RA 1KX4C 3LZ0C 1P3KB 3B0CW 3W98D 2BYKB 1KX5A 5G49A 3AZFA 5BNXA 3KUYB 1ID3B 5B0ZD 3REJD 3W98C 2G5HC 5CP6A 2XD5A 3EPKA 3X1SB 2JCHA 5B0ZC 2RIQA 3VH6W 2XD1A 5AV8B 5B0YA 4KGCD 3B0DB 4QLCA 2AROA 1BH9B 5B2JC 5B33C 2BYMA 3AZMB 1P3BB 4KGCC 3WKJA 2HUEB 3FDDA 3X1VA 2YFWA 3IP4C 5B40B 4JJNC 3REHB 2ZY2A 3UTAB 3AZNA 4WU9A 3R45A 5F99D 3WA9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6G A;  5CHL B;  1P3O B;  4Z66 D;  2HIO A;  4H9R B;  5F99 C;  3TU4 D;  3WA9 C;  1KX5 B;  1WWI A;  5G49 B;  4NFT A;  4Z66 C;  3AZF B;  3LZ1 D;  5BNX B;  3TU4 C;  5CPK D;  3AV1 A;  5CP6 B;  3LZ1 C;  1S32 D;  5JRG D;  5CPK C;  4UUZ A;  5B0Y B;  1S32 C;  4KUD B;  1BFM A;  5JRG C;  4QLC B;  2ARO B;  3AV1 D;  3MNN A;  2BYM B;  1U35 A;  1P3A D;  3WKJ B;  3VH5 A;  1M1A A;  5BO0 A;  3X1V B;  3UTB A;  2YFW B;  1P3A C;  3A6N D;  3AZN B;  5B2I A;  4WU9 B;  3MNN D;  4J8W A;  5CPJ A;  3R45 B;  1P3P B;  1B6W A;  3B6G B;  3A6N C;  1KX3 A;  2HIO B;  3O62 D;  1P3I A;  4G91 C;  3X1T D;  2FJ7 D;  3AV2 D;  4H9S C;  3O62 C;  3X1T C;  2FJ7 C;  2YFV A;  3B0C T;  3AV2 C;  3MGP D;  1M19 C;  3AV1 B;  3UT9 D;  3MGP C;  4H9Q A;  3UT9 C;  1R4V A;  4J8X A;  5AV5 A;  3MGQ D;  4Z5T A;  1HQ3 A;  3VH6 T;  2F8N G;  1P34 A;  4H9N A;  2F8N A;  4YM6 A;  1U35 B;  3REL B;  1P3M D;  3MGQ C;  1M1A B;  5BO0 B;  3UTB B;  5E5A B;  2NZD B;  4J8V D;  5CPI C;  1P3M C;  1N1J A;  5B2I B;  3X1U A;  2F8N D;  4J8W B;  5CPJ B;  5DNN D;  3NQU A;  3KXB C;  5AY8 D;  4J8V C;  5B1L A;  1KX3 B;  3WAA D;  1P3I B;  1P3G C;  5DNN C;  2NQB D;  5AY8 C;  3AFA D;  3REI D;  4YS3 A;  4AWL C;  3WAA C;  3C1B D;  3AZJ D;  3MGS D;  1KX4 A;  2RVQ D;  3LZ0 A;  2NQB C;  2YFV B;  3AFA C;  3REI C;  3AZG D;  3C1B C;  3AZJ C;  1AOI D;  3AZK C;  3MGS C;  3MVD D;  4ZBJ B;  2F8N H;  3W98 A;  3AZG C;  4HGA C;  1ZLA D;  5BS7 C;  1AOI C;  3LZ0 D;  3MVD C;  4G92 C;  5GT0 D;  4WNN A;  5B0Z A;  5AVC D;  5AV5 B;  4J8X B;  3AZH D;  1BH8 A;  1ZLA C;  4Z5T B;  1HQ3 B;  1P34 B;  4H9N B;  5DNM D;  5AV9 D;  4YM6 B;  5GT0 C;  5AVC C;  5B2J A;  3AZH C;  3AN2 D;  5JA4 A;  5DNM C;  5AV9 C;  3W97 D;  4KGC A;  1N1J B;  3X1U B;  3AN2 C;  3VH5 W;  3W97 C;  3NQU B;  4JJN A;  5B2J D;  5GT3 D;  1P3F D;  5BNV A;  5B33 D;  5B1L B;  5AV8 C;  1WWS A;  4EO5 C;  3LJA D;  5GT3 C;  1P3F C;  4YS3 B;  4LD9 D;  1KX4 B;  4JJN D;  3LZ0 B;  3LJA C;  3C1C C;  5F99 A;  3AYW D;  5GSU D;  2HUE C;  3WA9 A;  4WV4 B;  4Z66 A;  4LD9 C;  4WU8 D;  4E44 A;  3AYW C;  5GSU C;  3TU4 A;  3W98 B;  3AZE D;  4WU8 C;  3LZ1 A;  1P3L D;  4WNN B;  5B0Z B;  4R8P D;  4NE6 A;  3REJ B;  5CPK A;  1BH8 B;  3AZE C;  1S32 A;  1P3L C;  4XUJ D;  5JRG A;  4R8P C;  4E45 A;  2JSS A;  5JA4 B;  3WTP D;  4KGC B;  4XUJ C;  5AV6 D;  3MGR D;  3KSY A;  3WTP C;  2IO5 C;  1P3A A;  5AV6 C;  5BNV B;  3KWQ D;  3MGR C;  4X23 C;  3B6F D;  2CWE A;  3AZI D;  5GXQ D;  4KUD C;  5KDM A;  3A6N A;  3KWQ C;  3B6F C;  1Q9C A;  5B1M D;  3AZI C;  5GXQ C;  5F99 B;  3WA9 B;  4H9S A;  4Z66 B;  3O62 A;  5B1M C;  3X1T A;  2FJ7 A;  3TU4 B;  3AV2 A;  1M19 A;  3LZ1 B;  3MGP A;  5CPK B;  3V9R A;  1S32 B;  3UT9 A;  5JRG B;  1M19 D;  1M18 D;  4DRA A;  4XZQ D;  2LY8 A;  1TZY D;  3NQJ A;  3MGQ A;  1M18 C;  5C3I B;  3W99 D;  4XZQ C;  1P3A B;  5CPI A;  1P3M A;  1TZY C;  4UUZ B;  2PYO D;  1HTA A;  3VH5 T;  5KDM B;  3W99 C;  3KXB A;  4J8V A;  3REK D;  3A6N B;  2PYO C;  1F66 D;  3MNN B;  4ZUX D;  4G91 B;  1P3G A;  3REL C;  5DNN A;  5B32 D;  3REK C;  5AY8 A;  5CPI D;  5BT1 D;  3WAA A;  1F66 C;  3O62 B;  3AZL D;  1EQZ D;  5E5A C;  4ZUX C;  5B24 D;  2NZD C;  3KXB D;  3X1T B;  3W96 D;  5B32 C;  2NQB A;  2FJ7 B;  3AFA A;  3REI A;  3AV2 B;  3LEL D;  5BT1 C;  3C1B A;  3AZJ A;  3AZL C;  5AVB D;  3AZK A;  5B24 C;  1P3G D;  3MGS A;  1EQZ C;  4NE5 A;  3W96 C;  5FUG A;  3MGP B;  3AZG A;  3LEL C;  5BS7 A;  4J8U D;  1AOI A;  3V9R B;  5AVB C;  5B31 G;  3MVD A;  3UT9 B;  1ZLA A;  4J8U C;  3AZK D;  2BYK A;  5GT0 A;  5AVC A;  3AZH A;  3NQJ B;  3MGQ B;  2CV5 D;  5DNM A;  5AV9 A;  5B31 D;  1B67 A;  5CPI B;  1P3M B;  3AN2 A;  2CV5 C;  3WTP E;  4H9Q B;  1P3K D;  4H9O A;  3W97 A;  5B31 C;  5AV5 C;  4J8V B;  4NE3 A;  2F8N B;  5AV8 A;  3KUY D;  1ID3 D;  1P3K C;  5DNN B;  1BH9 A;  5AY8 B;  5GT3 A;  1P3F A;  5B33 A;  4AWL B;  3WAA B;  3X1S D;  3KUY C;  1ID3 C;  3LJA A;  3C1C A;  2NQB B;  3AFA B;  3REI B;  4DRB A;  5AV8 D;  2L5A A;  3C1B B;  3AZJ B;  4LD9 A;  3X1S C;  3MGS B;  3AYW A;  5FUG B;  5GSU A;  3AZG B;  4HGA B;  3AZM D;  1P3B D;  1AOI B;  4WU8 A;  3B0D C;  3C1C D;  3MVD B;  4G92 B;  1ZLA B;  3AZE A;  5B40 D;  4Z2M G;  3AZM C;  1P3B C;  3REH D;  1P3L A;  3UTA D;  5GT0 B;  5AVC B;  4R8P A;  3AZH B;  5B40 C;  1KU5 A;  5DNM B;  5AV9 B;  3REH C;  3UTA C;  1P3O D;  4XUJ A;  3AN2 B;  3WTP A;  4H9O B;  3W97 B;  1P3O C;  3REJ C;  1KX5 D;  5AV6 A;  3MGR A;  3AZF D;  4X23 A;  4EO5 B;  4KUD A;  1KX5 C;  5B2J B;  4KHA A;  5GT3 B;  5CP6 D;  1P3F B;  5B33 B;  3KWQ A;  3AZF C;  3B6F A;  4CSR A;  1F1E A;  5GXQ A;  3LJA B;  3AZI A;  3C1C B;  4H9P A;  5CP6 C;  4X23 D;  5B0Y D;  4LD9 B;  5B1M A;  4KUD D;  4QLC D;  4JJN B;  2ARO D;  3AYW B;  5GSU B;  4Z2M H;  5B0Y C;  4WU8 B;  3WKJ D;  4QLC C;  2ARO C;  3X1V D;  3AZE B;  3WKJ C;  1P3L B;  3AZN D;  4WU9 D;  4R8P B;  3X1V C;  1H3O A;  1P3P D;  3B6G D;  3AZN C;  4XUJ B;  2HIO D;  4WU9 C;  1M18 A;  1P3P C;  3WTP B;  2IO5 B;  4XZQ A;  3B6G C;  5AV6 B;  2HIO C;  1TZY A;  3MGR B;  4X23 B;  3W99 A;  4KHA B;  3KWQ B;  2PYO A;  3B6F B;  4CSR B;  3AZI B;  5GXQ B;  3REL A;  4H9P B;  3REK A;  3AV1 C;  5C3I C;  1F66 A;  5B1M B;  5E5A A;  4ZUX A;  2NZD A;  3VH6 A;  5B32 A;  5B32 G;  1U35 D;  3AZL A;  1EQZ A;  5B24 A;  3REL D;  3W96 A;  1M1A D;  3UTB D;  3LEL A;  4CAY A;  3MNN C;  5E5A D;  1U35 C;  2NZD D;  5AVB A;  5B2I D;  1M1A C;  1H3O B;  3B0B A;  5CPJ D;  4J8W D;  4J8U A;  3UTB C;  1JFI A;  2F8N K;  1P3P A;  5B2I C;  1KX3 D;  1P3I D;  1M19 B;  4J8W C;  5CPJ C;  1M18 B;  4XZQ B;  1KX3 C;  1TZY B;  1P3I C;  2CV5 A;  5B31 A;  1TAF A;  3W99 B;  2PYO B;  1P3K A;  3REK B;  1F66 B;  3KUY A;  1ID3 A;  4ZUX B;  4J8X D;  4ZBJ C;  5AV5 D;  5B32 B;  4Z5T D;  1HQ3 D;  1P34 D;  4YM6 D;  3X1S A;  3AZL B;  1EQZ B;  5B24 B;  4M6B A;  3KXB B;  4J8X C;  3W96 B;  4Z5T C;  1HQ3 C;  3LEL B;  1P34 C;  4CAY B;  4YM6 C;  5AVB B;  1P3G B;  3X1U D;  1JFI B;  4J8U B;  3AZM A;  1P3B A;  1A7W A;  4WZS B;  3X1U C;  5B1L D;  1ULY A;  3AZK B;  5B40 A;  2RVQ C;  3REH A;  3UTA A;  4YS3 D;  5B1L C;  1KX4 D;  2CV5 B;  5B31 B;  1TAF B;  1P3O A;  3REJ A;  4YS3 C;  4H9R A;  1KX4 C;  3LZ0 C;  1P3K B;  3B0C W;  3W98 D;  2BYK B;  1KX5 A;  5G49 A;  3AZF A;  5BNX A;  3KUY B;  1ID3 B;  5B0Z D;  3REJ D;  3W98 C;  5CP6 A;  3X1S B;  5B0Z C;  3VH6 W;  5AV8 B;  5B0Y A;  4KGC D;  3B0D B;  4QLC A;  2ARO A;  1BH9 B;  5B2J C;  5B33 C;  2BYM A;  3AZM B;  1P3B B;  4KGC C;  3WKJ A;  2HUE B;  3X1V A;  2YFW A;  5B40 B;  4JJN C;  3REH B;  3UTA B;  3AZN A;  4WU9 A;  3R45 A;  5F99 D;  3WA9 D; 
#chains in the Genus database with same CATH topology
 3B6G A;  5CHL B;  1P3O B;  4Z66 D;  2HIO A;  4H9R B;  5F99 C;  3TU4 D;  3WA9 C;  1KX5 B;  1WWI A;  5G49 B;  4NFT A;  4Z66 C;  3AZF B;  3LZ1 D;  5BNX B;  3TU4 C;  5CPK D;  3AV1 A;  5CP6 B;  3LZ1 C;  1S32 D;  5JRG D;  5CPK C;  4UUZ A;  5B0Y B;  1S32 C;  4KUD B;  1PZR A;  1BFM A;  5JRG C;  4QLC B;  2ARO B;  3AV1 D;  3MNN A;  2BYM B;  1U35 A;  1P3A D;  2G5I C;  3WKJ B;  3VH5 A;  1M1A A;  5BO0 A;  3X1V B;  3UTB A;  2YFW B;  1P3A C;  3A6N D;  3AZN B;  5B2I A;  4WU9 B;  3MNN D;  4J8W A;  5CPJ A;  3R45 B;  1P3P B;  1B6W A;  3B6G B;  3A6N C;  1KX3 A;  2HIO B;  3O62 D;  1P3I A;  4G91 C;  3X1T D;  2FJ7 D;  3AV2 D;  4H9S C;  3O62 C;  2ZY3 A;  3X1T C;  2FJ7 C;  2YFV A;  3B0C T;  3AV2 C;  3MGP D;  3EPH A;  1M19 C;  3AV1 B;  3UT9 D;  3MGP C;  4H9Q A;  3UT9 C;  1R4V A;  4J8X A;  5AV5 A;  3MGQ D;  4Z5T A;  1HQ3 A;  3VH6 T;  2F8N G;  1P34 A;  2BG1 A;  4H9N A;  2F8N A;  4YM6 A;  2ZY5 A;  1U35 B;  3REL B;  1P3M D;  2UWX A;  2ZM5 A;  3MGQ C;  1M1A B;  5BO0 B;  3UTB B;  2FFF B;  5E5A B;  2NZD B;  4J8V D;  5CPI C;  1P3M C;  1N1J A;  5B2I B;  3X1U A;  2F8N D;  3KFU G;  4J8W B;  5CPJ B;  5DNN D;  3NQU A;  3KXB C;  5AY8 D;  4J8V C;  5B1L A;  1KX3 B;  3WAA D;  1P3I B;  1P3G C;  5DNN C;  2NQB D;  5AY8 C;  3AFA D;  3REI D;  4YS3 A;  4AWL C;  3WAA C;  3C1B D;  3AZJ D;  2ZY4 A;  2Y2H A;  3MGS D;  1KX4 A;  2RVQ D;  3LZ0 A;  2NQB C;  2YFV B;  3AFA C;  3REI C;  3AZG D;  3C1B C;  3AZJ C;  1AOI D;  3AZK C;  3MGS C;  3MVD D;  4ZBJ B;  2F8N H;  3W98 A;  3AZG C;  4HGA C;  1ZLA D;  5BS7 C;  1AOI C;  3LZ0 D;  3MVD C;  4G92 C;  5GT0 D;  4WNN A;  5B0Z A;  5AVC D;  5AV5 B;  4J8X B;  3AZH D;  1BH8 A;  1ZLA C;  4Z5T B;  1HQ3 B;  1P34 B;  4H9N B;  5DNM D;  5AV9 D;  4YM6 B;  2Y2N A;  5GT0 C;  5AVC C;  5B2J A;  3AZH C;  3AN2 D;  2Y2P A;  5JA4 A;  5DNM C;  5AV9 C;  3A1K A;  3W97 D;  4KGC A;  1N1J B;  3X1U B;  3AN2 C;  3VH5 W;  2Y2K A;  3W97 C;  3NQU B;  3A1I A;  5B2J D;  4JJN A;  5GT3 D;  1P3F D;  5BNV A;  5B33 D;  5B1L B;  5AV8 C;  1WWS A;  4EO5 C;  3LJA D;  5GT3 C;  1P3F C;  4YS3 B;  4LD9 D;  1KX4 B;  4JJN D;  3LZ0 B;  3LJA C;  3C1C C;  5F99 A;  3AYW D;  5GSU D;  2HUE C;  3WA9 A;  4WV4 B;  2W8S A;  4Z66 A;  4LD9 C;  4WU8 D;  4E44 A;  3AYW C;  2Y2L A;  5GSU C;  3TU4 A;  3W98 B;  3AZE D;  4WU8 C;  3LZ1 A;  1P3L D;  4WNN B;  5B0Z B;  4R8P D;  4NE6 A;  3REJ B;  5CPK A;  1BH8 B;  3AZE C;  1T3U A;  1S32 A;  1P3L C;  4XUJ D;  5JRG A;  4R8P C;  2J8P A;  4E45 A;  3AL0 C;  2JSS A;  5JA4 B;  3WTP D;  4KGC B;  4XUJ C;  5AV6 D;  3MGR D;  3KSY A;  3WTP C;  2IO5 C;  1P3A A;  5AV6 C;  5BNV B;  3KWQ D;  3MGR C;  4X23 C;  3B6F D;  2JE5 A;  2CWE A;  3AZI D;  5GXQ D;  4KUD C;  5KDM A;  3A6N A;  3KWQ C;  3B6F C;  1Q9C A;  2Y2I A;  5B1M D;  3AZI C;  5GXQ C;  5F99 B;  3WA9 B;  4H9S A;  4Z66 B;  3O62 A;  5B1M C;  3X1T A;  2FJ7 A;  3TU4 B;  3AV2 A;  1M19 A;  3LZ1 B;  3EG5 B;  3H0L C;  3MGP A;  3H0M C;  5CPK B;  3V9R A;  1S32 B;  3UT9 A;  5JRG B;  1M19 D;  1M18 D;  4DRA A;  4XZQ D;  2LY8 A;  4UPK A;  1TZY D;  3NQJ A;  3MGQ A;  3EPJ A;  1M18 C;  5C3I B;  3W99 D;  4XZQ C;  1P3A B;  5CPI A;  1P3M A;  1TZY C;  4UUZ B;  2PYO D;  1HTA A;  3VH5 T;  5KDM B;  3W99 C;  3KXB A;  4J8V A;  3REK D;  3A6N B;  2PYO C;  1F66 D;  3MNN B;  4ZUX D;  4G91 B;  1P3G A;  3REL C;  5DNN A;  5B32 D;  1Z2C B;  5AY8 A;  3REK C;  5CPI D;  5BT1 D;  3WAA A;  1F66 C;  3O62 B;  3AZL D;  1EQZ D;  5E5A C;  4ZUX C;  5B24 D;  2NZD C;  3KXB D;  3X1T B;  3W96 D;  5B32 C;  2NQB A;  2FJ7 B;  3AFA A;  3REI A;  3AV2 B;  3LEL D;  5BT1 C;  3C1B A;  3AZJ A;  2Y2M A;  3AZL C;  5AVB D;  3AZK A;  5B24 C;  1P3G D;  3MGS A;  1EQZ C;  4NE5 A;  3W96 C;  5FUG A;  3MGP B;  3AZG A;  3LEL C;  5BS7 A;  4J8U D;  1AOI A;  3V9R B;  5AVB C;  5B31 G;  3MVD A;  3UT9 B;  2Y2G A;  1ZLA A;  4J8U C;  3AZK D;  2BYK A;  5GT0 A;  5AVC A;  3AZH A;  3NQJ B;  3MGQ B;  2CV5 D;  5DNM A;  5AV9 A;  5B31 D;  1B67 A;  5CPI B;  1P3M B;  3AN2 A;  2CV5 C;  3WTP E;  4H9Q B;  1P3K D;  4H9O A;  3W97 A;  5B31 C;  5AV5 C;  4J8V B;  4NE3 A;  2F8N B;  5AV8 A;  3KUY D;  1ID3 D;  1P3K C;  5DNN B;  1BH9 A;  5AY8 B;  5GT3 A;  1P3F A;  5B33 A;  4AWL B;  3WAA B;  3X1S D;  3KUY C;  1ID3 C;  3LJA A;  3C1C A;  2NQB B;  2VQR A;  3AFA B;  1W2E A;  4DRB A;  3REI B;  5AV8 D;  2L5A A;  3C1B B;  3AZJ B;  4LD9 A;  3X1S C;  3MGS B;  3AYW A;  5FUG B;  5GSU A;  3AZG B;  4HGA B;  3AZM D;  1P3B D;  1AOI B;  4WU8 A;  3B0D C;  3C1C D;  3MVD B;  4G92 B;  1ZLA B;  3AZE A;  5B40 D;  4Z2M G;  3AZM C;  1P3B C;  3REH D;  1P3L A;  3UTA D;  5GT0 B;  5AVC B;  4R8P A;  3AZH B;  5B40 C;  1KU5 A;  5DNM B;  5AV9 B;  3REH C;  3UTA C;  1P3O D;  4XUJ A;  3AN2 B;  3WTP A;  4H9O B;  3W97 B;  1P3O C;  3REJ C;  1KX5 D;  5AV6 A;  3MGR A;  3AZF D;  4X23 A;  4EO5 B;  4KUD A;  2DF4 C;  3EPL A;  1KX5 C;  5B2J B;  4KHA A;  5GT3 B;  5CP6 D;  1P3F B;  5B33 B;  3KWQ A;  3AZF C;  3B6F A;  4CSR A;  1F1E A;  5GXQ A;  3LJA B;  3AZI A;  3C1C B;  4H9P A;  5CP6 C;  4X23 D;  5B0Y D;  4LD9 B;  5B1M A;  4KUD D;  4QLC D;  4JJN B;  2ARO D;  3AYW B;  5GSU B;  4Z2M H;  3P5J B;  5B0Y C;  4WU8 B;  3WKJ D;  4QLC C;  2ARO C;  4WJ3 C;  3X1V D;  3AZE B;  3WKJ C;  1P3L B;  3AZN D;  4WU9 D;  4R8P B;  3X1V C;  1H3O A;  1P3P D;  3B6G D;  3AZN C;  4XUJ B;  2HIO D;  4WU9 C;  1M18 A;  2F2A C;  1P3P C;  3WTP B;  2IO5 B;  4XZQ A;  3B6G C;  5AV6 B;  2HIO C;  1TZY A;  3MGR B;  4X23 B;  3F6T A;  3W99 A;  4KHA B;  3KWQ B;  2PYO A;  3B6F B;  4CSR B;  3AZI B;  5GXQ B;  3REL A;  4H9P B;  3REK A;  3AV1 C;  5C3I C;  1F66 A;  5B1M B;  5E5A A;  4ZUX A;  2NZD A;  3VH6 A;  5B32 A;  5B32 G;  1U35 D;  3AZL A;  1EQZ A;  5B24 A;  3REL D;  3W96 A;  1M1A D;  3UTB D;  3LEL A;  4CAY A;  3MNN C;  5E5A D;  1U35 C;  2NZD D;  5AVB A;  5B2I D;  1M1A C;  1H3O B;  3B0B A;  5CPJ D;  4J8W D;  4J8U A;  3UTB C;  1JFI A;  2F8N K;  1P3P A;  5B2I C;  1KX3 D;  1P3I D;  1M19 B;  4J8W C;  5CPJ C;  1M18 B;  4XZQ B;  1KX3 C;  1TZY B;  1P3I C;  4DQY B;  2CV5 A;  5B31 A;  1TAF A;  3W99 B;  2PYO B;  1P3K A;  3REK B;  1F66 B;  3KUY A;  1ID3 A;  4ZUX B;  4J8X D;  4ZBJ C;  5AV5 D;  5B32 B;  4Z5T D;  1HQ3 D;  2Y2O A;  1P34 D;  4YM6 D;  3X1S A;  3AZL B;  1EQZ B;  5B24 B;  4M6B A;  3KXB B;  4J8X C;  3W96 B;  4Z5T C;  1HQ3 C;  3LEL B;  1P34 C;  4CAY B;  4YM6 C;  5AVB B;  1P3G B;  3X1U D;  1JFI B;  2DQN C;  4J8U B;  3AZM A;  1P3B A;  1A7W A;  4WZS B;  3X1U C;  5B1L D;  1ULY A;  3AZK B;  5B40 A;  2RVQ C;  3REH A;  3UTA A;  4YS3 D;  5B1L C;  1KX4 D;  3H0R C;  2CV5 B;  2Y2Q A;  5B31 B;  1TAF B;  1P3O A;  2Y2J A;  4YS3 C;  3REJ A;  4H9R A;  1KX4 C;  3LZ0 C;  1P3K B;  3B0C W;  3W98 D;  2BYK B;  1KX5 A;  5G49 A;  3AZF A;  5BNX A;  3KUY B;  1ID3 B;  5B0Z D;  3REJ D;  3W98 C;  2G5H C;  5CP6 A;  2XD5 A;  3EPK A;  3X1S B;  2JCH A;  5B0Z C;  2RIQ A;  3VH6 W;  2XD1 A;  5AV8 B;  5B0Y A;  4KGC D;  3B0D B;  4QLC A;  2ARO A;  1BH9 B;  5B2J C;  5B33 C;  2BYM A;  3AZM B;  1P3B B;  4KGC C;  3WKJ A;  2HUE B;  3FDD A;  3X1V A;  2YFW A;  3IP4 C;  5B40 B;  4JJN C;  3REH B;  2ZY2 A;  3UTA B;  3AZN A;  4WU9 A;  3R45 A;  5F99 D;  3WA9 D; 
#chains in the Genus database with same CATH homology
 3B6G A;  5CHL B;  1P3O B;  4Z66 D;  2HIO A;  4H9R B;  5F99 C;  3TU4 D;  3WA9 C;  1KX5 B;  1WWI A;  5G49 B;  4NFT A;  4Z66 C;  3AZF B;  3LZ1 D;  5BNX B;  3TU4 C;  5CPK D;  3AV1 A;  5CP6 B;  3LZ1 C;  1S32 D;  5JRG D;  5CPK C;  4UUZ A;  5B0Y B;  1S32 C;  4KUD B;  1PZR A;  1BFM A;  5JRG C;  4QLC B;  2ARO B;  3AV1 D;  3MNN A;  2BYM B;  1U35 A;  1P3A D;  2G5I C;  3WKJ B;  3VH5 A;  1M1A A;  5BO0 A;  3X1V B;  3UTB A;  2YFW B;  1P3A C;  3A6N D;  3AZN B;  5B2I A;  4WU9 B;  3MNN D;  4J8W A;  5CPJ A;  3R45 B;  1P3P B;  1B6W A;  3B6G B;  3A6N C;  1KX3 A;  2HIO B;  3O62 D;  1P3I A;  4G91 C;  3X1T D;  2FJ7 D;  3AV2 D;  4H9S C;  3O62 C;  2ZY3 A;  3X1T C;  2FJ7 C;  2YFV A;  3B0C T;  3AV2 C;  3MGP D;  3EPH A;  1M19 C;  3AV1 B;  3UT9 D;  3MGP C;  4H9Q A;  3UT9 C;  1R4V A;  4J8X A;  5AV5 A;  3MGQ D;  4Z5T A;  1HQ3 A;  3VH6 T;  2F8N G;  1P34 A;  2BG1 A;  4H9N A;  2F8N A;  4YM6 A;  2ZY5 A;  1U35 B;  3REL B;  1P3M D;  2UWX A;  2ZM5 A;  3MGQ C;  1M1A B;  5BO0 B;  3UTB B;  2FFF B;  5E5A B;  2NZD B;  4J8V D;  5CPI C;  1P3M C;  1N1J A;  5B2I B;  3X1U A;  2F8N D;  3KFU G;  4J8W B;  5CPJ B;  5DNN D;  3NQU A;  3KXB C;  5AY8 D;  4J8V C;  5B1L A;  1KX3 B;  3WAA D;  1P3I B;  1P3G C;  5DNN C;  2NQB D;  5AY8 C;  3AFA D;  3REI D;  4YS3 A;  4AWL C;  3WAA C;  3C1B D;  3AZJ D;  2ZY4 A;  2Y2H A;  3MGS D;  1KX4 A;  2RVQ D;  3LZ0 A;  2NQB C;  2YFV B;  3AFA C;  3REI C;  3AZG D;  3C1B C;  3AZJ C;  1AOI D;  3AZK C;  3MGS C;  3MVD D;  4ZBJ B;  2F8N H;  3W98 A;  3AZG C;  4HGA C;  1ZLA D;  5BS7 C;  1AOI C;  3LZ0 D;  3MVD C;  4G92 C;  5GT0 D;  4WNN A;  5B0Z A;  5AVC D;  5AV5 B;  4J8X B;  3AZH D;  1BH8 A;  1ZLA C;  4Z5T B;  1HQ3 B;  1P34 B;  4H9N B;  5DNM D;  5AV9 D;  4YM6 B;  2Y2N A;  5GT0 C;  5AVC C;  5B2J A;  3AZH C;  3AN2 D;  2Y2P A;  5JA4 A;  5DNM C;  5AV9 C;  3A1K A;  3W97 D;  4KGC A;  1N1J B;  3X1U B;  3AN2 C;  3VH5 W;  2Y2K A;  3W97 C;  3NQU B;  3A1I A;  5B2J D;  4JJN A;  5GT3 D;  1P3F D;  5BNV A;  5B33 D;  5B1L B;  5AV8 C;  1WWS A;  4EO5 C;  3LJA D;  5GT3 C;  1P3F C;  4YS3 B;  4LD9 D;  1KX4 B;  4JJN D;  3LZ0 B;  3LJA C;  3C1C C;  5F99 A;  3AYW D;  5GSU D;  2HUE C;  3WA9 A;  4WV4 B;  2W8S A;  4Z66 A;  4LD9 C;  4WU8 D;  4E44 A;  3AYW C;  2Y2L A;  5GSU C;  3TU4 A;  3W98 B;  3AZE D;  4WU8 C;  3LZ1 A;  1P3L D;  4WNN B;  5B0Z B;  4R8P D;  4NE6 A;  3REJ B;  5CPK A;  1BH8 B;  3AZE C;  1T3U A;  1S32 A;  1P3L C;  4XUJ D;  5JRG A;  4R8P C;  2J8P A;  4E45 A;  3AL0 C;  2JSS A;  5JA4 B;  3WTP D;  4KGC B;  4XUJ C;  5AV6 D;  3MGR D;  3KSY A;  3WTP C;  2IO5 C;  1P3A A;  5AV6 C;  5BNV B;  3KWQ D;  3MGR C;  4X23 C;  3B6F D;  2JE5 A;  2CWE A;  3AZI D;  5GXQ D;  4KUD C;  5KDM A;  3A6N A;  3KWQ C;  3B6F C;  1Q9C A;  2Y2I A;  5B1M D;  3AZI C;  5GXQ C;  5F99 B;  3WA9 B;  4H9S A;  4Z66 B;  3O62 A;  5B1M C;  3X1T A;  2FJ7 A;  3TU4 B;  3AV2 A;  1M19 A;  3LZ1 B;  3EG5 B;  3H0L C;  3MGP A;  3H0M C;  5CPK B;  3V9R A;  1S32 B;  3UT9 A;  5JRG B;  1M19 D;  1M18 D;  4DRA A;  4XZQ D;  2LY8 A;  4UPK A;  1TZY D;  3NQJ A;  3MGQ A;  3EPJ A;  1M18 C;  5C3I B;  3W99 D;  4XZQ C;  1P3A B;  5CPI A;  1P3M A;  1TZY C;  4UUZ B;  2PYO D;  1HTA A;  3VH5 T;  5KDM B;  3W99 C;  3KXB A;  4J8V A;  3REK D;  3A6N B;  2PYO C;  1F66 D;  3MNN B;  4ZUX D;  4G91 B;  1P3G A;  3REL C;  5DNN A;  5B32 D;  1Z2C B;  5AY8 A;  3REK C;  5CPI D;  5BT1 D;  3WAA A;  1F66 C;  3O62 B;  3AZL D;  1EQZ D;  5E5A C;  4ZUX C;  5B24 D;  2NZD C;  3KXB D;  3X1T B;  3W96 D;  5B32 C;  2NQB A;  2FJ7 B;  3AFA A;  3REI A;  3AV2 B;  3LEL D;  5BT1 C;  3C1B A;  3AZJ A;  2Y2M A;  3AZL C;  5AVB D;  3AZK A;  5B24 C;  1P3G D;  3MGS A;  1EQZ C;  4NE5 A;  3W96 C;  5FUG A;  3MGP B;  3AZG A;  3LEL C;  5BS7 A;  4J8U D;  1AOI A;  3V9R B;  5AVB C;  5B31 G;  3MVD A;  3UT9 B;  2Y2G A;  1ZLA A;  4J8U C;  3AZK D;  2BYK A;  5GT0 A;  5AVC A;  3AZH A;  3NQJ B;  3MGQ B;  2CV5 D;  5DNM A;  5AV9 A;  5B31 D;  1B67 A;  5CPI B;  1P3M B;  3AN2 A;  2CV5 C;  3WTP E;  4H9Q B;  1P3K D;  4H9O A;  3W97 A;  5B31 C;  5AV5 C;  4J8V B;  4NE3 A;  2F8N B;  5AV8 A;  3KUY D;  1ID3 D;  1P3K C;  5DNN B;  1BH9 A;  5AY8 B;  5GT3 A;  1P3F A;  5B33 A;  4AWL B;  3WAA B;  3X1S D;  3KUY C;  1ID3 C;  3LJA A;  3C1C A;  2NQB B;  2VQR A;  3AFA B;  1W2E A;  4DRB A;  3REI B;  5AV8 D;  2L5A A;  3C1B B;  3AZJ B;  4LD9 A;  3X1S C;  3MGS B;  3AYW A;  5FUG B;  5GSU A;  3AZG B;  4HGA B;  3AZM D;  1P3B D;  1AOI B;  4WU8 A;  3B0D C;  3C1C D;  3MVD B;  4G92 B;  1ZLA B;  3AZE A;  5B40 D;  4Z2M G;  3AZM C;  1P3B C;  3REH D;  1P3L A;  3UTA D;  5GT0 B;  5AVC B;  4R8P A;  3AZH B;  5B40 C;  1KU5 A;  5DNM B;  5AV9 B;  3REH C;  3UTA C;  1P3O D;  4XUJ A;  3AN2 B;  3WTP A;  4H9O B;  3W97 B;  1P3O C;  3REJ C;  1KX5 D;  5AV6 A;  3MGR A;  3AZF D;  4X23 A;  4EO5 B;  4KUD A;  2DF4 C;  3EPL A;  1KX5 C;  5B2J B;  4KHA A;  5GT3 B;  5CP6 D;  1P3F B;  5B33 B;  3KWQ A;  3AZF C;  3B6F A;  4CSR A;  1F1E A;  5GXQ A;  3LJA B;  3AZI A;  3C1C B;  4H9P A;  5CP6 C;  4X23 D;  5B0Y D;  4LD9 B;  5B1M A;  4KUD D;  4QLC D;  4JJN B;  2ARO D;  3AYW B;  5GSU B;  4Z2M H;  3P5J B;  5B0Y C;  4WU8 B;  3WKJ D;  4QLC C;  2ARO C;  4WJ3 C;  3X1V D;  3AZE B;  3WKJ C;  1P3L B;  3AZN D;  4WU9 D;  4R8P B;  3X1V C;  1H3O A;  1P3P D;  3B6G D;  3AZN C;  4XUJ B;  2HIO D;  4WU9 C;  1M18 A;  2F2A C;  1P3P C;  3WTP B;  2IO5 B;  4XZQ A;  3B6G C;  5AV6 B;  2HIO C;  1TZY A;  3MGR B;  4X23 B;  3F6T A;  3W99 A;  4KHA B;  3KWQ B;  2PYO A;  3B6F B;  4CSR B;  3AZI B;  5GXQ B;  3REL A;  4H9P B;  3REK A;  3AV1 C;  5C3I C;  1F66 A;  5B1M B;  5E5A A;  4ZUX A;  2NZD A;  3VH6 A;  5B32 A;  5B32 G;  1U35 D;  3AZL A;  1EQZ A;  5B24 A;  3REL D;  3W96 A;  1M1A D;  3UTB D;  3LEL A;  4CAY A;  3MNN C;  5E5A D;  1U35 C;  2NZD D;  5AVB A;  5B2I D;  1M1A C;  1H3O B;  3B0B A;  5CPJ D;  4J8W D;  4J8U A;  3UTB C;  1JFI A;  2F8N K;  1P3P A;  5B2I C;  1KX3 D;  1P3I D;  1M19 B;  4J8W C;  5CPJ C;  1M18 B;  4XZQ B;  1KX3 C;  1TZY B;  1P3I C;  4DQY B;  2CV5 A;  5B31 A;  1TAF A;  3W99 B;  2PYO B;  1P3K A;  3REK B;  1F66 B;  3KUY A;  1ID3 A;  4ZUX B;  4J8X D;  4ZBJ C;  5AV5 D;  5B32 B;  4Z5T D;  1HQ3 D;  2Y2O A;  1P34 D;  4YM6 D;  3X1S A;  3AZL B;  1EQZ B;  5B24 B;  4M6B A;  3KXB B;  4J8X C;  3W96 B;  4Z5T C;  1HQ3 C;  3LEL B;  1P34 C;  4CAY B;  4YM6 C;  5AVB B;  1P3G B;  3X1U D;  1JFI B;  2DQN C;  4J8U B;  3AZM A;  1P3B A;  1A7W A;  4WZS B;  3X1U C;  5B1L D;  1ULY A;  3AZK B;  5B40 A;  2RVQ C;  3REH A;  3UTA A;  4YS3 D;  5B1L C;  1KX4 D;  3H0R C;  2CV5 B;  2Y2Q A;  5B31 B;  1TAF B;  1P3O A;  2Y2J A;  4YS3 C;  3REJ A;  4H9R A;  1KX4 C;  3LZ0 C;  1P3K B;  3B0C W;  3W98 D;  2BYK B;  1KX5 A;  5G49 A;  3AZF A;  5BNX A;  3KUY B;  1ID3 B;  5B0Z D;  3REJ D;  3W98 C;  2G5H C;  5CP6 A;  2XD5 A;  3EPK A;  3X1S B;  2JCH A;  5B0Z C;  2RIQ A;  3VH6 W;  2XD1 A;  5AV8 B;  5B0Y A;  4KGC D;  3B0D B;  4QLC A;  2ARO A;  1BH9 B;  5B2J C;  5B33 C;  2BYM A;  3AZM B;  1P3B B;  4KGC C;  3WKJ A;  2HUE B;  3FDD A;  3X1V A;  2YFW A;  3IP4 C;  5B40 B;  4JJN C;  3REH B;  2ZY2 A;  3UTA B;  3AZN A;  4WU9 A;  3R45 A;  5F99 D;  3WA9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...