1KX4A

X-ray structure of the nucleosome core particle, ncp146b, at 2.6 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (5'(ATCTCCAAATATCCCTTGCGGATCGTAGAAAAAGTGTGTCAAACTGCGCTAT
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx4A00
3C1BD 3AZNC 4G92B 3NQUB 3AZNA 1P3OC 3KWQB 3AV1C 4EO5C 3MNND 1M18D 1P3OA 5B32C 3AZHC 3AV1A 5B24C 4Z66A 3X1VB 5B32A 5GSUD 3REJA 5B24A 3AZHA 2YFWA 5BNXA 3TU4C 3REHB 3R45A 5AV6C 3TU4A 3W98C 1KX4C 4JJNB 5AV9C 1KX4A 5AV9A 1TZYD 5B40C 4J8UD 5B40A 2RVQD 4H9NB 5G49B 3LZ0B 5JRGD 3RELB 4UUZA 4Z5TB 1EQZC 1M19A 4R8PB 5AVCC 1ULYA 2BYKB 3AN2D 2LY8A 5AVCA 4X23C 3B6GC 2CV5B 3A6ND 1P3BC 5B31B 4X23A 5GXQC 3B6GA 3AYWB 1P3BA 4NE6A 5B2JC 3C1CB 3REKD 5B2JA 5B1LD 5B2IC 3AFAC 2AROC 5KDMA 5GT0D 5B2IA 1P3KD 3AFAA 3UTBB 5CP6C 3W99D 1S32C 2AROA 3WTPC 3MNNB 1P34B 1P3LC 5B0ZB 2PYOD 5CP6A 3W97D 3AV2B 1S32A 3WTPA 1P3LA 5CPJC 3MGPB 4NE5A 3MGSA 3AZLD 5DNMB 5CPJA 4WNNA 5BNVA 1M1AD 4YM6C 1P3PC 5B33D 4YM6A 1KU5A 3O62B 3UT9D 1P3PA 4DRAA 4J8UB 3AZJB 3UTAB 1P3AD 2F8NB 5JRGB 3W96D 4WZSB 3MVDD 3LZ1D 3X1TD 3AN2B 1HQ3D 4XUJA 3KXBC 1ID3C 5AVBC 3AZFC 3MGRC 2YFVA 1P3GC 3KWQD 3KXBA 1ID3A 5AVBA 3AZFA 3MGRA 4ZUXC 1P3GA 5JA4B 3B0DC 3X1VD 3AV1D 2IO5B 4Z66D 4ZUXA 4AWLB 5CHLB 3REJD 5GT0B 3B6FC 4J8VB 1R4VA 3REHD 4LD9C 2PYOB 3B6FA 4XZQC 3W97B 1ZLAC 3TU4D 4LD9A 4J8XB 1JFIA 4XZQA 3REIC 3AZLB 3REIA 4YS3C 3WAAC 1M1AB 5GT3A 5B1MA 3LZ0D 4YS3A 3WAAA 5AV8C 3RELD 4Z5TD 5BO0A 4R8PD 1M19D 1F66D 5AV8A 4ZBJC 1P3MB 4CSRA 1P3AB 3MGQB 3WKJC 3W96B 1P3FC 3AYWD 3MVDB 2FJ7C 3X1TB 4KUDB 3WKJA 1HQ3B 1P3FA 3X1SB 3AZGB 2FJ7A 1P3IB 3WA9C 2HIOC 3LJAB 5B2JD 4G91B 4QLCC 3WA9A 3AZNB 4QLCA 5B2ID 3UTBD 3AFAD 1P34D 5B0ZD 1P3OB 5BS7C 3AV1B 3AV2D 4H9OA 4Z66B 4EO5B 1F1EA 3MGPD 1TAFA 1KX5C 5B32B 3REJB 3AZHB 5B24B 4J8WC 3MGSD 5DNMD 5CPIC 5BNXB 3LELD 1KX5A 1H3OA 3R45B 5E5AC 4WU9C 1BH8A 4J8WA 4WU8C 3TU4B 5AV6A 4WU9A 5E5AA 3V9RA 4WU8A 3W98A 3O62D 5AV9B 5FUGA 4CAYA 3UTAD 3AZEC 3AZJD 2F8ND 5B40B 3AZEA 3AZKC 4UUZB 1M19B 1F66B 1U35C 3AZKA 1EQZA 1U35A 5AVCB 5AY8C 4WV4B 4X23B 5AY8A 3B6GB 4XUJD 1P3BB 2NZDC 3X1UC 5GXQA 2NZDA 5AVBD 3X1UA 3MGRD 5B2JB 1P3GD 2NQBC 5B31G 5B0YC 3VH5A 1BH9A 5KDMB 4H9QA 5B2IB 2NQBA 3AFAB 5B0YA 4J8VD 2AROB 1B67A 3B6FD 1WWIA 5CP6B 2CV5C 1S32B 3WTPB 4J8XD 1P3LB 3VH5W 1A7WA 3AZIC 3MGSB 5CPJB 3LELB 3REID 4WNNB 3C1CC 4KGCC 3AZIA 3KUYC 5BNVB 5AV5C 3C1BC 4KGCA 5GT3D 5B1MD 3KUYA 5BT1D 3WAAD 5AV5A 3C1BA 1P3PB 1P3MD 5AV8D 4NE3A 1M18C 3MGQD 1M18A 5GSUC 2HUEB 4DRBA 4KUDD 5GSUA 3WKJD 3X1SD 3AZGD 1P3ID 3LJAD 1N1JB 4XUJB 1TZYC 3AZND 2YFVB 3KXBB 1ID3B 1TZYA 5AVBB 2RVQC 1B6WA 3MGRB 3AZFB 1P3OD 1P3GB 4KHAA 4ZUXB 5B32D 3AZHD 3AZMC 5B24D 3AN2C 1KX5D 3AZMA 3B6FB 5C3IC 3A6NC 4LD9B 5AV6D 2BYMA 1JFIB 4XZQB 3A6NA 1ZLAA 4WU8D 3W98D 1KX4D 5AV9D 3REIB 3REKC 5B40D 5B1LC 2IO5C 5GT3B 5B1MB 3REKA 4YS3B 5CPKC 3WAAB 5BO0B 5B1LA 1P3KC 3W99C 5AV8B 5CPKA 3AZKD 3NQJA 4HGAC 4CSRB 1EQZD 1P3KA 2PYOC 3W97C 3W99A 1U35D 4ZBJB 5AVCD 1KX3C 4X23D 3AZLC 3B6GD 1P3BD 1KX3A 5DNNC 5F99C 3WKJB 5GXQD 3VH6T 1M1AC 1AOIC 5DNNA 5F99A 2FJ7B 5B33C 1WWSA 1AOIA 2F8NK 5B33A 4M6BA 2HIOA 3UT9C 3WA9B 3B0CT 4QLCB 3UT9A 2AROD 5CP6D 1S32D 4H9OB 1Q9CA 3WTPD 1P3LD 3W96C 1TAFB 5BS7A 3MVDC 3LZ1C 2YFWB 4H9RA 3X1TC 5CPJD 1KX5B 1HQ3C 1H3OB 3KSYA 3MVDA 1BH8B 3LZ1A 4J8WB 2F8NH 5CPIA 5AV6B 4WU9B 4E44A 4G92C 4KGCD 4H9PA 2L5AA 3V9RB 4WU8B 3W98B 5AV5D 1KX4B 4YM6D 1P3PD 3NQUA 3KWQC 5FUGB 4CAYB 3B0BA 3X1VC 3KWQA 4Z66C 3AZEB 3REJC 3X1VA 3REHC 3AZKB 1EQZB 1U35B 3REHA 4JJNC 5AY8B 4JJNA 5GXQB 3KXBD 1ID3D 2NZDB 3AZFD 3X1UB 3LZ0C 3RELC 4Z5TC 3VH6A 4R8PC 4H9NA 4ZUXD 5G49A 3LZ0A 1M19C 1BH9B 1F66C 3RELA 4H9QB 4Z5TA 2NQBB 5B0YB 4R8PA 1F66A 3AZMD 2BYKA 5B31C 4LD9D 3VH6W 4XZQD 3AYWC 2CV5A 1ZLAD 5B31A 3AYWA 3AZIB 3B0CW 3WTPE 3C1CA 4KGCB 2JSSA 3KUYB 4YS3D 5AV5B 4YM6B 3C1BB 3UTBC 5CPKD 3MNNC 1P34C 5B0ZC 3UTBA 3AV2C 3MNNA 1P34A 5B0ZA 3MGPC 1M18B 3AV2A 3MGSC 5DNMC 3MGPA 3LELC 1KX3D 1HTAA 5GSUB 4Z2MH 1P3FD 5DNMA 3LELA 2F8NG 5DNND 5F99D 2FJ7D 1AOID 3O62C 3WA9D 2HIOD 4QLCD 4J8UC 3O62A 3UTAC 3AZJC 1TZYB 4J8UA 5JRGC 3UTAA 3AZJA 2F8NA 4KHAB 2HUEC 5JRGA 3B0DB 4NFTA 3AZMB 4J8WD 3AN2A 5CPID 4WU9D 2BYMB 5E5AD 4XUJC 5C3IB 3A6NB 1ZLAB 1N1JA 2CWEA 3AZED 4AWLC 3REKB 5JA4A 5GT0C 5B1LB 4E45A 4J8VC 5CPKB 3NQJB 5GT0A 1P3KB 4J8VA 3W99B 4HGAB 4J8XC 2PYOA 3W97A 5AY8D 4J8XA 4JJND 1KX3B 1P3FB 3AZLA 2NZDD 5DNNB 5F99B 3X1UD 1BFMA 5GT3C 5B1MC 1M1AA 1AOIB 5BT1C 4H9SC 5B33B 2HIOB 1P3MC 2NQBD 4H9SA 1P3AC 5B0YD 3UT9B 3MGQC 1P3MA 1P3AA 3MGQA 2CV5D 5B31D 4KUDC 4H9RB 3W96A 3X1SC 3AZGC 4Z2MG 3LZ1B 3AZID 3X1TA 1P3IC 4KUDA 5CPIB 3LJAC 1HQ3A 3X1SA 5E5AB 3C1CD 4G91C 3AZGA 4H9PB 3VH5T 3KUYD 1P3IA 3LJAA 5B32G
chains in the Genus database with same CATH superfamily
3C1BD 3AZNC 4G92B 3NQUB 2Y2QA 3AZNA 1P3OC 3KWQB 3AV1C 4EO5C 3MNND 1M18D 1P3OA 5B32C 3AZHC 3AV1A 5B24C 4Z66A 3X1VB 5B32A 5GSUD 3REJA 5B24A 3AZHA 2YFWA 2JCHA 5BNXA 3TU4C 3REHB 3R45A 5AV6C 3TU4A 3W98C 1KX4C 4JJNB 5AV9C 1KX4A 5AV9A 1TZYD 5B40C 4J8UD 5B40A 2RVQD 4H9NB 5G49B 3LZ0B 5JRGD 3RELB 4UUZA 4Z5TB 1EQZC 1M19A 4R8PB 5AVCC 1ULYA 2BYKB 3AN2D 2LY8A 5AVCA 4X23C 3B6GC 3H0LC 2CV5B 3A6ND 1P3BC 5B31B 4X23A 5GXQC 3B6GA 3AYWB 1P3BA 4NE6A 5B2JC 3C1CB 3REKD 5B2JA 3AL0C 5B1LD 5B2IC 3AFAC 2AROC 5KDMA 5GT0D 5B2IA 1P3KD 3AFAA 3UTBB 5CP6C 3W99D 1S32C 2AROA 3WTPC 3MNNB 1P34B 1P3LC 5B0ZB 2PYOD 5CP6A 3W97D 3AV2B 1S32A 3WTPA 1P3LA 2W8SA 3MGPB 5CPJC 4NE5A 3MGSA 3AZLD 5DNMB 5CPJA 1Z2CB 4WNNA 5BNVA 1M1AD 4YM6C 1P3PC 5B33D 4YM6A 1KU5A 3O62B 3UT9D 1P3PA 4DRAA 2UWXA 4J8UB 3AZJB 3UTAB 1P3AD 2F8NB 4WJ3C 5JRGB 2Y2PA 3W96D 4WZSB 3MVDD 3LZ1D 3X1TD 2XD1A 3AN2B 1HQ3D 2XD5A 2ZM5A 4XUJA 3KXBC 1ID3C 5AVBC 3AZFC 3MGRC 2YFVA 1P3GC 3KWQD 3KXBA 1ID3A 5AVBA 3AZFA 3MGRA 4ZUXC 1P3GA 5JA4B 3B0DC 3X1VD 3AV1D 2IO5B 4Z66D 4ZUXA 4AWLB 5CHLB 3REJD 5GT0B 3B6FC 4J8VB 1R4VA 3REHD 4LD9C 2PYOB 3B6FA 4XZQC 3W97B 1ZLAC 3TU4D 4LD9A 4J8XB 1JFIA 4XZQA 3REIC 3AZLB 3REIA 4YS3C 3WAAC 1M1AB 5GT3A 5B1MA 3LZ0D 4YS3A 3WAAA 5AV8C 3RELD 4Z5TD 5BO0A 4R8PD 1M19D 1F66D 5AV8A 4ZBJC 1P3MB 4CSRA 1P3AB 3MGQB 3WKJC 3W96B 1P3FC 2Y2KA 3AYWD 2ZY2A 3MVDB 2FJ7C 3X1TB 4KUDB 3WKJA 1HQ3B 1P3FA 3X1SB 3AZGB 2FJ7A 1P3IB 3EPKA 3WA9C 2HIOC 3LJAB 5B2JD 4G91B 4QLCC 3WA9A 3AZNB 4QLCA 5B2ID 3UTBD 3AFAD 1P34D 5B0ZD 1P3OB 5BS7C 3AV1B 3AV2D 4H9OA 4Z66B 4EO5B 1F1EA 3MGPD 1TAFA 1KX5C 5B32B 3REJB 3AZHB 5B24B 4J8WC 3MGSD 5DNMD 5CPIC 5BNXB 3LELD 1KX5A 1H3OA 3R45B 5E5AC 4WU9C 1BH8A 4J8WA 4WU8C 3TU4B 5AV6A 4WU9A 5E5AA 3V9RA 4WU8A 3W98A 3O62D 3FDDA 5AV9B 5FUGA 4CAYA 3UTAD 3AZEC 3F6TA 3AZJD 2F8ND 5B40B 3AZEA 3P5JB 3AZKC 4UUZB 2DQNC 1M19B 1F66B 1U35C 3AZKA 1EQZA 1U35A 2VQRA 5AVCB 5AY8C 4WV4B 4X23B 5AY8A 3B6GB 4XUJD 1P3BB 2NZDC 3X1UC 5GXQA 2NZDA 5AVBD 3X1UA 3MGRD 5B2JB 1P3GD 2NQBC 5B31G 5B0YC 3VH5A 1BH9A 5KDMB 4H9QA 5B2IB 2NQBA 3AFAB 5B0YA 4J8VD 2AROB 1B67A 3B6FD 1WWIA 5CP6B 2CV5C 1S32B 2RIQA 3WTPB 4J8XD 1P3LB 3VH5W 1A7WA 3AZIC 3MGSB 5CPJB 1PZRA 3LELB 2G5HC 3REID 4WNNB 3C1CC 3EPJA 4KGCC 3AZIA 3KUYC 5BNVB 5AV5C 3C1BC 4KGCA 3A1KA 5B1MD 5GT3D 3KUYA 5BT1D 3WAAD 5AV5A 3C1BA 1P3PB 1T3UA 1P3MD 5AV8D 4NE3A 3EPLA 1M18C 3MGQD 1M18A 5GSUC 2HUEB 4DRBA 4KUDD 5GSUA 3H0MC 3WKJD 3X1SD 3AZGD 1P3ID 3LJAD 1N1JB 4XUJB 1TZYC 3AZND 2YFVB 3KXBB 1ID3B 1TZYA 5AVBB 2RVQC 1B6WA 3MGRB 3AZFB 1P3OD 1P3GB 4KHAA 4ZUXB 5B32D 3AZHD 3AZMC 5B24D 3AN2C 1KX5D 3AZMA 3B6FB 5C3IC 3A6NC 4LD9B 5AV6D 2BYMA 1JFIB 2JE5A 4XZQB 3A6NA 1ZLAA 4WU8D 3W98D 1KX4D 5AV9D 3REIB 3REKC 5B40D 5B1LC 2IO5C 5GT3B 5B1MB 3REKA 4YS3B 5CPKC 3WAAB 5BO0B 5B1LA 1P3KC 3W99C 5AV8B 5CPKA 3AZKD 3NQJA 4HGAC 4CSRB 1EQZD 1P3KA 2PYOC 3W97C 3W99A 1U35D 4ZBJB 5AVCD 1KX3C 3A1IA 4X23D 3AZLC 3B6GD 4DQYB 1P3BD 1KX3A 5DNNC 5F99C 3WKJB 5GXQD 3VH6T 1M1AC 1AOIC 5DNNA 5F99A 2FJ7B 5B33C 1WWSA 1AOIA 2F8NK 5B33A 4M6BA 2HIOA 3UT9C 3WA9B 2DF4C 3B0CT 4QLCB 3UT9A 2AROD 2ZY3A 5CP6D 1S32D 4H9OB 1Q9CA 3WTPD 1P3LD 3W96C 1TAFB 5BS7A 3MVDC 3LZ1C 2YFWB 4H9RA 3X1TC 5CPJD 1KX5B 1HQ3C 1H3OB 3KSYA 3MVDA 1BH8B 1W2EA 3LZ1A 4J8WB 2F8NH 5CPIA 5AV6B 4WU9B 4E44A 4G92C 2Y2NA 4KGCD 4H9PA 2L5AA 3V9RB 4WU8B 3W98B 5AV5D 1KX4B 4YM6D 1P3PD 3KFUG 3NQUA 3KWQC 5FUGB 4CAYB 3B0BA 3X1VC 3KWQA 4Z66C 4UPKA 3AZEB 3REJC 3X1VA 3IP4C 3REHC 2Y2IA 3AZKB 1EQZB 1U35B 3REHA 4JJNC 5AY8B 4JJNA 5GXQB 3KXBD 1ID3D 2NZDB 3AZFD 3X1UB 3LZ0C 3RELC 4Z5TC 3VH6A 4R8PC 4H9NA 4ZUXD 5G49A 3LZ0A 1M19C 1BH9B 1F66C 3RELA 4H9QB 4Z5TA 2NQBB 5B0YB 4R8PA 1F66A 3AZMD 2BYKA 5B31C 4LD9D 3VH6W 4XZQD 3AYWC 2CV5A 2F2AC 1ZLAD 5B31A 3AYWA 3AZIB 3B0CW 3WTPE 3C1CA 4KGCB 2JSSA 3KUYB 4YS3D 5AV5B 4YM6B 3C1BB 3UTBC 5CPKD 3MNNC 1P34C 5B0ZC 3UTBA 3AV2C 3MNNA 1P34A 5B0ZA 3MGPC 1M18B 3AV2A 3MGSC 5DNMC 3MGPA 3LELC 1KX3D 1HTAA 5GSUB 2J8PA 4Z2MH 1P3FD 5DNMA 3LELA 2F8NG 5DNND 2Y2MA 5F99D 2FJ7D 3EG5B 1AOID 3O62C 3WA9D 2FFFB 2HIOD 4QLCD 4J8UC 2Y2LA 3O62A 3UTAC 3AZJC 1TZYB 4J8UA 5JRGC 3UTAA 3AZJA 2F8NA 4KHAB 2HUEC 5JRGA 2Y2GA 3B0DB 4NFTA 3AZMB 4J8WD 3AN2A 5CPID 4WU9D 2BYMB 5E5AD 4XUJC 5C3IB 3A6NB 1ZLAB 2ZY4A 1N1JA 2Y2JA 2CWEA 2BG1A 2Y2OA 3AZED 4AWLC 3REKB 5JA4A 5GT0C 5B1LB 4E45A 4J8VC 5CPKB 3NQJB 5GT0A 1P3KB 4J8VA 3W99B 4HGAB 4J8XC 2PYOA 3W97A 2ZY5A 5AY8D 4J8XA 4JJND 1KX3B 1P3FB 3AZLA 2NZDD 5DNNB 5F99B 3X1UD 1BFMA 5GT3C 5B1MC 1M1AA 1AOIB 5BT1C 2G5IC 4H9SC 5B33B 2HIOB 2Y2HA 3H0RC 1P3MC 2NQBD 4H9SA 1P3AC 5B0YD 3UT9B 3MGQC 1P3MA 1P3AA 3MGQA 2CV5D 3EPHA 5B31D 4KUDC 4H9RB 3W96A 3X1SC 3AZGC 4Z2MG 3LZ1B 3AZID 3X1TA 1P3IC 4KUDA 5CPIB 3LJAC 1HQ3A 3X1SA 5E5AB 3C1CD 4G91C 3AZGA 4H9PB 3VH5T 3KUYD 1P3IA 3LJAA 5B32G
chains in the Genus database with same CATH topology
3C1BD 3AZNC 4G92B 3NQUB 2Y2QA 3AZNA 1P3OC 3KWQB 3AV1C 4EO5C 3MNND 1M18D 1P3OA 5B32C 3AZHC 3AV1A 5B24C 4Z66A 3X1VB 5B32A 5GSUD 3REJA 5B24A 3AZHA 2YFWA 2JCHA 5BNXA 3TU4C 3REHB 3R45A 5AV6C 3TU4A 3W98C 1KX4C 4JJNB 5AV9C 1KX4A 5AV9A 1TZYD 5B40C 4J8UD 5B40A 2RVQD 4H9NB 5G49B 3LZ0B 5JRGD 3RELB 4UUZA 4Z5TB 1EQZC 1M19A 4R8PB 5AVCC 1ULYA 2BYKB 3AN2D 2LY8A 5AVCA 4X23C 3B6GC 3H0LC 2CV5B 3A6ND 1P3BC 5B31B 4X23A 5GXQC 3B6GA 3AYWB 1P3BA 4NE6A 5B2JC 3C1CB 3REKD 5B2JA 3AL0C 5B1LD 5B2IC 3AFAC 2AROC 5KDMA 5GT0D 5B2IA 1P3KD 3AFAA 3UTBB 5CP6C 3W99D 1S32C 2AROA 3WTPC 3MNNB 1P34B 1P3LC 5B0ZB 2PYOD 5CP6A 3W97D 3AV2B 1S32A 3WTPA 1P3LA 2W8SA 3MGPB 5CPJC 4NE5A 3MGSA 3AZLD 5DNMB 5CPJA 1Z2CB 4WNNA 5BNVA 1M1AD 4YM6C 1P3PC 5B33D 4YM6A 1KU5A 3O62B 3UT9D 1P3PA 4DRAA 2UWXA 4J8UB 3AZJB 3UTAB 1P3AD 2F8NB 4WJ3C 5JRGB 2Y2PA 3W96D 4WZSB 3MVDD 3LZ1D 3X1TD 2XD1A 3AN2B 1HQ3D 2XD5A 2ZM5A 4XUJA 3KXBC 1ID3C 5AVBC 3AZFC 3MGRC 2YFVA 1P3GC 3KWQD 3KXBA 1ID3A 5AVBA 3AZFA 3MGRA 4ZUXC 1P3GA 5JA4B 3B0DC 3X1VD 3AV1D 2IO5B 4Z66D 4ZUXA 4AWLB 5CHLB 3REJD 5GT0B 3B6FC 4J8VB 1R4VA 3REHD 4LD9C 2PYOB 3B6FA 4XZQC 3W97B 1ZLAC 3TU4D 4LD9A 4J8XB 1JFIA 4XZQA 3REIC 3AZLB 3REIA 4YS3C 3WAAC 1M1AB 5GT3A 5B1MA 3LZ0D 4YS3A 3WAAA 5AV8C 3RELD 4Z5TD 5BO0A 4R8PD 1M19D 1F66D 5AV8A 4ZBJC 1P3MB 4CSRA 1P3AB 3MGQB 3WKJC 3W96B 1P3FC 2Y2KA 3AYWD 2ZY2A 3MVDB 2FJ7C 3X1TB 4KUDB 3WKJA 1HQ3B 1P3FA 3X1SB 3AZGB 2FJ7A 1P3IB 3EPKA 3WA9C 2HIOC 3LJAB 5B2JD 4G91B 4QLCC 3WA9A 3AZNB 4QLCA 5B2ID 3UTBD 3AFAD 1P34D 5B0ZD 1P3OB 5BS7C 3AV1B 3AV2D 4H9OA 4Z66B 4EO5B 1F1EA 3MGPD 1TAFA 1KX5C 5B32B 3REJB 3AZHB 5B24B 4J8WC 3MGSD 5DNMD 5CPIC 5BNXB 3LELD 1KX5A 1H3OA 3R45B 5E5AC 4WU9C 1BH8A 4J8WA 4WU8C 3TU4B 5AV6A 4WU9A 5E5AA 3V9RA 4WU8A 3W98A 3O62D 3FDDA 5AV9B 5FUGA 4CAYA 3UTAD 3AZEC 3F6TA 3AZJD 2F8ND 5B40B 3AZEA 3P5JB 3AZKC 4UUZB 2DQNC 1M19B 1F66B 1U35C 3AZKA 1EQZA 1U35A 2VQRA 5AVCB 5AY8C 4WV4B 4X23B 5AY8A 3B6GB 4XUJD 1P3BB 2NZDC 3X1UC 5GXQA 2NZDA 5AVBD 3X1UA 3MGRD 5B2JB 1P3GD 2NQBC 5B31G 5B0YC 3VH5A 1BH9A 5KDMB 4H9QA 5B2IB 2NQBA 3AFAB 5B0YA 4J8VD 2AROB 1B67A 3B6FD 1WWIA 5CP6B 2CV5C 1S32B 2RIQA 3WTPB 4J8XD 1P3LB 3VH5W 1A7WA 3AZIC 3MGSB 5CPJB 1PZRA 3LELB 2G5HC 3REID 4WNNB 3C1CC 3EPJA 4KGCC 3AZIA 3KUYC 5BNVB 5AV5C 3C1BC 4KGCA 3A1KA 5B1MD 5GT3D 3KUYA 5BT1D 3WAAD 5AV5A 3C1BA 1P3PB 1T3UA 1P3MD 5AV8D 4NE3A 3EPLA 1M18C 3MGQD 1M18A 5GSUC 2HUEB 4DRBA 4KUDD 5GSUA 3H0MC 3WKJD 3X1SD 3AZGD 1P3ID 3LJAD 1N1JB 4XUJB 1TZYC 3AZND 2YFVB 3KXBB 1ID3B 1TZYA 5AVBB 2RVQC 1B6WA 3MGRB 3AZFB 1P3OD 1P3GB 4KHAA 4ZUXB 5B32D 3AZHD 3AZMC 5B24D 3AN2C 1KX5D 3AZMA 3B6FB 5C3IC 3A6NC 4LD9B 5AV6D 2BYMA 1JFIB 2JE5A 4XZQB 3A6NA 1ZLAA 4WU8D 3W98D 1KX4D 5AV9D 3REIB 3REKC 5B40D 5B1LC 2IO5C 5GT3B 5B1MB 3REKA 4YS3B 5CPKC 3WAAB 5BO0B 5B1LA 1P3KC 3W99C 5AV8B 5CPKA 3AZKD 3NQJA 4HGAC 4CSRB 1EQZD 1P3KA 2PYOC 3W97C 3W99A 1U35D 4ZBJB 5AVCD 1KX3C 3A1IA 4X23D 3AZLC 3B6GD 4DQYB 1P3BD 1KX3A 5DNNC 5F99C 3WKJB 5GXQD 3VH6T 1M1AC 1AOIC 5DNNA 5F99A 2FJ7B 5B33C 1WWSA 1AOIA 2F8NK 5B33A 4M6BA 2HIOA 3UT9C 3WA9B 2DF4C 3B0CT 4QLCB 3UT9A 2AROD 2ZY3A 5CP6D 1S32D 4H9OB 1Q9CA 3WTPD 1P3LD 3W96C 1TAFB 5BS7A 3MVDC 3LZ1C 2YFWB 4H9RA 3X1TC 5CPJD 1KX5B 1HQ3C 1H3OB 3KSYA 3MVDA 1BH8B 1W2EA 3LZ1A 4J8WB 2F8NH 5CPIA 5AV6B 4WU9B 4E44A 4G92C 2Y2NA 4KGCD 4H9PA 2L5AA 3V9RB 4WU8B 3W98B 5AV5D 1KX4B 4YM6D 1P3PD 3KFUG 3NQUA 3KWQC 5FUGB 4CAYB 3B0BA 3X1VC 3KWQA 4Z66C 4UPKA 3AZEB 3REJC 3X1VA 3IP4C 3REHC 2Y2IA 3AZKB 1EQZB 1U35B 3REHA 4JJNC 5AY8B 4JJNA 5GXQB 3KXBD 1ID3D 2NZDB 3AZFD 3X1UB 3LZ0C 3RELC 4Z5TC 3VH6A 4R8PC 4H9NA 4ZUXD 5G49A 3LZ0A 1M19C 1BH9B 1F66C 3RELA 4H9QB 4Z5TA 2NQBB 5B0YB 4R8PA 1F66A 3AZMD 2BYKA 5B31C 4LD9D 3VH6W 4XZQD 3AYWC 2CV5A 2F2AC 1ZLAD 5B31A 3AYWA 3AZIB 3B0CW 3WTPE 3C1CA 4KGCB 2JSSA 3KUYB 4YS3D 5AV5B 4YM6B 3C1BB 3UTBC 5CPKD 3MNNC 1P34C 5B0ZC 3UTBA 3AV2C 3MNNA 1P34A 5B0ZA 3MGPC 1M18B 3AV2A 3MGSC 5DNMC 3MGPA 3LELC 1KX3D 1HTAA 5GSUB 2J8PA 4Z2MH 1P3FD 5DNMA 3LELA 2F8NG 5DNND 2Y2MA 5F99D 2FJ7D 3EG5B 1AOID 3O62C 3WA9D 2FFFB 2HIOD 4QLCD 4J8UC 2Y2LA 3O62A 3UTAC 3AZJC 1TZYB 4J8UA 5JRGC 3UTAA 3AZJA 2F8NA 4KHAB 2HUEC 5JRGA 2Y2GA 3B0DB 4NFTA 3AZMB 4J8WD 3AN2A 5CPID 4WU9D 2BYMB 5E5AD 4XUJC 5C3IB 3A6NB 1ZLAB 2ZY4A 1N1JA 2Y2JA 2CWEA 2BG1A 2Y2OA 3AZED 4AWLC 3REKB 5JA4A 5GT0C 5B1LB 4E45A 4J8VC 5CPKB 3NQJB 5GT0A 1P3KB 4J8VA 3W99B 4HGAB 4J8XC 2PYOA 3W97A 2ZY5A 5AY8D 4J8XA 4JJND 1KX3B 1P3FB 3AZLA 2NZDD 5DNNB 5F99B 3X1UD 1BFMA 5GT3C 5B1MC 1M1AA 1AOIB 5BT1C 2G5IC 4H9SC 5B33B 2HIOB 2Y2HA 3H0RC 1P3MC 2NQBD 4H9SA 1P3AC 5B0YD 3UT9B 3MGQC 1P3MA 1P3AA 3MGQA 2CV5D 3EPHA 5B31D 4KUDC 4H9RB 3W96A 3X1SC 3AZGC 4Z2MG 3LZ1B 3AZID 3X1TA 1P3IC 4KUDA 5CPIB 3LJAC 1HQ3A 3X1SA 5E5AB 3C1CD 4G91C 3AZGA 4H9PB 3VH5T 3KUYD 1P3IA 3LJAA 5B32G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1B D;  3AZN C;  4G92 B;  3NQU B;  3AZN A;  1P3O C;  3KWQ B;  3AV1 C;  4EO5 C;  3MNN D;  1M18 D;  1P3O A;  5B32 C;  3AZH C;  3AV1 A;  5B24 C;  4Z66 A;  3X1V B;  5B32 A;  5GSU D;  3REJ A;  5B24 A;  3AZH A;  2YFW A;  5BNX A;  3TU4 C;  3REH B;  3R45 A;  5AV6 C;  3TU4 A;  3W98 C;  1KX4 C;  4JJN B;  5AV9 C;  1KX4 A;  5AV9 A;  1TZY D;  5B40 C;  4J8U D;  5B40 A;  2RVQ D;  4H9N B;  5G49 B;  3LZ0 B;  5JRG D;  3REL B;  4UUZ A;  4Z5T B;  1EQZ C;  1M19 A;  4R8P B;  5AVC C;  1ULY A;  2BYK B;  3AN2 D;  2LY8 A;  5AVC A;  4X23 C;  3B6G C;  2CV5 B;  3A6N D;  1P3B C;  5B31 B;  4X23 A;  5GXQ C;  3B6G A;  3AYW B;  1P3B A;  4NE6 A;  5B2J C;  3C1C B;  3REK D;  5B2J A;  5B1L D;  5B2I C;  3AFA C;  2ARO C;  5KDM A;  5GT0 D;  5B2I A;  1P3K D;  3AFA A;  3UTB B;  5CP6 C;  3W99 D;  1S32 C;  2ARO A;  3WTP C;  3MNN B;  1P34 B;  1P3L C;  5B0Z B;  2PYO D;  5CP6 A;  3W97 D;  3AV2 B;  1S32 A;  3WTP A;  1P3L A;  5CPJ C;  3MGP B;  4NE5 A;  3MGS A;  3AZL D;  5DNM B;  5CPJ A;  4WNN A;  5BNV A;  1M1A D;  4YM6 C;  1P3P C;  5B33 D;  4YM6 A;  1KU5 A;  3O62 B;  3UT9 D;  1P3P A;  4DRA A;  4J8U B;  3AZJ B;  3UTA B;  1P3A D;  2F8N B;  5JRG B;  3W96 D;  4WZS B;  3MVD D;  3LZ1 D;  3X1T D;  3AN2 B;  1HQ3 D;  4XUJ A;  3KXB C;  1ID3 C;  5AVB C;  3AZF C;  3MGR C;  2YFV A;  1P3G C;  3KWQ D;  3KXB A;  1ID3 A;  5AVB A;  3AZF A;  3MGR A;  4ZUX C;  1P3G A;  5JA4 B;  3B0D C;  3X1V D;  3AV1 D;  2IO5 B;  4Z66 D;  4ZUX A;  4AWL B;  5CHL B;  3REJ D;  5GT0 B;  3B6F C;  4J8V B;  1R4V A;  3REH D;  4LD9 C;  2PYO B;  3B6F A;  4XZQ C;  3W97 B;  1ZLA C;  3TU4 D;  4LD9 A;  4J8X B;  1JFI A;  4XZQ A;  3REI C;  3AZL B;  3REI A;  4YS3 C;  3WAA C;  1M1A B;  5GT3 A;  5B1M A;  3LZ0 D;  4YS3 A;  3WAA A;  5AV8 C;  3REL D;  4Z5T D;  5BO0 A;  4R8P D;  1M19 D;  1F66 D;  5AV8 A;  4ZBJ C;  1P3M B;  4CSR A;  1P3A B;  3MGQ B;  3WKJ C;  3W96 B;  1P3F C;  3AYW D;  3MVD B;  2FJ7 C;  3X1T B;  4KUD B;  3WKJ A;  1HQ3 B;  1P3F A;  3X1S B;  3AZG B;  2FJ7 A;  1P3I B;  3WA9 C;  2HIO C;  3LJA B;  5B2J D;  4G91 B;  4QLC C;  3WA9 A;  3AZN B;  4QLC A;  5B2I D;  3UTB D;  3AFA D;  1P34 D;  5B0Z D;  1P3O B;  5BS7 C;  3AV1 B;  3AV2 D;  4H9O A;  4Z66 B;  4EO5 B;  1F1E A;  3MGP D;  1TAF A;  1KX5 C;  5B32 B;  3REJ B;  3AZH B;  5B24 B;  4J8W C;  3MGS D;  5DNM D;  5CPI C;  5BNX B;  3LEL D;  1KX5 A;  1H3O A;  3R45 B;  5E5A C;  4WU9 C;  1BH8 A;  4J8W A;  4WU8 C;  3TU4 B;  5AV6 A;  4WU9 A;  5E5A A;  3V9R A;  4WU8 A;  3W98 A;  3O62 D;  5AV9 B;  5FUG A;  4CAY A;  3UTA D;  3AZE C;  3AZJ D;  2F8N D;  5B40 B;  3AZE A;  3AZK C;  4UUZ B;  1M19 B;  1F66 B;  1U35 C;  3AZK A;  1EQZ A;  1U35 A;  5AVC B;  5AY8 C;  4WV4 B;  4X23 B;  5AY8 A;  3B6G B;  4XUJ D;  1P3B B;  2NZD C;  3X1U C;  5GXQ A;  2NZD A;  5AVB D;  3X1U A;  3MGR D;  5B2J B;  1P3G D;  2NQB C;  5B31 G;  5B0Y C;  3VH5 A;  1BH9 A;  5KDM B;  4H9Q A;  5B2I B;  2NQB A;  3AFA B;  5B0Y A;  4J8V D;  2ARO B;  1B67 A;  3B6F D;  1WWI A;  5CP6 B;  2CV5 C;  1S32 B;  3WTP B;  4J8X D;  1P3L B;  3VH5 W;  1A7W A;  3AZI C;  3MGS B;  5CPJ B;  3LEL B;  3REI D;  4WNN B;  3C1C C;  4KGC C;  3AZI A;  3KUY C;  5BNV B;  5AV5 C;  3C1B C;  4KGC A;  5GT3 D;  5B1M D;  3KUY A;  5BT1 D;  3WAA D;  5AV5 A;  3C1B A;  1P3P B;  1P3M D;  5AV8 D;  4NE3 A;  1M18 C;  3MGQ D;  1M18 A;  5GSU C;  2HUE B;  4DRB A;  4KUD D;  5GSU A;  3WKJ D;  3X1S D;  3AZG D;  1P3I D;  3LJA D;  1N1J B;  4XUJ B;  1TZY C;  3AZN D;  2YFV B;  3KXB B;  1ID3 B;  1TZY A;  5AVB B;  2RVQ C;  1B6W A;  3MGR B;  3AZF B;  1P3O D;  1P3G B;  4KHA A;  4ZUX B;  5B32 D;  3AZH D;  3AZM C;  5B24 D;  3AN2 C;  1KX5 D;  3AZM A;  3B6F B;  5C3I C;  3A6N C;  4LD9 B;  5AV6 D;  2BYM A;  1JFI B;  4XZQ B;  3A6N A;  1ZLA A;  4WU8 D;  3W98 D;  1KX4 D;  5AV9 D;  3REI B;  3REK C;  5B40 D;  5B1L C;  2IO5 C;  5GT3 B;  5B1M B;  3REK A;  4YS3 B;  5CPK C;  3WAA B;  5BO0 B;  5B1L A;  1P3K C;  3W99 C;  5AV8 B;  5CPK A;  3AZK D;  3NQJ A;  4HGA C;  4CSR B;  1EQZ D;  1P3K A;  2PYO C;  3W97 C;  3W99 A;  1U35 D;  4ZBJ B;  5AVC D;  1KX3 C;  4X23 D;  3AZL C;  3B6G D;  1P3B D;  1KX3 A;  5DNN C;  5F99 C;  3WKJ B;  5GXQ D;  3VH6 T;  1M1A C;  1AOI C;  5DNN A;  5F99 A;  2FJ7 B;  5B33 C;  1WWS A;  1AOI A;  2F8N K;  5B33 A;  4M6B A;  2HIO A;  3UT9 C;  3WA9 B;  3B0C T;  4QLC B;  3UT9 A;  2ARO D;  5CP6 D;  1S32 D;  4H9O B;  1Q9C A;  3WTP D;  1P3L D;  3W96 C;  1TAF B;  5BS7 A;  3MVD C;  3LZ1 C;  2YFW B;  4H9R A;  3X1T C;  5CPJ D;  1KX5 B;  1HQ3 C;  1H3O B;  3KSY A;  3MVD A;  1BH8 B;  3LZ1 A;  4J8W B;  2F8N H;  5CPI A;  5AV6 B;  4WU9 B;  4E44 A;  4G92 C;  4KGC D;  4H9P A;  2L5A A;  3V9R B;  4WU8 B;  3W98 B;  5AV5 D;  1KX4 B;  4YM6 D;  1P3P D;  3NQU A;  3KWQ C;  5FUG B;  4CAY B;  3B0B A;  3X1V C;  3KWQ A;  4Z66 C;  3AZE B;  3REJ C;  3X1V A;  3REH C;  3AZK B;  1EQZ B;  1U35 B;  3REH A;  4JJN C;  5AY8 B;  4JJN A;  5GXQ B;  3KXB D;  1ID3 D;  2NZD B;  3AZF D;  3X1U B;  3LZ0 C;  3REL C;  4Z5T C;  3VH6 A;  4R8P C;  4H9N A;  4ZUX D;  5G49 A;  3LZ0 A;  1M19 C;  1BH9 B;  1F66 C;  3REL A;  4H9Q B;  4Z5T A;  2NQB B;  5B0Y B;  4R8P A;  1F66 A;  3AZM D;  2BYK A;  5B31 C;  4LD9 D;  3VH6 W;  4XZQ D;  3AYW C;  2CV5 A;  1ZLA D;  5B31 A;  3AYW A;  3AZI B;  3B0C W;  3WTP E;  3C1C A;  4KGC B;  2JSS A;  3KUY B;  4YS3 D;  5AV5 B;  4YM6 B;  3C1B B;  3UTB C;  5CPK D;  3MNN C;  1P34 C;  5B0Z C;  3UTB A;  3AV2 C;  3MNN A;  1P34 A;  5B0Z A;  3MGP C;  1M18 B;  3AV2 A;  3MGS C;  5DNM C;  3MGP A;  3LEL C;  1KX3 D;  1HTA A;  5GSU B;  4Z2M H;  1P3F D;  5DNM A;  3LEL A;  2F8N G;  5DNN D;  5F99 D;  2FJ7 D;  1AOI D;  3O62 C;  3WA9 D;  2HIO D;  4QLC D;  4J8U C;  3O62 A;  3UTA C;  3AZJ C;  1TZY B;  4J8U A;  5JRG C;  3UTA A;  3AZJ A;  2F8N A;  4KHA B;  2HUE C;  5JRG A;  3B0D B;  4NFT A;  3AZM B;  4J8W D;  3AN2 A;  5CPI D;  4WU9 D;  2BYM B;  5E5A D;  4XUJ C;  5C3I B;  3A6N B;  1ZLA B;  1N1J A;  2CWE A;  3AZE D;  4AWL C;  3REK B;  5JA4 A;  5GT0 C;  5B1L B;  4E45 A;  4J8V C;  5CPK B;  3NQJ B;  5GT0 A;  1P3K B;  4J8V A;  3W99 B;  4HGA B;  4J8X C;  2PYO A;  3W97 A;  5AY8 D;  4J8X A;  4JJN D;  1KX3 B;  1P3F B;  3AZL A;  2NZD D;  5DNN B;  5F99 B;  3X1U D;  1BFM A;  5GT3 C;  5B1M C;  1M1A A;  1AOI B;  5BT1 C;  4H9S C;  5B33 B;  2HIO B;  1P3M C;  2NQB D;  4H9S A;  1P3A C;  5B0Y D;  3UT9 B;  3MGQ C;  1P3M A;  1P3A A;  3MGQ A;  2CV5 D;  5B31 D;  4KUD C;  4H9R B;  3W96 A;  3X1S C;  3AZG C;  4Z2M G;  3LZ1 B;  3AZI D;  3X1T A;  1P3I C;  4KUD A;  5CPI B;  3LJA C;  1HQ3 A;  3X1S A;  5E5A B;  3C1C D;  4G91 C;  3AZG A;  4H9P B;  3VH5 T;  3KUY D;  1P3I A;  3LJA A;  5B32 G; 
#chains in the Genus database with same CATH topology
 3C1B D;  3AZN C;  4G92 B;  3NQU B;  2Y2Q A;  3AZN A;  1P3O C;  3KWQ B;  3AV1 C;  4EO5 C;  3MNN D;  1M18 D;  1P3O A;  5B32 C;  3AZH C;  3AV1 A;  5B24 C;  4Z66 A;  3X1V B;  5B32 A;  5GSU D;  3REJ A;  5B24 A;  3AZH A;  2YFW A;  2JCH A;  5BNX A;  3TU4 C;  3REH B;  3R45 A;  5AV6 C;  3TU4 A;  3W98 C;  1KX4 C;  4JJN B;  5AV9 C;  1KX4 A;  5AV9 A;  1TZY D;  5B40 C;  4J8U D;  5B40 A;  2RVQ D;  4H9N B;  5G49 B;  3LZ0 B;  5JRG D;  3REL B;  4UUZ A;  4Z5T B;  1EQZ C;  1M19 A;  4R8P B;  5AVC C;  1ULY A;  2BYK B;  3AN2 D;  2LY8 A;  5AVC A;  4X23 C;  3B6G C;  3H0L C;  2CV5 B;  3A6N D;  1P3B C;  5B31 B;  4X23 A;  5GXQ C;  3B6G A;  3AYW B;  1P3B A;  4NE6 A;  5B2J C;  3C1C B;  3REK D;  5B2J A;  3AL0 C;  5B1L D;  5B2I C;  3AFA C;  2ARO C;  5KDM A;  5GT0 D;  5B2I A;  1P3K D;  3AFA A;  3UTB B;  5CP6 C;  3W99 D;  1S32 C;  2ARO A;  3WTP C;  3MNN B;  1P34 B;  1P3L C;  5B0Z B;  2PYO D;  5CP6 A;  3W97 D;  3AV2 B;  1S32 A;  3WTP A;  1P3L A;  2W8S A;  3MGP B;  5CPJ C;  4NE5 A;  3MGS A;  3AZL D;  5DNM B;  5CPJ A;  1Z2C B;  4WNN A;  5BNV A;  1M1A D;  4YM6 C;  1P3P C;  5B33 D;  4YM6 A;  1KU5 A;  3O62 B;  3UT9 D;  1P3P A;  4DRA A;  2UWX A;  4J8U B;  3AZJ B;  3UTA B;  1P3A D;  2F8N B;  4WJ3 C;  5JRG B;  2Y2P A;  3W96 D;  4WZS B;  3MVD D;  3LZ1 D;  3X1T D;  2XD1 A;  3AN2 B;  1HQ3 D;  2XD5 A;  2ZM5 A;  4XUJ A;  3KXB C;  1ID3 C;  5AVB C;  3AZF C;  3MGR C;  2YFV A;  1P3G C;  3KWQ D;  3KXB A;  1ID3 A;  5AVB A;  3AZF A;  3MGR A;  4ZUX C;  1P3G A;  5JA4 B;  3B0D C;  3X1V D;  3AV1 D;  2IO5 B;  4Z66 D;  4ZUX A;  4AWL B;  5CHL B;  3REJ D;  5GT0 B;  3B6F C;  4J8V B;  1R4V A;  3REH D;  4LD9 C;  2PYO B;  3B6F A;  4XZQ C;  3W97 B;  1ZLA C;  3TU4 D;  4LD9 A;  4J8X B;  1JFI A;  4XZQ A;  3REI C;  3AZL B;  3REI A;  4YS3 C;  3WAA C;  1M1A B;  5GT3 A;  5B1M A;  3LZ0 D;  4YS3 A;  3WAA A;  5AV8 C;  3REL D;  4Z5T D;  5BO0 A;  4R8P D;  1M19 D;  1F66 D;  5AV8 A;  4ZBJ C;  1P3M B;  4CSR A;  1P3A B;  3MGQ B;  3WKJ C;  3W96 B;  1P3F C;  2Y2K A;  3AYW D;  2ZY2 A;  3MVD B;  2FJ7 C;  3X1T B;  4KUD B;  3WKJ A;  1HQ3 B;  1P3F A;  3X1S B;  3AZG B;  2FJ7 A;  1P3I B;  3EPK A;  3WA9 C;  2HIO C;  3LJA B;  5B2J D;  4G91 B;  4QLC C;  3WA9 A;  3AZN B;  4QLC A;  5B2I D;  3UTB D;  3AFA D;  1P34 D;  5B0Z D;  1P3O B;  5BS7 C;  3AV1 B;  3AV2 D;  4H9O A;  4Z66 B;  4EO5 B;  1F1E A;  3MGP D;  1TAF A;  1KX5 C;  5B32 B;  3REJ B;  3AZH B;  5B24 B;  4J8W C;  3MGS D;  5DNM D;  5CPI C;  5BNX B;  3LEL D;  1KX5 A;  1H3O A;  3R45 B;  5E5A C;  4WU9 C;  1BH8 A;  4J8W A;  4WU8 C;  3TU4 B;  5AV6 A;  4WU9 A;  5E5A A;  3V9R A;  4WU8 A;  3W98 A;  3O62 D;  3FDD A;  5AV9 B;  5FUG A;  4CAY A;  3UTA D;  3AZE C;  3F6T A;  3AZJ D;  2F8N D;  5B40 B;  3AZE A;  3P5J B;  3AZK C;  4UUZ B;  2DQN C;  1M19 B;  1F66 B;  1U35 C;  3AZK A;  1EQZ A;  1U35 A;  2VQR A;  5AVC B;  5AY8 C;  4WV4 B;  4X23 B;  5AY8 A;  3B6G B;  4XUJ D;  1P3B B;  2NZD C;  3X1U C;  5GXQ A;  2NZD A;  5AVB D;  3X1U A;  3MGR D;  5B2J B;  1P3G D;  2NQB C;  5B31 G;  5B0Y C;  3VH5 A;  1BH9 A;  5KDM B;  4H9Q A;  5B2I B;  2NQB A;  3AFA B;  5B0Y A;  4J8V D;  2ARO B;  1B67 A;  3B6F D;  1WWI A;  5CP6 B;  2CV5 C;  1S32 B;  2RIQ A;  3WTP B;  4J8X D;  1P3L B;  3VH5 W;  1A7W A;  3AZI C;  3MGS B;  5CPJ B;  1PZR A;  3LEL B;  2G5H C;  3REI D;  4WNN B;  3C1C C;  3EPJ A;  4KGC C;  3AZI A;  3KUY C;  5BNV B;  5AV5 C;  3C1B C;  4KGC A;  3A1K A;  5B1M D;  5GT3 D;  3KUY A;  5BT1 D;  3WAA D;  5AV5 A;  3C1B A;  1P3P B;  1T3U A;  1P3M D;  5AV8 D;  4NE3 A;  3EPL A;  1M18 C;  3MGQ D;  1M18 A;  5GSU C;  2HUE B;  4DRB A;  4KUD D;  5GSU A;  3H0M C;  3WKJ D;  3X1S D;  3AZG D;  1P3I D;  3LJA D;  1N1J B;  4XUJ B;  1TZY C;  3AZN D;  2YFV B;  3KXB B;  1ID3 B;  1TZY A;  5AVB B;  2RVQ C;  1B6W A;  3MGR B;  3AZF B;  1P3O D;  1P3G B;  4KHA A;  4ZUX B;  5B32 D;  3AZH D;  3AZM C;  5B24 D;  3AN2 C;  1KX5 D;  3AZM A;  3B6F B;  5C3I C;  3A6N C;  4LD9 B;  5AV6 D;  2BYM A;  1JFI B;  2JE5 A;  4XZQ B;  3A6N A;  1ZLA A;  4WU8 D;  3W98 D;  1KX4 D;  5AV9 D;  3REI B;  3REK C;  5B40 D;  5B1L C;  2IO5 C;  5GT3 B;  5B1M B;  3REK A;  4YS3 B;  5CPK C;  3WAA B;  5BO0 B;  5B1L A;  1P3K C;  3W99 C;  5AV8 B;  5CPK A;  3AZK D;  3NQJ A;  4HGA C;  4CSR B;  1EQZ D;  1P3K A;  2PYO C;  3W97 C;  3W99 A;  1U35 D;  4ZBJ B;  5AVC D;  1KX3 C;  3A1I A;  4X23 D;  3AZL C;  3B6G D;  4DQY B;  1P3B D;  1KX3 A;  5DNN C;  5F99 C;  3WKJ B;  5GXQ D;  3VH6 T;  1M1A C;  1AOI C;  5DNN A;  5F99 A;  2FJ7 B;  5B33 C;  1WWS A;  1AOI A;  2F8N K;  5B33 A;  4M6B A;  2HIO A;  3UT9 C;  3WA9 B;  2DF4 C;  3B0C T;  4QLC B;  3UT9 A;  2ARO D;  2ZY3 A;  5CP6 D;  1S32 D;  4H9O B;  1Q9C A;  3WTP D;  1P3L D;  3W96 C;  1TAF B;  5BS7 A;  3MVD C;  3LZ1 C;  2YFW B;  4H9R A;  3X1T C;  5CPJ D;  1KX5 B;  1HQ3 C;  1H3O B;  3KSY A;  3MVD A;  1BH8 B;  1W2E A;  3LZ1 A;  4J8W B;  2F8N H;  5CPI A;  5AV6 B;  4WU9 B;  4E44 A;  4G92 C;  2Y2N A;  4KGC D;  4H9P A;  2L5A A;  3V9R B;  4WU8 B;  3W98 B;  5AV5 D;  1KX4 B;  4YM6 D;  1P3P D;  3KFU G;  3NQU A;  3KWQ C;  5FUG B;  4CAY B;  3B0B A;  3X1V C;  3KWQ A;  4Z66 C;  4UPK A;  3AZE B;  3REJ C;  3X1V A;  3IP4 C;  3REH C;  2Y2I A;  3AZK B;  1EQZ B;  1U35 B;  3REH A;  4JJN C;  5AY8 B;  4JJN A;  5GXQ B;  3KXB D;  1ID3 D;  2NZD B;  3AZF D;  3X1U B;  3LZ0 C;  3REL C;  4Z5T C;  3VH6 A;  4R8P C;  4H9N A;  4ZUX D;  5G49 A;  3LZ0 A;  1M19 C;  1BH9 B;  1F66 C;  3REL A;  4H9Q B;  4Z5T A;  2NQB B;  5B0Y B;  4R8P A;  1F66 A;  3AZM D;  2BYK A;  5B31 C;  4LD9 D;  3VH6 W;  4XZQ D;  3AYW C;  2CV5 A;  2F2A C;  1ZLA D;  5B31 A;  3AYW A;  3AZI B;  3B0C W;  3WTP E;  3C1C A;  4KGC B;  2JSS A;  3KUY B;  4YS3 D;  5AV5 B;  4YM6 B;  3C1B B;  3UTB C;  5CPK D;  3MNN C;  1P34 C;  5B0Z C;  3UTB A;  3AV2 C;  3MNN A;  1P34 A;  5B0Z A;  3MGP C;  1M18 B;  3AV2 A;  3MGS C;  5DNM C;  3MGP A;  3LEL C;  1KX3 D;  1HTA A;  5GSU B;  2J8P A;  4Z2M H;  1P3F D;  5DNM A;  3LEL A;  2F8N G;  5DNN D;  2Y2M A;  5F99 D;  2FJ7 D;  3EG5 B;  1AOI D;  3O62 C;  3WA9 D;  2FFF B;  2HIO D;  4QLC D;  4J8U C;  2Y2L A;  3O62 A;  3UTA C;  3AZJ C;  1TZY B;  4J8U A;  5JRG C;  3UTA A;  3AZJ A;  2F8N A;  4KHA B;  2HUE C;  5JRG A;  2Y2G A;  3B0D B;  4NFT A;  3AZM B;  4J8W D;  3AN2 A;  5CPI D;  4WU9 D;  2BYM B;  5E5A D;  4XUJ C;  5C3I B;  3A6N B;  1ZLA B;  2ZY4 A;  1N1J A;  2Y2J A;  2CWE A;  2BG1 A;  2Y2O A;  3AZE D;  4AWL C;  3REK B;  5JA4 A;  5GT0 C;  5B1L B;  4E45 A;  4J8V C;  5CPK B;  3NQJ B;  5GT0 A;  1P3K B;  4J8V A;  3W99 B;  4HGA B;  4J8X C;  2PYO A;  3W97 A;  2ZY5 A;  5AY8 D;  4J8X A;  4JJN D;  1KX3 B;  1P3F B;  3AZL A;  2NZD D;  5DNN B;  5F99 B;  3X1U D;  1BFM A;  5GT3 C;  5B1M C;  1M1A A;  1AOI B;  5BT1 C;  2G5I C;  4H9S C;  5B33 B;  2HIO B;  2Y2H A;  3H0R C;  1P3M C;  2NQB D;  4H9S A;  1P3A C;  5B0Y D;  3UT9 B;  3MGQ C;  1P3M A;  1P3A A;  3MGQ A;  2CV5 D;  3EPH A;  5B31 D;  4KUD C;  4H9R B;  3W96 A;  3X1S C;  3AZG C;  4Z2M G;  3LZ1 B;  3AZI D;  3X1T A;  1P3I C;  4KUD A;  5CPI B;  3LJA C;  1HQ3 A;  3X1S A;  5E5A B;  3C1C D;  4G91 C;  3AZG A;  4H9P B;  3VH5 T;  3KUY D;  1P3I A;  3LJA A;  5B32 G; 
#chains in the Genus database with same CATH homology
 3C1B D;  3AZN C;  4G92 B;  3NQU B;  2Y2Q A;  3AZN A;  1P3O C;  3KWQ B;  3AV1 C;  4EO5 C;  3MNN D;  1M18 D;  1P3O A;  5B32 C;  3AZH C;  3AV1 A;  5B24 C;  4Z66 A;  3X1V B;  5B32 A;  5GSU D;  3REJ A;  5B24 A;  3AZH A;  2YFW A;  2JCH A;  5BNX A;  3TU4 C;  3REH B;  3R45 A;  5AV6 C;  3TU4 A;  3W98 C;  1KX4 C;  4JJN B;  5AV9 C;  1KX4 A;  5AV9 A;  1TZY D;  5B40 C;  4J8U D;  5B40 A;  2RVQ D;  4H9N B;  5G49 B;  3LZ0 B;  5JRG D;  3REL B;  4UUZ A;  4Z5T B;  1EQZ C;  1M19 A;  4R8P B;  5AVC C;  1ULY A;  2BYK B;  3AN2 D;  2LY8 A;  5AVC A;  4X23 C;  3B6G C;  3H0L C;  2CV5 B;  3A6N D;  1P3B C;  5B31 B;  4X23 A;  5GXQ C;  3B6G A;  3AYW B;  1P3B A;  4NE6 A;  5B2J C;  3C1C B;  3REK D;  5B2J A;  3AL0 C;  5B1L D;  5B2I C;  3AFA C;  2ARO C;  5KDM A;  5GT0 D;  5B2I A;  1P3K D;  3AFA A;  3UTB B;  5CP6 C;  3W99 D;  1S32 C;  2ARO A;  3WTP C;  3MNN B;  1P34 B;  1P3L C;  5B0Z B;  2PYO D;  5CP6 A;  3W97 D;  3AV2 B;  1S32 A;  3WTP A;  1P3L A;  2W8S A;  3MGP B;  5CPJ C;  4NE5 A;  3MGS A;  3AZL D;  5DNM B;  5CPJ A;  1Z2C B;  4WNN A;  5BNV A;  1M1A D;  4YM6 C;  1P3P C;  5B33 D;  4YM6 A;  1KU5 A;  3O62 B;  3UT9 D;  1P3P A;  4DRA A;  2UWX A;  4J8U B;  3AZJ B;  3UTA B;  1P3A D;  2F8N B;  4WJ3 C;  5JRG B;  2Y2P A;  3W96 D;  4WZS B;  3MVD D;  3LZ1 D;  3X1T D;  2XD1 A;  3AN2 B;  1HQ3 D;  2XD5 A;  2ZM5 A;  4XUJ A;  3KXB C;  1ID3 C;  5AVB C;  3AZF C;  3MGR C;  2YFV A;  1P3G C;  3KWQ D;  3KXB A;  1ID3 A;  5AVB A;  3AZF A;  3MGR A;  4ZUX C;  1P3G A;  5JA4 B;  3B0D C;  3X1V D;  3AV1 D;  2IO5 B;  4Z66 D;  4ZUX A;  4AWL B;  5CHL B;  3REJ D;  5GT0 B;  3B6F C;  4J8V B;  1R4V A;  3REH D;  4LD9 C;  2PYO B;  3B6F A;  4XZQ C;  3W97 B;  1ZLA C;  3TU4 D;  4LD9 A;  4J8X B;  1JFI A;  4XZQ A;  3REI C;  3AZL B;  3REI A;  4YS3 C;  3WAA C;  1M1A B;  5GT3 A;  5B1M A;  3LZ0 D;  4YS3 A;  3WAA A;  5AV8 C;  3REL D;  4Z5T D;  5BO0 A;  4R8P D;  1M19 D;  1F66 D;  5AV8 A;  4ZBJ C;  1P3M B;  4CSR A;  1P3A B;  3MGQ B;  3WKJ C;  3W96 B;  1P3F C;  2Y2K A;  3AYW D;  2ZY2 A;  3MVD B;  2FJ7 C;  3X1T B;  4KUD B;  3WKJ A;  1HQ3 B;  1P3F A;  3X1S B;  3AZG B;  2FJ7 A;  1P3I B;  3EPK A;  3WA9 C;  2HIO C;  3LJA B;  5B2J D;  4G91 B;  4QLC C;  3WA9 A;  3AZN B;  4QLC A;  5B2I D;  3UTB D;  3AFA D;  1P34 D;  5B0Z D;  1P3O B;  5BS7 C;  3AV1 B;  3AV2 D;  4H9O A;  4Z66 B;  4EO5 B;  1F1E A;  3MGP D;  1TAF A;  1KX5 C;  5B32 B;  3REJ B;  3AZH B;  5B24 B;  4J8W C;  3MGS D;  5DNM D;  5CPI C;  5BNX B;  3LEL D;  1KX5 A;  1H3O A;  3R45 B;  5E5A C;  4WU9 C;  1BH8 A;  4J8W A;  4WU8 C;  3TU4 B;  5AV6 A;  4WU9 A;  5E5A A;  3V9R A;  4WU8 A;  3W98 A;  3O62 D;  3FDD A;  5AV9 B;  5FUG A;  4CAY A;  3UTA D;  3AZE C;  3F6T A;  3AZJ D;  2F8N D;  5B40 B;  3AZE A;  3P5J B;  3AZK C;  4UUZ B;  2DQN C;  1M19 B;  1F66 B;  1U35 C;  3AZK A;  1EQZ A;  1U35 A;  2VQR A;  5AVC B;  5AY8 C;  4WV4 B;  4X23 B;  5AY8 A;  3B6G B;  4XUJ D;  1P3B B;  2NZD C;  3X1U C;  5GXQ A;  2NZD A;  5AVB D;  3X1U A;  3MGR D;  5B2J B;  1P3G D;  2NQB C;  5B31 G;  5B0Y C;  3VH5 A;  1BH9 A;  5KDM B;  4H9Q A;  5B2I B;  2NQB A;  3AFA B;  5B0Y A;  4J8V D;  2ARO B;  1B67 A;  3B6F D;  1WWI A;  5CP6 B;  2CV5 C;  1S32 B;  2RIQ A;  3WTP B;  4J8X D;  1P3L B;  3VH5 W;  1A7W A;  3AZI C;  3MGS B;  5CPJ B;  1PZR A;  3LEL B;  2G5H C;  3REI D;  4WNN B;  3C1C C;  3EPJ A;  4KGC C;  3AZI A;  3KUY C;  5BNV B;  5AV5 C;  3C1B C;  4KGC A;  3A1K A;  5B1M D;  5GT3 D;  3KUY A;  5BT1 D;  3WAA D;  5AV5 A;  3C1B A;  1P3P B;  1T3U A;  1P3M D;  5AV8 D;  4NE3 A;  3EPL A;  1M18 C;  3MGQ D;  1M18 A;  5GSU C;  2HUE B;  4DRB A;  4KUD D;  5GSU A;  3H0M C;  3WKJ D;  3X1S D;  3AZG D;  1P3I D;  3LJA D;  1N1J B;  4XUJ B;  1TZY C;  3AZN D;  2YFV B;  3KXB B;  1ID3 B;  1TZY A;  5AVB B;  2RVQ C;  1B6W A;  3MGR B;  3AZF B;  1P3O D;  1P3G B;  4KHA A;  4ZUX B;  5B32 D;  3AZH D;  3AZM C;  5B24 D;  3AN2 C;  1KX5 D;  3AZM A;  3B6F B;  5C3I C;  3A6N C;  4LD9 B;  5AV6 D;  2BYM A;  1JFI B;  2JE5 A;  4XZQ B;  3A6N A;  1ZLA A;  4WU8 D;  3W98 D;  1KX4 D;  5AV9 D;  3REI B;  3REK C;  5B40 D;  5B1L C;  2IO5 C;  5GT3 B;  5B1M B;  3REK A;  4YS3 B;  5CPK C;  3WAA B;  5BO0 B;  5B1L A;  1P3K C;  3W99 C;  5AV8 B;  5CPK A;  3AZK D;  3NQJ A;  4HGA C;  4CSR B;  1EQZ D;  1P3K A;  2PYO C;  3W97 C;  3W99 A;  1U35 D;  4ZBJ B;  5AVC D;  1KX3 C;  3A1I A;  4X23 D;  3AZL C;  3B6G D;  4DQY B;  1P3B D;  1KX3 A;  5DNN C;  5F99 C;  3WKJ B;  5GXQ D;  3VH6 T;  1M1A C;  1AOI C;  5DNN A;  5F99 A;  2FJ7 B;  5B33 C;  1WWS A;  1AOI A;  2F8N K;  5B33 A;  4M6B A;  2HIO A;  3UT9 C;  3WA9 B;  2DF4 C;  3B0C T;  4QLC B;  3UT9 A;  2ARO D;  2ZY3 A;  5CP6 D;  1S32 D;  4H9O B;  1Q9C A;  3WTP D;  1P3L D;  3W96 C;  1TAF B;  5BS7 A;  3MVD C;  3LZ1 C;  2YFW B;  4H9R A;  3X1T C;  5CPJ D;  1KX5 B;  1HQ3 C;  1H3O B;  3KSY A;  3MVD A;  1BH8 B;  1W2E A;  3LZ1 A;  4J8W B;  2F8N H;  5CPI A;  5AV6 B;  4WU9 B;  4E44 A;  4G92 C;  2Y2N A;  4KGC D;  4H9P A;  2L5A A;  3V9R B;  4WU8 B;  3W98 B;  5AV5 D;  1KX4 B;  4YM6 D;  1P3P D;  3KFU G;  3NQU A;  3KWQ C;  5FUG B;  4CAY B;  3B0B A;  3X1V C;  3KWQ A;  4Z66 C;  4UPK A;  3AZE B;  3REJ C;  3X1V A;  3IP4 C;  3REH C;  2Y2I A;  3AZK B;  1EQZ B;  1U35 B;  3REH A;  4JJN C;  5AY8 B;  4JJN A;  5GXQ B;  3KXB D;  1ID3 D;  2NZD B;  3AZF D;  3X1U B;  3LZ0 C;  3REL C;  4Z5T C;  3VH6 A;  4R8P C;  4H9N A;  4ZUX D;  5G49 A;  3LZ0 A;  1M19 C;  1BH9 B;  1F66 C;  3REL A;  4H9Q B;  4Z5T A;  2NQB B;  5B0Y B;  4R8P A;  1F66 A;  3AZM D;  2BYK A;  5B31 C;  4LD9 D;  3VH6 W;  4XZQ D;  3AYW C;  2CV5 A;  2F2A C;  1ZLA D;  5B31 A;  3AYW A;  3AZI B;  3B0C W;  3WTP E;  3C1C A;  4KGC B;  2JSS A;  3KUY B;  4YS3 D;  5AV5 B;  4YM6 B;  3C1B B;  3UTB C;  5CPK D;  3MNN C;  1P34 C;  5B0Z C;  3UTB A;  3AV2 C;  3MNN A;  1P34 A;  5B0Z A;  3MGP C;  1M18 B;  3AV2 A;  3MGS C;  5DNM C;  3MGP A;  3LEL C;  1KX3 D;  1HTA A;  5GSU B;  2J8P A;  4Z2M H;  1P3F D;  5DNM A;  3LEL A;  2F8N G;  5DNN D;  2Y2M A;  5F99 D;  2FJ7 D;  3EG5 B;  1AOI D;  3O62 C;  3WA9 D;  2FFF B;  2HIO D;  4QLC D;  4J8U C;  2Y2L A;  3O62 A;  3UTA C;  3AZJ C;  1TZY B;  4J8U A;  5JRG C;  3UTA A;  3AZJ A;  2F8N A;  4KHA B;  2HUE C;  5JRG A;  2Y2G A;  3B0D B;  4NFT A;  3AZM B;  4J8W D;  3AN2 A;  5CPI D;  4WU9 D;  2BYM B;  5E5A D;  4XUJ C;  5C3I B;  3A6N B;  1ZLA B;  2ZY4 A;  1N1J A;  2Y2J A;  2CWE A;  2BG1 A;  2Y2O A;  3AZE D;  4AWL C;  3REK B;  5JA4 A;  5GT0 C;  5B1L B;  4E45 A;  4J8V C;  5CPK B;  3NQJ B;  5GT0 A;  1P3K B;  4J8V A;  3W99 B;  4HGA B;  4J8X C;  2PYO A;  3W97 A;  2ZY5 A;  5AY8 D;  4J8X A;  4JJN D;  1KX3 B;  1P3F B;  3AZL A;  2NZD D;  5DNN B;  5F99 B;  3X1U D;  1BFM A;  5GT3 C;  5B1M C;  1M1A A;  1AOI B;  5BT1 C;  2G5I C;  4H9S C;  5B33 B;  2HIO B;  2Y2H A;  3H0R C;  1P3M C;  2NQB D;  4H9S A;  1P3A C;  5B0Y D;  3UT9 B;  3MGQ C;  1P3M A;  1P3A A;  3MGQ A;  2CV5 D;  3EPH A;  5B31 D;  4KUD C;  4H9R B;  3W96 A;  3X1S C;  3AZG C;  4Z2M G;  3LZ1 B;  3AZI D;  3X1T A;  1P3I C;  4KUD A;  5CPI B;  3LJA C;  1HQ3 A;  3X1S A;  5E5A B;  3C1C D;  4G91 C;  3AZG A;  4H9P B;  3VH5 T;  3KUY D;  1P3I A;  3LJA A;  5B32 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...