4YM6B

Crystal structure of the human nucleosome containing 6-4pp (outside)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
78
structure length
78
Chain Sequence
b'NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural basis of pyrimidine-pyrimidone (6-4) photoproduct recognition by UV-DDB in the nucleosome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 28
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ym6B00
4WV4B 3AN2D 4Z5TA 4H9OA 1HQ3B 3AZJB 3KXBA 5B1LB 5AV5A 3RELA 1P3LB 4J8UA 3REJA 3MGSC 5AV9C 5DNNA 3UTBD 1P3FD 3REIB 4H9NB 5B1MD 1U35C 3W96B 4KUDC 4R8PD 1N1JB 3B0CW 3AZKC 3WTPC 5B0YC 3LZ0C 3AN2C 4X23D 5B2JB 3VH5A 3V9RA 4J8WB 3TU4D 1P3GB 1TAFA 4XZQB 2FJ7D 1M18D 1JFIA 4H9RB 3UTBC 5AV8B 1P3FC 1KX3D 5B1MC 3AZIA 1P3BC 2F8NB 4R8PC 3AYWA 2AROD 1M19D 5CPID 3W97B 5B31D 2IO5C 3WTPE 4X23C 3X1VD 3AZEC 3X1SB 5BT1D 5AV9A 1P3MB 2FJ7C 5AY8B 2YFVA 5KDMA 4KUDA 2BYMA 3B6FA 5GT0C 3NQJB 4J8XC 4JJNB 1M19C 4ZUXD 5AVBD 3KUYD 3AZHA 3WKJB 3O62A 2F8NG 1P3OD 4YM6B 3MGQC 1F66A 4QLCB 5BT1C 3LZ1A 3MGRC 5GSUC 2NQBA 3W99C 4WU8B 4E45A 1HTAA 4AWLB 1ID3B 2NZDD 2HIOC 5B32B 4J8VC 5GT3D 2BYKA 5AVBC 3KUYC 3LJAB 5CP6B 1P3OC 5B24B 3LELD 3AZFB 3AZLC 4XUJB 3KWQD 5GT0A 1EQZD 1KU5A 5F99C 3C1BA 2NZDC 3UT9A 4NFTA 4Z66D 5C3IB 5B33B 4CSRB 3AZGA 1BH8B 4DRBA 3A6NC 1AOIA 4YS3C 4WU9D 5B32G 3LELC 3W99A 3WTPB 5AV6D 1TZYC 2HIOA 5JRGD 1EQZC 3UT9D 5E5AC 2PYOA 3W98D 4KGCA 4LD9D 3AV2D 3REHD 4G91C 3KXBD 1BH9B 2CV5D 3B6GD 5B1MB 4HGAB 3REJD 3KSYA 1R4VA 4E44A 4R8PB 3AZMB 1P34A 3C1CA 5AV6C 3X1UA 1P3KA 5JRGC 3AV1C 3WAAA 3UT9C 5B40C 3TU4B 3NQUB 4Z5TC 3X1TA 4H9PA 1ZLAA 3A6NA 5FUGA 3KXBC 1M18B 5AV5C 5B0ZC 3RELC 1KX3B 4J8UC 3REJC 3WA9B 5DNNC 2AROB 5CPIB 1HQ3A 5B31B 3AZID 3AZJA 3X1VB 1P3IC 1P3LA 1B6WA 3REIA 4H9NA 4CAYA 3AZNB 3W96A 5AV9D 4G92B 1H3OB 4WNNB 4KUDD 3B6FD 3AZKD 4ZUXB 5AVBB 3AZIC 2HUEB 3AYWC 4EO5C 3O62D 4XZQA 5B31G 5B0ZA 4H9RA 1M1AA 5AV8A 2F8NH 1F66D 2F8NA 2NZDB 1A7WA 1P3BD 3B6FC 5GT3B 1F1EA 1P3IA 3X1SA 3AZHC 4UUZA 1P3MA 3AZED 3O62C 1P3PC 3R45B 3VH6T 5JA4A 3KWQB 1F66C 3NQJA 3LZ1C 3B0DC 2YFWB 2NQBC 4JJNA 5GT0D 1P3AC 5DNMA 2CWEA 4Z66B 4J8XD 4ZBJC 1Q9CA 4YM6A 4WU9B 3AZGD 3MGQD 4WU8A 5GXQC 3MGRD 1KX4C 5GSUD 3UTAC 5BO0B 1ID3A 3W99D 3B0BA 5JRGB 5B32A 3W98B 4LD9B 4H9OB 2HIOD 3AFAA 3LJAA 4J8VD 3AV2B 3REHB 5CP6A 3KXBB 3MGPA 3C1BC 2CV5B 3B6GB 1P3PA 5B24A 3AZFA 4NE6A 4XUJA 3AZGC 1AOIC 1BFMA 5CPKB 3AZLD 3MNNB 1P3AA 1P34D 5F99D 5B2IB 5B33A 4H9SA 3X1UD 1P3KD 2PYOC 4KGCC 1BH8A 3V9RB 1TAFB 3A6ND 1ZLAD 4Z2MH 4YS3D 5GXQA 1KX4A 3UTAA 5AVCB 1KX5B 1P34C 1TZYD 1HQ3D 4EO5B 5E5AD 3C1CC 3X1UC 1P3KC 1BH9A 3WAAC 3MVDA 3REKC 3MGSB 3X1TC 5AV9B 3AZMA 1ZLAC 3REID 2YFVB 1U35B 3W96D 4KUDB 3AZKB 4DRAA 5B0YB 3LZ0B 3AN2B 1S32A 3TU4A 3NQUA 1HQ3C 3AV1D 5B40D 3AZJC 4Z5TD 5B1LC 1M18A 1P3LC 1KX3A 5AV5D 5B0ZD 3UTBB 1M1AD 1P3FB 3WA9A 3RELD 3REIC 5CPIA 4J8UD 5B31A 3W96C 1P3BB 5DNND 2F8ND 3X1VA 2IO5B 4X23B 5B2JC 1P3ID 3REKA 3AZEB 3X1SD 3AZNA 1P3GC 5CPJA 1P3MD 1H3OA 2FJ7B 4XZQC 4WNNA 1M1AC 5AV8C 5GT0B 4ZUXA 4KHAB 4J8XB 4JJND 1M19B 3W97C 5DNMD 3VH5T 5G49B 3AYWD 5B1LA 3MGQB 3X1SC 3MGRB 5CHLB 5GSUB 1P3MC 3W99B 4WU8D 1N1JA 2HIOB 5B32D 4J8VB 4JJNC 5BNXB 5B2JA 3KUYB 5DNMC 3AFAD 4J8WA 3MGPD 3R45A 4H9QB 3AZHD 1P3GA 3KWQA 1P3OB 2F8NK 4YM6C 5B24D 1P3PD 4QLCC 3AZLB 2YFWA 4XUJD 4WU8C 3LZ1D 5F99B 2NQBD 4Z66A 4AWLC 1ID3C 3W97A 1P3AD 5B32C 3AFAC 3LJAC 3A6NB 1ZLAB 5CP6C 3MGPC 4YS3B 2RVQC 5BO0A 5B24C 3LELB 3AZFC 5GXQD 1KX4D 5AY8A 4XUJC 3UTAD 3W98A 4LD9A 1TZYB 1EQZB 5E5AB 5BNVB 3AV2A 3REHA 2CV5A 3B6GA 3WKJA 5C3IC 5B33C 4G91B 4H9SC 3C1BD 3MVDD 4QLCA 4CAYB 5CPKA 3AZMD 1AOID 3MNNA 4WZSB 5B2IA 5AV6B 3AV1B 5B40B 3UT9B 1S32D 4Z5TB 2PYOD 4KGCD 5BS7A 5AV5B 5B0ZB 5AVCA 3MVDC 1M1AB 3RELB 4J8UB 4HGAC 3REJB 3WA9D 1KX5A 5DNNB 3AZMC 1P3IB 3C1CD 1S32C 4CSRA 3TU4C 3MGSA 4UUZB 3REKD 3WAAD 3AZND 5JA4B 3X1TD 1U35A 5CPJD 1M18C 1KX3C 3AZKA 3WTPA 5B0YA 3LZ0A 1JFIB 3WA9C 3AN2A 2AROC 5CPIC 3AZIB 5B31C 5DNMB 4NE5A 3AYWB 3X1VC 3VH5W 3AZJD 5B1LD 3UTBA 1P3FA 1P3LD 5B1MA 3AZNC 4G92C 3VH6A 3B0CT 4R8PA 5CPJC 1P3BA 5KDMB 2BYMB 4X23A 3AV1A 3B6FB 4NE3A 4ZUXC 2HUEC 3AFAB 3AZEA 3MGPB 5B2JD 3AZHB 3O62B 1P3PB 2FJ7A 4J8WD 1P3GD 1F66B 4XZQD 3LZ1B 3B0DB 4KHAA 4J8XA 2NQBB 5AV8D 2AROA 1M19A 1P3AB 5G49A 3LZ0D 5GT3C 3W97D 4ZBJB 3MGQA 3MGRA 2BYKB 5GSUA 4J8WC 5GXQB 1KX4B 3UTAB 1B67A 3KWQC 5AY8D 3VH6W 4J8VA 5BNXA 5AVBA 3KUYA 4Z66C 3C1BB 4H9QA 3MVDB 1P3OA 3WKJD 3AZLA 3AZGB 4WU9C 4YM6D 1WWIA 1AOIB 4QLCD 5CPKD 5F99A 2NZDA 3MNND 5AY8C 5B2ID 3W98C 1S32B 1ID3D 5GT3A 2JSSA 4LD9C 2PYOB 4KGCB 4Z2MG 1WWSA 4M6BA 3REHC 2L5AA 3AV2C 4YS3A 2LY8A 2CV5C 3LJAD 3LELA 3B6GC 3WKJC 5CP6D 2RVQD 5AVCD 3AZFD 5CPKC 1TZYA 1EQZA 5E5AA 1KX5D 1ULYA 5BNVA 3MNNC 1P34B 5B2IC 3C1CB 3X1UB 1P3KB 3REKB 3WAAB 5B33D 3MGSD 3X1TB 4WU9A 5CPJB 4H9PB 5BS7C 5FUGB 1U35D 5AVCC 5AV6A 3WTPD 5JRGA 5B0YD 5B40A 1KX5C
chains in the Genus database with same CATH superfamily
4WV4B 3AN2D 4Z5TA 4H9OA 1HQ3B 3AZJB 3KXBA 5B1LB 5AV5A 3RELA 1P3LB 4J8UA 1W2EA 3MGSC 3REJA 5AV9C 5DNNA 3UTBD 1P3FD 3REIB 2Y2GA 4H9NB 5B1MD 1U35C 3W96B 4KUDC 4R8PD 1N1JB 3B0CW 3AZKC 3WTPC 5B0YC 3LZ0C 3AN2C 4X23D 3FDDA 5B2JB 3VH5A 3V9RA 4J8WB 3TU4D 1P3GB 1TAFA 4XZQB 2FJ7D 1M18D 1JFIA 4H9RB 3UTBC 5AV8B 1P3FC 1KX3D 5B1MC 2XD5A 3AZIA 3EG5B 1P3BC 2F8NB 4R8PC 3AYWA 2AROD 1M19D 5CPID 3W97B 5B31D 2IO5C 3WTPE 4X23C 3X1VD 3AZEC 3X1SB 5BT1D 2Y2OA 5AV9A 1P3MB 2FJ7C 5AY8B 2YFVA 5KDMA 4KUDA 2BYMA 3B6FA 5GT0C 3NQJB 4J8XC 4JJNB 1M19C 4ZUXD 5AVBD 3KUYD 3AZHA 3WKJB 3O62A 2F8NG 1P3OD 4YM6B 3MGQC 1F66A 4QLCB 5BT1C 3LZ1A 3MGRC 5GSUC 2NQBA 3W99C 4WU8B 4E45A 2Y2LA 1HTAA 4AWLB 1T3UA 1ID3B 2NZDD 2HIOC 5B32B 4J8VC 5GT3D 2BYKA 5AVBC 3KUYC 3LJAB 5CP6B 3H0RC 1P3OC 5B24B 3LELD 3AZFB 3AZLC 4XUJB 3KWQD 5GT0A 1EQZD 1KU5A 5F99C 3C1BA 2NZDC 2JE5A 4NFTA 3UT9A 4Z66D 5C3IB 2ZM5A 5B33B 4CSRB 3AZGA 1BH8B 4DRBA 3A6NC 1AOIA 4YS3C 4WU9D 5B32G 3LELC 3W99A 3WTPB 5AV6D 1TZYC 2HIOA 5JRGD 1EQZC 3UT9D 5E5AC 2PYOA 3W98D 4KGCA 4LD9D 2UWXA 3AV2D 3REHD 4G91C 3KXBD 1BH9B 2CV5D 3B6GD 5B1MB 4HGAB 3REJD 3KSYA 1R4VA 2JCHA 4E44A 4R8PB 3AZMB 1P34A 3C1CA 5AV6C 3EPHA 3X1UA 2FFFB 5JRGC 3AV1C 1P3KA 3UT9C 5B40C 3WAAA 3F6TA 3TU4B 3NQUB 4Z5TC 3X1TA 4H9PA 1ZLAA 3A6NA 5FUGA 3KXBC 1M18B 5AV5C 5B0ZC 3RELC 1KX3B 4J8UC 3REJC 3WA9B 5DNNC 2AROB 3KFUG 5CPIB 1HQ3A 5B31B 3AZID 2G5IC 3AZJA 3X1VB 1P3IC 1P3LA 1B6WA 3REIA 4H9NA 4CAYA 3AZNB 3W96A 5AV9D 4G92B 1H3OB 4WNNB 4KUDD 3B6FD 3AZKD 4ZUXB 5AVBB 3AZIC 2HUEB 3AYWC 4EO5C 2Y2JA 4XZQA 3O62D 5B31G 5B0ZA 4H9RA 1M1AA 5AV8A 2F8NH 1F66D 2Y2HA 2F8NA 2NZDB 1A7WA 1P3BD 3B6FC 5GT3B 1F1EA 1P3IA 3X1SA 3AZHC 4UUZA 1P3MA 3AZED 3O62C 1P3PC 3R45B 3VH6T 5JA4A 3KWQB 1F66C 3NQJA 3LZ1C 3B0DC 2YFWB 2NQBC 4JJNA 2RIQA 5GT0D 1P3AC 5DNMA 2CWEA 4Z66B 4J8XD 1Z2CB 4ZBJC 1Q9CA 4YM6A 3EPLA 4WU9B 3AZGD 3MGQD 4WU8A 5GXQC 3MGRD 1KX4C 5GSUD 3UTAC 2Y2QA 5BO0B 1ID3A 3W99D 3B0BA 5JRGB 5B32A 3W98B 4LD9B 4H9OB 2HIOD 3AFAA 3LJAA 4J8VD 3AV2B 3REHB 5CP6A 3KXBB 3MGPA 3C1BC 2CV5B 3B6GB 1P3PA 5B24A 3AZFA 4NE6A 4XUJA 3AZGC 3H0MC 1AOIC 1BFMA 5CPKB 3AZLD 3MNNB 1P3AA 1P34D 5F99D 5B2IB 5B33A 4H9SA 3X1UD 1P3KD 2PYOC 4KGCC 1BH8A 2Y2MA 3V9RB 1TAFB 3A6ND 1ZLAD 4Z2MH 4YS3D 5GXQA 1KX4A 3UTAA 5AVCB 1KX5B 1P34C 1TZYD 1HQ3D 2Y2IA 5E5AD 4EO5B 3C1CC 2BG1A 3X1UC 1P3KC 1BH9A 3WAAC 3MVDA 3REKC 3MGSB 3X1TC 5AV9B 3AZMA 1ZLAC 3REID 2YFVB 1U35B 3W96D 4KUDB 4WJ3C 3AZKB 4DRAA 5B0YB 3LZ0B 3AN2B 1S32A 3TU4A 3NQUA 1HQ3C 3AV1D 5B40D 3AZJC 4Z5TD 5B1LC 1M18A 1P3LC 1KX3A 4UPKA 5AV5D 5B0ZD 3UTBB 1M1AD 1P3FB 3WA9A 3RELD 3REIC 5CPIA 4J8UD 5B31A 3W96C 1P3BB 5DNND 2F8ND 3X1VA 2Y2PA 2IO5B 4X23B 5B2JC 1P3ID 3REKA 3AZEB 3X1SD 3AZNA 1P3GC 5CPJA 1P3MD 1H3OA 2FJ7B 4XZQC 2W8SA 4WNNA 2ZY4A 1M1AC 5AV8C 5GT0B 4ZUXA 4KHAB 4J8XB 4JJND 1M19B 3W97C 5DNMD 3VH5T 5G49B 3AYWD 5B1LA 3MGQB 3X1SC 3MGRB 4DQYB 5CHLB 5GSUB 1P3MC 3W99B 4WU8D 1N1JA 2HIOB 2DF4C 5B32D 4J8VB 4JJNC 5BNXB 5B2JA 2J8PA 3KUYB 5DNMC 3AFAD 4J8WA 3MGPD 3R45A 4H9QB 3AZHD 1P3GA 3KWQA 1P3OB 2F8NK 4YM6C 5B24D 1P3PD 4QLCC 3AZLB 2YFWA 4XUJD 4WU8C 3LZ1D 5F99B 2NQBD 4Z66A 4AWLC 1ID3C 2ZY5A 3W97A 1P3AD 5B32C 3AFAC 3LJAC 3A6NB 1ZLAB 5CP6C 3MGPC 4YS3B 2RVQC 5BO0A 5B24C 3LELB 3AZFC 5GXQD 1KX4D 5AY8A 4XUJC 3UTAD 3W98A 4LD9A 1TZYB 1EQZB 5E5AB 5BNVB 3AV2A 3REHA 2CV5A 3B6GA 3WKJA 2ZY2A 5C3IC 5B33C 4G91B 4H9SC 3C1BD 3MVDD 3EPJA 4QLCA 4CAYB 5CPKA 3AZMD 1AOID 3MNNA 4WZSB 5B2IA 5AV6B 3AV1B 5B40B 3UT9B 1S32D 4Z5TB 2PYOD 4KGCD 5BS7A 3IP4C 5AV5B 5B0ZB 5AVCA 3MVDC 1M1AB 3RELB 4J8UB 2Y2NA 4HGAC 3REJB 3WA9D 1KX5A 5DNNB 3AZMC 1P3IB 3C1CD 1S32C 4CSRA 3TU4C 3MGSA 4UUZB 3REKD 3WAAD 3AZND 2DQNC 5JA4B 3X1TD 1U35A 5CPJD 1M18C 1KX3C 3A1KA 3AZKA 3WTPA 2XD1A 5B0YA 3LZ0A 1JFIB 3WA9C 3AN2A 2AROC 5CPIC 3AZIB 5B31C 5DNMB 4NE5A 3AYWB 3X1VC 3VH5W 3AZJD 5B1LD 3UTBA 1P3FA 1P3LD 5B1MA 3AZNC 3P5JB 4G92C 3VH6A 3B0CT 4R8PA 5CPJC 1P3BA 5KDMB 2BYMB 3A1IA 4X23A 3AV1A 3B6FB 4NE3A 4ZUXC 2HUEC 3H0LC 3AFAB 3AZEA 3MGPB 5B2JD 3AZHB 3O62B 1P3PB 2FJ7A 4J8WD 1PZRA 1P3GD 1F66B 4XZQD 3LZ1B 3B0DB 4KHAA 4J8XA 2NQBB 5AV8D 2AROA 1M19A 2ZY3A 1P3AB 5G49A 3LZ0D 5GT3C 3W97D 4ZBJB 3MGQA 3MGRA 2BYKB 5GSUA 4J8WC 5GXQB 1KX4B 3UTAB 1B67A 3KWQC 5AY8D 3VH6W 4J8VA 5BNXA 5AVBA 3KUYA 4Z66C 3C1BB 4H9QA 2G5HC 3MVDB 1P3OA 3WKJD 3AZLA 3AZGB 4WU9C 4YM6D 1WWIA 1AOIB 4QLCD 5CPKD 5F99A 2NZDA 3MNND 5AY8C 5B2ID 3W98C 1S32B 1ID3D 5GT3A 2JSSA 4LD9C 2PYOB 4KGCB 4Z2MG 1WWSA 2Y2KA 4M6BA 2L5AA 3REHC 3AV2C 4YS3A 2VQRA 2LY8A 2CV5C 3LJAD 3LELA 3B6GC 3WKJC 5CP6D 2RVQD 3EPKA 5AVCD 3AZFD 5CPKC 1TZYA 1EQZA 5E5AA 1KX5D 1ULYA 5BNVA 3AL0C 3MNNC 1P34B 5B2IC 3C1CB 3X1UB 1P3KB 3REKB 3WAAB 5B33D 3MGSD 3X1TB 4WU9A 5CPJB 4H9PB 5BS7C 5FUGB 1U35D 5AVCC 2F2AC 5AV6A 3WTPD 5JRGA 5B0YD 5B40A 1KX5C
chains in the Genus database with same CATH topology
4WV4B 3AN2D 4Z5TA 4H9OA 1HQ3B 3AZJB 3KXBA 5B1LB 5AV5A 3RELA 1P3LB 4J8UA 1W2EA 3MGSC 3REJA 5AV9C 5DNNA 3UTBD 1P3FD 3REIB 2Y2GA 4H9NB 5B1MD 1U35C 3W96B 4KUDC 4R8PD 1N1JB 3B0CW 3AZKC 3WTPC 5B0YC 3LZ0C 3AN2C 4X23D 3FDDA 5B2JB 3VH5A 3V9RA 4J8WB 3TU4D 1P3GB 1TAFA 4XZQB 2FJ7D 1M18D 1JFIA 4H9RB 3UTBC 5AV8B 1P3FC 1KX3D 5B1MC 2XD5A 3AZIA 3EG5B 1P3BC 2F8NB 4R8PC 3AYWA 2AROD 1M19D 5CPID 3W97B 5B31D 2IO5C 3WTPE 4X23C 3X1VD 3AZEC 3X1SB 5BT1D 2Y2OA 5AV9A 1P3MB 2FJ7C 5AY8B 2YFVA 5KDMA 4KUDA 2BYMA 3B6FA 5GT0C 3NQJB 4J8XC 4JJNB 1M19C 4ZUXD 5AVBD 3KUYD 3AZHA 3WKJB 3O62A 2F8NG 1P3OD 4YM6B 3MGQC 1F66A 4QLCB 5BT1C 3LZ1A 3MGRC 5GSUC 2NQBA 3W99C 4WU8B 4E45A 2Y2LA 1HTAA 4AWLB 1T3UA 1ID3B 2NZDD 2HIOC 5B32B 4J8VC 5GT3D 2BYKA 5AVBC 3KUYC 3LJAB 5CP6B 3H0RC 1P3OC 5B24B 3LELD 3AZFB 3AZLC 4XUJB 3KWQD 5GT0A 1EQZD 1KU5A 5F99C 3C1BA 2NZDC 2JE5A 4NFTA 3UT9A 4Z66D 5C3IB 2ZM5A 5B33B 4CSRB 3AZGA 1BH8B 4DRBA 3A6NC 1AOIA 4YS3C 4WU9D 5B32G 3LELC 3W99A 3WTPB 5AV6D 1TZYC 2HIOA 5JRGD 1EQZC 3UT9D 5E5AC 2PYOA 3W98D 4KGCA 4LD9D 2UWXA 3AV2D 3REHD 4G91C 3KXBD 1BH9B 2CV5D 3B6GD 5B1MB 4HGAB 3REJD 3KSYA 1R4VA 2JCHA 4E44A 4R8PB 3AZMB 1P34A 3C1CA 5AV6C 3EPHA 3X1UA 2FFFB 5JRGC 3AV1C 1P3KA 3UT9C 5B40C 3WAAA 3F6TA 3TU4B 3NQUB 4Z5TC 3X1TA 4H9PA 1ZLAA 3A6NA 5FUGA 3KXBC 1M18B 5AV5C 5B0ZC 3RELC 1KX3B 4J8UC 3REJC 3WA9B 5DNNC 2AROB 3KFUG 5CPIB 1HQ3A 5B31B 3AZID 2G5IC 3AZJA 3X1VB 1P3IC 1P3LA 1B6WA 3REIA 4H9NA 4CAYA 3AZNB 3W96A 5AV9D 4G92B 1H3OB 4WNNB 4KUDD 3B6FD 3AZKD 4ZUXB 5AVBB 3AZIC 2HUEB 3AYWC 4EO5C 2Y2JA 4XZQA 3O62D 5B31G 5B0ZA 4H9RA 1M1AA 5AV8A 2F8NH 1F66D 2Y2HA 2F8NA 2NZDB 1A7WA 1P3BD 3B6FC 5GT3B 1F1EA 1P3IA 3X1SA 3AZHC 4UUZA 1P3MA 3AZED 3O62C 1P3PC 3R45B 3VH6T 5JA4A 3KWQB 1F66C 3NQJA 3LZ1C 3B0DC 2YFWB 2NQBC 4JJNA 2RIQA 5GT0D 1P3AC 5DNMA 2CWEA 4Z66B 4J8XD 1Z2CB 4ZBJC 1Q9CA 4YM6A 3EPLA 4WU9B 3AZGD 3MGQD 4WU8A 5GXQC 3MGRD 1KX4C 5GSUD 3UTAC 2Y2QA 5BO0B 1ID3A 3W99D 3B0BA 5JRGB 5B32A 3W98B 4LD9B 4H9OB 2HIOD 3AFAA 3LJAA 4J8VD 3AV2B 3REHB 5CP6A 3KXBB 3MGPA 3C1BC 2CV5B 3B6GB 1P3PA 5B24A 3AZFA 4NE6A 4XUJA 3AZGC 3H0MC 1AOIC 1BFMA 5CPKB 3AZLD 3MNNB 1P3AA 1P34D 5F99D 5B2IB 5B33A 4H9SA 3X1UD 1P3KD 2PYOC 4KGCC 1BH8A 2Y2MA 3V9RB 1TAFB 3A6ND 1ZLAD 4Z2MH 4YS3D 5GXQA 1KX4A 3UTAA 5AVCB 1KX5B 1P34C 1TZYD 1HQ3D 2Y2IA 5E5AD 4EO5B 3C1CC 2BG1A 3X1UC 1P3KC 1BH9A 3WAAC 3MVDA 3REKC 3MGSB 3X1TC 5AV9B 3AZMA 1ZLAC 3REID 2YFVB 1U35B 3W96D 4KUDB 4WJ3C 3AZKB 4DRAA 5B0YB 3LZ0B 3AN2B 1S32A 3TU4A 3NQUA 1HQ3C 3AV1D 5B40D 3AZJC 4Z5TD 5B1LC 1M18A 1P3LC 1KX3A 4UPKA 5AV5D 5B0ZD 3UTBB 1M1AD 1P3FB 3WA9A 3RELD 3REIC 5CPIA 4J8UD 5B31A 3W96C 1P3BB 5DNND 2F8ND 3X1VA 2Y2PA 2IO5B 4X23B 5B2JC 1P3ID 3REKA 3AZEB 3X1SD 3AZNA 1P3GC 5CPJA 1P3MD 1H3OA 2FJ7B 4XZQC 2W8SA 4WNNA 2ZY4A 1M1AC 5AV8C 5GT0B 4ZUXA 4KHAB 4J8XB 4JJND 1M19B 3W97C 5DNMD 3VH5T 5G49B 3AYWD 5B1LA 3MGQB 3X1SC 3MGRB 4DQYB 5CHLB 5GSUB 1P3MC 3W99B 4WU8D 1N1JA 2HIOB 2DF4C 5B32D 4J8VB 4JJNC 5BNXB 5B2JA 2J8PA 3KUYB 5DNMC 3AFAD 4J8WA 3MGPD 3R45A 4H9QB 3AZHD 1P3GA 3KWQA 1P3OB 2F8NK 4YM6C 5B24D 1P3PD 4QLCC 3AZLB 2YFWA 4XUJD 4WU8C 3LZ1D 5F99B 2NQBD 4Z66A 4AWLC 1ID3C 2ZY5A 3W97A 1P3AD 5B32C 3AFAC 3LJAC 3A6NB 1ZLAB 5CP6C 3MGPC 4YS3B 2RVQC 5BO0A 5B24C 3LELB 3AZFC 5GXQD 1KX4D 5AY8A 4XUJC 3UTAD 3W98A 4LD9A 1TZYB 1EQZB 5E5AB 5BNVB 3AV2A 3REHA 2CV5A 3B6GA 3WKJA 2ZY2A 5C3IC 5B33C 4G91B 4H9SC 3C1BD 3MVDD 3EPJA 4QLCA 4CAYB 5CPKA 3AZMD 1AOID 3MNNA 4WZSB 5B2IA 5AV6B 3AV1B 5B40B 3UT9B 1S32D 4Z5TB 2PYOD 4KGCD 5BS7A 3IP4C 5AV5B 5B0ZB 5AVCA 3MVDC 1M1AB 3RELB 4J8UB 2Y2NA 4HGAC 3REJB 3WA9D 1KX5A 5DNNB 3AZMC 1P3IB 3C1CD 1S32C 4CSRA 3TU4C 3MGSA 4UUZB 3REKD 3WAAD 3AZND 2DQNC 5JA4B 3X1TD 1U35A 5CPJD 1M18C 1KX3C 3A1KA 3AZKA 3WTPA 2XD1A 5B0YA 3LZ0A 1JFIB 3WA9C 3AN2A 2AROC 5CPIC 3AZIB 5B31C 5DNMB 4NE5A 3AYWB 3X1VC 3VH5W 3AZJD 5B1LD 3UTBA 1P3FA 1P3LD 5B1MA 3AZNC 3P5JB 4G92C 3VH6A 3B0CT 4R8PA 5CPJC 1P3BA 5KDMB 2BYMB 3A1IA 4X23A 3AV1A 3B6FB 4NE3A 4ZUXC 2HUEC 3H0LC 3AFAB 3AZEA 3MGPB 5B2JD 3AZHB 3O62B 1P3PB 2FJ7A 4J8WD 1PZRA 1P3GD 1F66B 4XZQD 3LZ1B 3B0DB 4KHAA 4J8XA 2NQBB 5AV8D 2AROA 1M19A 2ZY3A 1P3AB 5G49A 3LZ0D 5GT3C 3W97D 4ZBJB 3MGQA 3MGRA 2BYKB 5GSUA 4J8WC 5GXQB 1KX4B 3UTAB 1B67A 3KWQC 5AY8D 3VH6W 4J8VA 5BNXA 5AVBA 3KUYA 4Z66C 3C1BB 4H9QA 2G5HC 3MVDB 1P3OA 3WKJD 3AZLA 3AZGB 4WU9C 4YM6D 1WWIA 1AOIB 4QLCD 5CPKD 5F99A 2NZDA 3MNND 5AY8C 5B2ID 3W98C 1S32B 1ID3D 5GT3A 2JSSA 4LD9C 2PYOB 4KGCB 4Z2MG 1WWSA 2Y2KA 4M6BA 2L5AA 3REHC 3AV2C 4YS3A 2VQRA 2LY8A 2CV5C 3LJAD 3LELA 3B6GC 3WKJC 5CP6D 2RVQD 3EPKA 5AVCD 3AZFD 5CPKC 1TZYA 1EQZA 5E5AA 1KX5D 1ULYA 5BNVA 3AL0C 3MNNC 1P34B 5B2IC 3C1CB 3X1UB 1P3KB 3REKB 3WAAB 5B33D 3MGSD 3X1TB 4WU9A 5CPJB 4H9PB 5BS7C 5FUGB 1U35D 5AVCC 2F2AC 5AV6A 3WTPD 5JRGA 5B0YD 5B40A 1KX5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WV4 B;  3AN2 D;  4Z5T A;  4H9O A;  1HQ3 B;  3AZJ B;  3KXB A;  5B1L B;  5AV5 A;  3REL A;  1P3L B;  4J8U A;  3REJ A;  3MGS C;  5AV9 C;  5DNN A;  3UTB D;  1P3F D;  3REI B;  4H9N B;  5B1M D;  1U35 C;  3W96 B;  4KUD C;  4R8P D;  1N1J B;  3B0C W;  3AZK C;  3WTP C;  5B0Y C;  3LZ0 C;  3AN2 C;  4X23 D;  5B2J B;  3VH5 A;  3V9R A;  4J8W B;  3TU4 D;  1P3G B;  1TAF A;  4XZQ B;  2FJ7 D;  1M18 D;  1JFI A;  4H9R B;  3UTB C;  5AV8 B;  1P3F C;  1KX3 D;  5B1M C;  3AZI A;  1P3B C;  2F8N B;  4R8P C;  3AYW A;  2ARO D;  1M19 D;  5CPI D;  3W97 B;  5B31 D;  2IO5 C;  3WTP E;  4X23 C;  3X1V D;  3AZE C;  3X1S B;  5BT1 D;  5AV9 A;  1P3M B;  2FJ7 C;  5AY8 B;  2YFV A;  5KDM A;  4KUD A;  2BYM A;  3B6F A;  5GT0 C;  3NQJ B;  4J8X C;  4JJN B;  1M19 C;  4ZUX D;  5AVB D;  3KUY D;  3AZH A;  3WKJ B;  3O62 A;  2F8N G;  1P3O D;  4YM6 B;  3MGQ C;  1F66 A;  4QLC B;  5BT1 C;  3LZ1 A;  3MGR C;  5GSU C;  2NQB A;  3W99 C;  4WU8 B;  4E45 A;  1HTA A;  4AWL B;  1ID3 B;  2NZD D;  2HIO C;  5B32 B;  4J8V C;  5GT3 D;  2BYK A;  5AVB C;  3KUY C;  3LJA B;  5CP6 B;  1P3O C;  5B24 B;  3LEL D;  3AZF B;  3AZL C;  4XUJ B;  3KWQ D;  5GT0 A;  1EQZ D;  1KU5 A;  5F99 C;  3C1B A;  2NZD C;  3UT9 A;  4NFT A;  4Z66 D;  5C3I B;  5B33 B;  4CSR B;  3AZG A;  1BH8 B;  4DRB A;  3A6N C;  1AOI A;  4YS3 C;  4WU9 D;  5B32 G;  3LEL C;  3W99 A;  3WTP B;  5AV6 D;  1TZY C;  2HIO A;  5JRG D;  1EQZ C;  3UT9 D;  5E5A C;  2PYO A;  3W98 D;  4KGC A;  4LD9 D;  3AV2 D;  3REH D;  4G91 C;  3KXB D;  1BH9 B;  2CV5 D;  3B6G D;  5B1M B;  4HGA B;  3REJ D;  3KSY A;  1R4V A;  4E44 A;  4R8P B;  3AZM B;  1P34 A;  3C1C A;  5AV6 C;  3X1U A;  1P3K A;  5JRG C;  3AV1 C;  3WAA A;  3UT9 C;  5B40 C;  3TU4 B;  3NQU B;  4Z5T C;  3X1T A;  4H9P A;  1ZLA A;  3A6N A;  5FUG A;  3KXB C;  1M18 B;  5AV5 C;  5B0Z C;  3REL C;  1KX3 B;  4J8U C;  3REJ C;  3WA9 B;  5DNN C;  2ARO B;  5CPI B;  1HQ3 A;  5B31 B;  3AZI D;  3AZJ A;  3X1V B;  1P3I C;  1P3L A;  1B6W A;  3REI A;  4H9N A;  4CAY A;  3AZN B;  3W96 A;  5AV9 D;  4G92 B;  1H3O B;  4WNN B;  4KUD D;  3B6F D;  3AZK D;  4ZUX B;  5AVB B;  3AZI C;  2HUE B;  3AYW C;  4EO5 C;  3O62 D;  4XZQ A;  5B31 G;  5B0Z A;  4H9R A;  1M1A A;  5AV8 A;  2F8N H;  1F66 D;  2F8N A;  2NZD B;  1A7W A;  1P3B D;  3B6F C;  5GT3 B;  1F1E A;  1P3I A;  3X1S A;  3AZH C;  4UUZ A;  1P3M A;  3AZE D;  3O62 C;  1P3P C;  3R45 B;  3VH6 T;  5JA4 A;  3KWQ B;  1F66 C;  3NQJ A;  3LZ1 C;  3B0D C;  2YFW B;  2NQB C;  4JJN A;  5GT0 D;  1P3A C;  5DNM A;  2CWE A;  4Z66 B;  4J8X D;  4ZBJ C;  1Q9C A;  4YM6 A;  4WU9 B;  3AZG D;  3MGQ D;  4WU8 A;  5GXQ C;  3MGR D;  1KX4 C;  5GSU D;  3UTA C;  5BO0 B;  1ID3 A;  3W99 D;  3B0B A;  5JRG B;  5B32 A;  3W98 B;  4LD9 B;  4H9O B;  2HIO D;  3AFA A;  3LJA A;  4J8V D;  3AV2 B;  3REH B;  5CP6 A;  3KXB B;  3MGP A;  3C1B C;  2CV5 B;  3B6G B;  1P3P A;  5B24 A;  3AZF A;  4NE6 A;  4XUJ A;  3AZG C;  1AOI C;  1BFM A;  5CPK B;  3AZL D;  3MNN B;  1P3A A;  1P34 D;  5F99 D;  5B2I B;  5B33 A;  4H9S A;  3X1U D;  1P3K D;  2PYO C;  4KGC C;  1BH8 A;  3V9R B;  1TAF B;  3A6N D;  1ZLA D;  4Z2M H;  4YS3 D;  5GXQ A;  1KX4 A;  3UTA A;  5AVC B;  1KX5 B;  1P34 C;  1TZY D;  1HQ3 D;  4EO5 B;  5E5A D;  3C1C C;  3X1U C;  1P3K C;  1BH9 A;  3WAA C;  3MVD A;  3REK C;  3MGS B;  3X1T C;  5AV9 B;  3AZM A;  1ZLA C;  3REI D;  2YFV B;  1U35 B;  3W96 D;  4KUD B;  3AZK B;  4DRA A;  5B0Y B;  3LZ0 B;  3AN2 B;  1S32 A;  3TU4 A;  3NQU A;  1HQ3 C;  3AV1 D;  5B40 D;  3AZJ C;  4Z5T D;  5B1L C;  1M18 A;  1P3L C;  1KX3 A;  5AV5 D;  5B0Z D;  3UTB B;  1M1A D;  1P3F B;  3WA9 A;  3REL D;  3REI C;  5CPI A;  4J8U D;  5B31 A;  3W96 C;  1P3B B;  5DNN D;  2F8N D;  3X1V A;  2IO5 B;  4X23 B;  5B2J C;  1P3I D;  3REK A;  3AZE B;  3X1S D;  3AZN A;  1P3G C;  5CPJ A;  1P3M D;  1H3O A;  2FJ7 B;  4XZQ C;  4WNN A;  1M1A C;  5AV8 C;  5GT0 B;  4ZUX A;  4KHA B;  4J8X B;  4JJN D;  1M19 B;  3W97 C;  5DNM D;  3VH5 T;  5G49 B;  3AYW D;  5B1L A;  3MGQ B;  3X1S C;  3MGR B;  5CHL B;  5GSU B;  1P3M C;  3W99 B;  4WU8 D;  1N1J A;  2HIO B;  5B32 D;  4J8V B;  4JJN C;  5BNX B;  5B2J A;  3KUY B;  5DNM C;  3AFA D;  4J8W A;  3MGP D;  3R45 A;  4H9Q B;  3AZH D;  1P3G A;  3KWQ A;  1P3O B;  2F8N K;  4YM6 C;  5B24 D;  1P3P D;  4QLC C;  3AZL B;  2YFW A;  4XUJ D;  4WU8 C;  3LZ1 D;  5F99 B;  2NQB D;  4Z66 A;  4AWL C;  1ID3 C;  3W97 A;  1P3A D;  5B32 C;  3AFA C;  3LJA C;  3A6N B;  1ZLA B;  5CP6 C;  3MGP C;  4YS3 B;  2RVQ C;  5BO0 A;  5B24 C;  3LEL B;  3AZF C;  5GXQ D;  1KX4 D;  5AY8 A;  4XUJ C;  3UTA D;  3W98 A;  4LD9 A;  1TZY B;  1EQZ B;  5E5A B;  5BNV B;  3AV2 A;  3REH A;  2CV5 A;  3B6G A;  3WKJ A;  5C3I C;  5B33 C;  4G91 B;  4H9S C;  3C1B D;  3MVD D;  4QLC A;  4CAY B;  5CPK A;  3AZM D;  1AOI D;  3MNN A;  4WZS B;  5B2I A;  5AV6 B;  3AV1 B;  5B40 B;  3UT9 B;  1S32 D;  4Z5T B;  2PYO D;  4KGC D;  5BS7 A;  5AV5 B;  5B0Z B;  5AVC A;  3MVD C;  1M1A B;  3REL B;  4J8U B;  4HGA C;  3REJ B;  3WA9 D;  1KX5 A;  5DNN B;  3AZM C;  1P3I B;  3C1C D;  1S32 C;  4CSR A;  3TU4 C;  3MGS A;  4UUZ B;  3REK D;  3WAA D;  3AZN D;  5JA4 B;  3X1T D;  1U35 A;  5CPJ D;  1M18 C;  1KX3 C;  3AZK A;  3WTP A;  5B0Y A;  3LZ0 A;  1JFI B;  3WA9 C;  3AN2 A;  2ARO C;  5CPI C;  3AZI B;  5B31 C;  5DNM B;  4NE5 A;  3AYW B;  3X1V C;  3VH5 W;  3AZJ D;  5B1L D;  3UTB A;  1P3F A;  1P3L D;  5B1M A;  3AZN C;  4G92 C;  3VH6 A;  3B0C T;  4R8P A;  5CPJ C;  1P3B A;  5KDM B;  2BYM B;  4X23 A;  3AV1 A;  3B6F B;  4NE3 A;  4ZUX C;  2HUE C;  3AFA B;  3AZE A;  3MGP B;  5B2J D;  3AZH B;  3O62 B;  1P3P B;  2FJ7 A;  4J8W D;  1P3G D;  1F66 B;  4XZQ D;  3LZ1 B;  3B0D B;  4KHA A;  4J8X A;  2NQB B;  5AV8 D;  2ARO A;  1M19 A;  1P3A B;  5G49 A;  3LZ0 D;  5GT3 C;  3W97 D;  4ZBJ B;  3MGQ A;  3MGR A;  2BYK B;  5GSU A;  4J8W C;  5GXQ B;  1KX4 B;  3UTA B;  1B67 A;  3KWQ C;  5AY8 D;  3VH6 W;  4J8V A;  5BNX A;  5AVB A;  3KUY A;  4Z66 C;  3C1B B;  4H9Q A;  3MVD B;  1P3O A;  3WKJ D;  3AZL A;  3AZG B;  4WU9 C;  4YM6 D;  1WWI A;  1AOI B;  4QLC D;  5CPK D;  5F99 A;  2NZD A;  3MNN D;  5AY8 C;  5B2I D;  3W98 C;  1S32 B;  1ID3 D;  5GT3 A;  2JSS A;  4LD9 C;  2PYO B;  4KGC B;  4Z2M G;  1WWS A;  4M6B A;  3REH C;  2L5A A;  3AV2 C;  4YS3 A;  2LY8 A;  2CV5 C;  3LJA D;  3LEL A;  3B6G C;  3WKJ C;  5CP6 D;  2RVQ D;  5AVC D;  3AZF D;  5CPK C;  1TZY A;  1EQZ A;  5E5A A;  1KX5 D;  1ULY A;  5BNV A;  3MNN C;  1P34 B;  5B2I C;  3C1C B;  3X1U B;  1P3K B;  3REK B;  3WAA B;  5B33 D;  3MGS D;  3X1T B;  4WU9 A;  5CPJ B;  4H9P B;  5BS7 C;  5FUG B;  1U35 D;  5AVC C;  5AV6 A;  3WTP D;  5JRG A;  5B0Y D;  5B40 A;  1KX5 C; 
#chains in the Genus database with same CATH topology
 4WV4 B;  3AN2 D;  4Z5T A;  4H9O A;  1HQ3 B;  3AZJ B;  3KXB A;  5B1L B;  5AV5 A;  3REL A;  1P3L B;  4J8U A;  1W2E A;  3MGS C;  3REJ A;  5AV9 C;  5DNN A;  3UTB D;  1P3F D;  3REI B;  2Y2G A;  4H9N B;  5B1M D;  1U35 C;  3W96 B;  4KUD C;  4R8P D;  1N1J B;  3B0C W;  3AZK C;  3WTP C;  5B0Y C;  3LZ0 C;  3AN2 C;  4X23 D;  3FDD A;  5B2J B;  3VH5 A;  3V9R A;  4J8W B;  3TU4 D;  1P3G B;  1TAF A;  4XZQ B;  2FJ7 D;  1M18 D;  1JFI A;  4H9R B;  3UTB C;  5AV8 B;  1P3F C;  1KX3 D;  5B1M C;  2XD5 A;  3AZI A;  3EG5 B;  1P3B C;  2F8N B;  4R8P C;  3AYW A;  2ARO D;  1M19 D;  5CPI D;  3W97 B;  5B31 D;  2IO5 C;  3WTP E;  4X23 C;  3X1V D;  3AZE C;  3X1S B;  5BT1 D;  2Y2O A;  5AV9 A;  1P3M B;  2FJ7 C;  5AY8 B;  2YFV A;  5KDM A;  4KUD A;  2BYM A;  3B6F A;  5GT0 C;  3NQJ B;  4J8X C;  4JJN B;  1M19 C;  4ZUX D;  5AVB D;  3KUY D;  3AZH A;  3WKJ B;  3O62 A;  2F8N G;  1P3O D;  4YM6 B;  3MGQ C;  1F66 A;  4QLC B;  5BT1 C;  3LZ1 A;  3MGR C;  5GSU C;  2NQB A;  3W99 C;  4WU8 B;  4E45 A;  2Y2L A;  1HTA A;  4AWL B;  1T3U A;  1ID3 B;  2NZD D;  2HIO C;  5B32 B;  4J8V C;  5GT3 D;  2BYK A;  5AVB C;  3KUY C;  3LJA B;  5CP6 B;  3H0R C;  1P3O C;  5B24 B;  3LEL D;  3AZF B;  3AZL C;  4XUJ B;  3KWQ D;  5GT0 A;  1EQZ D;  1KU5 A;  5F99 C;  3C1B A;  2NZD C;  2JE5 A;  4NFT A;  3UT9 A;  4Z66 D;  5C3I B;  2ZM5 A;  5B33 B;  4CSR B;  3AZG A;  1BH8 B;  4DRB A;  3A6N C;  1AOI A;  4YS3 C;  4WU9 D;  5B32 G;  3LEL C;  3W99 A;  3WTP B;  5AV6 D;  1TZY C;  2HIO A;  5JRG D;  1EQZ C;  3UT9 D;  5E5A C;  2PYO A;  3W98 D;  4KGC A;  4LD9 D;  2UWX A;  3AV2 D;  3REH D;  4G91 C;  3KXB D;  1BH9 B;  2CV5 D;  3B6G D;  5B1M B;  4HGA B;  3REJ D;  3KSY A;  1R4V A;  2JCH A;  4E44 A;  4R8P B;  3AZM B;  1P34 A;  3C1C A;  5AV6 C;  3EPH A;  3X1U A;  2FFF B;  5JRG C;  3AV1 C;  1P3K A;  3UT9 C;  5B40 C;  3WAA A;  3F6T A;  3TU4 B;  3NQU B;  4Z5T C;  3X1T A;  4H9P A;  1ZLA A;  3A6N A;  5FUG A;  3KXB C;  1M18 B;  5AV5 C;  5B0Z C;  3REL C;  1KX3 B;  4J8U C;  3REJ C;  3WA9 B;  5DNN C;  2ARO B;  3KFU G;  5CPI B;  1HQ3 A;  5B31 B;  3AZI D;  2G5I C;  3AZJ A;  3X1V B;  1P3I C;  1P3L A;  1B6W A;  3REI A;  4H9N A;  4CAY A;  3AZN B;  3W96 A;  5AV9 D;  4G92 B;  1H3O B;  4WNN B;  4KUD D;  3B6F D;  3AZK D;  4ZUX B;  5AVB B;  3AZI C;  2HUE B;  3AYW C;  4EO5 C;  2Y2J A;  4XZQ A;  3O62 D;  5B31 G;  5B0Z A;  4H9R A;  1M1A A;  5AV8 A;  2F8N H;  1F66 D;  2Y2H A;  2F8N A;  2NZD B;  1A7W A;  1P3B D;  3B6F C;  5GT3 B;  1F1E A;  1P3I A;  3X1S A;  3AZH C;  4UUZ A;  1P3M A;  3AZE D;  3O62 C;  1P3P C;  3R45 B;  3VH6 T;  5JA4 A;  3KWQ B;  1F66 C;  3NQJ A;  3LZ1 C;  3B0D C;  2YFW B;  2NQB C;  4JJN A;  2RIQ A;  5GT0 D;  1P3A C;  5DNM A;  2CWE A;  4Z66 B;  4J8X D;  1Z2C B;  4ZBJ C;  1Q9C A;  4YM6 A;  3EPL A;  4WU9 B;  3AZG D;  3MGQ D;  4WU8 A;  5GXQ C;  3MGR D;  1KX4 C;  5GSU D;  3UTA C;  2Y2Q A;  5BO0 B;  1ID3 A;  3W99 D;  3B0B A;  5JRG B;  5B32 A;  3W98 B;  4LD9 B;  4H9O B;  2HIO D;  3AFA A;  3LJA A;  4J8V D;  3AV2 B;  3REH B;  5CP6 A;  3KXB B;  3MGP A;  3C1B C;  2CV5 B;  3B6G B;  1P3P A;  5B24 A;  3AZF A;  4NE6 A;  4XUJ A;  3AZG C;  3H0M C;  1AOI C;  1BFM A;  5CPK B;  3AZL D;  3MNN B;  1P3A A;  1P34 D;  5F99 D;  5B2I B;  5B33 A;  4H9S A;  3X1U D;  1P3K D;  2PYO C;  4KGC C;  1BH8 A;  2Y2M A;  3V9R B;  1TAF B;  3A6N D;  1ZLA D;  4Z2M H;  4YS3 D;  5GXQ A;  1KX4 A;  3UTA A;  5AVC B;  1KX5 B;  1P34 C;  1TZY D;  1HQ3 D;  2Y2I A;  5E5A D;  4EO5 B;  3C1C C;  2BG1 A;  3X1U C;  1P3K C;  1BH9 A;  3WAA C;  3MVD A;  3REK C;  3MGS B;  3X1T C;  5AV9 B;  3AZM A;  1ZLA C;  3REI D;  2YFV B;  1U35 B;  3W96 D;  4KUD B;  4WJ3 C;  3AZK B;  4DRA A;  5B0Y B;  3LZ0 B;  3AN2 B;  1S32 A;  3TU4 A;  3NQU A;  1HQ3 C;  3AV1 D;  5B40 D;  3AZJ C;  4Z5T D;  5B1L C;  1M18 A;  1P3L C;  1KX3 A;  4UPK A;  5AV5 D;  5B0Z D;  3UTB B;  1M1A D;  1P3F B;  3WA9 A;  3REL D;  3REI C;  5CPI A;  4J8U D;  5B31 A;  3W96 C;  1P3B B;  5DNN D;  2F8N D;  3X1V A;  2Y2P A;  2IO5 B;  4X23 B;  5B2J C;  1P3I D;  3REK A;  3AZE B;  3X1S D;  3AZN A;  1P3G C;  5CPJ A;  1P3M D;  1H3O A;  2FJ7 B;  4XZQ C;  2W8S A;  4WNN A;  2ZY4 A;  1M1A C;  5AV8 C;  5GT0 B;  4ZUX A;  4KHA B;  4J8X B;  4JJN D;  1M19 B;  3W97 C;  5DNM D;  3VH5 T;  5G49 B;  3AYW D;  5B1L A;  3MGQ B;  3X1S C;  3MGR B;  4DQY B;  5CHL B;  5GSU B;  1P3M C;  3W99 B;  4WU8 D;  1N1J A;  2HIO B;  2DF4 C;  5B32 D;  4J8V B;  4JJN C;  5BNX B;  5B2J A;  2J8P A;  3KUY B;  5DNM C;  3AFA D;  4J8W A;  3MGP D;  3R45 A;  4H9Q B;  3AZH D;  1P3G A;  3KWQ A;  1P3O B;  2F8N K;  4YM6 C;  5B24 D;  1P3P D;  4QLC C;  3AZL B;  2YFW A;  4XUJ D;  4WU8 C;  3LZ1 D;  5F99 B;  2NQB D;  4Z66 A;  4AWL C;  1ID3 C;  2ZY5 A;  3W97 A;  1P3A D;  5B32 C;  3AFA C;  3LJA C;  3A6N B;  1ZLA B;  5CP6 C;  3MGP C;  4YS3 B;  2RVQ C;  5BO0 A;  5B24 C;  3LEL B;  3AZF C;  5GXQ D;  1KX4 D;  5AY8 A;  4XUJ C;  3UTA D;  3W98 A;  4LD9 A;  1TZY B;  1EQZ B;  5E5A B;  5BNV B;  3AV2 A;  3REH A;  2CV5 A;  3B6G A;  3WKJ A;  2ZY2 A;  5C3I C;  5B33 C;  4G91 B;  4H9S C;  3C1B D;  3MVD D;  3EPJ A;  4QLC A;  4CAY B;  5CPK A;  3AZM D;  1AOI D;  3MNN A;  4WZS B;  5B2I A;  5AV6 B;  3AV1 B;  5B40 B;  3UT9 B;  1S32 D;  4Z5T B;  2PYO D;  4KGC D;  5BS7 A;  3IP4 C;  5AV5 B;  5B0Z B;  5AVC A;  3MVD C;  1M1A B;  3REL B;  4J8U B;  2Y2N A;  4HGA C;  3REJ B;  3WA9 D;  1KX5 A;  5DNN B;  3AZM C;  1P3I B;  3C1C D;  1S32 C;  4CSR A;  3TU4 C;  3MGS A;  4UUZ B;  3REK D;  3WAA D;  3AZN D;  2DQN C;  5JA4 B;  3X1T D;  1U35 A;  5CPJ D;  1M18 C;  1KX3 C;  3A1K A;  3AZK A;  3WTP A;  2XD1 A;  5B0Y A;  3LZ0 A;  1JFI B;  3WA9 C;  3AN2 A;  2ARO C;  5CPI C;  3AZI B;  5B31 C;  5DNM B;  4NE5 A;  3AYW B;  3X1V C;  3VH5 W;  3AZJ D;  5B1L D;  3UTB A;  1P3F A;  1P3L D;  5B1M A;  3AZN C;  3P5J B;  4G92 C;  3VH6 A;  3B0C T;  4R8P A;  5CPJ C;  1P3B A;  5KDM B;  2BYM B;  3A1I A;  4X23 A;  3AV1 A;  3B6F B;  4NE3 A;  4ZUX C;  2HUE C;  3H0L C;  3AFA B;  3AZE A;  3MGP B;  5B2J D;  3AZH B;  3O62 B;  1P3P B;  2FJ7 A;  4J8W D;  1PZR A;  1P3G D;  1F66 B;  4XZQ D;  3LZ1 B;  3B0D B;  4KHA A;  4J8X A;  2NQB B;  5AV8 D;  2ARO A;  1M19 A;  2ZY3 A;  1P3A B;  5G49 A;  3LZ0 D;  5GT3 C;  3W97 D;  4ZBJ B;  3MGQ A;  3MGR A;  2BYK B;  5GSU A;  4J8W C;  5GXQ B;  1KX4 B;  3UTA B;  1B67 A;  3KWQ C;  5AY8 D;  3VH6 W;  4J8V A;  5BNX A;  5AVB A;  3KUY A;  4Z66 C;  3C1B B;  4H9Q A;  2G5H C;  3MVD B;  1P3O A;  3WKJ D;  3AZL A;  3AZG B;  4WU9 C;  4YM6 D;  1WWI A;  1AOI B;  4QLC D;  5CPK D;  5F99 A;  2NZD A;  3MNN D;  5AY8 C;  5B2I D;  3W98 C;  1S32 B;  1ID3 D;  5GT3 A;  2JSS A;  4LD9 C;  2PYO B;  4KGC B;  4Z2M G;  1WWS A;  2Y2K A;  4M6B A;  2L5A A;  3REH C;  3AV2 C;  4YS3 A;  2VQR A;  2LY8 A;  2CV5 C;  3LJA D;  3LEL A;  3B6G C;  3WKJ C;  5CP6 D;  2RVQ D;  3EPK A;  5AVC D;  3AZF D;  5CPK C;  1TZY A;  1EQZ A;  5E5A A;  1KX5 D;  1ULY A;  5BNV A;  3AL0 C;  3MNN C;  1P34 B;  5B2I C;  3C1C B;  3X1U B;  1P3K B;  3REK B;  3WAA B;  5B33 D;  3MGS D;  3X1T B;  4WU9 A;  5CPJ B;  4H9P B;  5BS7 C;  5FUG B;  1U35 D;  5AVC C;  2F2A C;  5AV6 A;  3WTP D;  5JRG A;  5B0Y D;  5B40 A;  1KX5 C; 
#chains in the Genus database with same CATH homology
 4WV4 B;  3AN2 D;  4Z5T A;  4H9O A;  1HQ3 B;  3AZJ B;  3KXB A;  5B1L B;  5AV5 A;  3REL A;  1P3L B;  4J8U A;  1W2E A;  3MGS C;  3REJ A;  5AV9 C;  5DNN A;  3UTB D;  1P3F D;  3REI B;  2Y2G A;  4H9N B;  5B1M D;  1U35 C;  3W96 B;  4KUD C;  4R8P D;  1N1J B;  3B0C W;  3AZK C;  3WTP C;  5B0Y C;  3LZ0 C;  3AN2 C;  4X23 D;  3FDD A;  5B2J B;  3VH5 A;  3V9R A;  4J8W B;  3TU4 D;  1P3G B;  1TAF A;  4XZQ B;  2FJ7 D;  1M18 D;  1JFI A;  4H9R B;  3UTB C;  5AV8 B;  1P3F C;  1KX3 D;  5B1M C;  2XD5 A;  3AZI A;  3EG5 B;  1P3B C;  2F8N B;  4R8P C;  3AYW A;  2ARO D;  1M19 D;  5CPI D;  3W97 B;  5B31 D;  2IO5 C;  3WTP E;  4X23 C;  3X1V D;  3AZE C;  3X1S B;  5BT1 D;  2Y2O A;  5AV9 A;  1P3M B;  2FJ7 C;  5AY8 B;  2YFV A;  5KDM A;  4KUD A;  2BYM A;  3B6F A;  5GT0 C;  3NQJ B;  4J8X C;  4JJN B;  1M19 C;  4ZUX D;  5AVB D;  3KUY D;  3AZH A;  3WKJ B;  3O62 A;  2F8N G;  1P3O D;  4YM6 B;  3MGQ C;  1F66 A;  4QLC B;  5BT1 C;  3LZ1 A;  3MGR C;  5GSU C;  2NQB A;  3W99 C;  4WU8 B;  4E45 A;  2Y2L A;  1HTA A;  4AWL B;  1T3U A;  1ID3 B;  2NZD D;  2HIO C;  5B32 B;  4J8V C;  5GT3 D;  2BYK A;  5AVB C;  3KUY C;  3LJA B;  5CP6 B;  3H0R C;  1P3O C;  5B24 B;  3LEL D;  3AZF B;  3AZL C;  4XUJ B;  3KWQ D;  5GT0 A;  1EQZ D;  1KU5 A;  5F99 C;  3C1B A;  2NZD C;  2JE5 A;  4NFT A;  3UT9 A;  4Z66 D;  5C3I B;  2ZM5 A;  5B33 B;  4CSR B;  3AZG A;  1BH8 B;  4DRB A;  3A6N C;  1AOI A;  4YS3 C;  4WU9 D;  5B32 G;  3LEL C;  3W99 A;  3WTP B;  5AV6 D;  1TZY C;  2HIO A;  5JRG D;  1EQZ C;  3UT9 D;  5E5A C;  2PYO A;  3W98 D;  4KGC A;  4LD9 D;  2UWX A;  3AV2 D;  3REH D;  4G91 C;  3KXB D;  1BH9 B;  2CV5 D;  3B6G D;  5B1M B;  4HGA B;  3REJ D;  3KSY A;  1R4V A;  2JCH A;  4E44 A;  4R8P B;  3AZM B;  1P34 A;  3C1C A;  5AV6 C;  3EPH A;  3X1U A;  2FFF B;  5JRG C;  3AV1 C;  1P3K A;  3UT9 C;  5B40 C;  3WAA A;  3F6T A;  3TU4 B;  3NQU B;  4Z5T C;  3X1T A;  4H9P A;  1ZLA A;  3A6N A;  5FUG A;  3KXB C;  1M18 B;  5AV5 C;  5B0Z C;  3REL C;  1KX3 B;  4J8U C;  3REJ C;  3WA9 B;  5DNN C;  2ARO B;  3KFU G;  5CPI B;  1HQ3 A;  5B31 B;  3AZI D;  2G5I C;  3AZJ A;  3X1V B;  1P3I C;  1P3L A;  1B6W A;  3REI A;  4H9N A;  4CAY A;  3AZN B;  3W96 A;  5AV9 D;  4G92 B;  1H3O B;  4WNN B;  4KUD D;  3B6F D;  3AZK D;  4ZUX B;  5AVB B;  3AZI C;  2HUE B;  3AYW C;  4EO5 C;  2Y2J A;  4XZQ A;  3O62 D;  5B31 G;  5B0Z A;  4H9R A;  1M1A A;  5AV8 A;  2F8N H;  1F66 D;  2Y2H A;  2F8N A;  2NZD B;  1A7W A;  1P3B D;  3B6F C;  5GT3 B;  1F1E A;  1P3I A;  3X1S A;  3AZH C;  4UUZ A;  1P3M A;  3AZE D;  3O62 C;  1P3P C;  3R45 B;  3VH6 T;  5JA4 A;  3KWQ B;  1F66 C;  3NQJ A;  3LZ1 C;  3B0D C;  2YFW B;  2NQB C;  4JJN A;  2RIQ A;  5GT0 D;  1P3A C;  5DNM A;  2CWE A;  4Z66 B;  4J8X D;  1Z2C B;  4ZBJ C;  1Q9C A;  4YM6 A;  3EPL A;  4WU9 B;  3AZG D;  3MGQ D;  4WU8 A;  5GXQ C;  3MGR D;  1KX4 C;  5GSU D;  3UTA C;  2Y2Q A;  5BO0 B;  1ID3 A;  3W99 D;  3B0B A;  5JRG B;  5B32 A;  3W98 B;  4LD9 B;  4H9O B;  2HIO D;  3AFA A;  3LJA A;  4J8V D;  3AV2 B;  3REH B;  5CP6 A;  3KXB B;  3MGP A;  3C1B C;  2CV5 B;  3B6G B;  1P3P A;  5B24 A;  3AZF A;  4NE6 A;  4XUJ A;  3AZG C;  3H0M C;  1AOI C;  1BFM A;  5CPK B;  3AZL D;  3MNN B;  1P3A A;  1P34 D;  5F99 D;  5B2I B;  5B33 A;  4H9S A;  3X1U D;  1P3K D;  2PYO C;  4KGC C;  1BH8 A;  2Y2M A;  3V9R B;  1TAF B;  3A6N D;  1ZLA D;  4Z2M H;  4YS3 D;  5GXQ A;  1KX4 A;  3UTA A;  5AVC B;  1KX5 B;  1P34 C;  1TZY D;  1HQ3 D;  2Y2I A;  5E5A D;  4EO5 B;  3C1C C;  2BG1 A;  3X1U C;  1P3K C;  1BH9 A;  3WAA C;  3MVD A;  3REK C;  3MGS B;  3X1T C;  5AV9 B;  3AZM A;  1ZLA C;  3REI D;  2YFV B;  1U35 B;  3W96 D;  4KUD B;  4WJ3 C;  3AZK B;  4DRA A;  5B0Y B;  3LZ0 B;  3AN2 B;  1S32 A;  3TU4 A;  3NQU A;  1HQ3 C;  3AV1 D;  5B40 D;  3AZJ C;  4Z5T D;  5B1L C;  1M18 A;  1P3L C;  1KX3 A;  4UPK A;  5AV5 D;  5B0Z D;  3UTB B;  1M1A D;  1P3F B;  3WA9 A;  3REL D;  3REI C;  5CPI A;  4J8U D;  5B31 A;  3W96 C;  1P3B B;  5DNN D;  2F8N D;  3X1V A;  2Y2P A;  2IO5 B;  4X23 B;  5B2J C;  1P3I D;  3REK A;  3AZE B;  3X1S D;  3AZN A;  1P3G C;  5CPJ A;  1P3M D;  1H3O A;  2FJ7 B;  4XZQ C;  2W8S A;  4WNN A;  2ZY4 A;  1M1A C;  5AV8 C;  5GT0 B;  4ZUX A;  4KHA B;  4J8X B;  4JJN D;  1M19 B;  3W97 C;  5DNM D;  3VH5 T;  5G49 B;  3AYW D;  5B1L A;  3MGQ B;  3X1S C;  3MGR B;  4DQY B;  5CHL B;  5GSU B;  1P3M C;  3W99 B;  4WU8 D;  1N1J A;  2HIO B;  2DF4 C;  5B32 D;  4J8V B;  4JJN C;  5BNX B;  5B2J A;  2J8P A;  3KUY B;  5DNM C;  3AFA D;  4J8W A;  3MGP D;  3R45 A;  4H9Q B;  3AZH D;  1P3G A;  3KWQ A;  1P3O B;  2F8N K;  4YM6 C;  5B24 D;  1P3P D;  4QLC C;  3AZL B;  2YFW A;  4XUJ D;  4WU8 C;  3LZ1 D;  5F99 B;  2NQB D;  4Z66 A;  4AWL C;  1ID3 C;  2ZY5 A;  3W97 A;  1P3A D;  5B32 C;  3AFA C;  3LJA C;  3A6N B;  1ZLA B;  5CP6 C;  3MGP C;  4YS3 B;  2RVQ C;  5BO0 A;  5B24 C;  3LEL B;  3AZF C;  5GXQ D;  1KX4 D;  5AY8 A;  4XUJ C;  3UTA D;  3W98 A;  4LD9 A;  1TZY B;  1EQZ B;  5E5A B;  5BNV B;  3AV2 A;  3REH A;  2CV5 A;  3B6G A;  3WKJ A;  2ZY2 A;  5C3I C;  5B33 C;  4G91 B;  4H9S C;  3C1B D;  3MVD D;  3EPJ A;  4QLC A;  4CAY B;  5CPK A;  3AZM D;  1AOI D;  3MNN A;  4WZS B;  5B2I A;  5AV6 B;  3AV1 B;  5B40 B;  3UT9 B;  1S32 D;  4Z5T B;  2PYO D;  4KGC D;  5BS7 A;  3IP4 C;  5AV5 B;  5B0Z B;  5AVC A;  3MVD C;  1M1A B;  3REL B;  4J8U B;  2Y2N A;  4HGA C;  3REJ B;  3WA9 D;  1KX5 A;  5DNN B;  3AZM C;  1P3I B;  3C1C D;  1S32 C;  4CSR A;  3TU4 C;  3MGS A;  4UUZ B;  3REK D;  3WAA D;  3AZN D;  2DQN C;  5JA4 B;  3X1T D;  1U35 A;  5CPJ D;  1M18 C;  1KX3 C;  3A1K A;  3AZK A;  3WTP A;  2XD1 A;  5B0Y A;  3LZ0 A;  1JFI B;  3WA9 C;  3AN2 A;  2ARO C;  5CPI C;  3AZI B;  5B31 C;  5DNM B;  4NE5 A;  3AYW B;  3X1V C;  3VH5 W;  3AZJ D;  5B1L D;  3UTB A;  1P3F A;  1P3L D;  5B1M A;  3AZN C;  3P5J B;  4G92 C;  3VH6 A;  3B0C T;  4R8P A;  5CPJ C;  1P3B A;  5KDM B;  2BYM B;  3A1I A;  4X23 A;  3AV1 A;  3B6F B;  4NE3 A;  4ZUX C;  2HUE C;  3H0L C;  3AFA B;  3AZE A;  3MGP B;  5B2J D;  3AZH B;  3O62 B;  1P3P B;  2FJ7 A;  4J8W D;  1PZR A;  1P3G D;  1F66 B;  4XZQ D;  3LZ1 B;  3B0D B;  4KHA A;  4J8X A;  2NQB B;  5AV8 D;  2ARO A;  1M19 A;  2ZY3 A;  1P3A B;  5G49 A;  3LZ0 D;  5GT3 C;  3W97 D;  4ZBJ B;  3MGQ A;  3MGR A;  2BYK B;  5GSU A;  4J8W C;  5GXQ B;  1KX4 B;  3UTA B;  1B67 A;  3KWQ C;  5AY8 D;  3VH6 W;  4J8V A;  5BNX A;  5AVB A;  3KUY A;  4Z66 C;  3C1B B;  4H9Q A;  2G5H C;  3MVD B;  1P3O A;  3WKJ D;  3AZL A;  3AZG B;  4WU9 C;  4YM6 D;  1WWI A;  1AOI B;  4QLC D;  5CPK D;  5F99 A;  2NZD A;  3MNN D;  5AY8 C;  5B2I D;  3W98 C;  1S32 B;  1ID3 D;  5GT3 A;  2JSS A;  4LD9 C;  2PYO B;  4KGC B;  4Z2M G;  1WWS A;  2Y2K A;  4M6B A;  2L5A A;  3REH C;  3AV2 C;  4YS3 A;  2VQR A;  2LY8 A;  2CV5 C;  3LJA D;  3LEL A;  3B6G C;  3WKJ C;  5CP6 D;  2RVQ D;  3EPK A;  5AVC D;  3AZF D;  5CPK C;  1TZY A;  1EQZ A;  5E5A A;  1KX5 D;  1ULY A;  5BNV A;  3AL0 C;  3MNN C;  1P34 B;  5B2I C;  3C1C B;  3X1U B;  1P3K B;  3REK B;  3WAA B;  5B33 D;  3MGS D;  3X1T B;  4WU9 A;  5CPJ B;  4H9P B;  5BS7 C;  5FUG B;  1U35 D;  5AVC C;  2F2A C;  5AV6 A;  3WTP D;  5JRG A;  5B0Y D;  5B40 A;  1KX5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...