4YM6B

Crystal structure of the human nucleosome containing 6-4pp (outside)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural basis of pyrimidine-pyrimidone (6-4) photoproduct recognition by UV-DDB in the nucleosome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 28
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ym6B00
5CPJB 5GXQA 4XZQA 1KX4B 5AV8D 4H9NA 5B2IC 3MNND 2YFWA 1S32A 3UTBD 3AZHC 3AYWB 3LELB 2YFVA 3AZEA 4ZBJB 5AVBD 3REKD 3AV2B 1P3PD 5CHLB 3KXBC 1M1AB 1F1EA 1U35C 3VH6A 3KUYB 3AZNA 1EQZD 4J8WC 1P3MB 3W98C 5BS7A 5G49B 1M18A 3AZIB 3W99C 2AROC 3X1TD 3X1UC 4J8XD 5GXQB 4XZQB 5F99D 4NE6A 4H9NB 4ZUXC 2YFWB 1P34A 1S32B 2YFVB 3AZEB 3AV1C 5B1MA 5CPKC 1P3KD 3WA9A 3LZ0A 3X1VD 5BNXA 4YM6A 5GT0A 5CPID 5DNNA 5AY8C 3AZNB 3TU4D 3C1BA 3REID 1ID3C 4XUJD 3WAAD 4Z5TA 5CPJD 5B33C 5B32G 4H9SA 3LELD 2PYOC 3REHC 1P34B 4J8UC 3RELC 2NZDD 3MVDC 5B1MB 2LY8A 4R8PC 3MGRC 3LZ0B 3MGQC 3WA9B 5BNXB 4YM6B 5GT0B 3KUYD 3X1SC 5DNNB 5AV9C 4LD9A 4NE3A 3C1BB 5C3IB 5B31C 4WNNA 3AZID 5GSUC 4Z5TB 4XZQD 3AN2A 5AVCC 5BO0A 3MGPB 5FUGA 5BT1D 2HUEB 1S32D 4X23D 1AOIA 2CV5A 1BH8A 1KX5A 5AV8C 5GT3D 3MNNC 3MGSA 4KUDA 1N1JA 5AVBC 3REKC 1P3PC 1F66A 2FJ7A 3B6GA 4WNNB 1EQZC 3C1CA 5B0YD 5B24A 3AN2B 3W97A 5BO0B 4WZSB 5FUGB 3X1TC 1P34D 3LZ1D 4J8XC 1AOIB 2CV5B 1BH8B 3KWQD 4G91C 5F99C 1KX5B 3AZMA 3LZ0D 4YM6D 4WU9D 4KUDB 1H3OA 3VH5T 5GT0D 3O62A 1N1JB 5CP6A 4HGAB 3UT9A 1P3OB 3AZLA 1F66B 1P3KC 4NE5A 2HIOA 5B1LD 3X1VC 2FJ7B 4Z5TD 5CPIC 3B6GB 3B0DC 5E5AD 1P3IA 3TU4C 3REIC 4XUJC 3C1CB 3AZGC 3WAAC 3MGPD 5CPJC 2F8NG 5B0ZD 3AZMB 4Z66C 2BYMA 4KGCA 1H3OB 4ZBJC 1R4VA 5AV6D 3O62B 5CP6B 3UT9B 1M19A 3B6FA 4EO5C 4CAYA 4WU8A 3AZLB 2NZDC 2HIOB 3KUYC 2IO5C 1P3IB 3LJAA 4J8VA 3AZIC 5JRGA 4E44A 5BT1C 1S32C 2BYMB 4X23C 1P3FD 4KGCB 5AV5A 3W96A 3B6FB 5GT3C 1P3OD 3NQJA 1F66D 4CAYB 4WU8B 2FJ7D 3B6GD 4QLCA 5JA4A 1P3AD 3C1CD 3AZKA 4J8VB 5JRGB 4G92C 2BYKA 3WKJC 4YS3A 4CSRA 5BNVA 5B0YC 1P34C 3LZ1C 4KHAA 4JJND 3UT9D 1WWSA 5AV5B 3W96B 3KWQC 3NQJB 3LZ0C 1B67A 2HIOD 4YM6C 3REJD 4WU9C 5GT0C 1P3LA 2F8NA 1P3BD 1P3ID 3B0BA 1ULYA 5B31G 3AZKB 5B1LC 5C3IC 4Z5TC 3VH6T 3AFAD 5E5AC 4YS3B 1B6WA 4CSRB 1M18B 4J8WA 3MGPC 1KX4D 3W98A 3W99A 2AROA 4KHAB 1TZYC 3AYWD 1ZLAA 5B0ZC 1P3GA 3AV2D 4ZUXA 5AV6C 1M1AD 1P3LB 2F8NB 3V9RA 3B0CW 3AV1A 4Z2MH 1P3MD 5AY8A 4J8WB 5GXQD 3W98B 3W99B 2AROB 3W96D 3AZJA 4H9PA 1ZLAB 5B33A 3AZED 1P3GB 1KX3A 1P3FC 4ZUXB 1P3OC 3REHA 3UTBC 1F66C 1WWIA 3AZKD 3V9RB 1JFIA 3AZND 3RELA 3AV1B 3B6GC 3MVDA 4LD9B 4R8PA 3MGRA 1P3AC 4AWLB 3C1CC 1M18D 3X1SA 5AV9A 5AY8B 5B31A 5GSUA 3AZJB 5B40A 4H9PB 4UUZA 1HQ3A 1KX3B 5B2JA 5AVCA 4JJNC 5B1MD 1P3LD 3WA9D 3MGSB 3REHB 5B32A 5DNND 3REJC 3MNNA 3C1BD 3MVDB 1P3IC 1P3BC 4R8PB 3MGRB 2NQBA 5DNMA 5AVBA 3X1SB 3REKA 5AV9B 3AFAC 5B31B 5B24B 3WTPA 5GSUB 3W97B 3AZFA 1ZLAD 3KSYA 5B40B 1P3GD 1KX4C 4E45A 1HQ3B 5B2JB 5AVCB 3AYWC 3LELC 4J8XA 5B32B 3AV1D 5F99A 3AV2C 4LD9D 1M1AC 3MNNB 2NQBB 3A6NA 5DNMB 3WTPE 5AVBB 3REKB 1P3MC 1P3KA 3X1VA 3AN2D 5CPIA 3WTPB 3AZJD 3AZFB 1AOID 4XUJA 2CV5D 5GXQC 4XZQC 3AZGA 1KX3D 1KX5D 3WAAA 3W96C 3MGSD 4KUDD 3UTAA 4J8XB 1KU5A 3AZEC 1A7WA 2JSSA 5F99B 1M19B 3MVDD 4Z66A 3B0CT 3AZKC 4H9RA 3A6NB 5AV9D 4H9OA 3AZNC 2NZDA 1P3KB 3LJAB 3X1VB 5BS7C 5B31D 5B24D 5GSUD 1M18C 3W97D 5CPIB 3B0DB 5B40D 4XUJB 1HQ3D 3AZGB 5B2JD 3WAAB 3AZMD 5B32D 3UTAB 3O62D 5CP6D 3AZLD 5B1MC 1P3LC 1BH9A 4Z66B 3NQUA 4X23A 2NQBD 3WA9C 5B2IA 2RVQD 4NFTA 5DNMD 4H9RB 3VH5W 5GT3A 5DNNC 4H9OB 5JA4B 4QLCB 3AZHA 3C1BC 4EO5B 2NZDB 3WTPD 3KXBA 2IO5B 3AZFD 2BYKB 1U35A 5BNVB 4H9SC 2HUEC 3WKJA 1ZLAC 4KGCD 1P3GC 3B6FD 5B0YA 1M19D 3X1UA 4WU8D 1BH9B 3LZ1A 3NQUB 4X23B 3A6ND 5B2IB 3KWQA 5GT3B 4LD9C 3AZHB 3LJAD 4WU9A 4AWLC 4J8VD 5JRGD 3KXBB 5CPKA 5B1LA 1U35B 3AZGD 3AN2C 1ID3A 5E5AA 4G92B 3AZJC 3WKJB 3UTAD 1AOIC 2CV5C 5AV5D 1KX5C 1KX3C 5B0YB 3MGPA 3X1UB 1HTAA 4Z66D 3MGSC 1TAFA 4KUDC 3LZ1B 4DRBA 1TZYA 4HGAC 4QLCD 3KWQB 2F8NH 5B0ZA 2PYOA 2L5AA 4J8UA 2FJ7C 4WU9B 5AV6A 5CPKB 3MGQA 4YS3D 5B1LB 5B24C 3W97C 1ID3B 5E5AB 5B40C 1HQ3C 5B2JC 2CWEA 3AZMC 5B33B 2F8NK 4DRAA 5B2ID 1TAFB 5B32C 3O62C 5CP6C 3UT9C 1TZYB 2F8ND 5KDMA 3AZHD 3AZLC 3VH5A 5B0ZB 2PYOB 4J8UB 2HIOC 5AV8A 1JFIB 2NQBC 2RVQC 1P3FA 5DNMC 5AV6B 3KXBD 4M6BA 3RELB 1P3OA 3UTBA 3MGQB 1U35D 3R45A 4J8WD 1P3PA 3WTPC 1Q9CA 3WKJD 3W98D 3VH6W 3AZFC 1P3AA 4H9QA 3W99D 2AROD 1EQZA 3X1UD 4UUZB 4ZUXD 4KGCC 3B6FC 3X1TA 1M19C 5KDMB 4WU8C 4Z2MG 5AV8B 3A6NC 4JJNA 1P3FB 5CPKD 3UTBB 3LJAC 3REJA 5AY8D 3R45B 4J8VC 1P3PB 1ID3D 5JRGC 1P3BA 1P3AB 4H9QB 1EQZB 3TU4A 3REIA 3AFAA 5B33D 3UTAC 1TZYD 5AV5C 3X1TB 5CPJA 3REHD 2PYOD 1KX4A 4J8UD 3RELD 4G91B 4JJNB 4QLCC 4R8PD 3MGRD 3LELA 3MGQD 3AYWA 3X1SD 3AV2A 3REJB 1M1AA 1P3BB 4WV4B 4YS3C 3KUYA 1P3MA 3TU4B 3REIB 3AFAB 1BFMA 5G49A 3AZIA 5AVCD
chains in the Genus database with same CATH superfamily
5CPJB 5GXQA 4XZQA 1KX4B 5AV8D 4H9NA 5B2IC 3MNND 2YFWA 1S32A 3UTBD 3AZHC 3AYWB 3LELB 2YFVA 3AZEA 4ZBJB 5AVBD 3REKD 3AV2B 1P3PD 5CHLB 3KXBC 1M1AB 1F1EA 1U35C 3VH6A 3KUYB 3AZNA 1EQZD 1W2EA 4J8WC 1P3MB 3W98C 5BS7A 5G49B 1M18A 3AZIB 3W99C 2AROC 3X1TD 3X1UC 4J8XD 5GXQB 4XZQB 2Y2MA 4NE6A 5F99D 4H9NB 4ZUXC 2YFWB 1P34A 1S32B 2YFVB 3AZEB 3AV1C 5B1MA 5CPKC 1P3KD 3WA9A 3LZ0A 3X1VD 5BNXA 4YM6A 5GT0A 5CPID 5DNNA 3H0LC 5AY8C 3AZNB 3TU4D 3C1BA 3REID 1ID3C 4XUJD 3WAAD 4Z5TA 5CPJD 5B33C 5B32G 4H9SA 1T3UA 3LELD 2PYOC 3REHC 1P34B 4J8UC 2Y2JA 3RELC 2NZDD 3MVDC 5B1MB 2LY8A 4R8PC 3MGRC 3LZ0B 3MGQC 3WA9B 5BNXB 4YM6B 5GT0B 3KUYD 3X1SC 5DNNB 5AV9C 4LD9A 4NE3A 3C1BB 5C3IB 5B31C 4WNNA 3AZID 5GSUC 4Z5TB 4XZQD 3AN2A 5AVCC 5BO0A 3MGPB 5FUGA 5BT1D 2HUEB 1S32D 4X23D 1AOIA 2CV5A 1BH8A 1KX5A 5AV8C 5GT3D 3MNNC 3KFUG 3MGSA 4KUDA 1N1JA 5AVBC 3REKC 1P3PC 1F66A 2FJ7A 3B6GA 4WNNB 2Y2KA 1EQZC 3C1CA 5B0YD 5B24A 3AN2B 3W97A 5BO0B 4WZSB 5FUGB 2ZY4A 3X1TC 1P34D 3LZ1D 4WJ3C 4J8XC 1AOIB 2CV5B 1BH8B 3KWQD 4G91C 5F99C 1KX5B 3AZMA 3LZ0D 4YM6D 4WU9D 4KUDB 1H3OA 3VH5T 5GT0D 3O62A 1N1JB 5CP6A 4HGAB 3UT9A 1P3OB 3AZLA 4UPKA 1F66B 1P3KC 4NE5A 2HIOA 5B1LD 3X1VC 2FJ7B 4Z5TD 5CPIC 3B6GB 3B0DC 5E5AD 1P3IA 3TU4C 3REIC 4XUJC 3H0RC 2G5HC 3C1CB 3AZGC 3WAAC 3MGPD 5CPJC 2F8NG 5B0ZD 3AZMB 4Z66C 2BYMA 4KGCA 1H3OB 4ZBJC 1R4VA 5AV6D 3O62B 5CP6B 3UT9B 1M19A 3B6FA 4EO5C 4CAYA 4WU8A 3AZLB 2NZDC 2HIOB 3KUYC 2IO5C 1P3IB 3LJAA 4J8VA 3AZIC 5JRGA 4E44A 3EPLA 2XD1A 5BT1C 1S32C 2BYMB 4X23C 1P3FD 4KGCB 5AV5A 3W96A 3B6FB 5GT3C 1P3OD 3NQJA 1F66D 4CAYB 4WU8B 2FJ7D 3B6GD 4QLCA 5JA4A 2ZY2A 2XD5A 1P3AD 3C1CD 3AZKA 4J8VB 5JRGB 4G92C 2BYKA 3WKJC 4YS3A 4CSRA 5BNVA 5B0YC 3EPHA 2FFFB 1P34C 3LZ1C 4KHAA 4JJND 3UT9D 1WWSA 5AV5B 3W96B 3KWQC 3NQJB 3LZ0C 1B67A 2HIOD 4YM6C 3REJD 4WU9C 5GT0C 1P3LA 2F8NA 1P3BD 1P3ID 3B0BA 1ULYA 5B31G 3AZKB 5B1LC 5C3IC 4Z5TC 3VH6T 3AFAD 5E5AC 4YS3B 1B6WA 4CSRB 1M18B 4J8WA 3MGPC 2Y2NA 1KX4D 3W98A 3AL0C 3W99A 2AROA 4KHAB 1TZYC 3AYWD 1ZLAA 5B0ZC 1P3GA 3AV2D 4ZUXA 5AV6C 1M1AD 1P3LB 2F8NB 3V9RA 3B0CW 3AV1A 4Z2MH 1P3MD 2ZY5A 5AY8A 2Y2PA 4J8WB 5GXQD 3W98B 3W99B 2AROB 3W96D 3AZJA 4H9PA 1ZLAB 5B33A 3AZED 1P3GB 1KX3A 1P3FC 4ZUXB 1P3OC 3REHA 3UTBC 1F66C 1WWIA 3AZKD 3V9RB 2Y2OA 1JFIA 3AZND 2Y2LA 3RELA 3AV1B 3B6GC 3MVDA 4LD9B 4R8PA 3MGRA 1P3AC 4AWLB 3C1CC 1M18D 3X1SA 5AV9A 5AY8B 3EPKA 5B31A 5GSUA 3AZJB 5B40A 4H9PB 4UUZA 3IP4C 1HQ3A 1KX3B 5B2JA 5AVCA 4JJNC 5B1MD 1P3LD 3WA9D 3MGSB 3REHB 5B32A 5DNND 3REJC 3MNNA 3C1BD 3MVDB 1P3IC 1P3BC 4R8PB 3MGRB 2NQBA 5DNMA 5AVBA 3X1SB 3REKA 2Y2QA 5AV9B 3AFAC 5B31B 5B24B 3WTPA 5GSUB 3W97B 3AZFA 1ZLAD 3KSYA 5B40B 1P3GD 1KX4C 4E45A 1HQ3B 5B2JB 5AVCB 3AYWC 3LELC 4J8XA 5B32B 3AV1D 5F99A 3AV2C 4LD9D 1M1AC 3MNNB 2NQBB 3A6NA 5DNMB 3WTPE 5AVBB 3REKB 1P3MC 1P3KA 3X1VA 3AN2D 5CPIA 3WTPB 3AZJD 3AZFB 1AOID 4XUJA 2CV5D 5GXQC 4XZQC 3AZGA 1KX3D 1KX5D 3WAAA 3W96C 3MGSD 4KUDD 3UTAA 4J8XB 1KU5A 3AZEC 1A7WA 2JSSA 3F6TA 5F99B 1M19B 3MVDD 4Z66A 3B0CT 3AZKC 4H9RA 3A6NB 5AV9D 4H9OA 3AZNC 2NZDA 1Z2CB 1P3KB 3LJAB 3X1VB 5BS7C 5B31D 5B24D 5GSUD 1M18C 3W97D 5CPIB 3B0DB 5B40D 4XUJB 1HQ3D 3AZGB 5B2JD 3WAAB 3AZMD 3EG5B 5B32D 3UTAB 3O62D 5CP6D 3AZLD 5B1MC 1P3LC 1BH9A 4Z66B 3NQUA 4X23A 2NQBD 3WA9C 5B2IA 2RVQD 4NFTA 2RIQA 5DNMD 4H9RB 3VH5W 5GT3A 5DNNC 3P5JB 4H9OB 5JA4B 4QLCB 3AZHA 3C1BC 4EO5B 2NZDB 4DQYB 2VQRA 3WTPD 3KXBA 2IO5B 3AZFD 2BYKB 1U35A 2BG1A 5BNVB 4H9SC 2HUEC 3WKJA 1ZLAC 4KGCD 1P3GC 3B6FD 5B0YA 1M19D 3X1UA 4WU8D 1BH9B 2W8SA 3NQUB 4X23B 3LZ1A 3A6ND 5B2IB 3KWQA 5GT3B 4LD9C 3AZHB 3LJAD 4WU9A 4AWLC 4J8VD 5JRGD 3KXBB 5CPKA 5B1LA 1U35B 3AZGD 3AN2C 2ZY3A 1ID3A 2UWXA 5E5AA 3H0MC 4G92B 3AZJC 3WKJB 3UTAD 1AOIC 2CV5C 5AV5D 1KX5C 1KX3C 5B0YB 3MGPA 3A1KA 2Y2HA 1HTAA 3X1UB 4Z66D 3MGSC 1TAFA 4KUDC 3LZ1B 4DRBA 1TZYA 4HGAC 4QLCD 3KWQB 2F8NH 5B0ZA 2PYOA 2L5AA 4J8UA 2G5IC 2FJ7C 4WU9B 5AV6A 2JE5A 2J8PA 5CPKB 3MGQA 4YS3D 5B1LB 5B24C 1PZRA 3W97C 1ID3B 5E5AB 5B40C 2DF4C 1HQ3C 5B2JC 2CWEA 3AZMC 5B33B 2F8NK 4DRAA 5B2ID 1TAFB 5B32C 3O62C 5CP6C 3UT9C 1TZYB 2F8ND 5KDMA 3AZHD 3AZLC 3VH5A 5B0ZB 2PYOB 4J8UB 2HIOC 5AV8A 1JFIB 2NQBC 2RVQC 1P3FA 5DNMC 5AV6B 3KXBD 4M6BA 3RELB 1P3OA 3UTBA 3MGQB 1U35D 3R45A 4J8WD 1P3PA 3WTPC 1Q9CA 3WKJD 3W98D 3VH6W 3AZFC 1P3AA 4H9QA 3FDDA 3W99D 2AROD 1EQZA 3X1UD 4UUZB 4ZUXD 4KGCC 3B6FC 3X1TA 1M19C 5KDMB 4WU8C 2Y2IA 4Z2MG 2Y2GA 5AV8B 3A6NC 4JJNA 1P3FB 5CPKD 3UTBB 3LJAC 2F2AC 3REJA 5AY8D 3R45B 4J8VC 1P3PB 1ID3D 5JRGC 1P3BA 1P3AB 4H9QB 2JCHA 1EQZB 3TU4A 3REIA 3AFAA 5B33D 3UTAC 3A1IA 1TZYD 5AV5C 3X1TB 5CPJA 3REHD 2PYOD 1KX4A 4J8UD 3RELD 4G91B 4JJNB 4QLCC 2DQNC 4R8PD 3LELA 3MGRD 3MGQD 3AYWA 3X1SD 3AV2A 3REJB 1M1AA 1P3BB 4WV4B 4YS3C 3EPJA 2ZM5A 3KUYA 1P3MA 3TU4B 3REIB 3AFAB 1BFMA 5G49A 3AZIA 5AVCD
chains in the Genus database with same CATH topology
5CPJB 5GXQA 4XZQA 1KX4B 5AV8D 4H9NA 5B2IC 3MNND 2YFWA 1S32A 3UTBD 3AZHC 3AYWB 3LELB 2YFVA 3AZEA 4ZBJB 5AVBD 3REKD 3AV2B 1P3PD 5CHLB 3KXBC 1M1AB 1F1EA 1U35C 3VH6A 3KUYB 3AZNA 1EQZD 1W2EA 4J8WC 1P3MB 3W98C 5BS7A 5G49B 1M18A 3AZIB 3W99C 2AROC 3X1TD 3X1UC 4J8XD 5GXQB 4XZQB 2Y2MA 4NE6A 5F99D 4H9NB 4ZUXC 2YFWB 1P34A 1S32B 2YFVB 3AZEB 3AV1C 5B1MA 5CPKC 1P3KD 3WA9A 3LZ0A 3X1VD 5BNXA 4YM6A 5GT0A 5CPID 5DNNA 3H0LC 5AY8C 3AZNB 3TU4D 3C1BA 3REID 1ID3C 4XUJD 3WAAD 4Z5TA 5CPJD 5B33C 5B32G 4H9SA 1T3UA 3LELD 2PYOC 3REHC 1P34B 4J8UC 2Y2JA 3RELC 2NZDD 3MVDC 5B1MB 2LY8A 4R8PC 3MGRC 3LZ0B 3MGQC 3WA9B 5BNXB 4YM6B 5GT0B 3KUYD 3X1SC 5DNNB 5AV9C 4LD9A 4NE3A 3C1BB 5C3IB 5B31C 4WNNA 3AZID 5GSUC 4Z5TB 4XZQD 3AN2A 5AVCC 5BO0A 3MGPB 5FUGA 5BT1D 2HUEB 1S32D 4X23D 1AOIA 2CV5A 1BH8A 1KX5A 5AV8C 5GT3D 3MNNC 3KFUG 3MGSA 4KUDA 1N1JA 5AVBC 3REKC 1P3PC 1F66A 2FJ7A 3B6GA 4WNNB 2Y2KA 1EQZC 3C1CA 5B0YD 5B24A 3AN2B 3W97A 5BO0B 4WZSB 5FUGB 2ZY4A 3X1TC 1P34D 3LZ1D 4WJ3C 4J8XC 1AOIB 2CV5B 1BH8B 3KWQD 4G91C 5F99C 1KX5B 3AZMA 3LZ0D 4YM6D 4WU9D 4KUDB 1H3OA 3VH5T 5GT0D 3O62A 1N1JB 5CP6A 4HGAB 3UT9A 1P3OB 3AZLA 4UPKA 1F66B 1P3KC 4NE5A 2HIOA 5B1LD 3X1VC 2FJ7B 4Z5TD 5CPIC 3B6GB 3B0DC 5E5AD 1P3IA 3TU4C 3REIC 4XUJC 3H0RC 2G5HC 3C1CB 3AZGC 3WAAC 3MGPD 5CPJC 2F8NG 5B0ZD 3AZMB 4Z66C 2BYMA 4KGCA 1H3OB 4ZBJC 1R4VA 5AV6D 3O62B 5CP6B 3UT9B 1M19A 3B6FA 4EO5C 4CAYA 4WU8A 3AZLB 2NZDC 2HIOB 3KUYC 2IO5C 1P3IB 3LJAA 4J8VA 3AZIC 5JRGA 4E44A 3EPLA 2XD1A 5BT1C 1S32C 2BYMB 4X23C 1P3FD 4KGCB 5AV5A 3W96A 3B6FB 5GT3C 1P3OD 3NQJA 1F66D 4CAYB 4WU8B 2FJ7D 3B6GD 4QLCA 5JA4A 2ZY2A 2XD5A 1P3AD 3C1CD 3AZKA 4J8VB 5JRGB 4G92C 2BYKA 3WKJC 4YS3A 4CSRA 5BNVA 5B0YC 3EPHA 2FFFB 1P34C 3LZ1C 4KHAA 4JJND 3UT9D 1WWSA 5AV5B 3W96B 3KWQC 3NQJB 3LZ0C 1B67A 2HIOD 4YM6C 3REJD 4WU9C 5GT0C 1P3LA 2F8NA 1P3BD 1P3ID 3B0BA 1ULYA 5B31G 3AZKB 5B1LC 5C3IC 4Z5TC 3VH6T 3AFAD 5E5AC 4YS3B 1B6WA 4CSRB 1M18B 4J8WA 3MGPC 2Y2NA 1KX4D 3W98A 3AL0C 3W99A 2AROA 4KHAB 1TZYC 3AYWD 1ZLAA 5B0ZC 1P3GA 3AV2D 4ZUXA 5AV6C 1M1AD 1P3LB 2F8NB 3V9RA 3B0CW 3AV1A 4Z2MH 1P3MD 2ZY5A 5AY8A 2Y2PA 4J8WB 5GXQD 3W98B 3W99B 2AROB 3W96D 3AZJA 4H9PA 1ZLAB 5B33A 3AZED 1P3GB 1KX3A 1P3FC 4ZUXB 1P3OC 3REHA 3UTBC 1F66C 1WWIA 3AZKD 3V9RB 2Y2OA 1JFIA 3AZND 2Y2LA 3RELA 3AV1B 3B6GC 3MVDA 4LD9B 4R8PA 3MGRA 1P3AC 4AWLB 3C1CC 1M18D 3X1SA 5AV9A 5AY8B 3EPKA 5B31A 5GSUA 3AZJB 5B40A 4H9PB 4UUZA 3IP4C 1HQ3A 1KX3B 5B2JA 5AVCA 4JJNC 5B1MD 1P3LD 3WA9D 3MGSB 3REHB 5B32A 5DNND 3REJC 3MNNA 3C1BD 3MVDB 1P3IC 1P3BC 4R8PB 3MGRB 2NQBA 5DNMA 5AVBA 3X1SB 3REKA 2Y2QA 5AV9B 3AFAC 5B31B 5B24B 3WTPA 5GSUB 3W97B 3AZFA 1ZLAD 3KSYA 5B40B 1P3GD 1KX4C 4E45A 1HQ3B 5B2JB 5AVCB 3AYWC 3LELC 4J8XA 5B32B 3AV1D 5F99A 3AV2C 4LD9D 1M1AC 3MNNB 2NQBB 3A6NA 5DNMB 3WTPE 5AVBB 3REKB 1P3MC 1P3KA 3X1VA 3AN2D 5CPIA 3WTPB 3AZJD 3AZFB 1AOID 4XUJA 2CV5D 5GXQC 4XZQC 3AZGA 1KX3D 1KX5D 3WAAA 3W96C 3MGSD 4KUDD 3UTAA 4J8XB 1KU5A 3AZEC 1A7WA 2JSSA 3F6TA 5F99B 1M19B 3MVDD 4Z66A 3B0CT 3AZKC 4H9RA 3A6NB 5AV9D 4H9OA 3AZNC 2NZDA 1Z2CB 1P3KB 3LJAB 3X1VB 5BS7C 5B31D 5B24D 5GSUD 1M18C 3W97D 5CPIB 3B0DB 5B40D 4XUJB 1HQ3D 3AZGB 5B2JD 3WAAB 3AZMD 3EG5B 5B32D 3UTAB 3O62D 5CP6D 3AZLD 5B1MC 1P3LC 1BH9A 4Z66B 3NQUA 4X23A 2NQBD 3WA9C 5B2IA 2RVQD 4NFTA 2RIQA 5DNMD 4H9RB 3VH5W 5GT3A 5DNNC 3P5JB 4H9OB 5JA4B 4QLCB 3AZHA 3C1BC 4EO5B 2NZDB 4DQYB 2VQRA 3WTPD 3KXBA 2IO5B 3AZFD 2BYKB 1U35A 2BG1A 5BNVB 4H9SC 2HUEC 3WKJA 1ZLAC 4KGCD 1P3GC 3B6FD 5B0YA 1M19D 3X1UA 4WU8D 1BH9B 2W8SA 3NQUB 4X23B 3LZ1A 3A6ND 5B2IB 3KWQA 5GT3B 4LD9C 3AZHB 3LJAD 4WU9A 4AWLC 4J8VD 5JRGD 3KXBB 5CPKA 5B1LA 1U35B 3AZGD 3AN2C 2ZY3A 1ID3A 2UWXA 5E5AA 3H0MC 4G92B 3AZJC 3WKJB 3UTAD 1AOIC 2CV5C 5AV5D 1KX5C 1KX3C 5B0YB 3MGPA 3A1KA 2Y2HA 1HTAA 3X1UB 4Z66D 3MGSC 1TAFA 4KUDC 3LZ1B 4DRBA 1TZYA 4HGAC 4QLCD 3KWQB 2F8NH 5B0ZA 2PYOA 2L5AA 4J8UA 2G5IC 2FJ7C 4WU9B 5AV6A 2JE5A 2J8PA 5CPKB 3MGQA 4YS3D 5B1LB 5B24C 1PZRA 3W97C 1ID3B 5E5AB 5B40C 2DF4C 1HQ3C 5B2JC 2CWEA 3AZMC 5B33B 2F8NK 4DRAA 5B2ID 1TAFB 5B32C 3O62C 5CP6C 3UT9C 1TZYB 2F8ND 5KDMA 3AZHD 3AZLC 3VH5A 5B0ZB 2PYOB 4J8UB 2HIOC 5AV8A 1JFIB 2NQBC 2RVQC 1P3FA 5DNMC 5AV6B 3KXBD 4M6BA 3RELB 1P3OA 3UTBA 3MGQB 1U35D 3R45A 4J8WD 1P3PA 3WTPC 1Q9CA 3WKJD 3W98D 3VH6W 3AZFC 1P3AA 4H9QA 3FDDA 3W99D 2AROD 1EQZA 3X1UD 4UUZB 4ZUXD 4KGCC 3B6FC 3X1TA 1M19C 5KDMB 4WU8C 2Y2IA 4Z2MG 2Y2GA 5AV8B 3A6NC 4JJNA 1P3FB 5CPKD 3UTBB 3LJAC 2F2AC 3REJA 5AY8D 3R45B 4J8VC 1P3PB 1ID3D 5JRGC 1P3BA 1P3AB 4H9QB 2JCHA 1EQZB 3TU4A 3REIA 3AFAA 5B33D 3UTAC 3A1IA 1TZYD 5AV5C 3X1TB 5CPJA 3REHD 2PYOD 1KX4A 4J8UD 3RELD 4G91B 4JJNB 4QLCC 2DQNC 4R8PD 3LELA 3MGRD 3MGQD 3AYWA 3X1SD 3AV2A 3REJB 1M1AA 1P3BB 4WV4B 4YS3C 3EPJA 2ZM5A 3KUYA 1P3MA 3TU4B 3REIB 3AFAB 1BFMA 5G49A 3AZIA 5AVCD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPJ B;  5GXQ A;  4XZQ A;  1KX4 B;  5AV8 D;  4H9N A;  5B2I C;  3MNN D;  2YFW A;  1S32 A;  3UTB D;  3AZH C;  3AYW B;  3LEL B;  2YFV A;  3AZE A;  4ZBJ B;  5AVB D;  3REK D;  3AV2 B;  1P3P D;  5CHL B;  3KXB C;  1M1A B;  1F1E A;  1U35 C;  3VH6 A;  3KUY B;  3AZN A;  1EQZ D;  4J8W C;  1P3M B;  3W98 C;  5BS7 A;  5G49 B;  1M18 A;  3AZI B;  3W99 C;  2ARO C;  3X1T D;  3X1U C;  4J8X D;  5GXQ B;  4XZQ B;  5F99 D;  4NE6 A;  4H9N B;  4ZUX C;  2YFW B;  1P34 A;  1S32 B;  2YFV B;  3AZE B;  3AV1 C;  5B1M A;  5CPK C;  1P3K D;  3WA9 A;  3LZ0 A;  3X1V D;  5BNX A;  4YM6 A;  5GT0 A;  5CPI D;  5DNN A;  5AY8 C;  3AZN B;  3TU4 D;  3C1B A;  3REI D;  1ID3 C;  4XUJ D;  3WAA D;  4Z5T A;  5CPJ D;  5B33 C;  5B32 G;  4H9S A;  3LEL D;  2PYO C;  3REH C;  1P34 B;  4J8U C;  3REL C;  2NZD D;  3MVD C;  5B1M B;  2LY8 A;  4R8P C;  3MGR C;  3LZ0 B;  3MGQ C;  3WA9 B;  5BNX B;  4YM6 B;  5GT0 B;  3KUY D;  3X1S C;  5DNN B;  5AV9 C;  4LD9 A;  4NE3 A;  3C1B B;  5C3I B;  5B31 C;  4WNN A;  3AZI D;  5GSU C;  4Z5T B;  4XZQ D;  3AN2 A;  5AVC C;  5BO0 A;  3MGP B;  5FUG A;  5BT1 D;  2HUE B;  1S32 D;  4X23 D;  1AOI A;  2CV5 A;  1BH8 A;  1KX5 A;  5AV8 C;  5GT3 D;  3MNN C;  3MGS A;  4KUD A;  1N1J A;  5AVB C;  3REK C;  1P3P C;  1F66 A;  2FJ7 A;  3B6G A;  4WNN B;  1EQZ C;  3C1C A;  5B0Y D;  5B24 A;  3AN2 B;  3W97 A;  5BO0 B;  4WZS B;  5FUG B;  3X1T C;  1P34 D;  3LZ1 D;  4J8X C;  1AOI B;  2CV5 B;  1BH8 B;  3KWQ D;  4G91 C;  5F99 C;  1KX5 B;  3AZM A;  3LZ0 D;  4YM6 D;  4WU9 D;  4KUD B;  1H3O A;  3VH5 T;  5GT0 D;  3O62 A;  1N1J B;  5CP6 A;  4HGA B;  3UT9 A;  1P3O B;  3AZL A;  1F66 B;  1P3K C;  4NE5 A;  2HIO A;  5B1L D;  3X1V C;  2FJ7 B;  4Z5T D;  5CPI C;  3B6G B;  3B0D C;  5E5A D;  1P3I A;  3TU4 C;  3REI C;  4XUJ C;  3C1C B;  3AZG C;  3WAA C;  3MGP D;  5CPJ C;  2F8N G;  5B0Z D;  3AZM B;  4Z66 C;  2BYM A;  4KGC A;  1H3O B;  4ZBJ C;  1R4V A;  5AV6 D;  3O62 B;  5CP6 B;  3UT9 B;  1M19 A;  3B6F A;  4EO5 C;  4CAY A;  4WU8 A;  3AZL B;  2NZD C;  2HIO B;  3KUY C;  2IO5 C;  1P3I B;  3LJA A;  4J8V A;  3AZI C;  5JRG A;  4E44 A;  5BT1 C;  1S32 C;  2BYM B;  4X23 C;  1P3F D;  4KGC B;  5AV5 A;  3W96 A;  3B6F B;  5GT3 C;  1P3O D;  3NQJ A;  1F66 D;  4CAY B;  4WU8 B;  2FJ7 D;  3B6G D;  4QLC A;  5JA4 A;  1P3A D;  3C1C D;  3AZK A;  4J8V B;  5JRG B;  4G92 C;  2BYK A;  3WKJ C;  4YS3 A;  4CSR A;  5BNV A;  5B0Y C;  1P34 C;  3LZ1 C;  4KHA A;  4JJN D;  3UT9 D;  1WWS A;  5AV5 B;  3W96 B;  3KWQ C;  3NQJ B;  3LZ0 C;  1B67 A;  2HIO D;  4YM6 C;  3REJ D;  4WU9 C;  5GT0 C;  1P3L A;  2F8N A;  1P3B D;  1P3I D;  3B0B A;  1ULY A;  5B31 G;  3AZK B;  5B1L C;  5C3I C;  4Z5T C;  3VH6 T;  3AFA D;  5E5A C;  4YS3 B;  1B6W A;  4CSR B;  1M18 B;  4J8W A;  3MGP C;  1KX4 D;  3W98 A;  3W99 A;  2ARO A;  4KHA B;  1TZY C;  3AYW D;  1ZLA A;  5B0Z C;  1P3G A;  3AV2 D;  4ZUX A;  5AV6 C;  1M1A D;  1P3L B;  2F8N B;  3V9R A;  3B0C W;  3AV1 A;  4Z2M H;  1P3M D;  5AY8 A;  4J8W B;  5GXQ D;  3W98 B;  3W99 B;  2ARO B;  3W96 D;  3AZJ A;  4H9P A;  1ZLA B;  5B33 A;  3AZE D;  1P3G B;  1KX3 A;  1P3F C;  4ZUX B;  1P3O C;  3REH A;  3UTB C;  1F66 C;  1WWI A;  3AZK D;  3V9R B;  1JFI A;  3AZN D;  3REL A;  3AV1 B;  3B6G C;  3MVD A;  4LD9 B;  4R8P A;  3MGR A;  1P3A C;  4AWL B;  3C1C C;  1M18 D;  3X1S A;  5AV9 A;  5AY8 B;  5B31 A;  5GSU A;  3AZJ B;  5B40 A;  4H9P B;  4UUZ A;  1HQ3 A;  1KX3 B;  5B2J A;  5AVC A;  4JJN C;  5B1M D;  1P3L D;  3WA9 D;  3MGS B;  3REH B;  5B32 A;  5DNN D;  3REJ C;  3MNN A;  3C1B D;  3MVD B;  1P3I C;  1P3B C;  4R8P B;  3MGR B;  2NQB A;  5DNM A;  5AVB A;  3X1S B;  3REK A;  5AV9 B;  3AFA C;  5B31 B;  5B24 B;  3WTP A;  5GSU B;  3W97 B;  3AZF A;  1ZLA D;  3KSY A;  5B40 B;  1P3G D;  1KX4 C;  4E45 A;  1HQ3 B;  5B2J B;  5AVC B;  3AYW C;  3LEL C;  4J8X A;  5B32 B;  3AV1 D;  5F99 A;  3AV2 C;  4LD9 D;  1M1A C;  3MNN B;  2NQB B;  3A6N A;  5DNM B;  3WTP E;  5AVB B;  3REK B;  1P3M C;  1P3K A;  3X1V A;  3AN2 D;  5CPI A;  3WTP B;  3AZJ D;  3AZF B;  1AOI D;  4XUJ A;  2CV5 D;  5GXQ C;  4XZQ C;  3AZG A;  1KX3 D;  1KX5 D;  3WAA A;  3W96 C;  3MGS D;  4KUD D;  3UTA A;  4J8X B;  1KU5 A;  3AZE C;  1A7W A;  2JSS A;  5F99 B;  1M19 B;  3MVD D;  4Z66 A;  3B0C T;  3AZK C;  4H9R A;  3A6N B;  5AV9 D;  4H9O A;  3AZN C;  2NZD A;  1P3K B;  3LJA B;  3X1V B;  5BS7 C;  5B31 D;  5B24 D;  5GSU D;  1M18 C;  3W97 D;  5CPI B;  3B0D B;  5B40 D;  4XUJ B;  1HQ3 D;  3AZG B;  5B2J D;  3WAA B;  3AZM D;  5B32 D;  3UTA B;  3O62 D;  5CP6 D;  3AZL D;  5B1M C;  1P3L C;  1BH9 A;  4Z66 B;  3NQU A;  4X23 A;  2NQB D;  3WA9 C;  5B2I A;  2RVQ D;  4NFT A;  5DNM D;  4H9R B;  3VH5 W;  5GT3 A;  5DNN C;  4H9O B;  5JA4 B;  4QLC B;  3AZH A;  3C1B C;  4EO5 B;  2NZD B;  3WTP D;  3KXB A;  2IO5 B;  3AZF D;  2BYK B;  1U35 A;  5BNV B;  4H9S C;  2HUE C;  3WKJ A;  1ZLA C;  4KGC D;  1P3G C;  3B6F D;  5B0Y A;  1M19 D;  3X1U A;  4WU8 D;  1BH9 B;  3LZ1 A;  3NQU B;  4X23 B;  3A6N D;  5B2I B;  3KWQ A;  5GT3 B;  4LD9 C;  3AZH B;  3LJA D;  4WU9 A;  4AWL C;  4J8V D;  5JRG D;  3KXB B;  5CPK A;  5B1L A;  1U35 B;  3AZG D;  3AN2 C;  1ID3 A;  5E5A A;  4G92 B;  3AZJ C;  3WKJ B;  3UTA D;  1AOI C;  2CV5 C;  5AV5 D;  1KX5 C;  1KX3 C;  5B0Y B;  3MGP A;  3X1U B;  1HTA A;  4Z66 D;  3MGS C;  1TAF A;  4KUD C;  3LZ1 B;  4DRB A;  1TZY A;  4HGA C;  4QLC D;  3KWQ B;  2F8N H;  5B0Z A;  2PYO A;  2L5A A;  4J8U A;  2FJ7 C;  4WU9 B;  5AV6 A;  5CPK B;  3MGQ A;  4YS3 D;  5B1L B;  5B24 C;  3W97 C;  1ID3 B;  5E5A B;  5B40 C;  1HQ3 C;  5B2J C;  2CWE A;  3AZM C;  5B33 B;  2F8N K;  4DRA A;  5B2I D;  1TAF B;  5B32 C;  3O62 C;  5CP6 C;  3UT9 C;  1TZY B;  2F8N D;  5KDM A;  3AZH D;  3AZL C;  3VH5 A;  5B0Z B;  2PYO B;  4J8U B;  2HIO C;  5AV8 A;  1JFI B;  2NQB C;  2RVQ C;  1P3F A;  5DNM C;  5AV6 B;  3KXB D;  4M6B A;  3REL B;  1P3O A;  3UTB A;  3MGQ B;  1U35 D;  3R45 A;  4J8W D;  1P3P A;  3WTP C;  1Q9C A;  3WKJ D;  3W98 D;  3VH6 W;  3AZF C;  1P3A A;  4H9Q A;  3W99 D;  2ARO D;  1EQZ A;  3X1U D;  4UUZ B;  4ZUX D;  4KGC C;  3B6F C;  3X1T A;  1M19 C;  5KDM B;  4WU8 C;  4Z2M G;  5AV8 B;  3A6N C;  4JJN A;  1P3F B;  5CPK D;  3UTB B;  3LJA C;  3REJ A;  5AY8 D;  3R45 B;  4J8V C;  1P3P B;  1ID3 D;  5JRG C;  1P3B A;  1P3A B;  4H9Q B;  1EQZ B;  3TU4 A;  3REI A;  3AFA A;  5B33 D;  3UTA C;  1TZY D;  5AV5 C;  3X1T B;  5CPJ A;  3REH D;  2PYO D;  1KX4 A;  4J8U D;  3REL D;  4G91 B;  4JJN B;  4QLC C;  4R8P D;  3MGR D;  3LEL A;  3MGQ D;  3AYW A;  3X1S D;  3AV2 A;  3REJ B;  1M1A A;  1P3B B;  4WV4 B;  4YS3 C;  3KUY A;  1P3M A;  3TU4 B;  3REI B;  3AFA B;  1BFM A;  5G49 A;  3AZI A;  5AVC D; 
#chains in the Genus database with same CATH topology
 5CPJ B;  5GXQ A;  4XZQ A;  1KX4 B;  5AV8 D;  4H9N A;  5B2I C;  3MNN D;  2YFW A;  1S32 A;  3UTB D;  3AZH C;  3AYW B;  3LEL B;  2YFV A;  3AZE A;  4ZBJ B;  5AVB D;  3REK D;  3AV2 B;  1P3P D;  5CHL B;  3KXB C;  1M1A B;  1F1E A;  1U35 C;  3VH6 A;  3KUY B;  3AZN A;  1EQZ D;  1W2E A;  4J8W C;  1P3M B;  3W98 C;  5BS7 A;  5G49 B;  1M18 A;  3AZI B;  3W99 C;  2ARO C;  3X1T D;  3X1U C;  4J8X D;  5GXQ B;  4XZQ B;  2Y2M A;  4NE6 A;  5F99 D;  4H9N B;  4ZUX C;  2YFW B;  1P34 A;  1S32 B;  2YFV B;  3AZE B;  3AV1 C;  5B1M A;  5CPK C;  1P3K D;  3WA9 A;  3LZ0 A;  3X1V D;  5BNX A;  4YM6 A;  5GT0 A;  5CPI D;  5DNN A;  3H0L C;  5AY8 C;  3AZN B;  3TU4 D;  3C1B A;  3REI D;  1ID3 C;  4XUJ D;  3WAA D;  4Z5T A;  5CPJ D;  5B33 C;  5B32 G;  4H9S A;  1T3U A;  3LEL D;  2PYO C;  3REH C;  1P34 B;  4J8U C;  2Y2J A;  3REL C;  2NZD D;  3MVD C;  5B1M B;  2LY8 A;  4R8P C;  3MGR C;  3LZ0 B;  3MGQ C;  3WA9 B;  5BNX B;  4YM6 B;  5GT0 B;  3KUY D;  3X1S C;  5DNN B;  5AV9 C;  4LD9 A;  4NE3 A;  3C1B B;  5C3I B;  5B31 C;  4WNN A;  3AZI D;  5GSU C;  4Z5T B;  4XZQ D;  3AN2 A;  5AVC C;  5BO0 A;  3MGP B;  5FUG A;  5BT1 D;  2HUE B;  1S32 D;  4X23 D;  1AOI A;  2CV5 A;  1BH8 A;  1KX5 A;  5AV8 C;  5GT3 D;  3MNN C;  3KFU G;  3MGS A;  4KUD A;  1N1J A;  5AVB C;  3REK C;  1P3P C;  1F66 A;  2FJ7 A;  3B6G A;  4WNN B;  2Y2K A;  1EQZ C;  3C1C A;  5B0Y D;  5B24 A;  3AN2 B;  3W97 A;  5BO0 B;  4WZS B;  5FUG B;  2ZY4 A;  3X1T C;  1P34 D;  3LZ1 D;  4WJ3 C;  4J8X C;  1AOI B;  2CV5 B;  1BH8 B;  3KWQ D;  4G91 C;  5F99 C;  1KX5 B;  3AZM A;  3LZ0 D;  4YM6 D;  4WU9 D;  4KUD B;  1H3O A;  3VH5 T;  5GT0 D;  3O62 A;  1N1J B;  5CP6 A;  4HGA B;  3UT9 A;  1P3O B;  3AZL A;  4UPK A;  1F66 B;  1P3K C;  4NE5 A;  2HIO A;  5B1L D;  3X1V C;  2FJ7 B;  4Z5T D;  5CPI C;  3B6G B;  3B0D C;  5E5A D;  1P3I A;  3TU4 C;  3REI C;  4XUJ C;  3H0R C;  2G5H C;  3C1C B;  3AZG C;  3WAA C;  3MGP D;  5CPJ C;  2F8N G;  5B0Z D;  3AZM B;  4Z66 C;  2BYM A;  4KGC A;  1H3O B;  4ZBJ C;  1R4V A;  5AV6 D;  3O62 B;  5CP6 B;  3UT9 B;  1M19 A;  3B6F A;  4EO5 C;  4CAY A;  4WU8 A;  3AZL B;  2NZD C;  2HIO B;  3KUY C;  2IO5 C;  1P3I B;  3LJA A;  4J8V A;  3AZI C;  5JRG A;  4E44 A;  3EPL A;  2XD1 A;  5BT1 C;  1S32 C;  2BYM B;  4X23 C;  1P3F D;  4KGC B;  5AV5 A;  3W96 A;  3B6F B;  5GT3 C;  1P3O D;  3NQJ A;  1F66 D;  4CAY B;  4WU8 B;  2FJ7 D;  3B6G D;  4QLC A;  5JA4 A;  2ZY2 A;  2XD5 A;  1P3A D;  3C1C D;  3AZK A;  4J8V B;  5JRG B;  4G92 C;  2BYK A;  3WKJ C;  4YS3 A;  4CSR A;  5BNV A;  5B0Y C;  3EPH A;  2FFF B;  1P34 C;  3LZ1 C;  4KHA A;  4JJN D;  3UT9 D;  1WWS A;  5AV5 B;  3W96 B;  3KWQ C;  3NQJ B;  3LZ0 C;  1B67 A;  2HIO D;  4YM6 C;  3REJ D;  4WU9 C;  5GT0 C;  1P3L A;  2F8N A;  1P3B D;  1P3I D;  3B0B A;  1ULY A;  5B31 G;  3AZK B;  5B1L C;  5C3I C;  4Z5T C;  3VH6 T;  3AFA D;  5E5A C;  4YS3 B;  1B6W A;  4CSR B;  1M18 B;  4J8W A;  3MGP C;  2Y2N A;  1KX4 D;  3W98 A;  3AL0 C;  3W99 A;  2ARO A;  4KHA B;  1TZY C;  3AYW D;  1ZLA A;  5B0Z C;  1P3G A;  3AV2 D;  4ZUX A;  5AV6 C;  1M1A D;  1P3L B;  2F8N B;  3V9R A;  3B0C W;  3AV1 A;  4Z2M H;  1P3M D;  2ZY5 A;  5AY8 A;  2Y2P A;  4J8W B;  5GXQ D;  3W98 B;  3W99 B;  2ARO B;  3W96 D;  3AZJ A;  4H9P A;  1ZLA B;  5B33 A;  3AZE D;  1P3G B;  1KX3 A;  1P3F C;  4ZUX B;  1P3O C;  3REH A;  3UTB C;  1F66 C;  1WWI A;  3AZK D;  3V9R B;  2Y2O A;  1JFI A;  3AZN D;  2Y2L A;  3REL A;  3AV1 B;  3B6G C;  3MVD A;  4LD9 B;  4R8P A;  3MGR A;  1P3A C;  4AWL B;  3C1C C;  1M18 D;  3X1S A;  5AV9 A;  5AY8 B;  3EPK A;  5B31 A;  5GSU A;  3AZJ B;  5B40 A;  4H9P B;  4UUZ A;  3IP4 C;  1HQ3 A;  1KX3 B;  5B2J A;  5AVC A;  4JJN C;  5B1M D;  1P3L D;  3WA9 D;  3MGS B;  3REH B;  5B32 A;  5DNN D;  3REJ C;  3MNN A;  3C1B D;  3MVD B;  1P3I C;  1P3B C;  4R8P B;  3MGR B;  2NQB A;  5DNM A;  5AVB A;  3X1S B;  3REK A;  2Y2Q A;  5AV9 B;  3AFA C;  5B31 B;  5B24 B;  3WTP A;  5GSU B;  3W97 B;  3AZF A;  1ZLA D;  3KSY A;  5B40 B;  1P3G D;  1KX4 C;  4E45 A;  1HQ3 B;  5B2J B;  5AVC B;  3AYW C;  3LEL C;  4J8X A;  5B32 B;  3AV1 D;  5F99 A;  3AV2 C;  4LD9 D;  1M1A C;  3MNN B;  2NQB B;  3A6N A;  5DNM B;  3WTP E;  5AVB B;  3REK B;  1P3M C;  1P3K A;  3X1V A;  3AN2 D;  5CPI A;  3WTP B;  3AZJ D;  3AZF B;  1AOI D;  4XUJ A;  2CV5 D;  5GXQ C;  4XZQ C;  3AZG A;  1KX3 D;  1KX5 D;  3WAA A;  3W96 C;  3MGS D;  4KUD D;  3UTA A;  4J8X B;  1KU5 A;  3AZE C;  1A7W A;  2JSS A;  3F6T A;  5F99 B;  1M19 B;  3MVD D;  4Z66 A;  3B0C T;  3AZK C;  4H9R A;  3A6N B;  5AV9 D;  4H9O A;  3AZN C;  2NZD A;  1Z2C B;  1P3K B;  3LJA B;  3X1V B;  5BS7 C;  5B31 D;  5B24 D;  5GSU D;  1M18 C;  3W97 D;  5CPI B;  3B0D B;  5B40 D;  4XUJ B;  1HQ3 D;  3AZG B;  5B2J D;  3WAA B;  3AZM D;  3EG5 B;  5B32 D;  3UTA B;  3O62 D;  5CP6 D;  3AZL D;  5B1M C;  1P3L C;  1BH9 A;  4Z66 B;  3NQU A;  4X23 A;  2NQB D;  3WA9 C;  5B2I A;  2RVQ D;  4NFT A;  2RIQ A;  5DNM D;  4H9R B;  3VH5 W;  5GT3 A;  5DNN C;  3P5J B;  4H9O B;  5JA4 B;  4QLC B;  3AZH A;  3C1B C;  4EO5 B;  2NZD B;  4DQY B;  2VQR A;  3WTP D;  3KXB A;  2IO5 B;  3AZF D;  2BYK B;  1U35 A;  2BG1 A;  5BNV B;  4H9S C;  2HUE C;  3WKJ A;  1ZLA C;  4KGC D;  1P3G C;  3B6F D;  5B0Y A;  1M19 D;  3X1U A;  4WU8 D;  1BH9 B;  2W8S A;  3NQU B;  4X23 B;  3LZ1 A;  3A6N D;  5B2I B;  3KWQ A;  5GT3 B;  4LD9 C;  3AZH B;  3LJA D;  4WU9 A;  4AWL C;  4J8V D;  5JRG D;  3KXB B;  5CPK A;  5B1L A;  1U35 B;  3AZG D;  3AN2 C;  2ZY3 A;  1ID3 A;  2UWX A;  5E5A A;  3H0M C;  4G92 B;  3AZJ C;  3WKJ B;  3UTA D;  1AOI C;  2CV5 C;  5AV5 D;  1KX5 C;  1KX3 C;  5B0Y B;  3MGP A;  3A1K A;  2Y2H A;  1HTA A;  3X1U B;  4Z66 D;  3MGS C;  1TAF A;  4KUD C;  3LZ1 B;  4DRB A;  1TZY A;  4HGA C;  4QLC D;  3KWQ B;  2F8N H;  5B0Z A;  2PYO A;  2L5A A;  4J8U A;  2G5I C;  2FJ7 C;  4WU9 B;  5AV6 A;  2JE5 A;  2J8P A;  5CPK B;  3MGQ A;  4YS3 D;  5B1L B;  5B24 C;  1PZR A;  3W97 C;  1ID3 B;  5E5A B;  5B40 C;  2DF4 C;  1HQ3 C;  5B2J C;  2CWE A;  3AZM C;  5B33 B;  2F8N K;  4DRA A;  5B2I D;  1TAF B;  5B32 C;  3O62 C;  5CP6 C;  3UT9 C;  1TZY B;  2F8N D;  5KDM A;  3AZH D;  3AZL C;  3VH5 A;  5B0Z B;  2PYO B;  4J8U B;  2HIO C;  5AV8 A;  1JFI B;  2NQB C;  2RVQ C;  1P3F A;  5DNM C;  5AV6 B;  3KXB D;  4M6B A;  3REL B;  1P3O A;  3UTB A;  3MGQ B;  1U35 D;  3R45 A;  4J8W D;  1P3P A;  3WTP C;  1Q9C A;  3WKJ D;  3W98 D;  3VH6 W;  3AZF C;  1P3A A;  4H9Q A;  3FDD A;  3W99 D;  2ARO D;  1EQZ A;  3X1U D;  4UUZ B;  4ZUX D;  4KGC C;  3B6F C;  3X1T A;  1M19 C;  5KDM B;  4WU8 C;  2Y2I A;  4Z2M G;  2Y2G A;  5AV8 B;  3A6N C;  4JJN A;  1P3F B;  5CPK D;  3UTB B;  3LJA C;  2F2A C;  3REJ A;  5AY8 D;  3R45 B;  4J8V C;  1P3P B;  1ID3 D;  5JRG C;  1P3B A;  1P3A B;  4H9Q B;  2JCH A;  1EQZ B;  3TU4 A;  3REI A;  3AFA A;  5B33 D;  3UTA C;  3A1I A;  1TZY D;  5AV5 C;  3X1T B;  5CPJ A;  3REH D;  2PYO D;  1KX4 A;  4J8U D;  3REL D;  4G91 B;  4JJN B;  4QLC C;  2DQN C;  4R8P D;  3LEL A;  3MGR D;  3MGQ D;  3AYW A;  3X1S D;  3AV2 A;  3REJ B;  1M1A A;  1P3B B;  4WV4 B;  4YS3 C;  3EPJ A;  2ZM5 A;  3KUY A;  1P3M A;  3TU4 B;  3REI B;  3AFA B;  1BFM A;  5G49 A;  3AZI A;  5AVC D; 
#chains in the Genus database with same CATH homology
 5CPJ B;  5GXQ A;  4XZQ A;  1KX4 B;  5AV8 D;  4H9N A;  5B2I C;  3MNN D;  2YFW A;  1S32 A;  3UTB D;  3AZH C;  3AYW B;  3LEL B;  2YFV A;  3AZE A;  4ZBJ B;  5AVB D;  3REK D;  3AV2 B;  1P3P D;  5CHL B;  3KXB C;  1M1A B;  1F1E A;  1U35 C;  3VH6 A;  3KUY B;  3AZN A;  1EQZ D;  1W2E A;  4J8W C;  1P3M B;  3W98 C;  5BS7 A;  5G49 B;  1M18 A;  3AZI B;  3W99 C;  2ARO C;  3X1T D;  3X1U C;  4J8X D;  5GXQ B;  4XZQ B;  2Y2M A;  4NE6 A;  5F99 D;  4H9N B;  4ZUX C;  2YFW B;  1P34 A;  1S32 B;  2YFV B;  3AZE B;  3AV1 C;  5B1M A;  5CPK C;  1P3K D;  3WA9 A;  3LZ0 A;  3X1V D;  5BNX A;  4YM6 A;  5GT0 A;  5CPI D;  5DNN A;  3H0L C;  5AY8 C;  3AZN B;  3TU4 D;  3C1B A;  3REI D;  1ID3 C;  4XUJ D;  3WAA D;  4Z5T A;  5CPJ D;  5B33 C;  5B32 G;  4H9S A;  1T3U A;  3LEL D;  2PYO C;  3REH C;  1P34 B;  4J8U C;  2Y2J A;  3REL C;  2NZD D;  3MVD C;  5B1M B;  2LY8 A;  4R8P C;  3MGR C;  3LZ0 B;  3MGQ C;  3WA9 B;  5BNX B;  4YM6 B;  5GT0 B;  3KUY D;  3X1S C;  5DNN B;  5AV9 C;  4LD9 A;  4NE3 A;  3C1B B;  5C3I B;  5B31 C;  4WNN A;  3AZI D;  5GSU C;  4Z5T B;  4XZQ D;  3AN2 A;  5AVC C;  5BO0 A;  3MGP B;  5FUG A;  5BT1 D;  2HUE B;  1S32 D;  4X23 D;  1AOI A;  2CV5 A;  1BH8 A;  1KX5 A;  5AV8 C;  5GT3 D;  3MNN C;  3KFU G;  3MGS A;  4KUD A;  1N1J A;  5AVB C;  3REK C;  1P3P C;  1F66 A;  2FJ7 A;  3B6G A;  4WNN B;  2Y2K A;  1EQZ C;  3C1C A;  5B0Y D;  5B24 A;  3AN2 B;  3W97 A;  5BO0 B;  4WZS B;  5FUG B;  2ZY4 A;  3X1T C;  1P34 D;  3LZ1 D;  4WJ3 C;  4J8X C;  1AOI B;  2CV5 B;  1BH8 B;  3KWQ D;  4G91 C;  5F99 C;  1KX5 B;  3AZM A;  3LZ0 D;  4YM6 D;  4WU9 D;  4KUD B;  1H3O A;  3VH5 T;  5GT0 D;  3O62 A;  1N1J B;  5CP6 A;  4HGA B;  3UT9 A;  1P3O B;  3AZL A;  4UPK A;  1F66 B;  1P3K C;  4NE5 A;  2HIO A;  5B1L D;  3X1V C;  2FJ7 B;  4Z5T D;  5CPI C;  3B6G B;  3B0D C;  5E5A D;  1P3I A;  3TU4 C;  3REI C;  4XUJ C;  3H0R C;  2G5H C;  3C1C B;  3AZG C;  3WAA C;  3MGP D;  5CPJ C;  2F8N G;  5B0Z D;  3AZM B;  4Z66 C;  2BYM A;  4KGC A;  1H3O B;  4ZBJ C;  1R4V A;  5AV6 D;  3O62 B;  5CP6 B;  3UT9 B;  1M19 A;  3B6F A;  4EO5 C;  4CAY A;  4WU8 A;  3AZL B;  2NZD C;  2HIO B;  3KUY C;  2IO5 C;  1P3I B;  3LJA A;  4J8V A;  3AZI C;  5JRG A;  4E44 A;  3EPL A;  2XD1 A;  5BT1 C;  1S32 C;  2BYM B;  4X23 C;  1P3F D;  4KGC B;  5AV5 A;  3W96 A;  3B6F B;  5GT3 C;  1P3O D;  3NQJ A;  1F66 D;  4CAY B;  4WU8 B;  2FJ7 D;  3B6G D;  4QLC A;  5JA4 A;  2ZY2 A;  2XD5 A;  1P3A D;  3C1C D;  3AZK A;  4J8V B;  5JRG B;  4G92 C;  2BYK A;  3WKJ C;  4YS3 A;  4CSR A;  5BNV A;  5B0Y C;  3EPH A;  2FFF B;  1P34 C;  3LZ1 C;  4KHA A;  4JJN D;  3UT9 D;  1WWS A;  5AV5 B;  3W96 B;  3KWQ C;  3NQJ B;  3LZ0 C;  1B67 A;  2HIO D;  4YM6 C;  3REJ D;  4WU9 C;  5GT0 C;  1P3L A;  2F8N A;  1P3B D;  1P3I D;  3B0B A;  1ULY A;  5B31 G;  3AZK B;  5B1L C;  5C3I C;  4Z5T C;  3VH6 T;  3AFA D;  5E5A C;  4YS3 B;  1B6W A;  4CSR B;  1M18 B;  4J8W A;  3MGP C;  2Y2N A;  1KX4 D;  3W98 A;  3AL0 C;  3W99 A;  2ARO A;  4KHA B;  1TZY C;  3AYW D;  1ZLA A;  5B0Z C;  1P3G A;  3AV2 D;  4ZUX A;  5AV6 C;  1M1A D;  1P3L B;  2F8N B;  3V9R A;  3B0C W;  3AV1 A;  4Z2M H;  1P3M D;  2ZY5 A;  5AY8 A;  2Y2P A;  4J8W B;  5GXQ D;  3W98 B;  3W99 B;  2ARO B;  3W96 D;  3AZJ A;  4H9P A;  1ZLA B;  5B33 A;  3AZE D;  1P3G B;  1KX3 A;  1P3F C;  4ZUX B;  1P3O C;  3REH A;  3UTB C;  1F66 C;  1WWI A;  3AZK D;  3V9R B;  2Y2O A;  1JFI A;  3AZN D;  2Y2L A;  3REL A;  3AV1 B;  3B6G C;  3MVD A;  4LD9 B;  4R8P A;  3MGR A;  1P3A C;  4AWL B;  3C1C C;  1M18 D;  3X1S A;  5AV9 A;  5AY8 B;  3EPK A;  5B31 A;  5GSU A;  3AZJ B;  5B40 A;  4H9P B;  4UUZ A;  3IP4 C;  1HQ3 A;  1KX3 B;  5B2J A;  5AVC A;  4JJN C;  5B1M D;  1P3L D;  3WA9 D;  3MGS B;  3REH B;  5B32 A;  5DNN D;  3REJ C;  3MNN A;  3C1B D;  3MVD B;  1P3I C;  1P3B C;  4R8P B;  3MGR B;  2NQB A;  5DNM A;  5AVB A;  3X1S B;  3REK A;  2Y2Q A;  5AV9 B;  3AFA C;  5B31 B;  5B24 B;  3WTP A;  5GSU B;  3W97 B;  3AZF A;  1ZLA D;  3KSY A;  5B40 B;  1P3G D;  1KX4 C;  4E45 A;  1HQ3 B;  5B2J B;  5AVC B;  3AYW C;  3LEL C;  4J8X A;  5B32 B;  3AV1 D;  5F99 A;  3AV2 C;  4LD9 D;  1M1A C;  3MNN B;  2NQB B;  3A6N A;  5DNM B;  3WTP E;  5AVB B;  3REK B;  1P3M C;  1P3K A;  3X1V A;  3AN2 D;  5CPI A;  3WTP B;  3AZJ D;  3AZF B;  1AOI D;  4XUJ A;  2CV5 D;  5GXQ C;  4XZQ C;  3AZG A;  1KX3 D;  1KX5 D;  3WAA A;  3W96 C;  3MGS D;  4KUD D;  3UTA A;  4J8X B;  1KU5 A;  3AZE C;  1A7W A;  2JSS A;  3F6T A;  5F99 B;  1M19 B;  3MVD D;  4Z66 A;  3B0C T;  3AZK C;  4H9R A;  3A6N B;  5AV9 D;  4H9O A;  3AZN C;  2NZD A;  1Z2C B;  1P3K B;  3LJA B;  3X1V B;  5BS7 C;  5B31 D;  5B24 D;  5GSU D;  1M18 C;  3W97 D;  5CPI B;  3B0D B;  5B40 D;  4XUJ B;  1HQ3 D;  3AZG B;  5B2J D;  3WAA B;  3AZM D;  3EG5 B;  5B32 D;  3UTA B;  3O62 D;  5CP6 D;  3AZL D;  5B1M C;  1P3L C;  1BH9 A;  4Z66 B;  3NQU A;  4X23 A;  2NQB D;  3WA9 C;  5B2I A;  2RVQ D;  4NFT A;  2RIQ A;  5DNM D;  4H9R B;  3VH5 W;  5GT3 A;  5DNN C;  3P5J B;  4H9O B;  5JA4 B;  4QLC B;  3AZH A;  3C1B C;  4EO5 B;  2NZD B;  4DQY B;  2VQR A;  3WTP D;  3KXB A;  2IO5 B;  3AZF D;  2BYK B;  1U35 A;  2BG1 A;  5BNV B;  4H9S C;  2HUE C;  3WKJ A;  1ZLA C;  4KGC D;  1P3G C;  3B6F D;  5B0Y A;  1M19 D;  3X1U A;  4WU8 D;  1BH9 B;  2W8S A;  3NQU B;  4X23 B;  3LZ1 A;  3A6N D;  5B2I B;  3KWQ A;  5GT3 B;  4LD9 C;  3AZH B;  3LJA D;  4WU9 A;  4AWL C;  4J8V D;  5JRG D;  3KXB B;  5CPK A;  5B1L A;  1U35 B;  3AZG D;  3AN2 C;  2ZY3 A;  1ID3 A;  2UWX A;  5E5A A;  3H0M C;  4G92 B;  3AZJ C;  3WKJ B;  3UTA D;  1AOI C;  2CV5 C;  5AV5 D;  1KX5 C;  1KX3 C;  5B0Y B;  3MGP A;  3A1K A;  2Y2H A;  1HTA A;  3X1U B;  4Z66 D;  3MGS C;  1TAF A;  4KUD C;  3LZ1 B;  4DRB A;  1TZY A;  4HGA C;  4QLC D;  3KWQ B;  2F8N H;  5B0Z A;  2PYO A;  2L5A A;  4J8U A;  2G5I C;  2FJ7 C;  4WU9 B;  5AV6 A;  2JE5 A;  2J8P A;  5CPK B;  3MGQ A;  4YS3 D;  5B1L B;  5B24 C;  1PZR A;  3W97 C;  1ID3 B;  5E5A B;  5B40 C;  2DF4 C;  1HQ3 C;  5B2J C;  2CWE A;  3AZM C;  5B33 B;  2F8N K;  4DRA A;  5B2I D;  1TAF B;  5B32 C;  3O62 C;  5CP6 C;  3UT9 C;  1TZY B;  2F8N D;  5KDM A;  3AZH D;  3AZL C;  3VH5 A;  5B0Z B;  2PYO B;  4J8U B;  2HIO C;  5AV8 A;  1JFI B;  2NQB C;  2RVQ C;  1P3F A;  5DNM C;  5AV6 B;  3KXB D;  4M6B A;  3REL B;  1P3O A;  3UTB A;  3MGQ B;  1U35 D;  3R45 A;  4J8W D;  1P3P A;  3WTP C;  1Q9C A;  3WKJ D;  3W98 D;  3VH6 W;  3AZF C;  1P3A A;  4H9Q A;  3FDD A;  3W99 D;  2ARO D;  1EQZ A;  3X1U D;  4UUZ B;  4ZUX D;  4KGC C;  3B6F C;  3X1T A;  1M19 C;  5KDM B;  4WU8 C;  2Y2I A;  4Z2M G;  2Y2G A;  5AV8 B;  3A6N C;  4JJN A;  1P3F B;  5CPK D;  3UTB B;  3LJA C;  2F2A C;  3REJ A;  5AY8 D;  3R45 B;  4J8V C;  1P3P B;  1ID3 D;  5JRG C;  1P3B A;  1P3A B;  4H9Q B;  2JCH A;  1EQZ B;  3TU4 A;  3REI A;  3AFA A;  5B33 D;  3UTA C;  3A1I A;  1TZY D;  5AV5 C;  3X1T B;  5CPJ A;  3REH D;  2PYO D;  1KX4 A;  4J8U D;  3REL D;  4G91 B;  4JJN B;  4QLC C;  2DQN C;  4R8P D;  3LEL A;  3MGR D;  3MGQ D;  3AYW A;  3X1S D;  3AV2 A;  3REJ B;  1M1A A;  1P3B B;  4WV4 B;  4YS3 C;  3EPJ A;  2ZM5 A;  3KUY A;  1P3M A;  3TU4 B;  3REI B;  3AFA B;  1BFM A;  5G49 A;  3AZI A;  5AVC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...