4KUDC

Crystal structure of n-terminal acetylated sir3 bah domain d205n mutant in complex with yeast nucleosome core particle
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/transcription/dna
molecule keywords Histone H3
publication title N alpha-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 28
structure length 103
sequence length 103
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4kudC00
2BYMB 2NZDD 5AV8C 5G49B 4CSRA 3LZ1D 5AV8A 1EQZD 4ZBJC 1P3OC 1P3OA 5AV5D 5B1LC 1P3AB 5B1LA 5GT0D 4WV4B 1TAFA 3VH6W 2BYMA 1B6WA 5G49A 3X1SC 3X1SA 5B0YD 4Z5TD 2F8NH 1WWIA 1KX5B 3REJD 5FUGB 3LELB 5AV9D 3B6FB 3MGPB 5B24C 5AVCC 5B24A 2RVQC 5AVCA 5B33B 3WAAD 1BH8B 5AVBB 1S32B 3W97B 4LD9D 3B6GB 3WKJB 2NQBD 5CP6C 3TU4C 3MVDB 5CP6A 3TU4A 3W98C 5B32D 1ZLAD 1M18B 2PYOB 3W98A 1KX5C 4NE3A 4ZUXB 1KX5A 1P3IC 5FUGA 1A7WA 1P3IA 1P3FD 5GXQC 5GXQA 5CPID 4J8WC 1P34D 5AVBC 4J8WA 1R4VA 5AVBA 3W97C 3WKJC 3W97A 5JRGB 3W96B 3WKJA 3KXBC 4WU9B 3KXBA 3MVDC 3MVDA 3NQUB 1M18C 4EO5B 2PYOC 1M18A 2PYOA 2HIOB 3KWQB 5B2JB 5B40B 3B0DB 3W96C 5JRGC 4WU8D 2FJ7B 3W96A 5JRGA 3REKD 4WU9C 1F66D 5BT1D 4WU9A 5CPJD 1TZYD 4R8PD 4JJNB 3NQUA 4WZSB 3RELD 3AV1B 3AZHB 3AZJD 1P3MA 1AOIC 1AOIA 3LZ0D 2AROD 3B0CW 4KHAB 1U35D 1P3KD 4H9NB 3B0DC 1N1JB 5B1MB 2FJ7C 2FJ7A 3REHD 3X1UD 2F8NB 5GSUC 4H9RB 5GSUA 4XUJB 3MNND 4CAYB 3C1BC 3UTAD 3AZID 3C1BA 3AV1C 3AZHC 5BNXB 3AV1A 3AZHA 1P3BD 3REIB 4WNNB 3AZMB 3AZFC 1M19B 1BFMA 3AZFA 5CPKB 3AV2B 5F99B 5B1MC 5AV8D 5B1MA 2BYKA 4NE6A 2F8NA 5AV6D 4Z66B 4H9RA 4XZQB 4YS3B 1P3OD 1JFIB 5BNXA 4UUZA 3REIC 3WTPB 3REIA 1Q9CA 3MGQB 3AZMC 4WNNA 3AZMA 1M19C 1M19A 5CPKC 5CPKA 1P3GB 3VH5T 3X1SD 4H9OB 1H3OA 3AYWB 4Z66C 3C1CB 4M6BA 3AZEB 4Z66A 5DNMC 4X23D 4XZQC 5DNMA 4XZQA 1KU5A 5E5AB 1JFIA 5B24D 3V9RB 3WTPC 5AVCD 2RVQD 3A6NC 3A6NA 4YM6B 4J8UB 3AFAB 3MGSC 1P3GC 3MGSA 1P3GA 5CP6D 3TU4D 2YFVB 3W98D 3AYWC 3C1CC 3WA9C 3AYWA 3AZEC 3C1CA 5AY8C 3WA9A 3AZEA 1P3ID 5AY8A 4G92B 5B31B 2IO5B 5GXQD 3O62B 1P3LB 2F8NK 1M1AD 3V9RA 4YM6C 4J8WD 5AVBD 4YM6A 3AFAC 1KX4B 3AFAA 5BO0B 3KXBD 1M18D 3B0BA 1KX3B 1P3LC 5B31G 2CV5B 5JRGD 1P3AC 1P3AA 5BO0A 4WU9D 3AN2D 1P3MD 3AZLD 1AOID 1KX3C 4J8VB 1KX3A 1HQ3B 3LELC 3LELA 4J8XB 4KUDB 3B6FC 3X1TD 3MGPC 3B6FA 3MGPA 2FJ7D 2NZDB 3LZ1B 5B33C 5B33A 1BH8A 1S32C 5GSUD 1S32A 3B6GC 4AWLB 4KGCB 3LJAD 3C1BD 1EQZB 3B6GA 5AV5B 4H9PB 4ZUXC 1HQ3C 5GT0B 4ZUXA 1HQ3A 4J8XC 3AZFD 4J8XA 4KGCC 4AWLC 5DNNB 4KGCA 3REJB 3UT9B 5AV5C 3WTPE 4EO5C 5AV5A 4H9PA 3X1VD 5GT0C 3KUYD 1P3PD 2HIOC 5GT0A 1M19D 2HIOA 3WAAB 5B0ZD 5B2JC 3KWQC 5CPKD 3KWQA 5B2JA 5GT3D 4LD9B 2NQBB 5B2IB 5B40C 5B40A 3W99D 3UTBD 3VH6T 4NFTA 5DNNC 3AZNB 1ZLAB 5DNMD 5DNNA 3UT9C 3UT9A 1P3FB 2JSSA 4JJNC 2YFWB 4JJNA 5CPIB 3A6ND 4E45A 1P34B 4DRAA 3MGSD 1P3GD 3R45B 4KHAA 5B2IC 5B2IA 4H9NA 1ZLAC 3AZNC 3AZED 3WA9D 5AY8D 1N1JA 3AZNA 1ZLAA 4HGAB 3NQJB 5B32G 2HUEB 4XUJC 2YFWA 3AZKB 4XUJA 4CAYA 1ULYA 4YM6D 1P34C 1P34A 5B1LD 4WU8B 3R45A 3REKB 5CPJB 3AV2C 5F99C 4R8PB 3AV2A 5F99A 4HGAC 3AZJB 3NQJA 2HUEC 3AZKC 3LZ0B 4DRBA 2AROB 3AZKA 3AZGB 4YS3C 1P3KB 2LY8A 4YS3A 5BS7C 4QLCB 5BS7A 1P3AD 4WU8C 3WTPA 3MGQC 4WU8A 3MGQA 5BT1C 3X1UB 3REHB 1F1EA 1BH9B 5C3IB 3UTAB 3AZIB 4H9OA 1KX3D 1P3BB 1KX5D 1ID3B 2AROC 3LELD 3AZGC 2AROA 3MGRB 3AZGA 5E5AC 4QLCC 3B6FD 5E5AA 4QLCA 3MGPD 5AV8B 5B33D 3B0CT 4J8UC 3X1UC 3VH5A 4J8UA 1S32D 3X1UA 3W97D 3B6GD 5AV6B 1P3BA 5C3IC 3WKJD 3UTAC 3AZIC 1P3OB 3UTAA 3MVDD 2YFVA 2PYOD 1ID3C 4ZUXD 1ID3A 3MGRC 4G92C 3MGRA 5B31C 2IO5C 5B31A 3O62C 3O62A 1P3LA 3X1SB 1KX4C 4KGCD 5AV6C 3W96D 1KX4A 5AV6A 5JA4B 4X23B 3KSYA 4Z2MH 5B24B 5AVCB 2HIOD 3KWQD 5B2JD 5B40D 5CP6B 2CV5C 3TU4B 2CV5A 3W98B 5DNND 4X23C 5JA4A 4X23A 3UT9D 5CHLB 1P3IB 4JJND 5GXQB 1M1AB 4G91B 3AZHD 3AV1D 4J8WB 4J8VC 2CWEA 4J8VA 2L5AA 5B2ID 3KXBB 4KUDC 4KUDA 5B1MD 3AZND 2NZDC 2NZDA 3LZ1C 3LZ1A 2F8ND 4XUJD 5B0YB 4Z5TB 1M1AC 1EQZC 1EQZA 1M1AA 4G91C 5AV9B 3VH5W 3REID 3AZMD 3AN2B 3AV2D 5F99D 1P3MB 3AZLB 1AOIB 4H9SC 4H9QB 4Z66D 4H9SA 5B32B 4Z5TC 5B0YC 3AZKD 5B0YA 4Z5TA 4XZQD 4YS3D 3REJC 5AV9C 3REJA 5AV9A 3X1TB 5BNVB 3WTPD 3MGQD 3WAAC 3AN2C 3WAAA 3AN2A 5KDMB 5GSUB 4LD9C 4LD9A 4E44A 3LJAB 3C1BB 2NQBC 1P3MC 2NQBA 3AZLC 1WWSA 3AZLA 3AYWD 3C1CD 5B32C 4H9QA 5B32A 3AZGD 5E5AD 4QLCD 3AZFB 1P3FC 3X1TC 1P3FA 3X1TA 5BNVA 5CPIC 2BYKB 4J8UD 5CPIA 3AFAD 5KDMA 3LJAC 3LJAA 1F66B 3VH6A 1TZYB 4UUZB 1ID3D 3X1VB 3MGRD 3KUYB 1P3PB 3RELB 4Z2MG 5B31D 3O62D 5B0ZB 1P3LD 5GT3B 1U35B 1H3OB 3W99B 1KX4D 3UTBB 5DNMB 3REKC 1F66C 3REKA 1F66A 2F8NG 5CPJC 1TZYC 4R8PC 5CPJA 1TZYA 4R8PA 3MNNB 3X1VC 1P3PC 3KUYC 3A6NB 3RELC 3X1VA 3KUYA 1P3PA 3RELA 3AZJC 5B0ZC 3AZJA 5B0ZA 3LZ0C 3MGSB 1HTAA 5GT3C 3LZ0A 1U35C 1P3KC 5GT3A 1U35A 1P3KA 2CV5D 3W99C 3W99A 3UTBC 3WA9B 4CSRB 3UTBA 4NE5A 5AY8B 3REHC 3REHA 1BH9A 1B67A 4ZBJB 3MNNC 3MNNA 3AZIA 4J8VD 1P3BC 5B1LB 1HQ3D 1TAFB 4J8XD 4KUDD
chains in the Genus database with same CATH superfamily
2Y2PA 2BYMB 2NZDD 5AV8C 5G49B 4CSRA 3LZ1D 5AV8A 3F6TA 1EQZD 4ZBJC 1P3OC 1P3OA 5AV5D 5B1LC 1P3AB 5B1LA 5GT0D 4WV4B 3AL0C 1TAFA 3VH6W 2BYMA 1B6WA 5G49A 3X1SC 3X1SA 5B0YD 2Y2OA 4Z5TD 1WWIA 1KX5B 2F8NH 3REJD 5FUGB 3LELB 5AV9D 3B6FB 3MGPB 5B24C 5AVCC 5B24A 2RVQC 5AVCA 5B33B 3WAAD 1BH8B 3H0MC 3H0RC 5AVBB 1S32B 3W97B 4LD9D 3B6GB 3WKJB 2NQBD 5CP6C 3TU4C 3MVDB 4DQYB 5CP6A 3TU4A 2Y2GA 5B32D 1ZLAD 1M18B 2PYOB 3W98C 1KX5C 3W98A 4NE3A 4ZUXB 1KX5A 1P3IC 5FUGA 1A7WA 1P3IA 1P3FD 5GXQC 5GXQA 5CPID 4J8WC 1P34D 5AVBC 4J8WA 1R4VA 5AVBA 3W97C 3WKJC 3W97A 5JRGB 3W96B 3WKJA 3KXBC 4WU9B 3KXBA 3MVDC 3MVDA 3NQUB 2FFFB 4EO5B 1M18C 2PYOC 1M18A 2PYOA 2HIOB 2Y2JA 3KWQB 5B2JB 5B40B 3B0DB 3W96C 5JRGC 4WU8D 2FJ7B 3W96A 5JRGA 3REKD 4WU9C 1F66D 5BT1D 4WU9A 5CPJD 1TZYD 4R8PD 4JJNB 3NQUA 4WZSB 2G5IC 3RELD 3AV1B 3AZHB 3AZJD 1P3MA 1AOIC 1AOIA 3LZ0D 2AROD 3B0CW 4KHAB 1U35D 1P3KD 3EPHA 4H9NB 2J8PA 3B0DC 1N1JB 5B1MB 2FJ7C 2FJ7A 3REHD 3X1UD 2ZM5A 2F8NB 5GSUC 4H9RB 5GSUA 4XUJB 3MNND 4CAYB 3C1BC 3UTAD 3AZID 3C1BA 2ZY4A 3AV1C 3AZHC 5BNXB 3AV1A 3AZHA 1P3BD 3REIB 4WNNB 3AZMB 2Y2HA 3AZFC 1M19B 1BFMA 3AZFA 5CPKB 3AV2B 5F99B 5B1MC 5AV8D 5B1MA 2JE5A 2BYKA 4NE6A 2F8NA 5AV6D 4Z66B 4H9RA 4XZQB 4YS3B 1P3OD 1JFIB 5BNXA 1T3UA 4UUZA 3REIC 3WTPB 3REIA 1Q9CA 3MGQB 3AZMC 4WNNA 3AZMA 1M19C 4WJ3C 1M19A 5CPKC 5CPKA 1P3GB 3VH5T 3X1SD 4H9OB 1PZRA 1H3OA 3AYWB 4Z66C 3C1CB 4M6BA 3AZEB 4Z66A 5DNMC 4X23D 4XZQC 2UWXA 5DNMA 4XZQA 1KU5A 5E5AB 1JFIA 5B24D 3V9RB 3WTPC 5AVCD 2RVQD 3A6NC 3A6NA 4YM6B 4J8UB 2XD1A 3AFAB 3MGSC 1P3GC 3MGSA 1P3GA 3H0LC 5CP6D 3TU4D 2YFVB 3W98D 3AYWC 3C1CC 3WA9C 3AYWA 3AZEC 3C1CA 5AY8C 3WA9A 3AZEA 1P3ID 5AY8A 4G92B 5B31B 3EPKA 2IO5B 5GXQD 3O62B 1P3LB 2F8NK 1M1AD 3V9RA 4YM6C 4J8WD 5AVBD 4YM6A 3AFAC 1KX4B 3AFAA 5BO0B 2W8SA 3KXBD 3P5JB 1M18D 3B0BA 3KFUG 1KX3B 1P3LC 5B31G 2JCHA 2CV5B 5JRGD 1P3AC 1P3AA 5BO0A 2ZY2A 4WU9D 3AN2D 3EPLA 2Y2LA 1P3MD 3AZLD 1AOID 1KX3C 4J8VB 1KX3A 1HQ3B 3LELC 3LELA 4J8XB 4KUDB 3B6FC 3A1KA 3X1TD 3MGPC 3B6FA 3MGPA 2FJ7D 2NZDB 3LZ1B 5B33C 5B33A 2F2AC 1BH8A 2DF4C 5GSUD 1S32C 1S32A 3B6GC 4AWLB 4KGCB 3LJAD 3C1BD 1EQZB 3B6GA 5AV5B 4H9PB 2Y2MA 4ZUXC 1HQ3C 5GT0B 4ZUXA 1HQ3A 4J8XC 3AZFD 4J8XA 1W2EA 2XD5A 4KGCC 4AWLC 5DNNB 4KGCA 3REJB 3UT9B 5AV5C 3WTPE 4EO5C 5AV5A 4H9PA 3X1VD 5GT0C 3KUYD 1P3PD 2HIOC 5GT0A 1M19D 2HIOA 3WAAB 5B0ZD 5B2JC 3KWQC 5CPKD 3KWQA 5B2JA 5GT3D 4LD9B 2NQBB 5B2IB 5B40C 5B40A 3W99D 3UTBD 3VH6T 4NFTA 5DNNC 3AZNB 1ZLAB 5DNMD 5DNNA 3UT9C 3UT9A 1P3FB 2JSSA 4JJNC 2YFWB 4JJNA 5CPIB 3A6ND 4E45A 3FDDA 1P34B 4DRAA 3MGSD 1P3GD 3R45B 4KHAA 5B2IC 5B2IA 4H9NA 1ZLAC 3AZNC 3AZED 3WA9D 5AY8D 1N1JA 3AZNA 1ZLAA 4HGAB 3NQJB 5B32G 2HUEB 4XUJC 2YFWA 3AZKB 4XUJA 4CAYA 1ULYA 4YM6D 1P34C 1P34A 5B1LD 4WU8B 3R45A 3REKB 5CPJB 2DQNC 3AV2C 5F99C 4R8PB 3AV2A 5F99A 4HGAC 3A1IA 3AZJB 2VQRA 3NQJA 2HUEC 3AZKC 3LZ0B 4DRBA 2AROB 3AZKA 3AZGB 4YS3C 1P3KB 2LY8A 4YS3A 5BS7C 4QLCB 5BS7A 1P3AD 4WU8C 3WTPA 3MGQC 4WU8A 3MGQA 5BT1C 3X1UB 3REHB 1F1EA 1BH9B 5C3IB 3UTAB 3AZIB 4H9OA 1KX3D 1P3BB 1KX5D 1ID3B 2AROC 3LELD 3EG5B 3AZGC 2AROA 3MGRB 3AZGA 2Y2QA 5E5AC 4QLCC 3B6FD 5E5AA 4QLCA 3IP4C 3MGPD 5AV8B 5B33D 3B0CT 4J8UC 3X1UC 3VH5A 4J8UA 1S32D 3X1UA 3W97D 3B6GD 5AV6B 1P3BA 5C3IC 3WKJD 3UTAC 3AZIC 1P3OB 3UTAA 3MVDD 2YFVA 2PYOD 1ID3C 4ZUXD 1ID3A 3MGRC 4G92C 3MGRA 5B31C 2IO5C 5B31A 3O62C 3O62A 1P3LA 3X1SB 1Z2CB 1KX4C 4KGCD 5AV6C 3W96D 1KX4A 5AV6A 5JA4B 4X23B 3KSYA 4Z2MH 5B24B 5AVCB 2HIOD 3KWQD 5B2JD 5B40D 5CP6B 2CV5C 3TU4B 2CV5A 3W98B 5DNND 4X23C 5JA4A 4X23A 3UT9D 5CHLB 1P3IB 4JJND 5GXQB 1M1AB 4G91B 3AZHD 3AV1D 4J8WB 4J8VC 2CWEA 4J8VA 2L5AA 5B2ID 3KXBB 4KUDC 4KUDA 2RIQA 5B1MD 3EPJA 3AZND 2NZDC 2NZDA 3LZ1C 3LZ1A 2F8ND 4XUJD 5B0YB 4Z5TB 1M1AC 1EQZC 1EQZA 1M1AA 4G91C 5AV9B 3VH5W 4UPKA 3REID 2Y2IA 3AZMD 3AN2B 3AV2D 5F99D 2G5HC 1P3MB 3AZLB 1AOIB 4H9SC 4H9QB 4Z66D 4H9SA 5B32B 4Z5TC 5B0YC 3AZKD 5B0YA 4Z5TA 4XZQD 4YS3D 3REJC 5AV9C 3REJA 5AV9A 3X1TB 5BNVB 3WTPD 3MGQD 3WAAC 3AN2C 3WAAA 3AN2A 5KDMB 5GSUB 4LD9C 4LD9A 4E44A 3LJAB 3C1BB 2NQBC 1P3MC 2NQBA 3AZLC 1WWSA 3AZLA 3AYWD 3C1CD 5B32C 4H9QA 5B32A 3AZGD 2ZY3A 5E5AD 4QLCD 3AZFB 2Y2NA 1P3FC 3X1TC 1P3FA 3X1TA 5BNVA 5CPIC 2ZY5A 2BYKB 4J8UD 5CPIA 3AFAD 5KDMA 3LJAC 3LJAA 1F66B 3VH6A 1TZYB 4UUZB 1ID3D 3X1VB 3MGRD 3KUYB 1P3PB 3RELB 4Z2MG 5B31D 3O62D 5B0ZB 1P3LD 5GT3B 1U35B 1H3OB 3W99B 1KX4D 3UTBB 2BG1A 5DNMB 3REKC 1F66C 3REKA 1F66A 2F8NG 5CPJC 1TZYC 4R8PC 5CPJA 1TZYA 4R8PA 3MNNB 3X1VC 1P3PC 3KUYC 3A6NB 3RELC 3X1VA 3KUYA 1P3PA 3RELA 3AZJC 5B0ZC 3AZJA 5B0ZA 3LZ0C 3MGSB 1HTAA 5GT3C 3LZ0A 1U35C 1P3KC 5GT3A 1U35A 1P3KA 2CV5D 3W99C 3W99A 3UTBC 3WA9B 4CSRB 3UTBA 4NE5A 5AY8B 3REHC 3REHA 1BH9A 1B67A 4ZBJB 3MNNC 3MNNA 3AZIA 2Y2KA 4J8VD 1P3BC 5B1LB 1HQ3D 1TAFB 4J8XD 4KUDD
chains in the Genus database with same CATH topology
2Y2PA 2BYMB 2NZDD 5AV8C 5G49B 4CSRA 3LZ1D 5AV8A 3F6TA 1EQZD 4ZBJC 1P3OC 1P3OA 5AV5D 5B1LC 1P3AB 5B1LA 5GT0D 4WV4B 3AL0C 1TAFA 3VH6W 2BYMA 1B6WA 5G49A 3X1SC 3X1SA 5B0YD 2Y2OA 4Z5TD 1WWIA 1KX5B 2F8NH 3REJD 5FUGB 3LELB 5AV9D 3B6FB 3MGPB 5B24C 5AVCC 5B24A 2RVQC 5AVCA 5B33B 3WAAD 1BH8B 3H0MC 3H0RC 5AVBB 1S32B 3W97B 4LD9D 3B6GB 3WKJB 2NQBD 5CP6C 3TU4C 3MVDB 4DQYB 5CP6A 3TU4A 2Y2GA 5B32D 1ZLAD 1M18B 2PYOB 3W98C 1KX5C 3W98A 4NE3A 4ZUXB 1KX5A 1P3IC 5FUGA 1A7WA 1P3IA 1P3FD 5GXQC 5GXQA 5CPID 4J8WC 1P34D 5AVBC 4J8WA 1R4VA 5AVBA 3W97C 3WKJC 3W97A 5JRGB 3W96B 3WKJA 3KXBC 4WU9B 3KXBA 3MVDC 3MVDA 3NQUB 2FFFB 4EO5B 1M18C 2PYOC 1M18A 2PYOA 2HIOB 2Y2JA 3KWQB 5B2JB 5B40B 3B0DB 3W96C 5JRGC 4WU8D 2FJ7B 3W96A 5JRGA 3REKD 4WU9C 1F66D 5BT1D 4WU9A 5CPJD 1TZYD 4R8PD 4JJNB 3NQUA 4WZSB 2G5IC 3RELD 3AV1B 3AZHB 3AZJD 1P3MA 1AOIC 1AOIA 3LZ0D 2AROD 3B0CW 4KHAB 1U35D 1P3KD 3EPHA 4H9NB 2J8PA 3B0DC 1N1JB 5B1MB 2FJ7C 2FJ7A 3REHD 3X1UD 2ZM5A 2F8NB 5GSUC 4H9RB 5GSUA 4XUJB 3MNND 4CAYB 3C1BC 3UTAD 3AZID 3C1BA 2ZY4A 3AV1C 3AZHC 5BNXB 3AV1A 3AZHA 1P3BD 3REIB 4WNNB 3AZMB 2Y2HA 3AZFC 1M19B 1BFMA 3AZFA 5CPKB 3AV2B 5F99B 5B1MC 5AV8D 5B1MA 2JE5A 2BYKA 4NE6A 2F8NA 5AV6D 4Z66B 4H9RA 4XZQB 4YS3B 1P3OD 1JFIB 5BNXA 1T3UA 4UUZA 3REIC 3WTPB 3REIA 1Q9CA 3MGQB 3AZMC 4WNNA 3AZMA 1M19C 4WJ3C 1M19A 5CPKC 5CPKA 1P3GB 3VH5T 3X1SD 4H9OB 1PZRA 1H3OA 3AYWB 4Z66C 3C1CB 4M6BA 3AZEB 4Z66A 5DNMC 4X23D 4XZQC 2UWXA 5DNMA 4XZQA 1KU5A 5E5AB 1JFIA 5B24D 3V9RB 3WTPC 5AVCD 2RVQD 3A6NC 3A6NA 4YM6B 4J8UB 2XD1A 3AFAB 3MGSC 1P3GC 3MGSA 1P3GA 3H0LC 5CP6D 3TU4D 2YFVB 3W98D 3AYWC 3C1CC 3WA9C 3AYWA 3AZEC 3C1CA 5AY8C 3WA9A 3AZEA 1P3ID 5AY8A 4G92B 5B31B 3EPKA 2IO5B 5GXQD 3O62B 1P3LB 2F8NK 1M1AD 3V9RA 4YM6C 4J8WD 5AVBD 4YM6A 3AFAC 1KX4B 3AFAA 5BO0B 2W8SA 3KXBD 3P5JB 1M18D 3B0BA 3KFUG 1KX3B 1P3LC 5B31G 2JCHA 2CV5B 5JRGD 1P3AC 1P3AA 5BO0A 2ZY2A 4WU9D 3AN2D 3EPLA 2Y2LA 1P3MD 3AZLD 1AOID 1KX3C 4J8VB 1KX3A 1HQ3B 3LELC 3LELA 4J8XB 4KUDB 3B6FC 3A1KA 3X1TD 3MGPC 3B6FA 3MGPA 2FJ7D 2NZDB 3LZ1B 5B33C 5B33A 2F2AC 1BH8A 2DF4C 5GSUD 1S32C 1S32A 3B6GC 4AWLB 4KGCB 3LJAD 3C1BD 1EQZB 3B6GA 5AV5B 4H9PB 2Y2MA 4ZUXC 1HQ3C 5GT0B 4ZUXA 1HQ3A 4J8XC 3AZFD 4J8XA 1W2EA 2XD5A 4KGCC 4AWLC 5DNNB 4KGCA 3REJB 3UT9B 5AV5C 3WTPE 4EO5C 5AV5A 4H9PA 3X1VD 5GT0C 3KUYD 1P3PD 2HIOC 5GT0A 1M19D 2HIOA 3WAAB 5B0ZD 5B2JC 3KWQC 5CPKD 3KWQA 5B2JA 5GT3D 4LD9B 2NQBB 5B2IB 5B40C 5B40A 3W99D 3UTBD 3VH6T 4NFTA 5DNNC 3AZNB 1ZLAB 5DNMD 5DNNA 3UT9C 3UT9A 1P3FB 2JSSA 4JJNC 2YFWB 4JJNA 5CPIB 3A6ND 4E45A 3FDDA 1P34B 4DRAA 3MGSD 1P3GD 3R45B 4KHAA 5B2IC 5B2IA 4H9NA 1ZLAC 3AZNC 3AZED 3WA9D 5AY8D 1N1JA 3AZNA 1ZLAA 4HGAB 3NQJB 5B32G 2HUEB 4XUJC 2YFWA 3AZKB 4XUJA 4CAYA 1ULYA 4YM6D 1P34C 1P34A 5B1LD 4WU8B 3R45A 3REKB 5CPJB 2DQNC 3AV2C 5F99C 4R8PB 3AV2A 5F99A 4HGAC 3A1IA 3AZJB 2VQRA 3NQJA 2HUEC 3AZKC 3LZ0B 4DRBA 2AROB 3AZKA 3AZGB 4YS3C 1P3KB 2LY8A 4YS3A 5BS7C 4QLCB 5BS7A 1P3AD 4WU8C 3WTPA 3MGQC 4WU8A 3MGQA 5BT1C 3X1UB 3REHB 1F1EA 1BH9B 5C3IB 3UTAB 3AZIB 4H9OA 1KX3D 1P3BB 1KX5D 1ID3B 2AROC 3LELD 3EG5B 3AZGC 2AROA 3MGRB 3AZGA 2Y2QA 5E5AC 4QLCC 3B6FD 5E5AA 4QLCA 3IP4C 3MGPD 5AV8B 5B33D 3B0CT 4J8UC 3X1UC 3VH5A 4J8UA 1S32D 3X1UA 3W97D 3B6GD 5AV6B 1P3BA 5C3IC 3WKJD 3UTAC 3AZIC 1P3OB 3UTAA 3MVDD 2YFVA 2PYOD 1ID3C 4ZUXD 1ID3A 3MGRC 4G92C 3MGRA 5B31C 2IO5C 5B31A 3O62C 3O62A 1P3LA 3X1SB 1Z2CB 1KX4C 4KGCD 5AV6C 3W96D 1KX4A 5AV6A 5JA4B 4X23B 3KSYA 4Z2MH 5B24B 5AVCB 2HIOD 3KWQD 5B2JD 5B40D 5CP6B 2CV5C 3TU4B 2CV5A 3W98B 5DNND 4X23C 5JA4A 4X23A 3UT9D 5CHLB 1P3IB 4JJND 5GXQB 1M1AB 4G91B 3AZHD 3AV1D 4J8WB 4J8VC 2CWEA 4J8VA 2L5AA 5B2ID 3KXBB 4KUDC 4KUDA 2RIQA 5B1MD 3EPJA 3AZND 2NZDC 2NZDA 3LZ1C 3LZ1A 2F8ND 4XUJD 5B0YB 4Z5TB 1M1AC 1EQZC 1EQZA 1M1AA 4G91C 5AV9B 3VH5W 4UPKA 3REID 2Y2IA 3AZMD 3AN2B 3AV2D 5F99D 2G5HC 1P3MB 3AZLB 1AOIB 4H9SC 4H9QB 4Z66D 4H9SA 5B32B 4Z5TC 5B0YC 3AZKD 5B0YA 4Z5TA 4XZQD 4YS3D 3REJC 5AV9C 3REJA 5AV9A 3X1TB 5BNVB 3WTPD 3MGQD 3WAAC 3AN2C 3WAAA 3AN2A 5KDMB 5GSUB 4LD9C 4LD9A 4E44A 3LJAB 3C1BB 2NQBC 1P3MC 2NQBA 3AZLC 1WWSA 3AZLA 3AYWD 3C1CD 5B32C 4H9QA 5B32A 3AZGD 2ZY3A 5E5AD 4QLCD 3AZFB 2Y2NA 1P3FC 3X1TC 1P3FA 3X1TA 5BNVA 5CPIC 2ZY5A 2BYKB 4J8UD 5CPIA 3AFAD 5KDMA 3LJAC 3LJAA 1F66B 3VH6A 1TZYB 4UUZB 1ID3D 3X1VB 3MGRD 3KUYB 1P3PB 3RELB 4Z2MG 5B31D 3O62D 5B0ZB 1P3LD 5GT3B 1U35B 1H3OB 3W99B 1KX4D 3UTBB 2BG1A 5DNMB 3REKC 1F66C 3REKA 1F66A 2F8NG 5CPJC 1TZYC 4R8PC 5CPJA 1TZYA 4R8PA 3MNNB 3X1VC 1P3PC 3KUYC 3A6NB 3RELC 3X1VA 3KUYA 1P3PA 3RELA 3AZJC 5B0ZC 3AZJA 5B0ZA 3LZ0C 3MGSB 1HTAA 5GT3C 3LZ0A 1U35C 1P3KC 5GT3A 1U35A 1P3KA 2CV5D 3W99C 3W99A 3UTBC 3WA9B 4CSRB 3UTBA 4NE5A 5AY8B 3REHC 3REHA 1BH9A 1B67A 4ZBJB 3MNNC 3MNNA 3AZIA 2Y2KA 4J8VD 1P3BC 5B1LB 1HQ3D 1TAFB 4J8XD 4KUDD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYM B;  2NZD D;  5AV8 C;  5G49 B;  4CSR A;  3LZ1 D;  5AV8 A;  1EQZ D;  4ZBJ C;  1P3O C;  1P3O A;  5AV5 D;  5B1L C;  1P3A B;  5B1L A;  5GT0 D;  4WV4 B;  1TAF A;  3VH6 W;  2BYM A;  1B6W A;  5G49 A;  3X1S C;  3X1S A;  5B0Y D;  4Z5T D;  2F8N H;  1WWI A;  1KX5 B;  3REJ D;  5FUG B;  3LEL B;  5AV9 D;  3B6F B;  3MGP B;  5B24 C;  5AVC C;  5B24 A;  2RVQ C;  5AVC A;  5B33 B;  3WAA D;  1BH8 B;  5AVB B;  1S32 B;  3W97 B;  4LD9 D;  3B6G B;  3WKJ B;  2NQB D;  5CP6 C;  3TU4 C;  3MVD B;  5CP6 A;  3TU4 A;  3W98 C;  5B32 D;  1ZLA D;  1M18 B;  2PYO B;  3W98 A;  1KX5 C;  4NE3 A;  4ZUX B;  1KX5 A;  1P3I C;  5FUG A;  1A7W A;  1P3I A;  1P3F D;  5GXQ C;  5GXQ A;  5CPI D;  4J8W C;  1P34 D;  5AVB C;  4J8W A;  1R4V A;  5AVB A;  3W97 C;  3WKJ C;  3W97 A;  5JRG B;  3W96 B;  3WKJ A;  3KXB C;  4WU9 B;  3KXB A;  3MVD C;  3MVD A;  3NQU B;  1M18 C;  4EO5 B;  2PYO C;  1M18 A;  2PYO A;  2HIO B;  3KWQ B;  5B2J B;  5B40 B;  3B0D B;  3W96 C;  5JRG C;  4WU8 D;  2FJ7 B;  3W96 A;  5JRG A;  3REK D;  4WU9 C;  1F66 D;  5BT1 D;  4WU9 A;  5CPJ D;  1TZY D;  4R8P D;  4JJN B;  3NQU A;  4WZS B;  3REL D;  3AV1 B;  3AZH B;  3AZJ D;  1P3M A;  1AOI C;  1AOI A;  3LZ0 D;  2ARO D;  3B0C W;  4KHA B;  1U35 D;  1P3K D;  4H9N B;  3B0D C;  1N1J B;  5B1M B;  2FJ7 C;  2FJ7 A;  3REH D;  3X1U D;  2F8N B;  5GSU C;  4H9R B;  5GSU A;  4XUJ B;  3MNN D;  4CAY B;  3C1B C;  3UTA D;  3AZI D;  3C1B A;  3AV1 C;  3AZH C;  5BNX B;  3AV1 A;  3AZH A;  1P3B D;  3REI B;  4WNN B;  3AZM B;  3AZF C;  1M19 B;  1BFM A;  3AZF A;  5CPK B;  3AV2 B;  5F99 B;  5B1M C;  5AV8 D;  5B1M A;  2BYK A;  4NE6 A;  2F8N A;  5AV6 D;  4Z66 B;  4H9R A;  4XZQ B;  4YS3 B;  1P3O D;  1JFI B;  5BNX A;  4UUZ A;  3REI C;  3WTP B;  3REI A;  1Q9C A;  3MGQ B;  3AZM C;  4WNN A;  3AZM A;  1M19 C;  1M19 A;  5CPK C;  5CPK A;  1P3G B;  3VH5 T;  3X1S D;  4H9O B;  1H3O A;  3AYW B;  4Z66 C;  3C1C B;  4M6B A;  3AZE B;  4Z66 A;  5DNM C;  4X23 D;  4XZQ C;  5DNM A;  4XZQ A;  1KU5 A;  5E5A B;  1JFI A;  5B24 D;  3V9R B;  3WTP C;  5AVC D;  2RVQ D;  3A6N C;  3A6N A;  4YM6 B;  4J8U B;  3AFA B;  3MGS C;  1P3G C;  3MGS A;  1P3G A;  5CP6 D;  3TU4 D;  2YFV B;  3W98 D;  3AYW C;  3C1C C;  3WA9 C;  3AYW A;  3AZE C;  3C1C A;  5AY8 C;  3WA9 A;  3AZE A;  1P3I D;  5AY8 A;  4G92 B;  5B31 B;  2IO5 B;  5GXQ D;  3O62 B;  1P3L B;  2F8N K;  1M1A D;  3V9R A;  4YM6 C;  4J8W D;  5AVB D;  4YM6 A;  3AFA C;  1KX4 B;  3AFA A;  5BO0 B;  3KXB D;  1M18 D;  3B0B A;  1KX3 B;  1P3L C;  5B31 G;  2CV5 B;  5JRG D;  1P3A C;  1P3A A;  5BO0 A;  4WU9 D;  3AN2 D;  1P3M D;  3AZL D;  1AOI D;  1KX3 C;  4J8V B;  1KX3 A;  1HQ3 B;  3LEL C;  3LEL A;  4J8X B;  4KUD B;  3B6F C;  3X1T D;  3MGP C;  3B6F A;  3MGP A;  2FJ7 D;  2NZD B;  3LZ1 B;  5B33 C;  5B33 A;  1BH8 A;  1S32 C;  5GSU D;  1S32 A;  3B6G C;  4AWL B;  4KGC B;  3LJA D;  3C1B D;  1EQZ B;  3B6G A;  5AV5 B;  4H9P B;  4ZUX C;  1HQ3 C;  5GT0 B;  4ZUX A;  1HQ3 A;  4J8X C;  3AZF D;  4J8X A;  4KGC C;  4AWL C;  5DNN B;  4KGC A;  3REJ B;  3UT9 B;  5AV5 C;  3WTP E;  4EO5 C;  5AV5 A;  4H9P A;  3X1V D;  5GT0 C;  3KUY D;  1P3P D;  2HIO C;  5GT0 A;  1M19 D;  2HIO A;  3WAA B;  5B0Z D;  5B2J C;  3KWQ C;  5CPK D;  3KWQ A;  5B2J A;  5GT3 D;  4LD9 B;  2NQB B;  5B2I B;  5B40 C;  5B40 A;  3W99 D;  3UTB D;  3VH6 T;  4NFT A;  5DNN C;  3AZN B;  1ZLA B;  5DNM D;  5DNN A;  3UT9 C;  3UT9 A;  1P3F B;  2JSS A;  4JJN C;  2YFW B;  4JJN A;  5CPI B;  3A6N D;  4E45 A;  1P34 B;  4DRA A;  3MGS D;  1P3G D;  3R45 B;  4KHA A;  5B2I C;  5B2I A;  4H9N A;  1ZLA C;  3AZN C;  3AZE D;  3WA9 D;  5AY8 D;  1N1J A;  3AZN A;  1ZLA A;  4HGA B;  3NQJ B;  5B32 G;  2HUE B;  4XUJ C;  2YFW A;  3AZK B;  4XUJ A;  4CAY A;  1ULY A;  4YM6 D;  1P34 C;  1P34 A;  5B1L D;  4WU8 B;  3R45 A;  3REK B;  5CPJ B;  3AV2 C;  5F99 C;  4R8P B;  3AV2 A;  5F99 A;  4HGA C;  3AZJ B;  3NQJ A;  2HUE C;  3AZK C;  3LZ0 B;  4DRB A;  2ARO B;  3AZK A;  3AZG B;  4YS3 C;  1P3K B;  2LY8 A;  4YS3 A;  5BS7 C;  4QLC B;  5BS7 A;  1P3A D;  4WU8 C;  3WTP A;  3MGQ C;  4WU8 A;  3MGQ A;  5BT1 C;  3X1U B;  3REH B;  1F1E A;  1BH9 B;  5C3I B;  3UTA B;  3AZI B;  4H9O A;  1KX3 D;  1P3B B;  1KX5 D;  1ID3 B;  2ARO C;  3LEL D;  3AZG C;  2ARO A;  3MGR B;  3AZG A;  5E5A C;  4QLC C;  3B6F D;  5E5A A;  4QLC A;  3MGP D;  5AV8 B;  5B33 D;  3B0C T;  4J8U C;  3X1U C;  3VH5 A;  4J8U A;  1S32 D;  3X1U A;  3W97 D;  3B6G D;  5AV6 B;  1P3B A;  5C3I C;  3WKJ D;  3UTA C;  3AZI C;  1P3O B;  3UTA A;  3MVD D;  2YFV A;  2PYO D;  1ID3 C;  4ZUX D;  1ID3 A;  3MGR C;  4G92 C;  3MGR A;  5B31 C;  2IO5 C;  5B31 A;  3O62 C;  3O62 A;  1P3L A;  3X1S B;  1KX4 C;  4KGC D;  5AV6 C;  3W96 D;  1KX4 A;  5AV6 A;  5JA4 B;  4X23 B;  3KSY A;  4Z2M H;  5B24 B;  5AVC B;  2HIO D;  3KWQ D;  5B2J D;  5B40 D;  5CP6 B;  2CV5 C;  3TU4 B;  2CV5 A;  3W98 B;  5DNN D;  4X23 C;  5JA4 A;  4X23 A;  3UT9 D;  5CHL B;  1P3I B;  4JJN D;  5GXQ B;  1M1A B;  4G91 B;  3AZH D;  3AV1 D;  4J8W B;  4J8V C;  2CWE A;  4J8V A;  2L5A A;  5B2I D;  3KXB B;  4KUD C;  4KUD A;  5B1M D;  3AZN D;  2NZD C;  2NZD A;  3LZ1 C;  3LZ1 A;  2F8N D;  4XUJ D;  5B0Y B;  4Z5T B;  1M1A C;  1EQZ C;  1EQZ A;  1M1A A;  4G91 C;  5AV9 B;  3VH5 W;  3REI D;  3AZM D;  3AN2 B;  3AV2 D;  5F99 D;  1P3M B;  3AZL B;  1AOI B;  4H9S C;  4H9Q B;  4Z66 D;  4H9S A;  5B32 B;  4Z5T C;  5B0Y C;  3AZK D;  5B0Y A;  4Z5T A;  4XZQ D;  4YS3 D;  3REJ C;  5AV9 C;  3REJ A;  5AV9 A;  3X1T B;  5BNV B;  3WTP D;  3MGQ D;  3WAA C;  3AN2 C;  3WAA A;  3AN2 A;  5KDM B;  5GSU B;  4LD9 C;  4LD9 A;  4E44 A;  3LJA B;  3C1B B;  2NQB C;  1P3M C;  2NQB A;  3AZL C;  1WWS A;  3AZL A;  3AYW D;  3C1C D;  5B32 C;  4H9Q A;  5B32 A;  3AZG D;  5E5A D;  4QLC D;  3AZF B;  1P3F C;  3X1T C;  1P3F A;  3X1T A;  5BNV A;  5CPI C;  2BYK B;  4J8U D;  5CPI A;  3AFA D;  5KDM A;  3LJA C;  3LJA A;  1F66 B;  3VH6 A;  1TZY B;  4UUZ B;  1ID3 D;  3X1V B;  3MGR D;  3KUY B;  1P3P B;  3REL B;  4Z2M G;  5B31 D;  3O62 D;  5B0Z B;  1P3L D;  5GT3 B;  1U35 B;  1H3O B;  3W99 B;  1KX4 D;  3UTB B;  5DNM B;  3REK C;  1F66 C;  3REK A;  1F66 A;  2F8N G;  5CPJ C;  1TZY C;  4R8P C;  5CPJ A;  1TZY A;  4R8P A;  3MNN B;  3X1V C;  1P3P C;  3KUY C;  3A6N B;  3REL C;  3X1V A;  3KUY A;  1P3P A;  3REL A;  3AZJ C;  5B0Z C;  3AZJ A;  5B0Z A;  3LZ0 C;  3MGS B;  1HTA A;  5GT3 C;  3LZ0 A;  1U35 C;  1P3K C;  5GT3 A;  1U35 A;  1P3K A;  2CV5 D;  3W99 C;  3W99 A;  3UTB C;  3WA9 B;  4CSR B;  3UTB A;  4NE5 A;  5AY8 B;  3REH C;  3REH A;  1BH9 A;  1B67 A;  4ZBJ B;  3MNN C;  3MNN A;  3AZI A;  4J8V D;  1P3B C;  5B1L B;  1HQ3 D;  1TAF B;  4J8X D;  4KUD D; 
#chains in the Genus database with same CATH topology
 2Y2P A;  2BYM B;  2NZD D;  5AV8 C;  5G49 B;  4CSR A;  3LZ1 D;  5AV8 A;  3F6T A;  1EQZ D;  4ZBJ C;  1P3O C;  1P3O A;  5AV5 D;  5B1L C;  1P3A B;  5B1L A;  5GT0 D;  4WV4 B;  3AL0 C;  1TAF A;  3VH6 W;  2BYM A;  1B6W A;  5G49 A;  3X1S C;  3X1S A;  5B0Y D;  2Y2O A;  4Z5T D;  1WWI A;  1KX5 B;  2F8N H;  3REJ D;  5FUG B;  3LEL B;  5AV9 D;  3B6F B;  3MGP B;  5B24 C;  5AVC C;  5B24 A;  2RVQ C;  5AVC A;  5B33 B;  3WAA D;  1BH8 B;  3H0M C;  3H0R C;  5AVB B;  1S32 B;  3W97 B;  4LD9 D;  3B6G B;  3WKJ B;  2NQB D;  5CP6 C;  3TU4 C;  3MVD B;  4DQY B;  5CP6 A;  3TU4 A;  2Y2G A;  5B32 D;  1ZLA D;  1M18 B;  2PYO B;  3W98 C;  1KX5 C;  3W98 A;  4NE3 A;  4ZUX B;  1KX5 A;  1P3I C;  5FUG A;  1A7W A;  1P3I A;  1P3F D;  5GXQ C;  5GXQ A;  5CPI D;  4J8W C;  1P34 D;  5AVB C;  4J8W A;  1R4V A;  5AVB A;  3W97 C;  3WKJ C;  3W97 A;  5JRG B;  3W96 B;  3WKJ A;  3KXB C;  4WU9 B;  3KXB A;  3MVD C;  3MVD A;  3NQU B;  2FFF B;  4EO5 B;  1M18 C;  2PYO C;  1M18 A;  2PYO A;  2HIO B;  2Y2J A;  3KWQ B;  5B2J B;  5B40 B;  3B0D B;  3W96 C;  5JRG C;  4WU8 D;  2FJ7 B;  3W96 A;  5JRG A;  3REK D;  4WU9 C;  1F66 D;  5BT1 D;  4WU9 A;  5CPJ D;  1TZY D;  4R8P D;  4JJN B;  3NQU A;  4WZS B;  2G5I C;  3REL D;  3AV1 B;  3AZH B;  3AZJ D;  1P3M A;  1AOI C;  1AOI A;  3LZ0 D;  2ARO D;  3B0C W;  4KHA B;  1U35 D;  1P3K D;  3EPH A;  4H9N B;  2J8P A;  3B0D C;  1N1J B;  5B1M B;  2FJ7 C;  2FJ7 A;  3REH D;  3X1U D;  2ZM5 A;  2F8N B;  5GSU C;  4H9R B;  5GSU A;  4XUJ B;  3MNN D;  4CAY B;  3C1B C;  3UTA D;  3AZI D;  3C1B A;  2ZY4 A;  3AV1 C;  3AZH C;  5BNX B;  3AV1 A;  3AZH A;  1P3B D;  3REI B;  4WNN B;  3AZM B;  2Y2H A;  3AZF C;  1M19 B;  1BFM A;  3AZF A;  5CPK B;  3AV2 B;  5F99 B;  5B1M C;  5AV8 D;  5B1M A;  2JE5 A;  2BYK A;  4NE6 A;  2F8N A;  5AV6 D;  4Z66 B;  4H9R A;  4XZQ B;  4YS3 B;  1P3O D;  1JFI B;  5BNX A;  1T3U A;  4UUZ A;  3REI C;  3WTP B;  3REI A;  1Q9C A;  3MGQ B;  3AZM C;  4WNN A;  3AZM A;  1M19 C;  4WJ3 C;  1M19 A;  5CPK C;  5CPK A;  1P3G B;  3VH5 T;  3X1S D;  4H9O B;  1PZR A;  1H3O A;  3AYW B;  4Z66 C;  3C1C B;  4M6B A;  3AZE B;  4Z66 A;  5DNM C;  4X23 D;  4XZQ C;  2UWX A;  5DNM A;  4XZQ A;  1KU5 A;  5E5A B;  1JFI A;  5B24 D;  3V9R B;  3WTP C;  5AVC D;  2RVQ D;  3A6N C;  3A6N A;  4YM6 B;  4J8U B;  2XD1 A;  3AFA B;  3MGS C;  1P3G C;  3MGS A;  1P3G A;  3H0L C;  5CP6 D;  3TU4 D;  2YFV B;  3W98 D;  3AYW C;  3C1C C;  3WA9 C;  3AYW A;  3AZE C;  3C1C A;  5AY8 C;  3WA9 A;  3AZE A;  1P3I D;  5AY8 A;  4G92 B;  5B31 B;  3EPK A;  2IO5 B;  5GXQ D;  3O62 B;  1P3L B;  2F8N K;  1M1A D;  3V9R A;  4YM6 C;  4J8W D;  5AVB D;  4YM6 A;  3AFA C;  1KX4 B;  3AFA A;  5BO0 B;  2W8S A;  3KXB D;  3P5J B;  1M18 D;  3B0B A;  3KFU G;  1KX3 B;  1P3L C;  5B31 G;  2JCH A;  2CV5 B;  5JRG D;  1P3A C;  1P3A A;  5BO0 A;  2ZY2 A;  4WU9 D;  3AN2 D;  3EPL A;  2Y2L A;  1P3M D;  3AZL D;  1AOI D;  1KX3 C;  4J8V B;  1KX3 A;  1HQ3 B;  3LEL C;  3LEL A;  4J8X B;  4KUD B;  3B6F C;  3A1K A;  3X1T D;  3MGP C;  3B6F A;  3MGP A;  2FJ7 D;  2NZD B;  3LZ1 B;  5B33 C;  5B33 A;  2F2A C;  1BH8 A;  2DF4 C;  5GSU D;  1S32 C;  1S32 A;  3B6G C;  4AWL B;  4KGC B;  3LJA D;  3C1B D;  1EQZ B;  3B6G A;  5AV5 B;  4H9P B;  2Y2M A;  4ZUX C;  1HQ3 C;  5GT0 B;  4ZUX A;  1HQ3 A;  4J8X C;  3AZF D;  4J8X A;  1W2E A;  2XD5 A;  4KGC C;  4AWL C;  5DNN B;  4KGC A;  3REJ B;  3UT9 B;  5AV5 C;  3WTP E;  4EO5 C;  5AV5 A;  4H9P A;  3X1V D;  5GT0 C;  3KUY D;  1P3P D;  2HIO C;  5GT0 A;  1M19 D;  2HIO A;  3WAA B;  5B0Z D;  5B2J C;  3KWQ C;  5CPK D;  3KWQ A;  5B2J A;  5GT3 D;  4LD9 B;  2NQB B;  5B2I B;  5B40 C;  5B40 A;  3W99 D;  3UTB D;  3VH6 T;  4NFT A;  5DNN C;  3AZN B;  1ZLA B;  5DNM D;  5DNN A;  3UT9 C;  3UT9 A;  1P3F B;  2JSS A;  4JJN C;  2YFW B;  4JJN A;  5CPI B;  3A6N D;  4E45 A;  3FDD A;  1P34 B;  4DRA A;  3MGS D;  1P3G D;  3R45 B;  4KHA A;  5B2I C;  5B2I A;  4H9N A;  1ZLA C;  3AZN C;  3AZE D;  3WA9 D;  5AY8 D;  1N1J A;  3AZN A;  1ZLA A;  4HGA B;  3NQJ B;  5B32 G;  2HUE B;  4XUJ C;  2YFW A;  3AZK B;  4XUJ A;  4CAY A;  1ULY A;  4YM6 D;  1P34 C;  1P34 A;  5B1L D;  4WU8 B;  3R45 A;  3REK B;  5CPJ B;  2DQN C;  3AV2 C;  5F99 C;  4R8P B;  3AV2 A;  5F99 A;  4HGA C;  3A1I A;  3AZJ B;  2VQR A;  3NQJ A;  2HUE C;  3AZK C;  3LZ0 B;  4DRB A;  2ARO B;  3AZK A;  3AZG B;  4YS3 C;  1P3K B;  2LY8 A;  4YS3 A;  5BS7 C;  4QLC B;  5BS7 A;  1P3A D;  4WU8 C;  3WTP A;  3MGQ C;  4WU8 A;  3MGQ A;  5BT1 C;  3X1U B;  3REH B;  1F1E A;  1BH9 B;  5C3I B;  3UTA B;  3AZI B;  4H9O A;  1KX3 D;  1P3B B;  1KX5 D;  1ID3 B;  2ARO C;  3LEL D;  3EG5 B;  3AZG C;  2ARO A;  3MGR B;  3AZG A;  2Y2Q A;  5E5A C;  4QLC C;  3B6F D;  5E5A A;  4QLC A;  3IP4 C;  3MGP D;  5AV8 B;  5B33 D;  3B0C T;  4J8U C;  3X1U C;  3VH5 A;  4J8U A;  1S32 D;  3X1U A;  3W97 D;  3B6G D;  5AV6 B;  1P3B A;  5C3I C;  3WKJ D;  3UTA C;  3AZI C;  1P3O B;  3UTA A;  3MVD D;  2YFV A;  2PYO D;  1ID3 C;  4ZUX D;  1ID3 A;  3MGR C;  4G92 C;  3MGR A;  5B31 C;  2IO5 C;  5B31 A;  3O62 C;  3O62 A;  1P3L A;  3X1S B;  1Z2C B;  1KX4 C;  4KGC D;  5AV6 C;  3W96 D;  1KX4 A;  5AV6 A;  5JA4 B;  4X23 B;  3KSY A;  4Z2M H;  5B24 B;  5AVC B;  2HIO D;  3KWQ D;  5B2J D;  5B40 D;  5CP6 B;  2CV5 C;  3TU4 B;  2CV5 A;  3W98 B;  5DNN D;  4X23 C;  5JA4 A;  4X23 A;  3UT9 D;  5CHL B;  1P3I B;  4JJN D;  5GXQ B;  1M1A B;  4G91 B;  3AZH D;  3AV1 D;  4J8W B;  4J8V C;  2CWE A;  4J8V A;  2L5A A;  5B2I D;  3KXB B;  4KUD C;  4KUD A;  2RIQ A;  5B1M D;  3EPJ A;  3AZN D;  2NZD C;  2NZD A;  3LZ1 C;  3LZ1 A;  2F8N D;  4XUJ D;  5B0Y B;  4Z5T B;  1M1A C;  1EQZ C;  1EQZ A;  1M1A A;  4G91 C;  5AV9 B;  3VH5 W;  4UPK A;  3REI D;  2Y2I A;  3AZM D;  3AN2 B;  3AV2 D;  5F99 D;  2G5H C;  1P3M B;  3AZL B;  1AOI B;  4H9S C;  4H9Q B;  4Z66 D;  4H9S A;  5B32 B;  4Z5T C;  5B0Y C;  3AZK D;  5B0Y A;  4Z5T A;  4XZQ D;  4YS3 D;  3REJ C;  5AV9 C;  3REJ A;  5AV9 A;  3X1T B;  5BNV B;  3WTP D;  3MGQ D;  3WAA C;  3AN2 C;  3WAA A;  3AN2 A;  5KDM B;  5GSU B;  4LD9 C;  4LD9 A;  4E44 A;  3LJA B;  3C1B B;  2NQB C;  1P3M C;  2NQB A;  3AZL C;  1WWS A;  3AZL A;  3AYW D;  3C1C D;  5B32 C;  4H9Q A;  5B32 A;  3AZG D;  2ZY3 A;  5E5A D;  4QLC D;  3AZF B;  2Y2N A;  1P3F C;  3X1T C;  1P3F A;  3X1T A;  5BNV A;  5CPI C;  2ZY5 A;  2BYK B;  4J8U D;  5CPI A;  3AFA D;  5KDM A;  3LJA C;  3LJA A;  1F66 B;  3VH6 A;  1TZY B;  4UUZ B;  1ID3 D;  3X1V B;  3MGR D;  3KUY B;  1P3P B;  3REL B;  4Z2M G;  5B31 D;  3O62 D;  5B0Z B;  1P3L D;  5GT3 B;  1U35 B;  1H3O B;  3W99 B;  1KX4 D;  3UTB B;  2BG1 A;  5DNM B;  3REK C;  1F66 C;  3REK A;  1F66 A;  2F8N G;  5CPJ C;  1TZY C;  4R8P C;  5CPJ A;  1TZY A;  4R8P A;  3MNN B;  3X1V C;  1P3P C;  3KUY C;  3A6N B;  3REL C;  3X1V A;  3KUY A;  1P3P A;  3REL A;  3AZJ C;  5B0Z C;  3AZJ A;  5B0Z A;  3LZ0 C;  3MGS B;  1HTA A;  5GT3 C;  3LZ0 A;  1U35 C;  1P3K C;  5GT3 A;  1U35 A;  1P3K A;  2CV5 D;  3W99 C;  3W99 A;  3UTB C;  3WA9 B;  4CSR B;  3UTB A;  4NE5 A;  5AY8 B;  3REH C;  3REH A;  1BH9 A;  1B67 A;  4ZBJ B;  3MNN C;  3MNN A;  3AZI A;  2Y2K A;  4J8V D;  1P3B C;  5B1L B;  1HQ3 D;  1TAF B;  4J8X D;  4KUD D; 
#chains in the Genus database with same CATH homology
 2Y2P A;  2BYM B;  2NZD D;  5AV8 C;  5G49 B;  4CSR A;  3LZ1 D;  5AV8 A;  3F6T A;  1EQZ D;  4ZBJ C;  1P3O C;  1P3O A;  5AV5 D;  5B1L C;  1P3A B;  5B1L A;  5GT0 D;  4WV4 B;  3AL0 C;  1TAF A;  3VH6 W;  2BYM A;  1B6W A;  5G49 A;  3X1S C;  3X1S A;  5B0Y D;  2Y2O A;  4Z5T D;  1WWI A;  1KX5 B;  2F8N H;  3REJ D;  5FUG B;  3LEL B;  5AV9 D;  3B6F B;  3MGP B;  5B24 C;  5AVC C;  5B24 A;  2RVQ C;  5AVC A;  5B33 B;  3WAA D;  1BH8 B;  3H0M C;  3H0R C;  5AVB B;  1S32 B;  3W97 B;  4LD9 D;  3B6G B;  3WKJ B;  2NQB D;  5CP6 C;  3TU4 C;  3MVD B;  4DQY B;  5CP6 A;  3TU4 A;  2Y2G A;  5B32 D;  1ZLA D;  1M18 B;  2PYO B;  3W98 C;  1KX5 C;  3W98 A;  4NE3 A;  4ZUX B;  1KX5 A;  1P3I C;  5FUG A;  1A7W A;  1P3I A;  1P3F D;  5GXQ C;  5GXQ A;  5CPI D;  4J8W C;  1P34 D;  5AVB C;  4J8W A;  1R4V A;  5AVB A;  3W97 C;  3WKJ C;  3W97 A;  5JRG B;  3W96 B;  3WKJ A;  3KXB C;  4WU9 B;  3KXB A;  3MVD C;  3MVD A;  3NQU B;  2FFF B;  4EO5 B;  1M18 C;  2PYO C;  1M18 A;  2PYO A;  2HIO B;  2Y2J A;  3KWQ B;  5B2J B;  5B40 B;  3B0D B;  3W96 C;  5JRG C;  4WU8 D;  2FJ7 B;  3W96 A;  5JRG A;  3REK D;  4WU9 C;  1F66 D;  5BT1 D;  4WU9 A;  5CPJ D;  1TZY D;  4R8P D;  4JJN B;  3NQU A;  4WZS B;  2G5I C;  3REL D;  3AV1 B;  3AZH B;  3AZJ D;  1P3M A;  1AOI C;  1AOI A;  3LZ0 D;  2ARO D;  3B0C W;  4KHA B;  1U35 D;  1P3K D;  3EPH A;  4H9N B;  2J8P A;  3B0D C;  1N1J B;  5B1M B;  2FJ7 C;  2FJ7 A;  3REH D;  3X1U D;  2ZM5 A;  2F8N B;  5GSU C;  4H9R B;  5GSU A;  4XUJ B;  3MNN D;  4CAY B;  3C1B C;  3UTA D;  3AZI D;  3C1B A;  2ZY4 A;  3AV1 C;  3AZH C;  5BNX B;  3AV1 A;  3AZH A;  1P3B D;  3REI B;  4WNN B;  3AZM B;  2Y2H A;  3AZF C;  1M19 B;  1BFM A;  3AZF A;  5CPK B;  3AV2 B;  5F99 B;  5B1M C;  5AV8 D;  5B1M A;  2JE5 A;  2BYK A;  4NE6 A;  2F8N A;  5AV6 D;  4Z66 B;  4H9R A;  4XZQ B;  4YS3 B;  1P3O D;  1JFI B;  5BNX A;  1T3U A;  4UUZ A;  3REI C;  3WTP B;  3REI A;  1Q9C A;  3MGQ B;  3AZM C;  4WNN A;  3AZM A;  1M19 C;  4WJ3 C;  1M19 A;  5CPK C;  5CPK A;  1P3G B;  3VH5 T;  3X1S D;  4H9O B;  1PZR A;  1H3O A;  3AYW B;  4Z66 C;  3C1C B;  4M6B A;  3AZE B;  4Z66 A;  5DNM C;  4X23 D;  4XZQ C;  2UWX A;  5DNM A;  4XZQ A;  1KU5 A;  5E5A B;  1JFI A;  5B24 D;  3V9R B;  3WTP C;  5AVC D;  2RVQ D;  3A6N C;  3A6N A;  4YM6 B;  4J8U B;  2XD1 A;  3AFA B;  3MGS C;  1P3G C;  3MGS A;  1P3G A;  3H0L C;  5CP6 D;  3TU4 D;  2YFV B;  3W98 D;  3AYW C;  3C1C C;  3WA9 C;  3AYW A;  3AZE C;  3C1C A;  5AY8 C;  3WA9 A;  3AZE A;  1P3I D;  5AY8 A;  4G92 B;  5B31 B;  3EPK A;  2IO5 B;  5GXQ D;  3O62 B;  1P3L B;  2F8N K;  1M1A D;  3V9R A;  4YM6 C;  4J8W D;  5AVB D;  4YM6 A;  3AFA C;  1KX4 B;  3AFA A;  5BO0 B;  2W8S A;  3KXB D;  3P5J B;  1M18 D;  3B0B A;  3KFU G;  1KX3 B;  1P3L C;  5B31 G;  2JCH A;  2CV5 B;  5JRG D;  1P3A C;  1P3A A;  5BO0 A;  2ZY2 A;  4WU9 D;  3AN2 D;  3EPL A;  2Y2L A;  1P3M D;  3AZL D;  1AOI D;  1KX3 C;  4J8V B;  1KX3 A;  1HQ3 B;  3LEL C;  3LEL A;  4J8X B;  4KUD B;  3B6F C;  3A1K A;  3X1T D;  3MGP C;  3B6F A;  3MGP A;  2FJ7 D;  2NZD B;  3LZ1 B;  5B33 C;  5B33 A;  2F2A C;  1BH8 A;  2DF4 C;  5GSU D;  1S32 C;  1S32 A;  3B6G C;  4AWL B;  4KGC B;  3LJA D;  3C1B D;  1EQZ B;  3B6G A;  5AV5 B;  4H9P B;  2Y2M A;  4ZUX C;  1HQ3 C;  5GT0 B;  4ZUX A;  1HQ3 A;  4J8X C;  3AZF D;  4J8X A;  1W2E A;  2XD5 A;  4KGC C;  4AWL C;  5DNN B;  4KGC A;  3REJ B;  3UT9 B;  5AV5 C;  3WTP E;  4EO5 C;  5AV5 A;  4H9P A;  3X1V D;  5GT0 C;  3KUY D;  1P3P D;  2HIO C;  5GT0 A;  1M19 D;  2HIO A;  3WAA B;  5B0Z D;  5B2J C;  3KWQ C;  5CPK D;  3KWQ A;  5B2J A;  5GT3 D;  4LD9 B;  2NQB B;  5B2I B;  5B40 C;  5B40 A;  3W99 D;  3UTB D;  3VH6 T;  4NFT A;  5DNN C;  3AZN B;  1ZLA B;  5DNM D;  5DNN A;  3UT9 C;  3UT9 A;  1P3F B;  2JSS A;  4JJN C;  2YFW B;  4JJN A;  5CPI B;  3A6N D;  4E45 A;  3FDD A;  1P34 B;  4DRA A;  3MGS D;  1P3G D;  3R45 B;  4KHA A;  5B2I C;  5B2I A;  4H9N A;  1ZLA C;  3AZN C;  3AZE D;  3WA9 D;  5AY8 D;  1N1J A;  3AZN A;  1ZLA A;  4HGA B;  3NQJ B;  5B32 G;  2HUE B;  4XUJ C;  2YFW A;  3AZK B;  4XUJ A;  4CAY A;  1ULY A;  4YM6 D;  1P34 C;  1P34 A;  5B1L D;  4WU8 B;  3R45 A;  3REK B;  5CPJ B;  2DQN C;  3AV2 C;  5F99 C;  4R8P B;  3AV2 A;  5F99 A;  4HGA C;  3A1I A;  3AZJ B;  2VQR A;  3NQJ A;  2HUE C;  3AZK C;  3LZ0 B;  4DRB A;  2ARO B;  3AZK A;  3AZG B;  4YS3 C;  1P3K B;  2LY8 A;  4YS3 A;  5BS7 C;  4QLC B;  5BS7 A;  1P3A D;  4WU8 C;  3WTP A;  3MGQ C;  4WU8 A;  3MGQ A;  5BT1 C;  3X1U B;  3REH B;  1F1E A;  1BH9 B;  5C3I B;  3UTA B;  3AZI B;  4H9O A;  1KX3 D;  1P3B B;  1KX5 D;  1ID3 B;  2ARO C;  3LEL D;  3EG5 B;  3AZG C;  2ARO A;  3MGR B;  3AZG A;  2Y2Q A;  5E5A C;  4QLC C;  3B6F D;  5E5A A;  4QLC A;  3IP4 C;  3MGP D;  5AV8 B;  5B33 D;  3B0C T;  4J8U C;  3X1U C;  3VH5 A;  4J8U A;  1S32 D;  3X1U A;  3W97 D;  3B6G D;  5AV6 B;  1P3B A;  5C3I C;  3WKJ D;  3UTA C;  3AZI C;  1P3O B;  3UTA A;  3MVD D;  2YFV A;  2PYO D;  1ID3 C;  4ZUX D;  1ID3 A;  3MGR C;  4G92 C;  3MGR A;  5B31 C;  2IO5 C;  5B31 A;  3O62 C;  3O62 A;  1P3L A;  3X1S B;  1Z2C B;  1KX4 C;  4KGC D;  5AV6 C;  3W96 D;  1KX4 A;  5AV6 A;  5JA4 B;  4X23 B;  3KSY A;  4Z2M H;  5B24 B;  5AVC B;  2HIO D;  3KWQ D;  5B2J D;  5B40 D;  5CP6 B;  2CV5 C;  3TU4 B;  2CV5 A;  3W98 B;  5DNN D;  4X23 C;  5JA4 A;  4X23 A;  3UT9 D;  5CHL B;  1P3I B;  4JJN D;  5GXQ B;  1M1A B;  4G91 B;  3AZH D;  3AV1 D;  4J8W B;  4J8V C;  2CWE A;  4J8V A;  2L5A A;  5B2I D;  3KXB B;  4KUD C;  4KUD A;  2RIQ A;  5B1M D;  3EPJ A;  3AZN D;  2NZD C;  2NZD A;  3LZ1 C;  3LZ1 A;  2F8N D;  4XUJ D;  5B0Y B;  4Z5T B;  1M1A C;  1EQZ C;  1EQZ A;  1M1A A;  4G91 C;  5AV9 B;  3VH5 W;  4UPK A;  3REI D;  2Y2I A;  3AZM D;  3AN2 B;  3AV2 D;  5F99 D;  2G5H C;  1P3M B;  3AZL B;  1AOI B;  4H9S C;  4H9Q B;  4Z66 D;  4H9S A;  5B32 B;  4Z5T C;  5B0Y C;  3AZK D;  5B0Y A;  4Z5T A;  4XZQ D;  4YS3 D;  3REJ C;  5AV9 C;  3REJ A;  5AV9 A;  3X1T B;  5BNV B;  3WTP D;  3MGQ D;  3WAA C;  3AN2 C;  3WAA A;  3AN2 A;  5KDM B;  5GSU B;  4LD9 C;  4LD9 A;  4E44 A;  3LJA B;  3C1B B;  2NQB C;  1P3M C;  2NQB A;  3AZL C;  1WWS A;  3AZL A;  3AYW D;  3C1C D;  5B32 C;  4H9Q A;  5B32 A;  3AZG D;  2ZY3 A;  5E5A D;  4QLC D;  3AZF B;  2Y2N A;  1P3F C;  3X1T C;  1P3F A;  3X1T A;  5BNV A;  5CPI C;  2ZY5 A;  2BYK B;  4J8U D;  5CPI A;  3AFA D;  5KDM A;  3LJA C;  3LJA A;  1F66 B;  3VH6 A;  1TZY B;  4UUZ B;  1ID3 D;  3X1V B;  3MGR D;  3KUY B;  1P3P B;  3REL B;  4Z2M G;  5B31 D;  3O62 D;  5B0Z B;  1P3L D;  5GT3 B;  1U35 B;  1H3O B;  3W99 B;  1KX4 D;  3UTB B;  2BG1 A;  5DNM B;  3REK C;  1F66 C;  3REK A;  1F66 A;  2F8N G;  5CPJ C;  1TZY C;  4R8P C;  5CPJ A;  1TZY A;  4R8P A;  3MNN B;  3X1V C;  1P3P C;  3KUY C;  3A6N B;  3REL C;  3X1V A;  3KUY A;  1P3P A;  3REL A;  3AZJ C;  5B0Z C;  3AZJ A;  5B0Z A;  3LZ0 C;  3MGS B;  1HTA A;  5GT3 C;  3LZ0 A;  1U35 C;  1P3K C;  5GT3 A;  1U35 A;  1P3K A;  2CV5 D;  3W99 C;  3W99 A;  3UTB C;  3WA9 B;  4CSR B;  3UTB A;  4NE5 A;  5AY8 B;  3REH C;  3REH A;  1BH9 A;  1B67 A;  4ZBJ B;  3MNN C;  3MNN A;  3AZI A;  2Y2K A;  4J8V D;  1P3B C;  5B1L B;  1HQ3 D;  1TAF B;  4J8X D;  4KUD D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...