4YM6B

Crystal structure of the human nucleosome containing 6-4pp (outside)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural basis of pyrimidine-pyrimidone (6-4) photoproduct recognition by UV-DDB in the nucleosome
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ym6B00
3AZKB 3REID 1EQZD 3X1SB 4JJNA 5C3IB 1TZYB 1F66D 1HQ3B 1P3BA 3MGSB 5B33B 5B0ZC 4YM6D 3KWQB 1P3PD 3AV1B 5B2IA 4XUJC 3AZGA 5JA4A 1P3KC 4QLCD 3C1BA 4XZQA 4G91B 5GSUC 5CPJA 5GT0A 4KHAB 2F8NB 5B0ZA 4WNNA 1P3OD 4XUJA 2NZDC 2BYMA 3WTPE 2PYOD 1P3KB 3UT9C 4CAYB 5GSUB 1ID3D 3X1UA 5GT3B 1ZLAB 3UTBC 4J8VD 5B31G 5DNNA 1P3AD 1KX3A 5BT1D 3A6NB 3AZFD 5B2JD 4Z66C 1JFIA 2YFVA 3MVDC 3WA9D 4DRAA 3LZ0A 3UTAC 3B6GA 5B32D 2NZDB 3AZID 3W97D 5AY8C 2YFWB 3AZHC 5B24D 3REHB 4LD9C 5CP6C 3UTBA 3UT9B 4WU8B 4JJND 3R45A 2NQBB 3UTBB 5B1MC 1AOIC 1P3BD 3W99D 3LJAB 4H9RA 3LELC 3UTAA 4Z66B 5G49A 3MVDB 4J8UC 5B2ID 3AZGD 3AZHA 1M1AD 2F8NG 5CP6A 3TU4C 3O62C 5AY8B 1BH9B 3AZHB 3C1BD 4XZQD 4LD9B 5CPJD 5GT0D 5AV8B 1TAFB 5B1MA 3AZMC 3WTPC 4AWLC 5B0ZD 2IO5C 1F1EA 1AOIB 4J8UA 3LELB 4XUJD 3AN2A 4Z2MH 3AFAC 2HIOC 3B6FA 3NQUA 3TU4A 3O62A 3MGRA 3RELC 1H3OA 3WAAC 3AZMA 3WTPA 3X1UD 4X23C 3W98D 5DNMC 5DNND 3AYWC 5FUGB 1KX3D 2RVQD 4AWLB 1KX4A 3AZJC 3MGPC 3AFAA 1S32C 4R8PC 3LZ0D 3KXBD 3B6GD 2HIOB 4HGAC 3C1CC 4H9QB 5B31C 3W96C 3REKC 4YS3C 1N1JA 3RELB 4H9SC 4G92C 1M19C 3VH5W 3WKJC 3WAAB 1N1JB 4J8WB 4X23B 1M18C 3KUYC 3AZJA 5DNMB 3MGPA 3AYWB 1TZYC 1HQ3C 4R8PA 3AZLB 3UTAD 3AZJB 3MGPB 5GXQC 4KGCC 1S32B 3C1CA 1HTAA 2AROB 4CSRA 3W96A 3REKA 4YS3A 3AV1C 4HGAB 5CP6D 5B1LC 4H9SA 5JRGB 5B31B 5AVCC 1M19A 1P3GC 3WKJA 3AZKA 1KU5A 4G92B 2FJ7B 5B1MD 4G91C 1TZYA 1HQ3A 3KUYB 1M18B 4Z5TC 3MGSA 5GXQA 5B33A 4J8UD 1P3FD 2L5AA 5BS7C 5AV6C 3AN2D 3KWQA 5GXQB 4KGCB 3AV1A 3B6FD 3TU4D 3O62D 3MGRD 5B1LB 5AVCB 3AZMD 1P3GB 3WTPD 3X1VC 5B0YC 4DRBA 3MNNC 4KHAA 2F8NA 5GT3C 3MGQC 3VH6A 1ZLAC 1KX4D 4Z5TB 2BYKA 3AFAD 3A6NC 3AZNC 5AV6B 2BYKB 5B40C 3REJC 1P3KA 5CPIB 1P34B 4CAYA 5GSUA 3X1VB 4KUDC 3REHC 5GT3A 5B0YB 1ZLAA 5F99C 3MNNB 3AZJD 4WU8C 5E5AB 3V9RB 5AV5C 2NQBC 3A6NA 3MGQB 3AZNA 1P3MC 4R8PD 3LZ1B 3LJAC 3C1CD 3AZNB 4Z2MG 1U35B 5B40B 3AV2C 3REJB 3REKD 3W96D 4YS3D 2NZDA 2YFWA 1M19D 3VH5A 3WKJD 3B0CW 4KUDA 3REHA 3AZKD 5AV9C 3UT9A 4ZBJB 5AVBB 3X1SD 3X1TC 4WU8A 4KUDB 1TZYD 2NQBA 5CPKC 1WWSA 1HQ3D 5AV8C 5F99B 3MGSD 5B33D 3LJAA 5AV5B 1P3MB 4Z66A 3KWQD 3MVDA 3AV1D 4J8XC 4NE3A 3AV2B 5AV9A 5B32G 5AY8A 1BH9A 4LD9A 5AV9B 3X1TB 5AV8A 1TAFA 5BNVA 4WU9C 1BH8B 2F8ND 5CPKB 4WZSB 5BNVB 1AOIA 4ZUXC 3LELA 2CV5C 3VH6W 4J8XB 3REIC 1EQZC 1P3KD 1A7WA 4H9PB 1F66C 5GSUD 1P3LB 5GT3D 1ZLAD 4WU9B 5FUGA 4YM6C 3B0DC 4J8WC 4H9NB 3A6ND 3AZND 2CV5A 1P3PC 4WV4B 4ZUXB 2CV5B 4QLCC 3AZLC 2HIOA 2NZDD 4H9QA 3REIB 2AROC 4UUZB 1EQZB 3REHD 3RELA 5JRGC 3UT9D 1KX5C 3WAAA 4WU8D 1F66B 2NQBD 4J8WA 4X23A 3UTBD 1P3OC 5DNMA 2FJ7C 3AYWA 4YM6B 3LJAD 3B0DB 3AZLA 1P3PB 4Z66D 3MVDD 1S32A 2PYOC 4QLCB 2AROA 5KDMA 5JRGA 1KX5A 5AY8D 5B31A 3AZHD 1ID3C 2CWEA 5KDMB 4LD9D 4EO5B 1KX5B 5AV8D 1P3IC 2FJ7A 5B2JC 1P3OB 1M18A 3KUYA 1AOID 3WA9C 5B32C 3LELD 1R4VA 3AZIC 3KSYA 3W97C 4KGCA 5B24C 2PYOB 4JJNC 5B1LA 1ID3B 5AVCA 1P3IA 1P3GA 4J8VB 5CPIC 1P3AB 1P34C 1P3BC 3W99C 1P3IB 3AZFB 5B2JB 2CV5D 4Z5TA 5B2IC 5E5AC 3VH6T 3WA9B 5BS7A 4H9OB 5B32B 5AV6A 1M1AC 2F8NK 3LZ1C 3AZIB 3W97B 2HIOD 5B24B 3C1BC 4XZQC 1U35C 4NFTA 5CPJC 5GT0C 5CPIA 4JJNB 3RELD 1P34A 3W99A 3WAAD 3X1VA 5BNXA 5B0YA 4J8WD 4X23D 4ZBJC 5AVBC 3MNNA 1P3BB 3W99B 5DNMD 5E5AA 3AYWD 3V9RA 5BNXB 3MGQA 1M1AA 3AZLD 3LZ1A 5B2IB 3MGPD 3AZGB 5JA4B 3AZEC 1S32D 1M1AB 1U35A 5B40A 3REJA 2AROD 3C1BB 4XZQB 1WWIA 5JRGD 1KX5D 5B31D 3X1UC 5CPJB 5GT0B 3W98C 3VH5T 5DNNC 5AVBA 1KX3C 2JSSA 2RVQC 2FJ7D 5B0ZB 4WNNB 5F99A 3KUYD 1M18D 1Q9CA 4XUJB 5AV5A 3AZEA 3LZ0C 3KXBC 3B6GC 1P3MA 4NE5A 5GXQD 2BYMB 4KGCD 3AZEB 3AV2A 3W98A 5B1LD 5AVCD 3X1UB 1P3GD 1P3ID 4NE6A 3W98B 5DNNB 3X1TA 1KX3B 1BH8A 1P3LC 3NQJA 5CPKA 4E44A 4M6BA 3KXBA 2YFVB 1JFIB 4Z5TD 3NQJB 3LZ0B 3KXBB 3B6GB 5AV6D 1BFMA 4J8XA 5CPID 3R45B 1P34D 4H9PA 3X1VD 1P3LA 5B0YD 3MNND 4WU9A 1P3FC 4H9RB 5E5AD 3UTAB 3AN2C 4H9NA 5G49B 3MGQD 3LZ1D 3B6FC 3MGRC 4ZUXA 2HUEC 1B67A 1U35D 5B40D 3REJD 5CP6B 3REIA 4UUZA 1EQZA 5B1MB 5AVBD 1P3FA 1F66A 4KUDD 1KX4C 4EO5C 5F99D 4J8UB 1P3FB 4YM6A 5AV5D 3AZED 3AN2B 1P3PA 1P3MD 3B6FB 3NQUB 3TU4B 3O62B 3MGRB 2HUEB 4QLCA 3AV2D 1H3OB 3B0BA 3AZMB 3WTPB 3B0CT 1ULYA 2IO5B 5AV9D 3X1TD 5BO0A 1B6WA 4J8VC 1KX4B 5CPKD 1P3AC 1P3OA 5BT1C 5BO0B 3AFAB 3AZFC 2F8NH 2PYOA 4J8XD 3AZKC 3X1SC 4E45A 5C3IC 1ID3A 4J8VA 1P3LD 1P3AA 3MGSC 5B33C 4WU9D 3AZFA 5CHLB 5B2JA 4R8PB 2LY8A 3KWQC 3C1CB 3WA9A 4ZUXD 5B32A 4H9OA 4CSRB 3REKB 3W96B 4YS3B 3AZIA 3W97A 3AZGC 3X1SA 1M19B 5B24A 3WKJB
chains in the Genus database with same CATH superfamily
3AZKB 3REID 1EQZD 3X1SB 4JJNA 5C3IB 1TZYB 4UPKA 1F66D 1HQ3B 1P3BA 3MGSB 3EPHA 2JE5A 5B33B 5B0ZC 4YM6D 3KWQB 3KFUG 1P3PD 3AV1B 5B2IA 4XUJC 3AZGA 5JA4A 1P3KC 4QLCD 3C1BA 4XZQA 4G91B 5GSUC 5CPJA 5GT0A 4KHAB 2F8NB 5B0ZA 4WNNA 1P3OD 4XUJA 2NZDC 2BYMA 3WTPE 2PYOD 1P3KB 3UT9C 4CAYB 5GSUB 1ID3D 2Y2NA 3X1UA 5GT3B 1ZLAB 3UTBC 4J8VD 5B31G 5DNNA 1P3AD 1KX3A 5BT1D 3A6NB 3AZFD 5B2JD 4Z66C 1JFIA 2BG1A 2YFVA 3MVDC 4DQYB 3WA9D 4DRAA 3LZ0A 3UTAC 3B6GA 5B32D 2NZDB 3AZID 3W97D 5AY8C 2YFWB 3AZHC 5B24D 3A1KA 3REHB 4LD9C 5CP6C 3UTBA 3UT9B 4WU8B 4JJND 3R45A 2ZY3A 2NQBB 3EPJA 3UTBB 5B1MC 1AOIC 1P3BD 3W99D 3LJAB 4H9RA 3LELC 2Y2OA 3UTAA 4Z66B 5G49A 2Y2HA 2Y2LA 3MVDB 4J8UC 5B2ID 3AZGD 3AZHA 2Y2PA 1M1AD 2F8NG 5CP6A 3TU4C 3O62C 5AY8B 1BH9B 3AZHB 3C1BD 4XZQD 4LD9B 5CPJD 5GT0D 5AV8B 1TAFB 5B1MA 3AZMC 3WTPC 1W2EA 4AWLC 2ZY4A 5B0ZD 2IO5C 1F1EA 3FDDA 1AOIB 4J8UA 3LELB 4XUJD 3AN2A 1T3UA 4Z2MH 3AFAC 2HIOC 3B6FA 3NQUA 3TU4A 3O62A 3MGRA 3RELC 1H3OA 3WAAC 3AZMA 3WTPA 3X1UD 4X23C 3W98D 5DNMC 5DNND 3AYWC 5FUGB 1KX3D 2RVQD 4AWLB 1KX4A 3AZJC 3P5JB 3MGPC 3AFAA 1S32C 2XD1A 4R8PC 3LZ0D 3KXBD 3B6GD 2HIOB 4HGAC 3C1CC 4H9QB 5B31C 3F6TA 3W96C 3REKC 4YS3C 1N1JA 3RELB 4H9SC 4G92C 1M19C 3VH5W 3WKJC 3WAAB 1N1JB 4J8WB 4X23B 1M18C 3KUYC 3AZJA 5DNMB 3MGPA 3AYWB 1TZYC 1HQ3C 4R8PA 3AZLB 3UTAD 3AZJB 3MGPB 5GXQC 4KGCC 1S32B 2Y2JA 3C1CA 1HTAA 2AROB 4CSRA 3W96A 3REKA 4YS3A 3AV1C 4HGAB 5CP6D 5B1LC 2Y2QA 4H9SA 5JRGB 5B31B 5AVCC 1P3GC 1M19A 3WKJA 3AZKA 1KU5A 4G92B 2FJ7B 5B1MD 4G91C 1TZYA 1HQ3A 3KUYB 1M18B 4Z5TC 3EPLA 3MGSA 5GXQA 5B33A 4J8UD 1P3FD 2L5AA 5BS7C 5AV6C 3AN2D 3KWQA 5GXQB 4KGCB 3AV1A 3B6FD 3TU4D 3O62D 3MGRD 5B1LB 2UWXA 5AVCB 3AZMD 1P3GB 3WTPD 3X1VC 5B0YC 4DRBA 3MNNC 4KHAA 2F8NA 5GT3C 3MGQC 3VH6A 1ZLAC 1KX4D 4Z5TB 2BYKA 3AFAD 3A6NC 3AZNC 5AV6B 2BYKB 5B40C 3REJC 2G5HC 1P3KA 5CPIB 2JCHA 1P34B 1Z2CB 4CAYA 5GSUA 3X1VB 4KUDC 3REHC 5GT3A 5B0YB 3EG5B 1ZLAA 5F99C 3MNNB 3AZJD 4WU8C 5E5AB 3V9RB 5AV5C 2NQBC 3A6NA 3MGQB 3AZNA 1P3MC 4R8PD 3LZ1B 3LJAC 3C1CD 3AZNB 4Z2MG 1U35B 5B40B 3AV2C 3REJB 3REKD 3W96D 4YS3D 2NZDA 2YFWA 1M19D 3VH5A 3WKJD 3B0CW 4KUDA 3REHA 3AZKD 5AV9C 3UT9A 4ZBJB 5AVBB 3X1SD 2J8PA 3X1TC 4WU8A 4KUDB 1TZYD 2NQBA 5CPKC 1WWSA 1HQ3D 5AV8C 5F99B 3MGSD 5B33D 3LJAA 5AV5B 1P3MB 4Z66A 3KWQD 3MVDA 3AV1D 4J8XC 3H0LC 4NE3A 3AV2B 5AV9A 5B32G 5AY8A 1BH9A 2XD5A 4LD9A 5AV9B 3X1TB 5AV8A 1TAFA 5BNVA 4WU9C 1BH8B 2F8ND 5CPKB 4WZSB 5BNVB 1AOIA 4ZUXC 3IP4C 3LELA 2CV5C 3AL0C 3VH6W 4J8XB 2DF4C 3REIC 1EQZC 1P3KD 1A7WA 4H9PB 1F66C 5GSUD 1P3LB 5GT3D 1ZLAD 1PZRA 4WU9B 2FFFB 5FUGA 4YM6C 3B0DC 4J8WC 4H9NB 3A6ND 3AZND 2CV5A 1P3PC 4WV4B 4ZUXB 2CV5B 4QLCC 3AZLC 2HIOA 2NZDD 4H9QA 3REIB 2AROC 4UUZB 1EQZB 3REHD 3RELA 5JRGC 3UT9D 1KX5C 3WAAA 4WU8D 1F66B 2NQBD 4J8WA 4X23A 3UTBD 1P3OC 5DNMA 2FJ7C 3AYWA 4YM6B 3LJAD 3B0DB 3AZLA 2W8SA 1P3PB 4Z66D 3MVDD 1S32A 2PYOC 4QLCB 2AROA 5KDMA 5JRGA 1KX5A 5AY8D 5B31A 3AZHD 1ID3C 2CWEA 5KDMB 4LD9D 4EO5B 1KX5B 5AV8D 1P3IC 2FJ7A 5B2JC 2G5IC 1P3OB 1M18A 3KUYA 1AOID 3WA9C 5B32C 2Y2KA 3LELD 1R4VA 3AZIC 3KSYA 3W97C 4KGCA 5B24C 2PYOB 4JJNC 5B1LA 1ID3B 5AVCA 1P3IA 1P3GA 4J8VB 5CPIC 1P3AB 1P34C 1P3BC 3W99C 1P3IB 3AZFB 5B2JB 2CV5D 4Z5TA 5B2IC 5E5AC 3VH6T 3WA9B 5B32B 4H9OB 5BS7A 5AV6A 1M1AC 2F8NK 3LZ1C 3AZIB 3W97B 2HIOD 5B24B 3C1BC 4XZQC 1U35C 4NFTA 5CPJC 5GT0C 5CPIA 4JJNB 3RELD 1P34A 3W99A 3WAAD 2Y2MA 3X1VA 5BNXA 5B0YA 4J8WD 4X23D 4ZBJC 5AVBC 3MNNA 1P3BB 3W99B 5DNMD 2Y2IA 5E5AA 3V9RA 5BNXB 3AYWD 3MGQA 1M1AA 3AZLD 2ZY2A 3LZ1A 5B2IB 3MGPD 3AZGB 5JA4B 3AZEC 1S32D 1M1AB 1U35A 5B40A 3REJA 2AROD 3C1BB 4XZQB 1WWIA 5JRGD 1KX5D 5B31D 3X1UC 5CPJB 5GT0B 3W98C 3VH5T 5DNNC 5AVBA 3H0MC 1KX3C 2JSSA 2RVQC 2FJ7D 5B0ZB 2RIQA 4WNNB 2DQNC 5F99A 3KUYD 1M18D 3A1IA 1Q9CA 4XUJB 5AV5A 3AZEA 3LZ0C 3KXBC 3B6GC 1P3MA 4NE5A 5GXQD 2BYMB 4KGCD 3AZEB 3AV2A 3W98A 5B1LD 2Y2GA 3EPKA 2ZY5A 5AVCD 3X1UB 1P3GD 4NE6A 1P3ID 3W98B 5DNNB 3X1TA 1KX3B 1BH8A 1P3LC 3NQJA 5CPKA 4E44A 4M6BA 3KXBA 2YFVB 1JFIB 4Z5TD 3NQJB 3LZ0B 2VQRA 3KXBB 3B6GB 2ZM5A 5AV6D 1BFMA 4J8XA 5CPID 3R45B 1P34D 4H9PA 3X1VD 1P3LA 5B0YD 3MNND 4WU9A 1P3FC 4H9RB 5E5AD 3UTAB 3AN2C 4H9NA 5G49B 3MGQD 4WJ3C 3LZ1D 3B6FC 3MGRC 4ZUXA 2HUEC 1B67A 1U35D 5B40D 3REJD 5CP6B 3REIA 4UUZA 1EQZA 5B1MB 5AVBD 1P3FA 1F66A 4KUDD 1KX4C 4EO5C 5F99D 4J8UB 1P3FB 4YM6A 5AV5D 3AZED 3AN2B 1P3PA 1P3MD 3B6FB 3NQUB 3TU4B 3O62B 3MGRB 2HUEB 4QLCA 3AV2D 1H3OB 3B0BA 3AZMB 3WTPB 3B0CT 1ULYA 2IO5B 5AV9D 3X1TD 3H0RC 5BO0A 1B6WA 4J8VC 1KX4B 5CPKD 1P3AC 1P3OA 5BT1C 5BO0B 2F2AC 3AFAB 3AZFC 2F8NH 2PYOA 4J8XD 3AZKC 3X1SC 4E45A 5C3IC 1ID3A 4J8VA 1P3LD 1P3AA 3MGSC 5B33C 4WU9D 3AZFA 5CHLB 5B2JA 4R8PB 2LY8A 3KWQC 3C1CB 3WA9A 4ZUXD 5B32A 4H9OA 4CSRB 3REKB 3W96B 4YS3B 3AZIA 3W97A 3AZGC 3X1SA 1M19B 5B24A 3WKJB
chains in the Genus database with same CATH topology
3AZKB 3REID 1EQZD 3X1SB 4JJNA 5C3IB 1TZYB 4UPKA 1F66D 1HQ3B 1P3BA 3MGSB 3EPHA 2JE5A 5B33B 5B0ZC 4YM6D 3KWQB 3KFUG 1P3PD 3AV1B 5B2IA 4XUJC 3AZGA 5JA4A 1P3KC 4QLCD 3C1BA 4XZQA 4G91B 5GSUC 5CPJA 5GT0A 4KHAB 2F8NB 5B0ZA 4WNNA 1P3OD 4XUJA 2NZDC 2BYMA 3WTPE 2PYOD 1P3KB 3UT9C 4CAYB 5GSUB 1ID3D 2Y2NA 3X1UA 5GT3B 1ZLAB 3UTBC 4J8VD 5B31G 5DNNA 1P3AD 1KX3A 5BT1D 3A6NB 3AZFD 5B2JD 4Z66C 1JFIA 2BG1A 2YFVA 3MVDC 4DQYB 3WA9D 4DRAA 3LZ0A 3UTAC 3B6GA 5B32D 2NZDB 3AZID 3W97D 5AY8C 2YFWB 3AZHC 5B24D 3A1KA 3REHB 4LD9C 5CP6C 3UTBA 3UT9B 4WU8B 4JJND 3R45A 2ZY3A 2NQBB 3EPJA 3UTBB 5B1MC 1AOIC 1P3BD 3W99D 3LJAB 4H9RA 3LELC 2Y2OA 3UTAA 4Z66B 5G49A 2Y2HA 2Y2LA 3MVDB 4J8UC 5B2ID 3AZGD 3AZHA 2Y2PA 1M1AD 2F8NG 5CP6A 3TU4C 3O62C 5AY8B 1BH9B 3AZHB 3C1BD 4XZQD 4LD9B 5CPJD 5GT0D 5AV8B 1TAFB 5B1MA 3AZMC 3WTPC 1W2EA 4AWLC 2ZY4A 5B0ZD 2IO5C 1F1EA 3FDDA 1AOIB 4J8UA 3LELB 4XUJD 3AN2A 1T3UA 4Z2MH 3AFAC 2HIOC 3B6FA 3NQUA 3TU4A 3O62A 3MGRA 3RELC 1H3OA 3WAAC 3AZMA 3WTPA 3X1UD 4X23C 3W98D 5DNMC 5DNND 3AYWC 5FUGB 1KX3D 2RVQD 4AWLB 1KX4A 3AZJC 3P5JB 3MGPC 3AFAA 1S32C 2XD1A 4R8PC 3LZ0D 3KXBD 3B6GD 2HIOB 4HGAC 3C1CC 4H9QB 5B31C 3F6TA 3W96C 3REKC 4YS3C 1N1JA 3RELB 4H9SC 4G92C 1M19C 3VH5W 3WKJC 3WAAB 1N1JB 4J8WB 4X23B 1M18C 3KUYC 3AZJA 5DNMB 3MGPA 3AYWB 1TZYC 1HQ3C 4R8PA 3AZLB 3UTAD 3AZJB 3MGPB 5GXQC 4KGCC 1S32B 2Y2JA 3C1CA 1HTAA 2AROB 4CSRA 3W96A 3REKA 4YS3A 3AV1C 4HGAB 5CP6D 5B1LC 2Y2QA 4H9SA 5JRGB 5B31B 5AVCC 1P3GC 1M19A 3WKJA 3AZKA 1KU5A 4G92B 2FJ7B 5B1MD 4G91C 1TZYA 1HQ3A 3KUYB 1M18B 4Z5TC 3EPLA 3MGSA 5GXQA 5B33A 4J8UD 1P3FD 2L5AA 5BS7C 5AV6C 3AN2D 3KWQA 5GXQB 4KGCB 3AV1A 3B6FD 3TU4D 3O62D 3MGRD 5B1LB 2UWXA 5AVCB 3AZMD 1P3GB 3WTPD 3X1VC 5B0YC 4DRBA 3MNNC 4KHAA 2F8NA 5GT3C 3MGQC 3VH6A 1ZLAC 1KX4D 4Z5TB 2BYKA 3AFAD 3A6NC 3AZNC 5AV6B 2BYKB 5B40C 3REJC 2G5HC 1P3KA 5CPIB 2JCHA 1P34B 1Z2CB 4CAYA 5GSUA 3X1VB 4KUDC 3REHC 5GT3A 5B0YB 3EG5B 1ZLAA 5F99C 3MNNB 3AZJD 4WU8C 5E5AB 3V9RB 5AV5C 2NQBC 3A6NA 3MGQB 3AZNA 1P3MC 4R8PD 3LZ1B 3LJAC 3C1CD 3AZNB 4Z2MG 1U35B 5B40B 3AV2C 3REJB 3REKD 3W96D 4YS3D 2NZDA 2YFWA 1M19D 3VH5A 3WKJD 3B0CW 4KUDA 3REHA 3AZKD 5AV9C 3UT9A 4ZBJB 5AVBB 3X1SD 2J8PA 3X1TC 4WU8A 4KUDB 1TZYD 2NQBA 5CPKC 1WWSA 1HQ3D 5AV8C 5F99B 3MGSD 5B33D 3LJAA 5AV5B 1P3MB 4Z66A 3KWQD 3MVDA 3AV1D 4J8XC 3H0LC 4NE3A 3AV2B 5AV9A 5B32G 5AY8A 1BH9A 2XD5A 4LD9A 5AV9B 3X1TB 5AV8A 1TAFA 5BNVA 4WU9C 1BH8B 2F8ND 5CPKB 4WZSB 5BNVB 1AOIA 4ZUXC 3IP4C 3LELA 2CV5C 3AL0C 3VH6W 4J8XB 2DF4C 3REIC 1EQZC 1P3KD 1A7WA 4H9PB 1F66C 5GSUD 1P3LB 5GT3D 1ZLAD 1PZRA 4WU9B 2FFFB 5FUGA 4YM6C 3B0DC 4J8WC 4H9NB 3A6ND 3AZND 2CV5A 1P3PC 4WV4B 4ZUXB 2CV5B 4QLCC 3AZLC 2HIOA 2NZDD 4H9QA 3REIB 2AROC 4UUZB 1EQZB 3REHD 3RELA 5JRGC 3UT9D 1KX5C 3WAAA 4WU8D 1F66B 2NQBD 4J8WA 4X23A 3UTBD 1P3OC 5DNMA 2FJ7C 3AYWA 4YM6B 3LJAD 3B0DB 3AZLA 2W8SA 1P3PB 4Z66D 3MVDD 1S32A 2PYOC 4QLCB 2AROA 5KDMA 5JRGA 1KX5A 5AY8D 5B31A 3AZHD 1ID3C 2CWEA 5KDMB 4LD9D 4EO5B 1KX5B 5AV8D 1P3IC 2FJ7A 5B2JC 2G5IC 1P3OB 1M18A 3KUYA 1AOID 3WA9C 5B32C 2Y2KA 3LELD 1R4VA 3AZIC 3KSYA 3W97C 4KGCA 5B24C 2PYOB 4JJNC 5B1LA 1ID3B 5AVCA 1P3IA 1P3GA 4J8VB 5CPIC 1P3AB 1P34C 1P3BC 3W99C 1P3IB 3AZFB 5B2JB 2CV5D 4Z5TA 5B2IC 5E5AC 3VH6T 3WA9B 5B32B 4H9OB 5BS7A 5AV6A 1M1AC 2F8NK 3LZ1C 3AZIB 3W97B 2HIOD 5B24B 3C1BC 4XZQC 1U35C 4NFTA 5CPJC 5GT0C 5CPIA 4JJNB 3RELD 1P34A 3W99A 3WAAD 2Y2MA 3X1VA 5BNXA 5B0YA 4J8WD 4X23D 4ZBJC 5AVBC 3MNNA 1P3BB 3W99B 5DNMD 2Y2IA 5E5AA 3V9RA 5BNXB 3AYWD 3MGQA 1M1AA 3AZLD 2ZY2A 3LZ1A 5B2IB 3MGPD 3AZGB 5JA4B 3AZEC 1S32D 1M1AB 1U35A 5B40A 3REJA 2AROD 3C1BB 4XZQB 1WWIA 5JRGD 1KX5D 5B31D 3X1UC 5CPJB 5GT0B 3W98C 3VH5T 5DNNC 5AVBA 3H0MC 1KX3C 2JSSA 2RVQC 2FJ7D 5B0ZB 2RIQA 4WNNB 2DQNC 5F99A 3KUYD 1M18D 3A1IA 1Q9CA 4XUJB 5AV5A 3AZEA 3LZ0C 3KXBC 3B6GC 1P3MA 4NE5A 5GXQD 2BYMB 4KGCD 3AZEB 3AV2A 3W98A 5B1LD 2Y2GA 3EPKA 2ZY5A 5AVCD 3X1UB 1P3GD 4NE6A 1P3ID 3W98B 5DNNB 3X1TA 1KX3B 1BH8A 1P3LC 3NQJA 5CPKA 4E44A 4M6BA 3KXBA 2YFVB 1JFIB 4Z5TD 3NQJB 3LZ0B 2VQRA 3KXBB 3B6GB 2ZM5A 5AV6D 1BFMA 4J8XA 5CPID 3R45B 1P34D 4H9PA 3X1VD 1P3LA 5B0YD 3MNND 4WU9A 1P3FC 4H9RB 5E5AD 3UTAB 3AN2C 4H9NA 5G49B 3MGQD 4WJ3C 3LZ1D 3B6FC 3MGRC 4ZUXA 2HUEC 1B67A 1U35D 5B40D 3REJD 5CP6B 3REIA 4UUZA 1EQZA 5B1MB 5AVBD 1P3FA 1F66A 4KUDD 1KX4C 4EO5C 5F99D 4J8UB 1P3FB 4YM6A 5AV5D 3AZED 3AN2B 1P3PA 1P3MD 3B6FB 3NQUB 3TU4B 3O62B 3MGRB 2HUEB 4QLCA 3AV2D 1H3OB 3B0BA 3AZMB 3WTPB 3B0CT 1ULYA 2IO5B 5AV9D 3X1TD 3H0RC 5BO0A 1B6WA 4J8VC 1KX4B 5CPKD 1P3AC 1P3OA 5BT1C 5BO0B 2F2AC 3AFAB 3AZFC 2F8NH 2PYOA 4J8XD 3AZKC 3X1SC 4E45A 5C3IC 1ID3A 4J8VA 1P3LD 1P3AA 3MGSC 5B33C 4WU9D 3AZFA 5CHLB 5B2JA 4R8PB 2LY8A 3KWQC 3C1CB 3WA9A 4ZUXD 5B32A 4H9OA 4CSRB 3REKB 3W96B 4YS3B 3AZIA 3W97A 3AZGC 3X1SA 1M19B 5B24A 3WKJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZK B;  3REI D;  1EQZ D;  3X1S B;  4JJN A;  5C3I B;  1TZY B;  1F66 D;  1HQ3 B;  1P3B A;  3MGS B;  5B33 B;  5B0Z C;  4YM6 D;  3KWQ B;  1P3P D;  3AV1 B;  5B2I A;  4XUJ C;  3AZG A;  5JA4 A;  1P3K C;  4QLC D;  3C1B A;  4XZQ A;  4G91 B;  5GSU C;  5CPJ A;  5GT0 A;  4KHA B;  2F8N B;  5B0Z A;  4WNN A;  1P3O D;  4XUJ A;  2NZD C;  2BYM A;  3WTP E;  2PYO D;  1P3K B;  3UT9 C;  4CAY B;  5GSU B;  1ID3 D;  3X1U A;  5GT3 B;  1ZLA B;  3UTB C;  4J8V D;  5B31 G;  5DNN A;  1P3A D;  1KX3 A;  5BT1 D;  3A6N B;  3AZF D;  5B2J D;  4Z66 C;  1JFI A;  2YFV A;  3MVD C;  3WA9 D;  4DRA A;  3LZ0 A;  3UTA C;  3B6G A;  5B32 D;  2NZD B;  3AZI D;  3W97 D;  5AY8 C;  2YFW B;  3AZH C;  5B24 D;  3REH B;  4LD9 C;  5CP6 C;  3UTB A;  3UT9 B;  4WU8 B;  4JJN D;  3R45 A;  2NQB B;  3UTB B;  5B1M C;  1AOI C;  1P3B D;  3W99 D;  3LJA B;  4H9R A;  3LEL C;  3UTA A;  4Z66 B;  5G49 A;  3MVD B;  4J8U C;  5B2I D;  3AZG D;  3AZH A;  1M1A D;  2F8N G;  5CP6 A;  3TU4 C;  3O62 C;  5AY8 B;  1BH9 B;  3AZH B;  3C1B D;  4XZQ D;  4LD9 B;  5CPJ D;  5GT0 D;  5AV8 B;  1TAF B;  5B1M A;  3AZM C;  3WTP C;  4AWL C;  5B0Z D;  2IO5 C;  1F1E A;  1AOI B;  4J8U A;  3LEL B;  4XUJ D;  3AN2 A;  4Z2M H;  3AFA C;  2HIO C;  3B6F A;  3NQU A;  3TU4 A;  3O62 A;  3MGR A;  3REL C;  1H3O A;  3WAA C;  3AZM A;  3WTP A;  3X1U D;  4X23 C;  3W98 D;  5DNM C;  5DNN D;  3AYW C;  5FUG B;  1KX3 D;  2RVQ D;  4AWL B;  1KX4 A;  3AZJ C;  3MGP C;  3AFA A;  1S32 C;  4R8P C;  3LZ0 D;  3KXB D;  3B6G D;  2HIO B;  4HGA C;  3C1C C;  4H9Q B;  5B31 C;  3W96 C;  3REK C;  4YS3 C;  1N1J A;  3REL B;  4H9S C;  4G92 C;  1M19 C;  3VH5 W;  3WKJ C;  3WAA B;  1N1J B;  4J8W B;  4X23 B;  1M18 C;  3KUY C;  3AZJ A;  5DNM B;  3MGP A;  3AYW B;  1TZY C;  1HQ3 C;  4R8P A;  3AZL B;  3UTA D;  3AZJ B;  3MGP B;  5GXQ C;  4KGC C;  1S32 B;  3C1C A;  1HTA A;  2ARO B;  4CSR A;  3W96 A;  3REK A;  4YS3 A;  3AV1 C;  4HGA B;  5CP6 D;  5B1L C;  4H9S A;  5JRG B;  5B31 B;  5AVC C;  1M19 A;  1P3G C;  3WKJ A;  3AZK A;  1KU5 A;  4G92 B;  2FJ7 B;  5B1M D;  4G91 C;  1TZY A;  1HQ3 A;  3KUY B;  1M18 B;  4Z5T C;  3MGS A;  5GXQ A;  5B33 A;  4J8U D;  1P3F D;  2L5A A;  5BS7 C;  5AV6 C;  3AN2 D;  3KWQ A;  5GXQ B;  4KGC B;  3AV1 A;  3B6F D;  3TU4 D;  3O62 D;  3MGR D;  5B1L B;  5AVC B;  3AZM D;  1P3G B;  3WTP D;  3X1V C;  5B0Y C;  4DRB A;  3MNN C;  4KHA A;  2F8N A;  5GT3 C;  3MGQ C;  3VH6 A;  1ZLA C;  1KX4 D;  4Z5T B;  2BYK A;  3AFA D;  3A6N C;  3AZN C;  5AV6 B;  2BYK B;  5B40 C;  3REJ C;  1P3K A;  5CPI B;  1P34 B;  4CAY A;  5GSU A;  3X1V B;  4KUD C;  3REH C;  5GT3 A;  5B0Y B;  1ZLA A;  5F99 C;  3MNN B;  3AZJ D;  4WU8 C;  5E5A B;  3V9R B;  5AV5 C;  2NQB C;  3A6N A;  3MGQ B;  3AZN A;  1P3M C;  4R8P D;  3LZ1 B;  3LJA C;  3C1C D;  3AZN B;  4Z2M G;  1U35 B;  5B40 B;  3AV2 C;  3REJ B;  3REK D;  3W96 D;  4YS3 D;  2NZD A;  2YFW A;  1M19 D;  3VH5 A;  3WKJ D;  3B0C W;  4KUD A;  3REH A;  3AZK D;  5AV9 C;  3UT9 A;  4ZBJ B;  5AVB B;  3X1S D;  3X1T C;  4WU8 A;  4KUD B;  1TZY D;  2NQB A;  5CPK C;  1WWS A;  1HQ3 D;  5AV8 C;  5F99 B;  3MGS D;  5B33 D;  3LJA A;  5AV5 B;  1P3M B;  4Z66 A;  3KWQ D;  3MVD A;  3AV1 D;  4J8X C;  4NE3 A;  3AV2 B;  5AV9 A;  5B32 G;  5AY8 A;  1BH9 A;  4LD9 A;  5AV9 B;  3X1T B;  5AV8 A;  1TAF A;  5BNV A;  4WU9 C;  1BH8 B;  2F8N D;  5CPK B;  4WZS B;  5BNV B;  1AOI A;  4ZUX C;  3LEL A;  2CV5 C;  3VH6 W;  4J8X B;  3REI C;  1EQZ C;  1P3K D;  1A7W A;  4H9P B;  1F66 C;  5GSU D;  1P3L B;  5GT3 D;  1ZLA D;  4WU9 B;  5FUG A;  4YM6 C;  3B0D C;  4J8W C;  4H9N B;  3A6N D;  3AZN D;  2CV5 A;  1P3P C;  4WV4 B;  4ZUX B;  2CV5 B;  4QLC C;  3AZL C;  2HIO A;  2NZD D;  4H9Q A;  3REI B;  2ARO C;  4UUZ B;  1EQZ B;  3REH D;  3REL A;  5JRG C;  3UT9 D;  1KX5 C;  3WAA A;  4WU8 D;  1F66 B;  2NQB D;  4J8W A;  4X23 A;  3UTB D;  1P3O C;  5DNM A;  2FJ7 C;  3AYW A;  4YM6 B;  3LJA D;  3B0D B;  3AZL A;  1P3P B;  4Z66 D;  3MVD D;  1S32 A;  2PYO C;  4QLC B;  2ARO A;  5KDM A;  5JRG A;  1KX5 A;  5AY8 D;  5B31 A;  3AZH D;  1ID3 C;  2CWE A;  5KDM B;  4LD9 D;  4EO5 B;  1KX5 B;  5AV8 D;  1P3I C;  2FJ7 A;  5B2J C;  1P3O B;  1M18 A;  3KUY A;  1AOI D;  3WA9 C;  5B32 C;  3LEL D;  1R4V A;  3AZI C;  3KSY A;  3W97 C;  4KGC A;  5B24 C;  2PYO B;  4JJN C;  5B1L A;  1ID3 B;  5AVC A;  1P3I A;  1P3G A;  4J8V B;  5CPI C;  1P3A B;  1P34 C;  1P3B C;  3W99 C;  1P3I B;  3AZF B;  5B2J B;  2CV5 D;  4Z5T A;  5B2I C;  5E5A C;  3VH6 T;  3WA9 B;  5BS7 A;  4H9O B;  5B32 B;  5AV6 A;  1M1A C;  2F8N K;  3LZ1 C;  3AZI B;  3W97 B;  2HIO D;  5B24 B;  3C1B C;  4XZQ C;  1U35 C;  4NFT A;  5CPJ C;  5GT0 C;  5CPI A;  4JJN B;  3REL D;  1P34 A;  3W99 A;  3WAA D;  3X1V A;  5BNX A;  5B0Y A;  4J8W D;  4X23 D;  4ZBJ C;  5AVB C;  3MNN A;  1P3B B;  3W99 B;  5DNM D;  5E5A A;  3AYW D;  3V9R A;  5BNX B;  3MGQ A;  1M1A A;  3AZL D;  3LZ1 A;  5B2I B;  3MGP D;  3AZG B;  5JA4 B;  3AZE C;  1S32 D;  1M1A B;  1U35 A;  5B40 A;  3REJ A;  2ARO D;  3C1B B;  4XZQ B;  1WWI A;  5JRG D;  1KX5 D;  5B31 D;  3X1U C;  5CPJ B;  5GT0 B;  3W98 C;  3VH5 T;  5DNN C;  5AVB A;  1KX3 C;  2JSS A;  2RVQ C;  2FJ7 D;  5B0Z B;  4WNN B;  5F99 A;  3KUY D;  1M18 D;  1Q9C A;  4XUJ B;  5AV5 A;  3AZE A;  3LZ0 C;  3KXB C;  3B6G C;  1P3M A;  4NE5 A;  5GXQ D;  2BYM B;  4KGC D;  3AZE B;  3AV2 A;  3W98 A;  5B1L D;  5AVC D;  3X1U B;  1P3G D;  1P3I D;  4NE6 A;  3W98 B;  5DNN B;  3X1T A;  1KX3 B;  1BH8 A;  1P3L C;  3NQJ A;  5CPK A;  4E44 A;  4M6B A;  3KXB A;  2YFV B;  1JFI B;  4Z5T D;  3NQJ B;  3LZ0 B;  3KXB B;  3B6G B;  5AV6 D;  1BFM A;  4J8X A;  5CPI D;  3R45 B;  1P34 D;  4H9P A;  3X1V D;  1P3L A;  5B0Y D;  3MNN D;  4WU9 A;  1P3F C;  4H9R B;  5E5A D;  3UTA B;  3AN2 C;  4H9N A;  5G49 B;  3MGQ D;  3LZ1 D;  3B6F C;  3MGR C;  4ZUX A;  2HUE C;  1B67 A;  1U35 D;  5B40 D;  3REJ D;  5CP6 B;  3REI A;  4UUZ A;  1EQZ A;  5B1M B;  5AVB D;  1P3F A;  1F66 A;  4KUD D;  1KX4 C;  4EO5 C;  5F99 D;  4J8U B;  1P3F B;  4YM6 A;  5AV5 D;  3AZE D;  3AN2 B;  1P3P A;  1P3M D;  3B6F B;  3NQU B;  3TU4 B;  3O62 B;  3MGR B;  2HUE B;  4QLC A;  3AV2 D;  1H3O B;  3B0B A;  3AZM B;  3WTP B;  3B0C T;  1ULY A;  2IO5 B;  5AV9 D;  3X1T D;  5BO0 A;  1B6W A;  4J8V C;  1KX4 B;  5CPK D;  1P3A C;  1P3O A;  5BT1 C;  5BO0 B;  3AFA B;  3AZF C;  2F8N H;  2PYO A;  4J8X D;  3AZK C;  3X1S C;  4E45 A;  5C3I C;  1ID3 A;  4J8V A;  1P3L D;  1P3A A;  3MGS C;  5B33 C;  4WU9 D;  3AZF A;  5CHL B;  5B2J A;  4R8P B;  2LY8 A;  3KWQ C;  3C1C B;  3WA9 A;  4ZUX D;  5B32 A;  4H9O A;  4CSR B;  3REK B;  3W96 B;  4YS3 B;  3AZI A;  3W97 A;  3AZG C;  3X1S A;  1M19 B;  5B24 A;  3WKJ B; 
#chains in the Genus database with same CATH topology
 3AZK B;  3REI D;  1EQZ D;  3X1S B;  4JJN A;  5C3I B;  1TZY B;  4UPK A;  1F66 D;  1HQ3 B;  1P3B A;  3MGS B;  3EPH A;  2JE5 A;  5B33 B;  5B0Z C;  4YM6 D;  3KWQ B;  3KFU G;  1P3P D;  3AV1 B;  5B2I A;  4XUJ C;  3AZG A;  5JA4 A;  1P3K C;  4QLC D;  3C1B A;  4XZQ A;  4G91 B;  5GSU C;  5CPJ A;  5GT0 A;  4KHA B;  2F8N B;  5B0Z A;  4WNN A;  1P3O D;  4XUJ A;  2NZD C;  2BYM A;  3WTP E;  2PYO D;  1P3K B;  3UT9 C;  4CAY B;  5GSU B;  1ID3 D;  2Y2N A;  3X1U A;  5GT3 B;  1ZLA B;  3UTB C;  4J8V D;  5B31 G;  5DNN A;  1P3A D;  1KX3 A;  5BT1 D;  3A6N B;  3AZF D;  5B2J D;  4Z66 C;  1JFI A;  2BG1 A;  2YFV A;  3MVD C;  4DQY B;  3WA9 D;  4DRA A;  3LZ0 A;  3UTA C;  3B6G A;  5B32 D;  2NZD B;  3AZI D;  3W97 D;  5AY8 C;  2YFW B;  3AZH C;  5B24 D;  3A1K A;  3REH B;  4LD9 C;  5CP6 C;  3UTB A;  3UT9 B;  4WU8 B;  4JJN D;  3R45 A;  2ZY3 A;  2NQB B;  3EPJ A;  3UTB B;  5B1M C;  1AOI C;  1P3B D;  3W99 D;  3LJA B;  4H9R A;  3LEL C;  2Y2O A;  3UTA A;  4Z66 B;  5G49 A;  2Y2H A;  2Y2L A;  3MVD B;  4J8U C;  5B2I D;  3AZG D;  3AZH A;  2Y2P A;  1M1A D;  2F8N G;  5CP6 A;  3TU4 C;  3O62 C;  5AY8 B;  1BH9 B;  3AZH B;  3C1B D;  4XZQ D;  4LD9 B;  5CPJ D;  5GT0 D;  5AV8 B;  1TAF B;  5B1M A;  3AZM C;  3WTP C;  1W2E A;  4AWL C;  2ZY4 A;  5B0Z D;  2IO5 C;  1F1E A;  3FDD A;  1AOI B;  4J8U A;  3LEL B;  4XUJ D;  3AN2 A;  1T3U A;  4Z2M H;  3AFA C;  2HIO C;  3B6F A;  3NQU A;  3TU4 A;  3O62 A;  3MGR A;  3REL C;  1H3O A;  3WAA C;  3AZM A;  3WTP A;  3X1U D;  4X23 C;  3W98 D;  5DNM C;  5DNN D;  3AYW C;  5FUG B;  1KX3 D;  2RVQ D;  4AWL B;  1KX4 A;  3AZJ C;  3P5J B;  3MGP C;  3AFA A;  1S32 C;  2XD1 A;  4R8P C;  3LZ0 D;  3KXB D;  3B6G D;  2HIO B;  4HGA C;  3C1C C;  4H9Q B;  5B31 C;  3F6T A;  3W96 C;  3REK C;  4YS3 C;  1N1J A;  3REL B;  4H9S C;  4G92 C;  1M19 C;  3VH5 W;  3WKJ C;  3WAA B;  1N1J B;  4J8W B;  4X23 B;  1M18 C;  3KUY C;  3AZJ A;  5DNM B;  3MGP A;  3AYW B;  1TZY C;  1HQ3 C;  4R8P A;  3AZL B;  3UTA D;  3AZJ B;  3MGP B;  5GXQ C;  4KGC C;  1S32 B;  2Y2J A;  3C1C A;  1HTA A;  2ARO B;  4CSR A;  3W96 A;  3REK A;  4YS3 A;  3AV1 C;  4HGA B;  5CP6 D;  5B1L C;  2Y2Q A;  4H9S A;  5JRG B;  5B31 B;  5AVC C;  1P3G C;  1M19 A;  3WKJ A;  3AZK A;  1KU5 A;  4G92 B;  2FJ7 B;  5B1M D;  4G91 C;  1TZY A;  1HQ3 A;  3KUY B;  1M18 B;  4Z5T C;  3EPL A;  3MGS A;  5GXQ A;  5B33 A;  4J8U D;  1P3F D;  2L5A A;  5BS7 C;  5AV6 C;  3AN2 D;  3KWQ A;  5GXQ B;  4KGC B;  3AV1 A;  3B6F D;  3TU4 D;  3O62 D;  3MGR D;  5B1L B;  2UWX A;  5AVC B;  3AZM D;  1P3G B;  3WTP D;  3X1V C;  5B0Y C;  4DRB A;  3MNN C;  4KHA A;  2F8N A;  5GT3 C;  3MGQ C;  3VH6 A;  1ZLA C;  1KX4 D;  4Z5T B;  2BYK A;  3AFA D;  3A6N C;  3AZN C;  5AV6 B;  2BYK B;  5B40 C;  3REJ C;  2G5H C;  1P3K A;  5CPI B;  2JCH A;  1P34 B;  1Z2C B;  4CAY A;  5GSU A;  3X1V B;  4KUD C;  3REH C;  5GT3 A;  5B0Y B;  3EG5 B;  1ZLA A;  5F99 C;  3MNN B;  3AZJ D;  4WU8 C;  5E5A B;  3V9R B;  5AV5 C;  2NQB C;  3A6N A;  3MGQ B;  3AZN A;  1P3M C;  4R8P D;  3LZ1 B;  3LJA C;  3C1C D;  3AZN B;  4Z2M G;  1U35 B;  5B40 B;  3AV2 C;  3REJ B;  3REK D;  3W96 D;  4YS3 D;  2NZD A;  2YFW A;  1M19 D;  3VH5 A;  3WKJ D;  3B0C W;  4KUD A;  3REH A;  3AZK D;  5AV9 C;  3UT9 A;  4ZBJ B;  5AVB B;  3X1S D;  2J8P A;  3X1T C;  4WU8 A;  4KUD B;  1TZY D;  2NQB A;  5CPK C;  1WWS A;  1HQ3 D;  5AV8 C;  5F99 B;  3MGS D;  5B33 D;  3LJA A;  5AV5 B;  1P3M B;  4Z66 A;  3KWQ D;  3MVD A;  3AV1 D;  4J8X C;  3H0L C;  4NE3 A;  3AV2 B;  5AV9 A;  5B32 G;  5AY8 A;  1BH9 A;  2XD5 A;  4LD9 A;  5AV9 B;  3X1T B;  5AV8 A;  1TAF A;  5BNV A;  4WU9 C;  1BH8 B;  2F8N D;  5CPK B;  4WZS B;  5BNV B;  1AOI A;  4ZUX C;  3IP4 C;  3LEL A;  2CV5 C;  3AL0 C;  3VH6 W;  4J8X B;  2DF4 C;  3REI C;  1EQZ C;  1P3K D;  1A7W A;  4H9P B;  1F66 C;  5GSU D;  1P3L B;  5GT3 D;  1ZLA D;  1PZR A;  4WU9 B;  2FFF B;  5FUG A;  4YM6 C;  3B0D C;  4J8W C;  4H9N B;  3A6N D;  3AZN D;  2CV5 A;  1P3P C;  4WV4 B;  4ZUX B;  2CV5 B;  4QLC C;  3AZL C;  2HIO A;  2NZD D;  4H9Q A;  3REI B;  2ARO C;  4UUZ B;  1EQZ B;  3REH D;  3REL A;  5JRG C;  3UT9 D;  1KX5 C;  3WAA A;  4WU8 D;  1F66 B;  2NQB D;  4J8W A;  4X23 A;  3UTB D;  1P3O C;  5DNM A;  2FJ7 C;  3AYW A;  4YM6 B;  3LJA D;  3B0D B;  3AZL A;  2W8S A;  1P3P B;  4Z66 D;  3MVD D;  1S32 A;  2PYO C;  4QLC B;  2ARO A;  5KDM A;  5JRG A;  1KX5 A;  5AY8 D;  5B31 A;  3AZH D;  1ID3 C;  2CWE A;  5KDM B;  4LD9 D;  4EO5 B;  1KX5 B;  5AV8 D;  1P3I C;  2FJ7 A;  5B2J C;  2G5I C;  1P3O B;  1M18 A;  3KUY A;  1AOI D;  3WA9 C;  5B32 C;  2Y2K A;  3LEL D;  1R4V A;  3AZI C;  3KSY A;  3W97 C;  4KGC A;  5B24 C;  2PYO B;  4JJN C;  5B1L A;  1ID3 B;  5AVC A;  1P3I A;  1P3G A;  4J8V B;  5CPI C;  1P3A B;  1P34 C;  1P3B C;  3W99 C;  1P3I B;  3AZF B;  5B2J B;  2CV5 D;  4Z5T A;  5B2I C;  5E5A C;  3VH6 T;  3WA9 B;  5B32 B;  4H9O B;  5BS7 A;  5AV6 A;  1M1A C;  2F8N K;  3LZ1 C;  3AZI B;  3W97 B;  2HIO D;  5B24 B;  3C1B C;  4XZQ C;  1U35 C;  4NFT A;  5CPJ C;  5GT0 C;  5CPI A;  4JJN B;  3REL D;  1P34 A;  3W99 A;  3WAA D;  2Y2M A;  3X1V A;  5BNX A;  5B0Y A;  4J8W D;  4X23 D;  4ZBJ C;  5AVB C;  3MNN A;  1P3B B;  3W99 B;  5DNM D;  2Y2I A;  5E5A A;  3V9R A;  5BNX B;  3AYW D;  3MGQ A;  1M1A A;  3AZL D;  2ZY2 A;  3LZ1 A;  5B2I B;  3MGP D;  3AZG B;  5JA4 B;  3AZE C;  1S32 D;  1M1A B;  1U35 A;  5B40 A;  3REJ A;  2ARO D;  3C1B B;  4XZQ B;  1WWI A;  5JRG D;  1KX5 D;  5B31 D;  3X1U C;  5CPJ B;  5GT0 B;  3W98 C;  3VH5 T;  5DNN C;  5AVB A;  3H0M C;  1KX3 C;  2JSS A;  2RVQ C;  2FJ7 D;  5B0Z B;  2RIQ A;  4WNN B;  2DQN C;  5F99 A;  3KUY D;  1M18 D;  3A1I A;  1Q9C A;  4XUJ B;  5AV5 A;  3AZE A;  3LZ0 C;  3KXB C;  3B6G C;  1P3M A;  4NE5 A;  5GXQ D;  2BYM B;  4KGC D;  3AZE B;  3AV2 A;  3W98 A;  5B1L D;  2Y2G A;  3EPK A;  2ZY5 A;  5AVC D;  3X1U B;  1P3G D;  4NE6 A;  1P3I D;  3W98 B;  5DNN B;  3X1T A;  1KX3 B;  1BH8 A;  1P3L C;  3NQJ A;  5CPK A;  4E44 A;  4M6B A;  3KXB A;  2YFV B;  1JFI B;  4Z5T D;  3NQJ B;  3LZ0 B;  2VQR A;  3KXB B;  3B6G B;  2ZM5 A;  5AV6 D;  1BFM A;  4J8X A;  5CPI D;  3R45 B;  1P34 D;  4H9P A;  3X1V D;  1P3L A;  5B0Y D;  3MNN D;  4WU9 A;  1P3F C;  4H9R B;  5E5A D;  3UTA B;  3AN2 C;  4H9N A;  5G49 B;  3MGQ D;  4WJ3 C;  3LZ1 D;  3B6F C;  3MGR C;  4ZUX A;  2HUE C;  1B67 A;  1U35 D;  5B40 D;  3REJ D;  5CP6 B;  3REI A;  4UUZ A;  1EQZ A;  5B1M B;  5AVB D;  1P3F A;  1F66 A;  4KUD D;  1KX4 C;  4EO5 C;  5F99 D;  4J8U B;  1P3F B;  4YM6 A;  5AV5 D;  3AZE D;  3AN2 B;  1P3P A;  1P3M D;  3B6F B;  3NQU B;  3TU4 B;  3O62 B;  3MGR B;  2HUE B;  4QLC A;  3AV2 D;  1H3O B;  3B0B A;  3AZM B;  3WTP B;  3B0C T;  1ULY A;  2IO5 B;  5AV9 D;  3X1T D;  3H0R C;  5BO0 A;  1B6W A;  4J8V C;  1KX4 B;  5CPK D;  1P3A C;  1P3O A;  5BT1 C;  5BO0 B;  2F2A C;  3AFA B;  3AZF C;  2F8N H;  2PYO A;  4J8X D;  3AZK C;  3X1S C;  4E45 A;  5C3I C;  1ID3 A;  4J8V A;  1P3L D;  1P3A A;  3MGS C;  5B33 C;  4WU9 D;  3AZF A;  5CHL B;  5B2J A;  4R8P B;  2LY8 A;  3KWQ C;  3C1C B;  3WA9 A;  4ZUX D;  5B32 A;  4H9O A;  4CSR B;  3REK B;  3W96 B;  4YS3 B;  3AZI A;  3W97 A;  3AZG C;  3X1S A;  1M19 B;  5B24 A;  3WKJ B; 
#chains in the Genus database with same CATH homology
 3AZK B;  3REI D;  1EQZ D;  3X1S B;  4JJN A;  5C3I B;  1TZY B;  4UPK A;  1F66 D;  1HQ3 B;  1P3B A;  3MGS B;  3EPH A;  2JE5 A;  5B33 B;  5B0Z C;  4YM6 D;  3KWQ B;  3KFU G;  1P3P D;  3AV1 B;  5B2I A;  4XUJ C;  3AZG A;  5JA4 A;  1P3K C;  4QLC D;  3C1B A;  4XZQ A;  4G91 B;  5GSU C;  5CPJ A;  5GT0 A;  4KHA B;  2F8N B;  5B0Z A;  4WNN A;  1P3O D;  4XUJ A;  2NZD C;  2BYM A;  3WTP E;  2PYO D;  1P3K B;  3UT9 C;  4CAY B;  5GSU B;  1ID3 D;  2Y2N A;  3X1U A;  5GT3 B;  1ZLA B;  3UTB C;  4J8V D;  5B31 G;  5DNN A;  1P3A D;  1KX3 A;  5BT1 D;  3A6N B;  3AZF D;  5B2J D;  4Z66 C;  1JFI A;  2BG1 A;  2YFV A;  3MVD C;  4DQY B;  3WA9 D;  4DRA A;  3LZ0 A;  3UTA C;  3B6G A;  5B32 D;  2NZD B;  3AZI D;  3W97 D;  5AY8 C;  2YFW B;  3AZH C;  5B24 D;  3A1K A;  3REH B;  4LD9 C;  5CP6 C;  3UTB A;  3UT9 B;  4WU8 B;  4JJN D;  3R45 A;  2ZY3 A;  2NQB B;  3EPJ A;  3UTB B;  5B1M C;  1AOI C;  1P3B D;  3W99 D;  3LJA B;  4H9R A;  3LEL C;  2Y2O A;  3UTA A;  4Z66 B;  5G49 A;  2Y2H A;  2Y2L A;  3MVD B;  4J8U C;  5B2I D;  3AZG D;  3AZH A;  2Y2P A;  1M1A D;  2F8N G;  5CP6 A;  3TU4 C;  3O62 C;  5AY8 B;  1BH9 B;  3AZH B;  3C1B D;  4XZQ D;  4LD9 B;  5CPJ D;  5GT0 D;  5AV8 B;  1TAF B;  5B1M A;  3AZM C;  3WTP C;  1W2E A;  4AWL C;  2ZY4 A;  5B0Z D;  2IO5 C;  1F1E A;  3FDD A;  1AOI B;  4J8U A;  3LEL B;  4XUJ D;  3AN2 A;  1T3U A;  4Z2M H;  3AFA C;  2HIO C;  3B6F A;  3NQU A;  3TU4 A;  3O62 A;  3MGR A;  3REL C;  1H3O A;  3WAA C;  3AZM A;  3WTP A;  3X1U D;  4X23 C;  3W98 D;  5DNM C;  5DNN D;  3AYW C;  5FUG B;  1KX3 D;  2RVQ D;  4AWL B;  1KX4 A;  3AZJ C;  3P5J B;  3MGP C;  3AFA A;  1S32 C;  2XD1 A;  4R8P C;  3LZ0 D;  3KXB D;  3B6G D;  2HIO B;  4HGA C;  3C1C C;  4H9Q B;  5B31 C;  3F6T A;  3W96 C;  3REK C;  4YS3 C;  1N1J A;  3REL B;  4H9S C;  4G92 C;  1M19 C;  3VH5 W;  3WKJ C;  3WAA B;  1N1J B;  4J8W B;  4X23 B;  1M18 C;  3KUY C;  3AZJ A;  5DNM B;  3MGP A;  3AYW B;  1TZY C;  1HQ3 C;  4R8P A;  3AZL B;  3UTA D;  3AZJ B;  3MGP B;  5GXQ C;  4KGC C;  1S32 B;  2Y2J A;  3C1C A;  1HTA A;  2ARO B;  4CSR A;  3W96 A;  3REK A;  4YS3 A;  3AV1 C;  4HGA B;  5CP6 D;  5B1L C;  2Y2Q A;  4H9S A;  5JRG B;  5B31 B;  5AVC C;  1P3G C;  1M19 A;  3WKJ A;  3AZK A;  1KU5 A;  4G92 B;  2FJ7 B;  5B1M D;  4G91 C;  1TZY A;  1HQ3 A;  3KUY B;  1M18 B;  4Z5T C;  3EPL A;  3MGS A;  5GXQ A;  5B33 A;  4J8U D;  1P3F D;  2L5A A;  5BS7 C;  5AV6 C;  3AN2 D;  3KWQ A;  5GXQ B;  4KGC B;  3AV1 A;  3B6F D;  3TU4 D;  3O62 D;  3MGR D;  5B1L B;  2UWX A;  5AVC B;  3AZM D;  1P3G B;  3WTP D;  3X1V C;  5B0Y C;  4DRB A;  3MNN C;  4KHA A;  2F8N A;  5GT3 C;  3MGQ C;  3VH6 A;  1ZLA C;  1KX4 D;  4Z5T B;  2BYK A;  3AFA D;  3A6N C;  3AZN C;  5AV6 B;  2BYK B;  5B40 C;  3REJ C;  2G5H C;  1P3K A;  5CPI B;  2JCH A;  1P34 B;  1Z2C B;  4CAY A;  5GSU A;  3X1V B;  4KUD C;  3REH C;  5GT3 A;  5B0Y B;  3EG5 B;  1ZLA A;  5F99 C;  3MNN B;  3AZJ D;  4WU8 C;  5E5A B;  3V9R B;  5AV5 C;  2NQB C;  3A6N A;  3MGQ B;  3AZN A;  1P3M C;  4R8P D;  3LZ1 B;  3LJA C;  3C1C D;  3AZN B;  4Z2M G;  1U35 B;  5B40 B;  3AV2 C;  3REJ B;  3REK D;  3W96 D;  4YS3 D;  2NZD A;  2YFW A;  1M19 D;  3VH5 A;  3WKJ D;  3B0C W;  4KUD A;  3REH A;  3AZK D;  5AV9 C;  3UT9 A;  4ZBJ B;  5AVB B;  3X1S D;  2J8P A;  3X1T C;  4WU8 A;  4KUD B;  1TZY D;  2NQB A;  5CPK C;  1WWS A;  1HQ3 D;  5AV8 C;  5F99 B;  3MGS D;  5B33 D;  3LJA A;  5AV5 B;  1P3M B;  4Z66 A;  3KWQ D;  3MVD A;  3AV1 D;  4J8X C;  3H0L C;  4NE3 A;  3AV2 B;  5AV9 A;  5B32 G;  5AY8 A;  1BH9 A;  2XD5 A;  4LD9 A;  5AV9 B;  3X1T B;  5AV8 A;  1TAF A;  5BNV A;  4WU9 C;  1BH8 B;  2F8N D;  5CPK B;  4WZS B;  5BNV B;  1AOI A;  4ZUX C;  3IP4 C;  3LEL A;  2CV5 C;  3AL0 C;  3VH6 W;  4J8X B;  2DF4 C;  3REI C;  1EQZ C;  1P3K D;  1A7W A;  4H9P B;  1F66 C;  5GSU D;  1P3L B;  5GT3 D;  1ZLA D;  1PZR A;  4WU9 B;  2FFF B;  5FUG A;  4YM6 C;  3B0D C;  4J8W C;  4H9N B;  3A6N D;  3AZN D;  2CV5 A;  1P3P C;  4WV4 B;  4ZUX B;  2CV5 B;  4QLC C;  3AZL C;  2HIO A;  2NZD D;  4H9Q A;  3REI B;  2ARO C;  4UUZ B;  1EQZ B;  3REH D;  3REL A;  5JRG C;  3UT9 D;  1KX5 C;  3WAA A;  4WU8 D;  1F66 B;  2NQB D;  4J8W A;  4X23 A;  3UTB D;  1P3O C;  5DNM A;  2FJ7 C;  3AYW A;  4YM6 B;  3LJA D;  3B0D B;  3AZL A;  2W8S A;  1P3P B;  4Z66 D;  3MVD D;  1S32 A;  2PYO C;  4QLC B;  2ARO A;  5KDM A;  5JRG A;  1KX5 A;  5AY8 D;  5B31 A;  3AZH D;  1ID3 C;  2CWE A;  5KDM B;  4LD9 D;  4EO5 B;  1KX5 B;  5AV8 D;  1P3I C;  2FJ7 A;  5B2J C;  2G5I C;  1P3O B;  1M18 A;  3KUY A;  1AOI D;  3WA9 C;  5B32 C;  2Y2K A;  3LEL D;  1R4V A;  3AZI C;  3KSY A;  3W97 C;  4KGC A;  5B24 C;  2PYO B;  4JJN C;  5B1L A;  1ID3 B;  5AVC A;  1P3I A;  1P3G A;  4J8V B;  5CPI C;  1P3A B;  1P34 C;  1P3B C;  3W99 C;  1P3I B;  3AZF B;  5B2J B;  2CV5 D;  4Z5T A;  5B2I C;  5E5A C;  3VH6 T;  3WA9 B;  5B32 B;  4H9O B;  5BS7 A;  5AV6 A;  1M1A C;  2F8N K;  3LZ1 C;  3AZI B;  3W97 B;  2HIO D;  5B24 B;  3C1B C;  4XZQ C;  1U35 C;  4NFT A;  5CPJ C;  5GT0 C;  5CPI A;  4JJN B;  3REL D;  1P34 A;  3W99 A;  3WAA D;  2Y2M A;  3X1V A;  5BNX A;  5B0Y A;  4J8W D;  4X23 D;  4ZBJ C;  5AVB C;  3MNN A;  1P3B B;  3W99 B;  5DNM D;  2Y2I A;  5E5A A;  3V9R A;  5BNX B;  3AYW D;  3MGQ A;  1M1A A;  3AZL D;  2ZY2 A;  3LZ1 A;  5B2I B;  3MGP D;  3AZG B;  5JA4 B;  3AZE C;  1S32 D;  1M1A B;  1U35 A;  5B40 A;  3REJ A;  2ARO D;  3C1B B;  4XZQ B;  1WWI A;  5JRG D;  1KX5 D;  5B31 D;  3X1U C;  5CPJ B;  5GT0 B;  3W98 C;  3VH5 T;  5DNN C;  5AVB A;  3H0M C;  1KX3 C;  2JSS A;  2RVQ C;  2FJ7 D;  5B0Z B;  2RIQ A;  4WNN B;  2DQN C;  5F99 A;  3KUY D;  1M18 D;  3A1I A;  1Q9C A;  4XUJ B;  5AV5 A;  3AZE A;  3LZ0 C;  3KXB C;  3B6G C;  1P3M A;  4NE5 A;  5GXQ D;  2BYM B;  4KGC D;  3AZE B;  3AV2 A;  3W98 A;  5B1L D;  2Y2G A;  3EPK A;  2ZY5 A;  5AVC D;  3X1U B;  1P3G D;  4NE6 A;  1P3I D;  3W98 B;  5DNN B;  3X1T A;  1KX3 B;  1BH8 A;  1P3L C;  3NQJ A;  5CPK A;  4E44 A;  4M6B A;  3KXB A;  2YFV B;  1JFI B;  4Z5T D;  3NQJ B;  3LZ0 B;  2VQR A;  3KXB B;  3B6G B;  2ZM5 A;  5AV6 D;  1BFM A;  4J8X A;  5CPI D;  3R45 B;  1P34 D;  4H9P A;  3X1V D;  1P3L A;  5B0Y D;  3MNN D;  4WU9 A;  1P3F C;  4H9R B;  5E5A D;  3UTA B;  3AN2 C;  4H9N A;  5G49 B;  3MGQ D;  4WJ3 C;  3LZ1 D;  3B6F C;  3MGR C;  4ZUX A;  2HUE C;  1B67 A;  1U35 D;  5B40 D;  3REJ D;  5CP6 B;  3REI A;  4UUZ A;  1EQZ A;  5B1M B;  5AVB D;  1P3F A;  1F66 A;  4KUD D;  1KX4 C;  4EO5 C;  5F99 D;  4J8U B;  1P3F B;  4YM6 A;  5AV5 D;  3AZE D;  3AN2 B;  1P3P A;  1P3M D;  3B6F B;  3NQU B;  3TU4 B;  3O62 B;  3MGR B;  2HUE B;  4QLC A;  3AV2 D;  1H3O B;  3B0B A;  3AZM B;  3WTP B;  3B0C T;  1ULY A;  2IO5 B;  5AV9 D;  3X1T D;  3H0R C;  5BO0 A;  1B6W A;  4J8V C;  1KX4 B;  5CPK D;  1P3A C;  1P3O A;  5BT1 C;  5BO0 B;  2F2A C;  3AFA B;  3AZF C;  2F8N H;  2PYO A;  4J8X D;  3AZK C;  3X1S C;  4E45 A;  5C3I C;  1ID3 A;  4J8V A;  1P3L D;  1P3A A;  3MGS C;  5B33 C;  4WU9 D;  3AZF A;  5CHL B;  5B2J A;  4R8P B;  2LY8 A;  3KWQ C;  3C1C B;  3WA9 A;  4ZUX D;  5B32 A;  4H9O A;  4CSR B;  3REK B;  3W96 B;  4YS3 B;  3AZI A;  3W97 A;  3AZG C;  3X1S A;  1M19 B;  5B24 A;  3WKJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...