4KUDC

Crystal structure of n-terminal acetylated sir3 bah domain d205n mutant in complex with yeast nucleosome core particle
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3
publication title N alpha-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein/transcription/dna
total genus 28
structure length 103
sequence length 103
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4kudC00
5CPKA 3MNNB 3AZLA 2JSSA 3LZ0B 3REKA 3REJB 3W98A 5JA4A 1F66B 4XUJC 5DNMB 1M1AD 1TAFA 3WA9C 3WA9D 1HQ3C 1HQ3D 4HGAB 3MGRD 1KX5B 4J8WB 3LELD 5CPKB 4JJNA 3TU4A 3WTPE 3AZLB 4J8XD 5AVCA 3REKB 1P3OA 4WU9D 4DRBA 3AZGA 4WU9C 1P3PA 3W98B 5JA4B 4YM6D 1P3AD 3AZID 5CPIC 3AZIC 1KX3A 1TAFB 1P3IC 3B0DB 4H9RA 3VH6T 3B0CW 4X23C 5BS7C 4X23D 4J8UC 4JJNB 3TU4B 1Q9CA 5AVCB 3LZ1C 1P3OB 5JRGA 3AZGB 3AZEC 3AZED 5GXQD 5GXQC 1P3PB 3AN2D 5AY8C 5AY8D 4EO5B 1P3BD 1P3MA 1KX3B 3WKJC 2CWEA 4DRAA 5B40C 4H9RB 1M19C 1M19D 3MVDD 1M1AA 3WA9A 1F1EA 1HQ3A 5JRGB 3MGRA 3AZKC 1P3MB 3LELA 3MGPC 3MGPD 1TZYD 4J8VC 4J8XA 4WU9A 2RVQD 2RVQC 4YM6A 1P3AA 5AV8D 3AZIA 1M1AB 3WA9B 1KX4C 1HQ3B 4Z5TC 3MGRB 1BFMA 5CP6D 4X23A 3LELB 4J8XB 3VH5T 4WU9B 3AZEA 2FJ7C 5GXQA 3O62C 3O62D 5B1MD 3AN2A 4YM6B 5AY8A 1P3AB 1ID3C 1P3BA 1ID3D 3AZIB 5DNNC 5B2JD 5B2JC 4NE5A 1M19A 4X23B 3MVDA 3WTPC 3AZEB 1ULYA 5GXQB 3AN2B 5AY8B 1P3BB 3MGPA 1TZYA 3AZMC 3W96C 3W96D 1M19B 5AV8A 5B24D 3X1SD 5B24C 5GT3D 5GT3C 3MVDB 3X1SC 4AWLB 5F99D 5B2IC 5B2ID 5CP6A 1U35C 1U35D 3MGPB 5KDMA 1TZYB 1P3GC 1P3GD 5DNMC 3O62A 5B1MA 3AZHD 4R8PD 5AV8B 1ID3A 1KX5C 1WWSA 5B2JA 4E45A 1KX4B 5CPKC 3AZLC 5CP6B 3X1UC 3X1UD 3REKC 3KSYA 5KDMB 2NQBD 5CPJD 5CPJC 4NFTA 5GT0D 4H9SA 3O62B 5B1MB 2NZDD 1ID3B 3B0DC 5B2JB 3W96A 5B32D 4JJNC 3TU4C 3AZNC 3AZND 5B1LD 1P3OC 5B24A 3X1SA 5GT3A 3AZGC 4KUDD 1P3PC 4KUDC 5F99A 3KXBC 5B2IA 3KXBD 4YS3C 4YS3D 1U35A 3X1VC 3X1VD 1P3GA 2CV5C 4G92B 2CV5D 3W96B 3AZHA 4R8PA 5B24B 3X1SB 5GT3B 3MGQD 5B0YC 5B0YD 3B0CT 1P3MC 1H3OA 5F99B 5B2IB 3X1TD 3X1UA 1U35B 3KUYD 2NQBA 5CPJA 1N1JA 1P3GB 5GT0A 1M1AC 3AZHB 4R8PB 2NZDA 3MGRC 1HTAA 1B67A 1H3OB 4WV4B 1BH8A 5B32A 3LELC 5BO0A 4Z2MG 4QLCD 3X1UB 5B1LA 4J8XC 3AZNA 3AYWC 3AYWD 4KUDA 2NQBB 5CPJB 1N1JB 1M18D 2LY8A 4YM6C 3UTAD 1P3AC 1M18C 1EQZD 3V9RA 5GT0B 3KXBA 1A7WA 4YS3A 2NZDB 3X1VA 5GSUD 2CV5A 4E44A 1BH8B 5B32B 5BO0B 3AZNB 5B1LB 4KUDB 3MGQA 5B0YA 3AN2C 1P3BC 3WAAC 3V9RB 3KXBB 3WAAD 4YS3B 3X1TA 5AVBC 5AVBD 5B33D 5B33C 3KUYA 3X1VB 1P3FC 2CV5B 1P3FD 3AFAC 3AFAD 3MVDC 4AWLC 4LD9C 4LD9D 3MGQB 5B0YB 4CSRA 5B31C 5B31D 3AV1D 1TZYC 3X1TB 4QLCA 3AYWA 4ZBJB 3KUYB 4KGCC 4KGCD 3MGSD 1M18A 3UTAA 5AV8C 1EQZA 3KWQD 1KU5A 3W99D 3W99C 5GSUA 5CP6C 4KHAA 4QLCB 3AYWB 5AV6C 5AV6D 1P34D 5B1MC 1M18B 3UTAB 1EQZB 3WAAA 4XZQC 4XZQD 5AVBA 5B33A 5GSUB 1P3FA 3AFAA 3VH6W 4KHAB 4LD9A 4H9SC 4G91B 2AROD 3WAAB 5B31A 3AV1A 5AVBB 5B33B 4G92C 4KGCA 3A6ND 3MGSA 1P3FB 3AFAB 4LD9B 3KWQA 5F99C 3W99A 5B31B 3C1CC 3C1CD 3AV1B 3NQUA 3UT9C 3UT9D 5AV6A 4KGCB 5BNXA 3AV2D 1P34A 3MGSB 3AZHC 4R8PC 4XZQA 2HUEC 4NE3A 3KWQB 3W99B 1P3KD 2NQBC 3RELC 3RELD 3AZJC 3AZJD 3NQUB 5GT0C 5AV6B 5BNXB 3REID 1P34B 2AROA 1AOID 4WU8D 4WU8C 2NZDC 4NE6A 4XZQB 3VH6A 5B32C 3A6NA 5B1LC 2YFVA 2YFWA 2AROB 2F8NH 2F8ND 3C1CA 3UT9A 5AV9C 5AV9D 3AV2A 3A6NB 2PYOC 2PYOD 4UUZA 3MGQC 2YFVB 5BT1D 5BT1C 5B0ZD 5B0ZC 3X1TC 3REHD 1P3KA 4ZBJC 3KUYC 3C1CB 3RELA 3AZJA 3UT9B 4Z66D 4M6BA 4Z66C 3AV2B 3REIA 5B32G 3UTBD 1AOIA 4Z2MH 4WU8A 4UUZB 2HUEB 3W97C 3W97D 3AZFC 3AZFD 4QLCC 1P3KB 3VH5A 5CHLB 5AV5D 5AV5C 3RELB 3AZJB 3UTAC 1EQZC 3REIB 1AOIB 4WU8B 2F8NA 4CAYA 5GSUC 5AV9A 2PYOA 4XUJD 5G49A 1BH9A 4G91C 4H9NA 1B6WA 5B0ZA 3REHA 1S32C 1S32D 2F8NB 2F8NK 4CAYB 3NQJA 5AV9B 4Z66A 4WNNA 3UTBA 2PYOB 5G49B 5CPID 1BH9B 4H9NB 3W97A 1P3ID 3AZFA 1WWIA 5B0ZB 3AV1C 2HIOC 2HIOD 3REHB 4J8UD 5AV5A 3MGSC 3LJAD 3LZ1D 3NQJB 3LJAC 4Z66B 4WNNB 3UTBB 3KWQC 4H9PA 2IO5B 2BYMA 3W97B 3WKJD 3AZFB 4H9QA 5B40D 4CSRB 5E5AC 5E5AD 3B6FC 4XUJA 3B6FD 5BNVA 1P34C 5AV5B 3AZKD 1S32A 4H9PB 4J8VD 2BYMB 4H9QB 5B31G 4XUJB 5CPIA 5BNVB 2AROC 1P3IA 1KX4D 4Z5TD 2HIOA 5BS7A 4J8UA 5FUGA 1S32B 3B6GD 3B6GC 3R45A 3A6NC 3LJAA 3LZ1A 2FJ7D 1ZLAC 1ZLAD 3B0BA 5CPIB 5C3IC 1P3LC 5DNND 1P3LD 1P3IB 3WKJA 5B40A 2HIOB 5E5AA 4WZSB 3B6FA 4J8UB 5FUGB 4H9OA 3R45B 3AV2C 3WTPD 3LJAB 3LZ1B 3AZKA 3C1BC 3C1BD 4J8VA 3AZMD 4ZUXD 4ZUXC 3WKJB 1P3KC 5B40B 5E5AB 3B6FB 4H9OB 3REIC 1AOIC 3VH5W 4Z5TA 1KX4A 3MNNC 3MNND 3AZKB 3LZ0C 3LZ0D 3REJC 3REJD 3B6GA 4J8VB 1F66D 1F66C 5DNMD 2L5AA 2FJ7A 1ZLAA 4HGAC 1KX5D 1P3LA 5DNNA 4J8WD 4J8WC 4Z5TB 2BYKA 5CPKD 1JFIA 3AZLD 3REKD 3B6GB 3W98C 3W98D 1R4VA 3WTPA 2FJ7B 3C1BA 2YFWB 1ZLAB 5C3IB 3AZMA 5DNNB 1P3LB 4ZUXA 3REHC 2BYKB 4JJND 1JFIB 3TU4D 5AVCC 5AVCD 1P3OD 3AZGD 1P3PD 3WTPB 4EO5C 3UTBC 3MNNA 1KX3C 2IO5C 3C1BB 1KX3D 3LZ0A 3REJA 3AZMB 4ZUXB 1F66A 5DNMA 2F8NG 5JRGD 5JRGC 1KX5A 1P3MD 4J8WA
chains in the Genus database with same CATH superfamily
5CPKA 2ZY2A 3MNNB 3AZLA 2JSSA 3LZ0B 3REKA 3REJB 3W98A 5JA4A 1F66B 4XUJC 5DNMB 1M1AD 1TAFA 3WA9C 3WA9D 1HQ3C 1HQ3D 4HGAB 3MGRD 1KX5B 3H0MC 4J8WB 3LELD 5CPKB 4JJNA 3TU4A 3WTPE 3AZLB 4J8XD 5AVCA 3REKB 1P3OA 4WU9D 4DRBA 3AZGA 4WU9C 1P3PA 3W98B 5JA4B 4YM6D 1P3AD 4DQYB 3AZID 5CPIC 3AZIC 1KX3A 1TAFB 1P3IC 3B0DB 3F6TA 4H9RA 3VH6T 3B0CW 4X23C 5BS7C 4X23D 4J8UC 4JJNB 3TU4B 1Q9CA 5AVCB 3LZ1C 1P3OB 5JRGA 3AZGB 3AZEC 3AZED 5GXQD 5GXQC 1P3PB 3AN2D 2J8PA 5AY8C 5AY8D 2Y2MA 4EO5B 1P3BD 1P3MA 1KX3B 2Y2GA 3WKJC 2CWEA 4DRAA 5B40C 4H9RB 1M19C 1M19D 3MVDD 1M1AA 3WA9A 1F1EA 5JRGB 1HQ3A 3MGRA 3AZKC 1P3MB 3LELA 3MGPC 3MGPD 1TZYD 4J8VC 4J8XA 4WU9A 2RVQD 2RVQC 4YM6A 1P3AA 5AV8D 3AZIA 1M1AB 3WA9B 1KX4C 1HQ3B 4Z5TC 3MGRB 1W2EA 1BFMA 5CP6D 4X23A 3LELB 4J8XB 3VH5T 4WU9B 3AZEA 2FJ7C 5GXQA 3O62C 3O62D 5B1MD 3AN2A 4YM6B 5AY8A 1P3AB 1ID3C 1P3BA 1ID3D 3AZIB 1Z2CB 5DNNC 5B2JD 5B2JC 4NE5A 1M19A 4X23B 3MVDA 3WTPC 3AZEB 1ULYA 5GXQB 3AN2B 5AY8B 1P3BB 3MGPA 1TZYA 3AZMC 3W96C 3H0RC 3W96D 1M19B 5AV8A 5B24C 5B24D 5GT3D 5GT3C 3X1SD 3MVDB 3X1SC 4AWLB 5F99D 2ZY4A 5B2IC 5B2ID 5CP6A 1U35C 1U35D 3KFUG 3MGPB 5KDMA 1TZYB 1P3GC 1P3GD 5DNMC 3O62A 5B1MA 3AZHD 4R8PD 5AV8B 1ID3A 1KX5C 1WWSA 5B2JA 4E45A 1KX4B 5CPKC 3AZLC 5CP6B 3X1UC 3X1UD 3REKC 3KSYA 5KDMB 2NQBD 5CPJD 5CPJC 4NFTA 5GT0D 4H9SA 3O62B 5B1MB 3EG5B 2NZDD 1ID3B 3B0DC 5B2JB 3W96A 5B32D 4JJNC 3TU4C 3AZNC 3AZND 5B1LD 1P3OC 5B24A 3X1SA 5GT3A 3AZGC 4KUDD 1P3PC 4KUDC 5F99A 3KXBC 5B2IA 3KXBD 4YS3C 4YS3D 1U35A 2W8SA 3X1VC 3X1VD 1P3GA 2CV5C 4G92B 2CV5D 3W96B 3AZHA 4R8PA 5B24B 3X1SB 5GT3B 3MGQD 5B0YC 5B0YD 3B0CT 1P3MC 1H3OA 5F99B 5B2IB 3AL0C 3X1TD 3X1UA 1U35B 3KUYD 2NQBA 5CPJA 1N1JA 1P3GB 5GT0A 1M1AC 1PZRA 3AZHB 4R8PB 2NZDA 3MGRC 1HTAA 1B67A 1H3OB 4WV4B 1BH8A 5B32A 3LELC 5BO0A 4Z2MG 3A1IA 4QLCD 5B1LA 2G5IC 3X1UB 4J8XC 3AZNA 3AYWC 3AYWD 4KUDA 2NQBB 5CPJB 1N1JB 1M18D 2LY8A 4YM6C 3UTAD 1P3AC 1M18C 1EQZD 3V9RA 5GT0B 3KXBA 1A7WA 4YS3A 2NZDB 3X1VA 3EPHA 5GSUD 2CV5A 4E44A 1BH8B 5B32B 5BO0B 2G5HC 3AZNB 5B1LB 4KUDB 2RIQA 5B0YA 3MGQA 3AN2C 1P3BC 3WAAC 3V9RB 3KXBB 3WAAD 4YS3B 3X1TA 5AVBC 5AVBD 5B33D 5B33C 3KUYA 3X1VB 1P3FC 3A1KA 2CV5B 1P3FD 3AFAC 3AFAD 3MVDC 4AWLC 4LD9C 2XD1A 4LD9D 3MGQB 5B0YB 4CSRA 5B31C 5B31D 3AV1D 1TZYC 3X1TB 4QLCA 3AYWA 4ZBJB 3KUYB 4KGCC 4KGCD 3MGSD 1M18A 3UTAA 5AV8C 1EQZA 2Y2PA 3KWQD 1KU5A 3W99D 3W99C 5GSUA 5CP6C 4KHAA 4QLCB 3AYWB 5AV6C 5AV6D 1P34D 5B1MC 1M18B 3UTAB 1EQZB 3WAAA 4XZQC 4XZQD 5AVBA 2VQRA 5B33A 5GSUB 1P3FA 3AFAA 3VH6W 4KHAB 4LD9A 3EPKA 4H9SC 4G91B 4UPKA 2AROD 3WAAB 5B31A 3AV1A 5AVBB 5B33B 4G92C 4KGCA 3A6ND 3MGSA 1P3FB 3AFAB 2XD5A 4LD9B 3KWQA 5F99C 3P5JB 3W99A 5B31B 3C1CC 3C1CD 3AV1B 3NQUA 3UT9C 3UT9D 5AV6A 4KGCB 5BNXA 3AV2D 1P34A 3MGSB 3AZHC 4R8PC 4XZQA 2HUEC 4NE3A 3EPLA 3KWQB 3W99B 1P3KD 2Y2HA 2NQBC 3RELC 3RELD 3AZJC 3AZJD 3NQUB 5GT0C 5AV6B 5BNXB 3REID 1P34B 2AROA 1AOID 4WU8D 4WU8C 2NZDC 4NE6A 4XZQB 3VH6A 5B32C 3A6NA 5B1LC 2YFVA 2YFWA 2AROB 2F8NH 2F8ND 3C1CA 2Y2LA 3UT9A 5AV9C 5AV9D 3AV2A 3A6NB 2PYOC 2PYOD 4UUZA 3MGQC 2YFVB 5BT1D 5BT1C 5B0ZD 5B0ZC 3X1TC 3REHD 1P3KA 4ZBJC 3KUYC 3C1CB 3RELA 3AZJA 3UT9B 4Z66D 4M6BA 4Z66C 3AV2B 3REIA 5B32G 3UTBD 1AOIA 4Z2MH 4WU8A 2JCHA 4UUZB 2HUEB 3W97C 3W97D 3AZFC 3AZFD 4QLCC 1P3KB 3VH5A 3IP4C 5CHLB 5AV5D 5AV5C 3RELB 3AZJB 4WJ3C 3UTAC 1EQZC 3REIB 1AOIB 4WU8B 2F8NA 4CAYA 5GSUC 5AV9A 2PYOA 4XUJD 5G49A 1BH9A 4G91C 2ZY3A 4H9NA 1B6WA 2JE5A 5B0ZA 3REHA 1S32C 1S32D 2Y2KA 2F8NB 2F8NK 4CAYB 3NQJA 5AV9B 4Z66A 4WNNA 2ZY5A 3UTBA 2PYOB 5G49B 5CPID 1BH9B 3EPJA 4H9NB 3W97A 1P3ID 3AZFA 1WWIA 2Y2QA 5B0ZB 3AV1C 2HIOC 2HIOD 3REHB 4J8UD 5AV5A 3MGSC 3LJAD 3LZ1D 3NQJB 3LJAC 4Z66B 4WNNB 3UTBB 3KWQC 4H9PA 2IO5B 2BYMA 3W97B 3WKJD 3FDDA 3AZFB 4H9QA 5B40D 4CSRB 5E5AC 5E5AD 3B6FC 4XUJA 3B6FD 5BNVA 1P34C 5AV5B 3AZKD 1T3UA 1S32A 4H9PB 4J8VD 2BYMB 4H9QB 5B31G 4XUJB 5CPIA 5BNVB 2AROC 1P3IA 1KX4D 4Z5TD 2HIOA 5BS7A 4J8UA 5FUGA 1S32B 3B6GD 3B6GC 2Y2JA 3R45A 3A6NC 3LJAA 3LZ1A 2FJ7D 1ZLAC 1ZLAD 3B0BA 5CPIB 5C3IC 1P3LC 2Y2IA 5DNND 1P3LD 1P3IB 3WKJA 5B40A 2HIOB 5E5AA 4WZSB 3B6FA 4J8UB 3H0LC 5FUGB 4H9OA 2BG1A 3R45B 3WTPD 3AV2C 3LJAB 3LZ1B 3AZKA 3C1BC 3C1BD 4J8VA 3AZMD 4ZUXD 4ZUXC 3WKJB 1P3KC 5B40B 5E5AB 3B6FB 4H9OB 3REIC 1AOIC 2Y2NA 3VH5W 4Z5TA 1KX4A 3MNNC 3MNND 2Y2OA 3AZKB 3LZ0C 3LZ0D 3REJC 3REJD 3B6GA 4J8VB 1F66D 1F66C 5DNMD 2L5AA 2FJ7A 1ZLAA 4HGAC 1KX5D 1P3LA 5DNNA 4J8WD 4J8WC 4Z5TB 2BYKA 5CPKD 1JFIA 3AZLD 3REKD 3B6GB 3W98C 3W98D 1R4VA 3WTPA 2F2AC 2ZM5A 2FJ7B 3C1BA 2FFFB 2YFWB 1ZLAB 2DQNC 5C3IB 3AZMA 5DNNB 1P3LB 4ZUXA 3REHC 2BYKB 4JJND 1JFIB 3TU4D 5AVCC 5AVCD 1P3OD 3AZGD 1P3PD 2UWXA 3WTPB 4EO5C 3UTBC 3MNNA 1KX3C 2IO5C 3C1BB 1KX3D 3LZ0A 3REJA 3AZMB 4ZUXB 1F66A 5DNMA 2F8NG 5JRGD 5JRGC 1KX5A 1P3MD 4J8WA 2DF4C
chains in the Genus database with same CATH topology
5CPKA 2ZY2A 3MNNB 3AZLA 2JSSA 3LZ0B 3REKA 3REJB 3W98A 5JA4A 1F66B 4XUJC 5DNMB 1M1AD 1TAFA 3WA9C 3WA9D 1HQ3C 1HQ3D 4HGAB 3MGRD 1KX5B 3H0MC 4J8WB 3LELD 5CPKB 4JJNA 3TU4A 3WTPE 3AZLB 4J8XD 5AVCA 3REKB 1P3OA 4WU9D 4DRBA 3AZGA 4WU9C 1P3PA 3W98B 5JA4B 4YM6D 1P3AD 4DQYB 3AZID 5CPIC 3AZIC 1KX3A 1TAFB 1P3IC 3B0DB 3F6TA 4H9RA 3VH6T 3B0CW 4X23C 5BS7C 4X23D 4J8UC 4JJNB 3TU4B 1Q9CA 5AVCB 3LZ1C 1P3OB 5JRGA 3AZGB 3AZEC 3AZED 5GXQD 5GXQC 1P3PB 3AN2D 2J8PA 5AY8C 5AY8D 2Y2MA 4EO5B 1P3BD 1P3MA 1KX3B 2Y2GA 3WKJC 2CWEA 4DRAA 5B40C 4H9RB 1M19C 1M19D 3MVDD 1M1AA 3WA9A 1F1EA 5JRGB 1HQ3A 3MGRA 3AZKC 1P3MB 3LELA 3MGPC 3MGPD 1TZYD 4J8VC 4J8XA 4WU9A 2RVQD 2RVQC 4YM6A 1P3AA 5AV8D 3AZIA 1M1AB 3WA9B 1KX4C 1HQ3B 4Z5TC 3MGRB 1W2EA 1BFMA 5CP6D 4X23A 3LELB 4J8XB 3VH5T 4WU9B 3AZEA 2FJ7C 5GXQA 3O62C 3O62D 5B1MD 3AN2A 4YM6B 5AY8A 1P3AB 1ID3C 1P3BA 1ID3D 3AZIB 1Z2CB 5DNNC 5B2JD 5B2JC 4NE5A 1M19A 4X23B 3MVDA 3WTPC 3AZEB 1ULYA 5GXQB 3AN2B 5AY8B 1P3BB 3MGPA 1TZYA 3AZMC 3W96C 3H0RC 3W96D 1M19B 5AV8A 5B24C 5B24D 5GT3D 5GT3C 3X1SD 3MVDB 3X1SC 4AWLB 5F99D 2ZY4A 5B2IC 5B2ID 5CP6A 1U35C 1U35D 3KFUG 3MGPB 5KDMA 1TZYB 1P3GC 1P3GD 5DNMC 3O62A 5B1MA 3AZHD 4R8PD 5AV8B 1ID3A 1KX5C 1WWSA 5B2JA 4E45A 1KX4B 5CPKC 3AZLC 5CP6B 3X1UC 3X1UD 3REKC 3KSYA 5KDMB 2NQBD 5CPJD 5CPJC 4NFTA 5GT0D 4H9SA 3O62B 5B1MB 3EG5B 2NZDD 1ID3B 3B0DC 5B2JB 3W96A 5B32D 4JJNC 3TU4C 3AZNC 3AZND 5B1LD 1P3OC 5B24A 3X1SA 5GT3A 3AZGC 4KUDD 1P3PC 4KUDC 5F99A 3KXBC 5B2IA 3KXBD 4YS3C 4YS3D 1U35A 2W8SA 3X1VC 3X1VD 1P3GA 2CV5C 4G92B 2CV5D 3W96B 3AZHA 4R8PA 5B24B 3X1SB 5GT3B 3MGQD 5B0YC 5B0YD 3B0CT 1P3MC 1H3OA 5F99B 5B2IB 3AL0C 3X1TD 3X1UA 1U35B 3KUYD 2NQBA 5CPJA 1N1JA 1P3GB 5GT0A 1M1AC 1PZRA 3AZHB 4R8PB 2NZDA 3MGRC 1HTAA 1B67A 1H3OB 4WV4B 1BH8A 5B32A 3LELC 5BO0A 4Z2MG 3A1IA 4QLCD 5B1LA 2G5IC 3X1UB 4J8XC 3AZNA 3AYWC 3AYWD 4KUDA 2NQBB 5CPJB 1N1JB 1M18D 2LY8A 4YM6C 3UTAD 1P3AC 1M18C 1EQZD 3V9RA 5GT0B 3KXBA 1A7WA 4YS3A 2NZDB 3X1VA 3EPHA 5GSUD 2CV5A 4E44A 1BH8B 5B32B 5BO0B 2G5HC 3AZNB 5B1LB 4KUDB 2RIQA 5B0YA 3MGQA 3AN2C 1P3BC 3WAAC 3V9RB 3KXBB 3WAAD 4YS3B 3X1TA 5AVBC 5AVBD 5B33D 5B33C 3KUYA 3X1VB 1P3FC 3A1KA 2CV5B 1P3FD 3AFAC 3AFAD 3MVDC 4AWLC 4LD9C 2XD1A 4LD9D 3MGQB 5B0YB 4CSRA 5B31C 5B31D 3AV1D 1TZYC 3X1TB 4QLCA 3AYWA 4ZBJB 3KUYB 4KGCC 4KGCD 3MGSD 1M18A 3UTAA 5AV8C 1EQZA 2Y2PA 3KWQD 1KU5A 3W99D 3W99C 5GSUA 5CP6C 4KHAA 4QLCB 3AYWB 5AV6C 5AV6D 1P34D 5B1MC 1M18B 3UTAB 1EQZB 3WAAA 4XZQC 4XZQD 5AVBA 2VQRA 5B33A 5GSUB 1P3FA 3AFAA 3VH6W 4KHAB 4LD9A 3EPKA 4H9SC 4G91B 4UPKA 2AROD 3WAAB 5B31A 3AV1A 5AVBB 5B33B 4G92C 4KGCA 3A6ND 3MGSA 1P3FB 3AFAB 2XD5A 4LD9B 3KWQA 5F99C 3P5JB 3W99A 5B31B 3C1CC 3C1CD 3AV1B 3NQUA 3UT9C 3UT9D 5AV6A 4KGCB 5BNXA 3AV2D 1P34A 3MGSB 3AZHC 4R8PC 4XZQA 2HUEC 4NE3A 3EPLA 3KWQB 3W99B 1P3KD 2Y2HA 2NQBC 3RELC 3RELD 3AZJC 3AZJD 3NQUB 5GT0C 5AV6B 5BNXB 3REID 1P34B 2AROA 1AOID 4WU8D 4WU8C 2NZDC 4NE6A 4XZQB 3VH6A 5B32C 3A6NA 5B1LC 2YFVA 2YFWA 2AROB 2F8NH 2F8ND 3C1CA 2Y2LA 3UT9A 5AV9C 5AV9D 3AV2A 3A6NB 2PYOC 2PYOD 4UUZA 3MGQC 2YFVB 5BT1D 5BT1C 5B0ZD 5B0ZC 3X1TC 3REHD 1P3KA 4ZBJC 3KUYC 3C1CB 3RELA 3AZJA 3UT9B 4Z66D 4M6BA 4Z66C 3AV2B 3REIA 5B32G 3UTBD 1AOIA 4Z2MH 4WU8A 2JCHA 4UUZB 2HUEB 3W97C 3W97D 3AZFC 3AZFD 4QLCC 1P3KB 3VH5A 3IP4C 5CHLB 5AV5D 5AV5C 3RELB 3AZJB 4WJ3C 3UTAC 1EQZC 3REIB 1AOIB 4WU8B 2F8NA 4CAYA 5GSUC 5AV9A 2PYOA 4XUJD 5G49A 1BH9A 4G91C 2ZY3A 4H9NA 1B6WA 2JE5A 5B0ZA 3REHA 1S32C 1S32D 2Y2KA 2F8NB 2F8NK 4CAYB 3NQJA 5AV9B 4Z66A 4WNNA 2ZY5A 3UTBA 2PYOB 5G49B 5CPID 1BH9B 3EPJA 4H9NB 3W97A 1P3ID 3AZFA 1WWIA 2Y2QA 5B0ZB 3AV1C 2HIOC 2HIOD 3REHB 4J8UD 5AV5A 3MGSC 3LJAD 3LZ1D 3NQJB 3LJAC 4Z66B 4WNNB 3UTBB 3KWQC 4H9PA 2IO5B 2BYMA 3W97B 3WKJD 3FDDA 3AZFB 4H9QA 5B40D 4CSRB 5E5AC 5E5AD 3B6FC 4XUJA 3B6FD 5BNVA 1P34C 5AV5B 3AZKD 1T3UA 1S32A 4H9PB 4J8VD 2BYMB 4H9QB 5B31G 4XUJB 5CPIA 5BNVB 2AROC 1P3IA 1KX4D 4Z5TD 2HIOA 5BS7A 4J8UA 5FUGA 1S32B 3B6GD 3B6GC 2Y2JA 3R45A 3A6NC 3LJAA 3LZ1A 2FJ7D 1ZLAC 1ZLAD 3B0BA 5CPIB 5C3IC 1P3LC 2Y2IA 5DNND 1P3LD 1P3IB 3WKJA 5B40A 2HIOB 5E5AA 4WZSB 3B6FA 4J8UB 3H0LC 5FUGB 4H9OA 2BG1A 3R45B 3WTPD 3AV2C 3LJAB 3LZ1B 3AZKA 3C1BC 3C1BD 4J8VA 3AZMD 4ZUXD 4ZUXC 3WKJB 1P3KC 5B40B 5E5AB 3B6FB 4H9OB 3REIC 1AOIC 2Y2NA 3VH5W 4Z5TA 1KX4A 3MNNC 3MNND 2Y2OA 3AZKB 3LZ0C 3LZ0D 3REJC 3REJD 3B6GA 4J8VB 1F66D 1F66C 5DNMD 2L5AA 2FJ7A 1ZLAA 4HGAC 1KX5D 1P3LA 5DNNA 4J8WD 4J8WC 4Z5TB 2BYKA 5CPKD 1JFIA 3AZLD 3REKD 3B6GB 3W98C 3W98D 1R4VA 3WTPA 2F2AC 2ZM5A 2FJ7B 3C1BA 2FFFB 2YFWB 1ZLAB 2DQNC 5C3IB 3AZMA 5DNNB 1P3LB 4ZUXA 3REHC 2BYKB 4JJND 1JFIB 3TU4D 5AVCC 5AVCD 1P3OD 3AZGD 1P3PD 2UWXA 3WTPB 4EO5C 3UTBC 3MNNA 1KX3C 2IO5C 3C1BB 1KX3D 3LZ0A 3REJA 3AZMB 4ZUXB 1F66A 5DNMA 2F8NG 5JRGD 5JRGC 1KX5A 1P3MD 4J8WA 2DF4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPK A;  3MNN B;  3AZL A;  2JSS A;  3LZ0 B;  3REK A;  3REJ B;  3W98 A;  5JA4 A;  1F66 B;  4XUJ C;  5DNM B;  1M1A D;  1TAF A;  3WA9 C;  3WA9 D;  1HQ3 C;  1HQ3 D;  4HGA B;  3MGR D;  1KX5 B;  4J8W B;  3LEL D;  5CPK B;  4JJN A;  3TU4 A;  3WTP E;  3AZL B;  4J8X D;  5AVC A;  3REK B;  1P3O A;  4WU9 D;  4DRB A;  3AZG A;  4WU9 C;  1P3P A;  3W98 B;  5JA4 B;  4YM6 D;  1P3A D;  3AZI D;  5CPI C;  3AZI C;  1KX3 A;  1TAF B;  1P3I C;  3B0D B;  4H9R A;  3VH6 T;  3B0C W;  4X23 C;  5BS7 C;  4X23 D;  4J8U C;  4JJN B;  3TU4 B;  1Q9C A;  5AVC B;  3LZ1 C;  1P3O B;  5JRG A;  3AZG B;  3AZE C;  3AZE D;  5GXQ D;  5GXQ C;  1P3P B;  3AN2 D;  5AY8 C;  5AY8 D;  4EO5 B;  1P3B D;  1P3M A;  1KX3 B;  3WKJ C;  2CWE A;  4DRA A;  5B40 C;  4H9R B;  1M19 C;  1M19 D;  3MVD D;  1M1A A;  3WA9 A;  1F1E A;  1HQ3 A;  5JRG B;  3MGR A;  3AZK C;  1P3M B;  3LEL A;  3MGP C;  3MGP D;  1TZY D;  4J8V C;  4J8X A;  4WU9 A;  2RVQ D;  2RVQ C;  4YM6 A;  1P3A A;  5AV8 D;  3AZI A;  1M1A B;  3WA9 B;  1KX4 C;  1HQ3 B;  4Z5T C;  3MGR B;  1BFM A;  5CP6 D;  4X23 A;  3LEL B;  4J8X B;  3VH5 T;  4WU9 B;  3AZE A;  2FJ7 C;  5GXQ A;  3O62 C;  3O62 D;  5B1M D;  3AN2 A;  4YM6 B;  5AY8 A;  1P3A B;  1ID3 C;  1P3B A;  1ID3 D;  3AZI B;  5DNN C;  5B2J D;  5B2J C;  4NE5 A;  1M19 A;  4X23 B;  3MVD A;  3WTP C;  3AZE B;  1ULY A;  5GXQ B;  3AN2 B;  5AY8 B;  1P3B B;  3MGP A;  1TZY A;  3AZM C;  3W96 C;  3W96 D;  1M19 B;  5AV8 A;  5B24 D;  3X1S D;  5B24 C;  5GT3 D;  5GT3 C;  3MVD B;  3X1S C;  4AWL B;  5F99 D;  5B2I C;  5B2I D;  5CP6 A;  1U35 C;  1U35 D;  3MGP B;  5KDM A;  1TZY B;  1P3G C;  1P3G D;  5DNM C;  3O62 A;  5B1M A;  3AZH D;  4R8P D;  5AV8 B;  1ID3 A;  1KX5 C;  1WWS A;  5B2J A;  4E45 A;  1KX4 B;  5CPK C;  3AZL C;  5CP6 B;  3X1U C;  3X1U D;  3REK C;  3KSY A;  5KDM B;  2NQB D;  5CPJ D;  5CPJ C;  4NFT A;  5GT0 D;  4H9S A;  3O62 B;  5B1M B;  2NZD D;  1ID3 B;  3B0D C;  5B2J B;  3W96 A;  5B32 D;  4JJN C;  3TU4 C;  3AZN C;  3AZN D;  5B1L D;  1P3O C;  5B24 A;  3X1S A;  5GT3 A;  3AZG C;  4KUD D;  1P3P C;  4KUD C;  5F99 A;  3KXB C;  5B2I A;  3KXB D;  4YS3 C;  4YS3 D;  1U35 A;  3X1V C;  3X1V D;  1P3G A;  2CV5 C;  4G92 B;  2CV5 D;  3W96 B;  3AZH A;  4R8P A;  5B24 B;  3X1S B;  5GT3 B;  3MGQ D;  5B0Y C;  5B0Y D;  3B0C T;  1P3M C;  1H3O A;  5F99 B;  5B2I B;  3X1T D;  3X1U A;  1U35 B;  3KUY D;  2NQB A;  5CPJ A;  1N1J A;  1P3G B;  5GT0 A;  1M1A C;  3AZH B;  4R8P B;  2NZD A;  3MGR C;  1HTA A;  1B67 A;  1H3O B;  4WV4 B;  1BH8 A;  5B32 A;  3LEL C;  5BO0 A;  4Z2M G;  4QLC D;  3X1U B;  5B1L A;  4J8X C;  3AZN A;  3AYW C;  3AYW D;  4KUD A;  2NQB B;  5CPJ B;  1N1J B;  1M18 D;  2LY8 A;  4YM6 C;  3UTA D;  1P3A C;  1M18 C;  1EQZ D;  3V9R A;  5GT0 B;  3KXB A;  1A7W A;  4YS3 A;  2NZD B;  3X1V A;  5GSU D;  2CV5 A;  4E44 A;  1BH8 B;  5B32 B;  5BO0 B;  3AZN B;  5B1L B;  4KUD B;  3MGQ A;  5B0Y A;  3AN2 C;  1P3B C;  3WAA C;  3V9R B;  3KXB B;  3WAA D;  4YS3 B;  3X1T A;  5AVB C;  5AVB D;  5B33 D;  5B33 C;  3KUY A;  3X1V B;  1P3F C;  2CV5 B;  1P3F D;  3AFA C;  3AFA D;  3MVD C;  4AWL C;  4LD9 C;  4LD9 D;  3MGQ B;  5B0Y B;  4CSR A;  5B31 C;  5B31 D;  3AV1 D;  1TZY C;  3X1T B;  4QLC A;  3AYW A;  4ZBJ B;  3KUY B;  4KGC C;  4KGC D;  3MGS D;  1M18 A;  3UTA A;  5AV8 C;  1EQZ A;  3KWQ D;  1KU5 A;  3W99 D;  3W99 C;  5GSU A;  5CP6 C;  4KHA A;  4QLC B;  3AYW B;  5AV6 C;  5AV6 D;  1P34 D;  5B1M C;  1M18 B;  3UTA B;  1EQZ B;  3WAA A;  4XZQ C;  4XZQ D;  5AVB A;  5B33 A;  5GSU B;  1P3F A;  3AFA A;  3VH6 W;  4KHA B;  4LD9 A;  4H9S C;  4G91 B;  2ARO D;  3WAA B;  5B31 A;  3AV1 A;  5AVB B;  5B33 B;  4G92 C;  4KGC A;  3A6N D;  3MGS A;  1P3F B;  3AFA B;  4LD9 B;  3KWQ A;  5F99 C;  3W99 A;  5B31 B;  3C1C C;  3C1C D;  3AV1 B;  3NQU A;  3UT9 C;  3UT9 D;  5AV6 A;  4KGC B;  5BNX A;  3AV2 D;  1P34 A;  3MGS B;  3AZH C;  4R8P C;  4XZQ A;  2HUE C;  4NE3 A;  3KWQ B;  3W99 B;  1P3K D;  2NQB C;  3REL C;  3REL D;  3AZJ C;  3AZJ D;  3NQU B;  5GT0 C;  5AV6 B;  5BNX B;  3REI D;  1P34 B;  2ARO A;  1AOI D;  4WU8 D;  4WU8 C;  2NZD C;  4NE6 A;  4XZQ B;  3VH6 A;  5B32 C;  3A6N A;  5B1L C;  2YFV A;  2YFW A;  2ARO B;  2F8N H;  2F8N D;  3C1C A;  3UT9 A;  5AV9 C;  5AV9 D;  3AV2 A;  3A6N B;  2PYO C;  2PYO D;  4UUZ A;  3MGQ C;  2YFV B;  5BT1 D;  5BT1 C;  5B0Z D;  5B0Z C;  3X1T C;  3REH D;  1P3K A;  4ZBJ C;  3KUY C;  3C1C B;  3REL A;  3AZJ A;  3UT9 B;  4Z66 D;  4M6B A;  4Z66 C;  3AV2 B;  3REI A;  5B32 G;  3UTB D;  1AOI A;  4Z2M H;  4WU8 A;  4UUZ B;  2HUE B;  3W97 C;  3W97 D;  3AZF C;  3AZF D;  4QLC C;  1P3K B;  3VH5 A;  5CHL B;  5AV5 D;  5AV5 C;  3REL B;  3AZJ B;  3UTA C;  1EQZ C;  3REI B;  1AOI B;  4WU8 B;  2F8N A;  4CAY A;  5GSU C;  5AV9 A;  2PYO A;  4XUJ D;  5G49 A;  1BH9 A;  4G91 C;  4H9N A;  1B6W A;  5B0Z A;  3REH A;  1S32 C;  1S32 D;  2F8N B;  2F8N K;  4CAY B;  3NQJ A;  5AV9 B;  4Z66 A;  4WNN A;  3UTB A;  2PYO B;  5G49 B;  5CPI D;  1BH9 B;  4H9N B;  3W97 A;  1P3I D;  3AZF A;  1WWI A;  5B0Z B;  3AV1 C;  2HIO C;  2HIO D;  3REH B;  4J8U D;  5AV5 A;  3MGS C;  3LJA D;  3LZ1 D;  3NQJ B;  3LJA C;  4Z66 B;  4WNN B;  3UTB B;  3KWQ C;  4H9P A;  2IO5 B;  2BYM A;  3W97 B;  3WKJ D;  3AZF B;  4H9Q A;  5B40 D;  4CSR B;  5E5A C;  5E5A D;  3B6F C;  4XUJ A;  3B6F D;  5BNV A;  1P34 C;  5AV5 B;  3AZK D;  1S32 A;  4H9P B;  4J8V D;  2BYM B;  4H9Q B;  5B31 G;  4XUJ B;  5CPI A;  5BNV B;  2ARO C;  1P3I A;  1KX4 D;  4Z5T D;  2HIO A;  5BS7 A;  4J8U A;  5FUG A;  1S32 B;  3B6G D;  3B6G C;  3R45 A;  3A6N C;  3LJA A;  3LZ1 A;  2FJ7 D;  1ZLA C;  1ZLA D;  3B0B A;  5CPI B;  5C3I C;  1P3L C;  5DNN D;  1P3L D;  1P3I B;  3WKJ A;  5B40 A;  2HIO B;  5E5A A;  4WZS B;  3B6F A;  4J8U B;  5FUG B;  4H9O A;  3R45 B;  3AV2 C;  3WTP D;  3LJA B;  3LZ1 B;  3AZK A;  3C1B C;  3C1B D;  4J8V A;  3AZM D;  4ZUX D;  4ZUX C;  3WKJ B;  1P3K C;  5B40 B;  5E5A B;  3B6F B;  4H9O B;  3REI C;  1AOI C;  3VH5 W;  4Z5T A;  1KX4 A;  3MNN C;  3MNN D;  3AZK B;  3LZ0 C;  3LZ0 D;  3REJ C;  3REJ D;  3B6G A;  4J8V B;  1F66 D;  1F66 C;  5DNM D;  2L5A A;  2FJ7 A;  1ZLA A;  4HGA C;  1KX5 D;  1P3L A;  5DNN A;  4J8W D;  4J8W C;  4Z5T B;  2BYK A;  5CPK D;  1JFI A;  3AZL D;  3REK D;  3B6G B;  3W98 C;  3W98 D;  1R4V A;  3WTP A;  2FJ7 B;  3C1B A;  2YFW B;  1ZLA B;  5C3I B;  3AZM A;  5DNN B;  1P3L B;  4ZUX A;  3REH C;  2BYK B;  4JJN D;  1JFI B;  3TU4 D;  5AVC C;  5AVC D;  1P3O D;  3AZG D;  1P3P D;  3WTP B;  4EO5 C;  3UTB C;  3MNN A;  1KX3 C;  2IO5 C;  3C1B B;  1KX3 D;  3LZ0 A;  3REJ A;  3AZM B;  4ZUX B;  1F66 A;  5DNM A;  2F8N G;  5JRG D;  5JRG C;  1KX5 A;  1P3M D;  4J8W A; 
#chains in the Genus database with same CATH topology
 5CPK A;  2ZY2 A;  3MNN B;  3AZL A;  2JSS A;  3LZ0 B;  3REK A;  3REJ B;  3W98 A;  5JA4 A;  1F66 B;  4XUJ C;  5DNM B;  1M1A D;  1TAF A;  3WA9 C;  3WA9 D;  1HQ3 C;  1HQ3 D;  4HGA B;  3MGR D;  1KX5 B;  3H0M C;  4J8W B;  3LEL D;  5CPK B;  4JJN A;  3TU4 A;  3WTP E;  3AZL B;  4J8X D;  5AVC A;  3REK B;  1P3O A;  4WU9 D;  4DRB A;  3AZG A;  4WU9 C;  1P3P A;  3W98 B;  5JA4 B;  4YM6 D;  1P3A D;  4DQY B;  3AZI D;  5CPI C;  3AZI C;  1KX3 A;  1TAF B;  1P3I C;  3B0D B;  3F6T A;  4H9R A;  3VH6 T;  3B0C W;  4X23 C;  5BS7 C;  4X23 D;  4J8U C;  4JJN B;  3TU4 B;  1Q9C A;  5AVC B;  3LZ1 C;  1P3O B;  5JRG A;  3AZG B;  3AZE C;  3AZE D;  5GXQ D;  5GXQ C;  1P3P B;  3AN2 D;  2J8P A;  5AY8 C;  5AY8 D;  2Y2M A;  4EO5 B;  1P3B D;  1P3M A;  1KX3 B;  2Y2G A;  3WKJ C;  2CWE A;  4DRA A;  5B40 C;  4H9R B;  1M19 C;  1M19 D;  3MVD D;  1M1A A;  3WA9 A;  1F1E A;  5JRG B;  1HQ3 A;  3MGR A;  3AZK C;  1P3M B;  3LEL A;  3MGP C;  3MGP D;  1TZY D;  4J8V C;  4J8X A;  4WU9 A;  2RVQ D;  2RVQ C;  4YM6 A;  1P3A A;  5AV8 D;  3AZI A;  1M1A B;  3WA9 B;  1KX4 C;  1HQ3 B;  4Z5T C;  3MGR B;  1W2E A;  1BFM A;  5CP6 D;  4X23 A;  3LEL B;  4J8X B;  3VH5 T;  4WU9 B;  3AZE A;  2FJ7 C;  5GXQ A;  3O62 C;  3O62 D;  5B1M D;  3AN2 A;  4YM6 B;  5AY8 A;  1P3A B;  1ID3 C;  1P3B A;  1ID3 D;  3AZI B;  1Z2C B;  5DNN C;  5B2J D;  5B2J C;  4NE5 A;  1M19 A;  4X23 B;  3MVD A;  3WTP C;  3AZE B;  1ULY A;  5GXQ B;  3AN2 B;  5AY8 B;  1P3B B;  3MGP A;  1TZY A;  3AZM C;  3W96 C;  3H0R C;  3W96 D;  1M19 B;  5AV8 A;  5B24 C;  5B24 D;  5GT3 D;  5GT3 C;  3X1S D;  3MVD B;  3X1S C;  4AWL B;  5F99 D;  2ZY4 A;  5B2I C;  5B2I D;  5CP6 A;  1U35 C;  1U35 D;  3KFU G;  3MGP B;  5KDM A;  1TZY B;  1P3G C;  1P3G D;  5DNM C;  3O62 A;  5B1M A;  3AZH D;  4R8P D;  5AV8 B;  1ID3 A;  1KX5 C;  1WWS A;  5B2J A;  4E45 A;  1KX4 B;  5CPK C;  3AZL C;  5CP6 B;  3X1U C;  3X1U D;  3REK C;  3KSY A;  5KDM B;  2NQB D;  5CPJ D;  5CPJ C;  4NFT A;  5GT0 D;  4H9S A;  3O62 B;  5B1M B;  3EG5 B;  2NZD D;  1ID3 B;  3B0D C;  5B2J B;  3W96 A;  5B32 D;  4JJN C;  3TU4 C;  3AZN C;  3AZN D;  5B1L D;  1P3O C;  5B24 A;  3X1S A;  5GT3 A;  3AZG C;  4KUD D;  1P3P C;  4KUD C;  5F99 A;  3KXB C;  5B2I A;  3KXB D;  4YS3 C;  4YS3 D;  1U35 A;  2W8S A;  3X1V C;  3X1V D;  1P3G A;  2CV5 C;  4G92 B;  2CV5 D;  3W96 B;  3AZH A;  4R8P A;  5B24 B;  3X1S B;  5GT3 B;  3MGQ D;  5B0Y C;  5B0Y D;  3B0C T;  1P3M C;  1H3O A;  5F99 B;  5B2I B;  3AL0 C;  3X1T D;  3X1U A;  1U35 B;  3KUY D;  2NQB A;  5CPJ A;  1N1J A;  1P3G B;  5GT0 A;  1M1A C;  1PZR A;  3AZH B;  4R8P B;  2NZD A;  3MGR C;  1HTA A;  1B67 A;  1H3O B;  4WV4 B;  1BH8 A;  5B32 A;  3LEL C;  5BO0 A;  4Z2M G;  3A1I A;  4QLC D;  5B1L A;  2G5I C;  3X1U B;  4J8X C;  3AZN A;  3AYW C;  3AYW D;  4KUD A;  2NQB B;  5CPJ B;  1N1J B;  1M18 D;  2LY8 A;  4YM6 C;  3UTA D;  1P3A C;  1M18 C;  1EQZ D;  3V9R A;  5GT0 B;  3KXB A;  1A7W A;  4YS3 A;  2NZD B;  3X1V A;  3EPH A;  5GSU D;  2CV5 A;  4E44 A;  1BH8 B;  5B32 B;  5BO0 B;  2G5H C;  3AZN B;  5B1L B;  4KUD B;  2RIQ A;  5B0Y A;  3MGQ A;  3AN2 C;  1P3B C;  3WAA C;  3V9R B;  3KXB B;  3WAA D;  4YS3 B;  3X1T A;  5AVB C;  5AVB D;  5B33 D;  5B33 C;  3KUY A;  3X1V B;  1P3F C;  3A1K A;  2CV5 B;  1P3F D;  3AFA C;  3AFA D;  3MVD C;  4AWL C;  4LD9 C;  2XD1 A;  4LD9 D;  3MGQ B;  5B0Y B;  4CSR A;  5B31 C;  5B31 D;  3AV1 D;  1TZY C;  3X1T B;  4QLC A;  3AYW A;  4ZBJ B;  3KUY B;  4KGC C;  4KGC D;  3MGS D;  1M18 A;  3UTA A;  5AV8 C;  1EQZ A;  2Y2P A;  3KWQ D;  1KU5 A;  3W99 D;  3W99 C;  5GSU A;  5CP6 C;  4KHA A;  4QLC B;  3AYW B;  5AV6 C;  5AV6 D;  1P34 D;  5B1M C;  1M18 B;  3UTA B;  1EQZ B;  3WAA A;  4XZQ C;  4XZQ D;  5AVB A;  2VQR A;  5B33 A;  5GSU B;  1P3F A;  3AFA A;  3VH6 W;  4KHA B;  4LD9 A;  3EPK A;  4H9S C;  4G91 B;  4UPK A;  2ARO D;  3WAA B;  5B31 A;  3AV1 A;  5AVB B;  5B33 B;  4G92 C;  4KGC A;  3A6N D;  3MGS A;  1P3F B;  3AFA B;  2XD5 A;  4LD9 B;  3KWQ A;  5F99 C;  3P5J B;  3W99 A;  5B31 B;  3C1C C;  3C1C D;  3AV1 B;  3NQU A;  3UT9 C;  3UT9 D;  5AV6 A;  4KGC B;  5BNX A;  3AV2 D;  1P34 A;  3MGS B;  3AZH C;  4R8P C;  4XZQ A;  2HUE C;  4NE3 A;  3EPL A;  3KWQ B;  3W99 B;  1P3K D;  2Y2H A;  2NQB C;  3REL C;  3REL D;  3AZJ C;  3AZJ D;  3NQU B;  5GT0 C;  5AV6 B;  5BNX B;  3REI D;  1P34 B;  2ARO A;  1AOI D;  4WU8 D;  4WU8 C;  2NZD C;  4NE6 A;  4XZQ B;  3VH6 A;  5B32 C;  3A6N A;  5B1L C;  2YFV A;  2YFW A;  2ARO B;  2F8N H;  2F8N D;  3C1C A;  2Y2L A;  3UT9 A;  5AV9 C;  5AV9 D;  3AV2 A;  3A6N B;  2PYO C;  2PYO D;  4UUZ A;  3MGQ C;  2YFV B;  5BT1 D;  5BT1 C;  5B0Z D;  5B0Z C;  3X1T C;  3REH D;  1P3K A;  4ZBJ C;  3KUY C;  3C1C B;  3REL A;  3AZJ A;  3UT9 B;  4Z66 D;  4M6B A;  4Z66 C;  3AV2 B;  3REI A;  5B32 G;  3UTB D;  1AOI A;  4Z2M H;  4WU8 A;  2JCH A;  4UUZ B;  2HUE B;  3W97 C;  3W97 D;  3AZF C;  3AZF D;  4QLC C;  1P3K B;  3VH5 A;  3IP4 C;  5CHL B;  5AV5 D;  5AV5 C;  3REL B;  3AZJ B;  4WJ3 C;  3UTA C;  1EQZ C;  3REI B;  1AOI B;  4WU8 B;  2F8N A;  4CAY A;  5GSU C;  5AV9 A;  2PYO A;  4XUJ D;  5G49 A;  1BH9 A;  4G91 C;  2ZY3 A;  4H9N A;  1B6W A;  2JE5 A;  5B0Z A;  3REH A;  1S32 C;  1S32 D;  2Y2K A;  2F8N B;  2F8N K;  4CAY B;  3NQJ A;  5AV9 B;  4Z66 A;  4WNN A;  2ZY5 A;  3UTB A;  2PYO B;  5G49 B;  5CPI D;  1BH9 B;  3EPJ A;  4H9N B;  3W97 A;  1P3I D;  3AZF A;  1WWI A;  2Y2Q A;  5B0Z B;  3AV1 C;  2HIO C;  2HIO D;  3REH B;  4J8U D;  5AV5 A;  3MGS C;  3LJA D;  3LZ1 D;  3NQJ B;  3LJA C;  4Z66 B;  4WNN B;  3UTB B;  3KWQ C;  4H9P A;  2IO5 B;  2BYM A;  3W97 B;  3WKJ D;  3FDD A;  3AZF B;  4H9Q A;  5B40 D;  4CSR B;  5E5A C;  5E5A D;  3B6F C;  4XUJ A;  3B6F D;  5BNV A;  1P34 C;  5AV5 B;  3AZK D;  1T3U A;  1S32 A;  4H9P B;  4J8V D;  2BYM B;  4H9Q B;  5B31 G;  4XUJ B;  5CPI A;  5BNV B;  2ARO C;  1P3I A;  1KX4 D;  4Z5T D;  2HIO A;  5BS7 A;  4J8U A;  5FUG A;  1S32 B;  3B6G D;  3B6G C;  2Y2J A;  3R45 A;  3A6N C;  3LJA A;  3LZ1 A;  2FJ7 D;  1ZLA C;  1ZLA D;  3B0B A;  5CPI B;  5C3I C;  1P3L C;  2Y2I A;  5DNN D;  1P3L D;  1P3I B;  3WKJ A;  5B40 A;  2HIO B;  5E5A A;  4WZS B;  3B6F A;  4J8U B;  3H0L C;  5FUG B;  4H9O A;  2BG1 A;  3R45 B;  3WTP D;  3AV2 C;  3LJA B;  3LZ1 B;  3AZK A;  3C1B C;  3C1B D;  4J8V A;  3AZM D;  4ZUX D;  4ZUX C;  3WKJ B;  1P3K C;  5B40 B;  5E5A B;  3B6F B;  4H9O B;  3REI C;  1AOI C;  2Y2N A;  3VH5 W;  4Z5T A;  1KX4 A;  3MNN C;  3MNN D;  2Y2O A;  3AZK B;  3LZ0 C;  3LZ0 D;  3REJ C;  3REJ D;  3B6G A;  4J8V B;  1F66 D;  1F66 C;  5DNM D;  2L5A A;  2FJ7 A;  1ZLA A;  4HGA C;  1KX5 D;  1P3L A;  5DNN A;  4J8W D;  4J8W C;  4Z5T B;  2BYK A;  5CPK D;  1JFI A;  3AZL D;  3REK D;  3B6G B;  3W98 C;  3W98 D;  1R4V A;  3WTP A;  2F2A C;  2ZM5 A;  2FJ7 B;  3C1B A;  2FFF B;  2YFW B;  1ZLA B;  2DQN C;  5C3I B;  3AZM A;  5DNN B;  1P3L B;  4ZUX A;  3REH C;  2BYK B;  4JJN D;  1JFI B;  3TU4 D;  5AVC C;  5AVC D;  1P3O D;  3AZG D;  1P3P D;  2UWX A;  3WTP B;  4EO5 C;  3UTB C;  3MNN A;  1KX3 C;  2IO5 C;  3C1B B;  1KX3 D;  3LZ0 A;  3REJ A;  3AZM B;  4ZUX B;  1F66 A;  5DNM A;  2F8N G;  5JRG D;  5JRG C;  1KX5 A;  1P3M D;  4J8W A;  2DF4 C; 
#chains in the Genus database with same CATH homology
 5CPK A;  2ZY2 A;  3MNN B;  3AZL A;  2JSS A;  3LZ0 B;  3REK A;  3REJ B;  3W98 A;  5JA4 A;  1F66 B;  4XUJ C;  5DNM B;  1M1A D;  1TAF A;  3WA9 C;  3WA9 D;  1HQ3 C;  1HQ3 D;  4HGA B;  3MGR D;  1KX5 B;  3H0M C;  4J8W B;  3LEL D;  5CPK B;  4JJN A;  3TU4 A;  3WTP E;  3AZL B;  4J8X D;  5AVC A;  3REK B;  1P3O A;  4WU9 D;  4DRB A;  3AZG A;  4WU9 C;  1P3P A;  3W98 B;  5JA4 B;  4YM6 D;  1P3A D;  4DQY B;  3AZI D;  5CPI C;  3AZI C;  1KX3 A;  1TAF B;  1P3I C;  3B0D B;  3F6T A;  4H9R A;  3VH6 T;  3B0C W;  4X23 C;  5BS7 C;  4X23 D;  4J8U C;  4JJN B;  3TU4 B;  1Q9C A;  5AVC B;  3LZ1 C;  1P3O B;  5JRG A;  3AZG B;  3AZE C;  3AZE D;  5GXQ D;  5GXQ C;  1P3P B;  3AN2 D;  2J8P A;  5AY8 C;  5AY8 D;  2Y2M A;  4EO5 B;  1P3B D;  1P3M A;  1KX3 B;  2Y2G A;  3WKJ C;  2CWE A;  4DRA A;  5B40 C;  4H9R B;  1M19 C;  1M19 D;  3MVD D;  1M1A A;  3WA9 A;  1F1E A;  5JRG B;  1HQ3 A;  3MGR A;  3AZK C;  1P3M B;  3LEL A;  3MGP C;  3MGP D;  1TZY D;  4J8V C;  4J8X A;  4WU9 A;  2RVQ D;  2RVQ C;  4YM6 A;  1P3A A;  5AV8 D;  3AZI A;  1M1A B;  3WA9 B;  1KX4 C;  1HQ3 B;  4Z5T C;  3MGR B;  1W2E A;  1BFM A;  5CP6 D;  4X23 A;  3LEL B;  4J8X B;  3VH5 T;  4WU9 B;  3AZE A;  2FJ7 C;  5GXQ A;  3O62 C;  3O62 D;  5B1M D;  3AN2 A;  4YM6 B;  5AY8 A;  1P3A B;  1ID3 C;  1P3B A;  1ID3 D;  3AZI B;  1Z2C B;  5DNN C;  5B2J D;  5B2J C;  4NE5 A;  1M19 A;  4X23 B;  3MVD A;  3WTP C;  3AZE B;  1ULY A;  5GXQ B;  3AN2 B;  5AY8 B;  1P3B B;  3MGP A;  1TZY A;  3AZM C;  3W96 C;  3H0R C;  3W96 D;  1M19 B;  5AV8 A;  5B24 C;  5B24 D;  5GT3 D;  5GT3 C;  3X1S D;  3MVD B;  3X1S C;  4AWL B;  5F99 D;  2ZY4 A;  5B2I C;  5B2I D;  5CP6 A;  1U35 C;  1U35 D;  3KFU G;  3MGP B;  5KDM A;  1TZY B;  1P3G C;  1P3G D;  5DNM C;  3O62 A;  5B1M A;  3AZH D;  4R8P D;  5AV8 B;  1ID3 A;  1KX5 C;  1WWS A;  5B2J A;  4E45 A;  1KX4 B;  5CPK C;  3AZL C;  5CP6 B;  3X1U C;  3X1U D;  3REK C;  3KSY A;  5KDM B;  2NQB D;  5CPJ D;  5CPJ C;  4NFT A;  5GT0 D;  4H9S A;  3O62 B;  5B1M B;  3EG5 B;  2NZD D;  1ID3 B;  3B0D C;  5B2J B;  3W96 A;  5B32 D;  4JJN C;  3TU4 C;  3AZN C;  3AZN D;  5B1L D;  1P3O C;  5B24 A;  3X1S A;  5GT3 A;  3AZG C;  4KUD D;  1P3P C;  4KUD C;  5F99 A;  3KXB C;  5B2I A;  3KXB D;  4YS3 C;  4YS3 D;  1U35 A;  2W8S A;  3X1V C;  3X1V D;  1P3G A;  2CV5 C;  4G92 B;  2CV5 D;  3W96 B;  3AZH A;  4R8P A;  5B24 B;  3X1S B;  5GT3 B;  3MGQ D;  5B0Y C;  5B0Y D;  3B0C T;  1P3M C;  1H3O A;  5F99 B;  5B2I B;  3AL0 C;  3X1T D;  3X1U A;  1U35 B;  3KUY D;  2NQB A;  5CPJ A;  1N1J A;  1P3G B;  5GT0 A;  1M1A C;  1PZR A;  3AZH B;  4R8P B;  2NZD A;  3MGR C;  1HTA A;  1B67 A;  1H3O B;  4WV4 B;  1BH8 A;  5B32 A;  3LEL C;  5BO0 A;  4Z2M G;  3A1I A;  4QLC D;  5B1L A;  2G5I C;  3X1U B;  4J8X C;  3AZN A;  3AYW C;  3AYW D;  4KUD A;  2NQB B;  5CPJ B;  1N1J B;  1M18 D;  2LY8 A;  4YM6 C;  3UTA D;  1P3A C;  1M18 C;  1EQZ D;  3V9R A;  5GT0 B;  3KXB A;  1A7W A;  4YS3 A;  2NZD B;  3X1V A;  3EPH A;  5GSU D;  2CV5 A;  4E44 A;  1BH8 B;  5B32 B;  5BO0 B;  2G5H C;  3AZN B;  5B1L B;  4KUD B;  2RIQ A;  5B0Y A;  3MGQ A;  3AN2 C;  1P3B C;  3WAA C;  3V9R B;  3KXB B;  3WAA D;  4YS3 B;  3X1T A;  5AVB C;  5AVB D;  5B33 D;  5B33 C;  3KUY A;  3X1V B;  1P3F C;  3A1K A;  2CV5 B;  1P3F D;  3AFA C;  3AFA D;  3MVD C;  4AWL C;  4LD9 C;  2XD1 A;  4LD9 D;  3MGQ B;  5B0Y B;  4CSR A;  5B31 C;  5B31 D;  3AV1 D;  1TZY C;  3X1T B;  4QLC A;  3AYW A;  4ZBJ B;  3KUY B;  4KGC C;  4KGC D;  3MGS D;  1M18 A;  3UTA A;  5AV8 C;  1EQZ A;  2Y2P A;  3KWQ D;  1KU5 A;  3W99 D;  3W99 C;  5GSU A;  5CP6 C;  4KHA A;  4QLC B;  3AYW B;  5AV6 C;  5AV6 D;  1P34 D;  5B1M C;  1M18 B;  3UTA B;  1EQZ B;  3WAA A;  4XZQ C;  4XZQ D;  5AVB A;  2VQR A;  5B33 A;  5GSU B;  1P3F A;  3AFA A;  3VH6 W;  4KHA B;  4LD9 A;  3EPK A;  4H9S C;  4G91 B;  4UPK A;  2ARO D;  3WAA B;  5B31 A;  3AV1 A;  5AVB B;  5B33 B;  4G92 C;  4KGC A;  3A6N D;  3MGS A;  1P3F B;  3AFA B;  2XD5 A;  4LD9 B;  3KWQ A;  5F99 C;  3P5J B;  3W99 A;  5B31 B;  3C1C C;  3C1C D;  3AV1 B;  3NQU A;  3UT9 C;  3UT9 D;  5AV6 A;  4KGC B;  5BNX A;  3AV2 D;  1P34 A;  3MGS B;  3AZH C;  4R8P C;  4XZQ A;  2HUE C;  4NE3 A;  3EPL A;  3KWQ B;  3W99 B;  1P3K D;  2Y2H A;  2NQB C;  3REL C;  3REL D;  3AZJ C;  3AZJ D;  3NQU B;  5GT0 C;  5AV6 B;  5BNX B;  3REI D;  1P34 B;  2ARO A;  1AOI D;  4WU8 D;  4WU8 C;  2NZD C;  4NE6 A;  4XZQ B;  3VH6 A;  5B32 C;  3A6N A;  5B1L C;  2YFV A;  2YFW A;  2ARO B;  2F8N H;  2F8N D;  3C1C A;  2Y2L A;  3UT9 A;  5AV9 C;  5AV9 D;  3AV2 A;  3A6N B;  2PYO C;  2PYO D;  4UUZ A;  3MGQ C;  2YFV B;  5BT1 D;  5BT1 C;  5B0Z D;  5B0Z C;  3X1T C;  3REH D;  1P3K A;  4ZBJ C;  3KUY C;  3C1C B;  3REL A;  3AZJ A;  3UT9 B;  4Z66 D;  4M6B A;  4Z66 C;  3AV2 B;  3REI A;  5B32 G;  3UTB D;  1AOI A;  4Z2M H;  4WU8 A;  2JCH A;  4UUZ B;  2HUE B;  3W97 C;  3W97 D;  3AZF C;  3AZF D;  4QLC C;  1P3K B;  3VH5 A;  3IP4 C;  5CHL B;  5AV5 D;  5AV5 C;  3REL B;  3AZJ B;  4WJ3 C;  3UTA C;  1EQZ C;  3REI B;  1AOI B;  4WU8 B;  2F8N A;  4CAY A;  5GSU C;  5AV9 A;  2PYO A;  4XUJ D;  5G49 A;  1BH9 A;  4G91 C;  2ZY3 A;  4H9N A;  1B6W A;  2JE5 A;  5B0Z A;  3REH A;  1S32 C;  1S32 D;  2Y2K A;  2F8N B;  2F8N K;  4CAY B;  3NQJ A;  5AV9 B;  4Z66 A;  4WNN A;  2ZY5 A;  3UTB A;  2PYO B;  5G49 B;  5CPI D;  1BH9 B;  3EPJ A;  4H9N B;  3W97 A;  1P3I D;  3AZF A;  1WWI A;  2Y2Q A;  5B0Z B;  3AV1 C;  2HIO C;  2HIO D;  3REH B;  4J8U D;  5AV5 A;  3MGS C;  3LJA D;  3LZ1 D;  3NQJ B;  3LJA C;  4Z66 B;  4WNN B;  3UTB B;  3KWQ C;  4H9P A;  2IO5 B;  2BYM A;  3W97 B;  3WKJ D;  3FDD A;  3AZF B;  4H9Q A;  5B40 D;  4CSR B;  5E5A C;  5E5A D;  3B6F C;  4XUJ A;  3B6F D;  5BNV A;  1P34 C;  5AV5 B;  3AZK D;  1T3U A;  1S32 A;  4H9P B;  4J8V D;  2BYM B;  4H9Q B;  5B31 G;  4XUJ B;  5CPI A;  5BNV B;  2ARO C;  1P3I A;  1KX4 D;  4Z5T D;  2HIO A;  5BS7 A;  4J8U A;  5FUG A;  1S32 B;  3B6G D;  3B6G C;  2Y2J A;  3R45 A;  3A6N C;  3LJA A;  3LZ1 A;  2FJ7 D;  1ZLA C;  1ZLA D;  3B0B A;  5CPI B;  5C3I C;  1P3L C;  2Y2I A;  5DNN D;  1P3L D;  1P3I B;  3WKJ A;  5B40 A;  2HIO B;  5E5A A;  4WZS B;  3B6F A;  4J8U B;  3H0L C;  5FUG B;  4H9O A;  2BG1 A;  3R45 B;  3WTP D;  3AV2 C;  3LJA B;  3LZ1 B;  3AZK A;  3C1B C;  3C1B D;  4J8V A;  3AZM D;  4ZUX D;  4ZUX C;  3WKJ B;  1P3K C;  5B40 B;  5E5A B;  3B6F B;  4H9O B;  3REI C;  1AOI C;  2Y2N A;  3VH5 W;  4Z5T A;  1KX4 A;  3MNN C;  3MNN D;  2Y2O A;  3AZK B;  3LZ0 C;  3LZ0 D;  3REJ C;  3REJ D;  3B6G A;  4J8V B;  1F66 D;  1F66 C;  5DNM D;  2L5A A;  2FJ7 A;  1ZLA A;  4HGA C;  1KX5 D;  1P3L A;  5DNN A;  4J8W D;  4J8W C;  4Z5T B;  2BYK A;  5CPK D;  1JFI A;  3AZL D;  3REK D;  3B6G B;  3W98 C;  3W98 D;  1R4V A;  3WTP A;  2F2A C;  2ZM5 A;  2FJ7 B;  3C1B A;  2FFF B;  2YFW B;  1ZLA B;  2DQN C;  5C3I B;  3AZM A;  5DNN B;  1P3L B;  4ZUX A;  3REH C;  2BYK B;  4JJN D;  1JFI B;  3TU4 D;  5AVC C;  5AVC D;  1P3O D;  3AZG D;  1P3P D;  2UWX A;  3WTP B;  4EO5 C;  3UTB C;  3MNN A;  1KX3 C;  2IO5 C;  3C1B B;  1KX3 D;  3LZ0 A;  3REJ A;  3AZM B;  4ZUX B;  1F66 A;  5DNM A;  2F8N G;  5JRG D;  5JRG C;  1KX5 A;  1P3M D;  4J8W A;  2DF4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...