4KUDC

Crystal structure of n-terminal acetylated sir3 bah domain d205n mutant in complex with yeast nucleosome core particle
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3
publication title N alpha-acetylated Sir3 stabilizes the conformation of a nucleosome-binding loop in the BAH domain
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein/transcription/dna
total genus 28
structure length 103
sequence length 103
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4kudC00
3W99D 5B24A 4WU8D 4H9PA 3REKA 3WKJC 3UTBB 3AZED 5B32B 3WTPD 4J8UC 1P3IA 1P3BA 5CPKD 4X23C 1P34C 1U35A 3WAAA 2HIOA 1N1JB 5AVBB 3AZLD 4HGAC 5B24B 1AOID 3LZ0D 2AROC 3AFAD 2PYOA 3AZMB 4J8WD 3KWQB 3AZHD 3MGRC 3NQJA 3VH6T 3MGQA 3W98C 3AV2B 5BT1D 5B0YB 4KUDA 1R4VA 3REKC 5AVCD 3UTAC 5GT0D 4DRBA 4Z5TD 4ZUXA 3MGSA 1P3MC 3W96B 1ID3B 3AZKA 3AYWB 1P3BC 4H9SA 4J8VB 3AZFD 1U35C 2HIOC 4YS3D 3AZID 5AY8A 3AN2D 5E5AA 5CP6C 5AV9A 5GT3A 3REJB 3KUYB 2PYOC 3VH5W 2BYMB 3REIB 1P3AD 5B0ZC 1KX5D 5AV5B 5F99B 1S32D 3WTPA 4KUDC 3X1SB 5CPKA 5B33C 4QLCD 3MGPA 3UT9B 4H9OB 5B1MB 4ZUXC 3MGSC 3AZLA 4ZBJB 4CAYB 1AOIA 3LZ0A 3AZKC 3AZNB 3B0BA 3AFAA 4H9SC 4R8PC 4J8WA 3AZHA 5CPJC 3VH6A 4NE3A 2YFVA 4KGCD 5AV9C 5DNND 5C3IB 3MGPB 2CV5D 2F8ND 3W99C 4WU8C 3B6FB 4WNNA 3V9RB 2BYKA 3TU4B 5AVCA 1P3PB 1ZLAD 5GT0A 3AZEC 4KHAB 3A6ND 4Z5TA 3WTPC 3X1VB 4NE6A 1P3FD 1P3OA 2HUEB 3R45A 3AZFA 5CPKC 4YS3A 1M18B 3AZIA 3AN2A 3AZLC 1AOIC 1KX4D 3LZ0C 3AFAC 4H9QA 4J8WC 3LELD 1P3AA 4UUZA 3AZHC 5B40D 1KX5A 1H3OB 5B2JC 4E45A 5BT1C 1S32A 4WU9D 4H9NB 4QLCA 5KDMA 5B1LB 4CSRA 1P3KD 4Z5TC 3UTAD 1M1AB 3AZFC 3AV1B 5B31B 4YS3C 3AZIC 3MVDB 3AZGB 4KGCA 5DNNA 3NQUA 5CP6D 5AV6B 4WV4B 2CV5A 2F8NA 2NQBB 1KX5C 3A6NA 3C1BD 1KX3C 5BS7A 3MNND 4EO5C 4QLCC 1P3LD 4Z66B 4YM6D 5B33D 1KX4A 1BH8B 4G91C 2IO5C 2NZDD 1TZYC 1TAFA 4JJNB 3AV2D 4R8PD 3WKJB 5GXQD 3B0CW 5B40A 3X1TC 4J8UB 4KGCC 5DNNC 4XZQD 3MGRA 5CPIB 4LD9B 4H9RB 4X23B 1P34B 4WU9A 1HQ3D 1KU5A 1ZLAC 2AROB 3A6NC 2L5AA 1P3FC 3UTAA 1P3MA 5BS7C 4J8XB 5AV8C 3KUYD 3W98B 3REID 1KX4C 5AV5D 1F1EA 5CP6A 4H9PB 3REKB 3LELC 5B40C 1P3IB 5B0ZA 1P3BB 3WAAB 5B2JD 1U35B 3C1BA 4WU9C 2HIOB 5B1MD 4Z2MH 3MNNA 3AZND 5B2IC 1P3LA 5B32G 4YM6A 5B33A 1P3KC 2PYOB 4XUJD 2NZDA 3NQJB 3MGQB 4R8PA 3X1UD 3WTPE 5GXQA 4G92B 5CPJA 4XZQA 4KUDB 3UTBC 5B32C 1HQ3A 4ZUXB 3MGSB 3W99A 4WU8A 3AZKB 1F66D 2FJ7D 3C1BC 3AZEA 3B6GD 5AVBC 1WWSA 2LY8A 3MNNC 5CPJB 5AY8B 1KX3D 5E5AB 1P3LC 5AV9B 5GT3B 4YM6C 3REHD 1P3GD 3W99B 2NZDC 3AV2C 3RELD 1TZYD 5GXQC 3WTPB 2F8NK 4XZQC 3C1CD 2YFWA 3X1TD 5CPKB 5B2JA 1HQ3C 4M6BA 1JFIA 3WA9D 3AZLB 1AOIB 4J8VC 3LZ0B 5BNVA 3AFAB 2RVQD 4J8WB 1M19D 3AZHB 3KXBD 2YFVB 3KUYC 3LZ1D 2JSSA 3REIC 3X1UA 5AV8D 5AV5C 4WNNB 3AZJD 2BYKB 5GSUD 5AVCB 5GT0B 4Z5TB 5DNMD 1EQZD 3VH6W 1F66A 1P3OB 3LJAD 3O62D 3AZFB 3R45B 2FJ7A 2F8NH 5B1MC 4YS3B 5JRGD 3AZIB 3AZNC 3AN2B 1KX3A 5B2ID 4JJND 4XUJC 3REHA 1P3GA 4H9QB 1P3AB 4UUZB 1KX5B 5C3IC 4LD9D 3RELA 3W97D 1TZYA 3X1UC 1S32B 3C1CA 3X1TA 4EO5B 4QLCB 3WA9A 3UTBD 5KDMB 4CSRB 5B32D 2HUEC 4G91B 1F66C 2FJ7C 2IO5B 1ZLAA 3B6GC 1BH9A 1P3FA 1M19A 5AVBD 3KXBA 5BNXA 5B24D 4KGCB 5DNNB 3LZ1A 3NQUB 5G49A 5AV8A 5CHLB 3REHC 3AZMD 1P3GC 2CV5B 2F8NB 3KWQD 5B31G 5GSUA 3RELC 3WAAD 3A6NB 3LELA 5DNMA 1P3FB 1EQZA 3C1CC 5B0YD 3LJAA 3O62A 5B1LC 5BO0A 5JRGA 3WA9C 3VH5T 3W96D 3B0DC 4AWLC 1KX4B 1ID3D 3AV1C 3AYWD 4HGAB 5JA4A 5B2IA 2RVQC 4J8VD 1TAFB 1P3KA 3AZGC 1M19C 5B40B 3KXBC 3W97A 3LZ1C 2F8NG 5AV6C 3MGRB 3REJD 4WU9B 1B6WA 3AZJC 5GSUC 5F99D 3UTBA 5B32A 5DNMC 1EQZC 3UTAB 3X1SD 3LJAC 3O62C 1P3MB 5JRGC 3UT9D 1N1JA 5AVBA 4JJNC 5CP6B 3AZMA 1B67A 5FUGA 3KWQA 5CPIC 4LD9C 4E44A 5B0ZB 3W97C 3AV2A 3MGPD 3C1BB 5B0YA 3MNNB 3B6FD 3TU4D 1P3LB 3VH5A 1P3PD 4YM6B 5B33B 5FUGB 3W96A 3X1VD 1ID3A 4J8XC 3AYWA 4J8VA 2NZDB 4DRAA 4R8PB 1M18D 5GXQB 5B24C 4XZQB 3REJA 3KUYA 3AZMC 2BYMA 3REIA 1HQ3B 1P3IC 3KWQC 1P3OD 4WU8B 3WAAC 5AV5A 5F99A 3AZEB 5B0YC 3X1SA 3UT9A 4H9OA 5B1LD 5B1MA 3W96C 4CAYA 1ID3C 3AZNA 1M1AD 3MGQC 3AYWC 3AV1D 5B31D 4G92C 4XUJA 3MVDD 1WWIA 3AZGD 1A7WA 4WZSB 2YFWB 3REJC 5B2JB 5AV6D 1JFIB 2NQBD 4Z2MG 3B6FA 3V9RA 3TU4A 5F99C 1P3PA 5BNVB 4KHAA 3X1VA 1Q9CA 1HTAA 4XUJB 5AY8C 3X1SC 5E5AC 3B0CT 5GT3C 1M18A 3UT9C 4Z66D 3X1UB 3B6GA 4ZBJC 3WKJD 4J8UD 1H3OA 1F66B 2FJ7B 2CWEA 3MGPC 5CPID 1BFMA 4X23D 1P34D 3B6GB 4H9NA 3B6FC 1KX3B 3TU4C 1P3PC 2AROD 5B1LA 3X1VC 3REHB 1P3GB 1M1AA 3MGRD 5B31A 4J8XD 3AV1A 3RELB 1M18C 3W98D 3MVDA 1TZYB 4NE5A 3AZGA 3C1CB 1ULYA 3X1TB 5AVCC 5GT0C 3REKD 5AV6A 3WA9B 2NQBA 1P3OC 1P3MD 3B0DB 4AWLB 1P3ID 3AZJA 1P3BD 1ZLAB 1U35D 2HIOD 3AN2C 1BH9B 1M19B 3KXBB 5BNXB 4NFTA 4Z66A 3LZ1B 5G49B 5AV8B 3KSYA 1P3AC 2PYOD 1BH8A 1M1AC 5B0ZD 3AZJB 5GSUB 5B31C 3MGQD 1S32C 4JJNA 3WKJA 3MVDC 3LELB 5DNMB 1EQZB 4J8UA 4KUDD 3LJAB 3O62B 5CPIA 4LD9A 4H9RA 4X23A 1P34A 5BO0B 5JRGB 2NQBC 4ZUXD 3MGSD 2AROA 3AZKD 5JA4B 5B2IB 1P3KB 5CPJD 5AY8D 5E5AD 4J8XA 5AV9D 3W97B 4Z66C 5GT3D 3W98A 2CV5C
chains in the Genus database with same CATH superfamily
3W99D 5B24A 4WU8D 2W8SA 4H9PA 3REKA 3WKJC 3UTBB 3AZED 5B32B 3WTPD 4J8UC 1P3IA 2Y2KA 1P3BA 5CPKD 4X23C 2ZY2A 1U35A 1P34C 3WAAA 2HIOA 3A1KA 1N1JB 5AVBB 3AZLD 4HGAC 5B24B 1AOID 3EPKA 3LZ0D 2AROC 3AFAD 2PYOA 3AZMB 2G5IC 4J8WD 3KWQB 3AZHD 3EPHA 3MGRC 3NQJA 3VH6T 3MGQA 3W98C 3AV2B 5BT1D 5B0YB 4KUDA 1R4VA 3REKC 5AVCD 2DQNC 3UTAC 2Y2QA 5GT0D 4DRBA 4Z5TD 4ZUXA 3MGSA 1P3MC 3W96B 1ID3B 3AZKA 2Y2IA 3AYWB 1P3BC 4H9SA 4J8VB 3AZFD 1U35C 2HIOC 4YS3D 3AZID 4UPKA 5AY8A 3AN2D 5E5AA 5CP6C 5AV9A 5GT3A 3REJB 3KUYB 2PYOC 3VH5W 2BYMB 3REIB 1P3AD 5B0ZC 1KX5D 5AV5B 5F99B 1S32D 3WTPA 4KUDC 3X1SB 5CPKA 5B33C 4QLCD 3MGPA 3UT9B 4H9OB 5B1MB 4ZUXC 3MGSC 3AZLA 4ZBJB 4CAYB 1AOIA 3LZ0A 3AZKC 3AZNB 3B0BA 3AFAA 4H9SC 4R8PC 4J8WA 3AZHA 5CPJC 3VH6A 2XD5A 4NE3A 2YFVA 4KGCD 5AV9C 5DNND 5C3IB 3MGPB 2CV5D 2F8ND 3W99C 4WU8C 3B6FB 2F2AC 4WNNA 2BYKA 3V9RB 3TU4B 2JE5A 5AVCA 1P3PB 1ZLAD 5GT0A 3AZEC 4KHAB 3A6ND 4Z5TA 3WTPC 3X1VB 4NE6A 1P3FD 1P3OA 2HUEB 3R45A 3AZFA 5CPKC 4YS3A 1M18B 3AZIA 3AN2A 3AZLC 1AOIC 1KX4D 3LZ0C 3AFAC 2RIQA 4H9QA 3LELD 4J8WC 1P3AA 4UUZA 3AZHC 5B40D 1KX5A 1H3OB 5B2JC 4E45A 5BT1C 1S32A 3A1IA 4WU9D 4H9NB 4QLCA 5KDMA 5B1LB 4CSRA 1P3KD 4Z5TC 3UTAD 1M1AB 3AZFC 3AV1B 5B31B 4YS3C 3AZIC 3MVDB 3AZGB 4KGCA 5DNNA 2J8PA 3NQUA 5CP6D 5AV6B 4WV4B 2CV5A 2F8NA 2NQBB 1KX5C 3A6NA 1T3UA 3C1BD 1KX3C 5BS7A 3MNND 4EO5C 4QLCC 1P3LD 4Z66B 4YM6D 5B33D 1KX4A 3F6TA 1BH8B 4G91C 2IO5C 2NZDD 1TZYC 1TAFA 4JJNB 3AV2D 4R8PD 3WKJB 5GXQD 3B0CW 5B40A 3X1TC 4J8UB 4KGCC 5DNNC 4XZQD 3MGRA 5CPIB 4LD9B 4H9RB 4X23B 1P34B 4WU9A 1HQ3D 1KU5A 1ZLAC 2AROB 3A6NC 2L5AA 1P3FC 3UTAA 1P3MA 5BS7C 4J8XB 5AV8C 3KUYD 3W98B 3REID 1KX4C 5AV5D 1F1EA 5CP6A 4H9PB 3REKB 3LELC 5B40C 1P3IB 5B0ZA 1P3BB 3WAAB 5B2JD 1U35B 3C1BA 4WU9C 2HIOB 5B1MD 4Z2MH 3MNNA 3AZND 5B2IC 1P3LA 5B32G 4YM6A 5B33A 1P3KC 2PYOB 4XUJD 2NZDA 3NQJB 3MGQB 4R8PA 3X1UD 3WTPE 5GXQA 4G92B 5CPJA 4XZQA 4KUDB 3UTBC 5B32C 1HQ3A 4ZUXB 3MGSB 3W99A 4WU8A 2DF4C 3AZKB 1F66D 2FJ7D 3C1BC 3AZEA 3B6GD 5AVBC 1WWSA 2LY8A 3MNNC 5CPJB 5AY8B 1KX3D 5E5AB 1P3LC 5AV9B 5GT3B 4YM6C 1W2EA 3REHD 1P3GD 3W99B 2NZDC 3AV2C 2XD1A 3RELD 1TZYD 5GXQC 3WTPB 2F8NK 4XZQC 3C1CD 2YFWA 2Y2PA 3X1TD 5CPKB 5B2JA 1HQ3C 3H0RC 4M6BA 1JFIA 3WA9D 3AZLB 1AOIB 4J8VC 3LZ0B 5BNVA 3AFAB 2RVQD 4J8WB 1M19D 3IP4C 3AZHB 3KXBD 2YFVB 3KUYC 3LZ1D 2JSSA 3REIC 3X1UA 5AV8D 3AL0C 5AV5C 4WNNB 3AZJD 2BYKB 5GSUD 5AVCB 5GT0B 4Z5TB 5DNMD 1EQZD 3VH6W 1F66A 1P3OB 3LJAD 3O62D 3AZFB 3R45B 2FJ7A 2F8NH 2BG1A 5B1MC 4YS3B 5JRGD 3AZIB 3AZNC 2ZY3A 3AN2B 1KX3A 5B2ID 4JJND 4XUJC 3REHA 1P3GA 4H9QB 1P3AB 4UUZB 1KX5B 5C3IC 4LD9D 3RELA 3W97D 1TZYA 2Y2NA 3X1UC 3FDDA 1S32B 3C1CA 3X1TA 4EO5B 4QLCB 3WA9A 3UTBD 5KDMB 4CSRB 5B32D 2FFFB 2HUEC 4G91B 1F66C 2FJ7C 2IO5B 1ZLAA 3B6GC 1BH9A 1P3FA 1M19A 5AVBD 3KXBA 5BNXA 5B24D 4KGCB 2Y2OA 3P5JB 5DNNB 3LZ1A 3NQUB 5G49A 5AV8A 5CHLB 3REHC 3AZMD 1P3GC 3H0MC 3EG5B 2CV5B 2F8NB 2JCHA 3KWQD 5B31G 5GSUA 3RELC 3WAAD 3A6NB 3LELA 5DNMA 1P3FB 1EQZA 3C1CC 5B0YD 3LJAA 3O62A 5B1LC 5BO0A 5JRGA 3WA9C 2G5HC 3VH5T 3W96D 3B0DC 4AWLC 1KX4B 1ID3D 1PZRA 3AV1C 3AYWD 4HGAB 5JA4A 5B2IA 2RVQC 4J8VD 1TAFB 1P3KA 3AZGC 1M19C 5B40B 3KXBC 3W97A 3LZ1C 2F8NG 5AV6C 3MGRB 3REJD 4WU9B 1B6WA 2UWXA 2Y2JA 3AZJC 5GSUC 4WJ3C 5F99D 3UTBA 5B32A 5DNMC 1EQZC 3UTAB 3X1SD 3LJAC 3O62C 1P3MB 5JRGC 3UT9D 1N1JA 5AVBA 4JJNC 5CP6B 3AZMA 1B67A 5FUGA 3KWQA 5CPIC 4LD9C 4E44A 5B0ZB 3W97C 3AV2A 3MGPD 3C1BB 2Y2LA 5B0YA 3MNNB 3B6FD 3TU4D 1P3LB 3VH5A 1P3PD 4YM6B 5B33B 5FUGB 3W96A 3X1VD 2ZY5A 1ID3A 4J8XC 3AYWA 2Y2MA 4J8VA 2NZDB 4DRAA 4R8PB 1M18D 5GXQB 5B24C 4XZQB 4DQYB 3REJA 3KUYA 3AZMC 2BYMA 3REIA 1HQ3B 1P3IC 3KWQC 1P3OD 4WU8B 3WAAC 5AV5A 5F99A 3AZEB 5B0YC 3X1SA 3UT9A 4H9OA 5B1LD 5B1MA 3W96C 4CAYA 1ID3C 2ZY4A 3AZNA 1M1AD 3MGQC 3AYWC 3AV1D 5B31D 4G92C 4XUJA 3MVDD 1WWIA 3AZGD 1A7WA 4WZSB 2YFWB 3REJC 5B2JB 5AV6D 1JFIB 2NQBD 4Z2MG 3B6FA 3V9RA 3TU4A 5F99C 1P3PA 5BNVB 4KHAA 3X1VA 1HTAA 1Q9CA 4XUJB 5AY8C 3X1SC 5E5AC 3B0CT 5GT3C 1M18A 3UT9C 4Z66D 2VQRA 3X1UB 3B6GA 4ZBJC 3WKJD 4J8UD 1H3OA 1F66B 2FJ7B 2CWEA 3MGPC 5CPID 1BFMA 4X23D 1P34D 3B6GB 4H9NA 3B6FC 1KX3B 3TU4C 1P3PC 2AROD 5B1LA 3X1VC 3REHB 1P3GB 1M1AA 3MGRD 5B31A 4J8XD 3AV1A 3RELB 2ZM5A 1M18C 3W98D 3MVDA 1TZYB 4NE5A 3AZGA 3C1CB 1ULYA 3X1TB 5AVCC 5GT0C 3REKD 5AV6A 3EPLA 3WA9B 2NQBA 1P3OC 1P3MD 3B0DB 4AWLB 1P3ID 3KFUG 3AZJA 1P3BD 3EPJA 1ZLAB 1U35D 2HIOD 3AN2C 1BH9B 1M19B 3KXBB 5BNXB 4NFTA 4Z66A 3LZ1B 3H0LC 5G49B 3KSYA 5AV8B 1P3AC 2PYOD 1BH8A 1M1AC 2Y2HA 5B0ZD 3AZJB 5GSUB 5B31C 3MGQD 1S32C 4JJNA 3WKJA 1Z2CB 3MVDC 3LELB 5DNMB 1EQZB 2Y2GA 4J8UA 4KUDD 3LJAB 3O62B 5CPIA 4LD9A 4H9RA 4X23A 1P34A 5BO0B 5JRGB 2NQBC 4ZUXD 3MGSD 2AROA 3AZKD 5JA4B 5B2IB 1P3KB 5CPJD 5AY8D 5E5AD 4J8XA 5AV9D 3W97B 4Z66C 5GT3D 3W98A 2CV5C
chains in the Genus database with same CATH topology
3W99D 5B24A 4WU8D 2W8SA 4H9PA 3REKA 3WKJC 3UTBB 3AZED 5B32B 3WTPD 4J8UC 1P3IA 2Y2KA 1P3BA 5CPKD 4X23C 2ZY2A 1U35A 1P34C 3WAAA 2HIOA 3A1KA 1N1JB 5AVBB 3AZLD 4HGAC 5B24B 1AOID 3EPKA 3LZ0D 2AROC 3AFAD 2PYOA 3AZMB 2G5IC 4J8WD 3KWQB 3AZHD 3EPHA 3MGRC 3NQJA 3VH6T 3MGQA 3W98C 3AV2B 5BT1D 5B0YB 4KUDA 1R4VA 3REKC 5AVCD 2DQNC 3UTAC 2Y2QA 5GT0D 4DRBA 4Z5TD 4ZUXA 3MGSA 1P3MC 3W96B 1ID3B 3AZKA 2Y2IA 3AYWB 1P3BC 4H9SA 4J8VB 3AZFD 1U35C 2HIOC 4YS3D 3AZID 4UPKA 5AY8A 3AN2D 5E5AA 5CP6C 5AV9A 5GT3A 3REJB 3KUYB 2PYOC 3VH5W 2BYMB 3REIB 1P3AD 5B0ZC 1KX5D 5AV5B 5F99B 1S32D 3WTPA 4KUDC 3X1SB 5CPKA 5B33C 4QLCD 3MGPA 3UT9B 4H9OB 5B1MB 4ZUXC 3MGSC 3AZLA 4ZBJB 4CAYB 1AOIA 3LZ0A 3AZKC 3AZNB 3B0BA 3AFAA 4H9SC 4R8PC 4J8WA 3AZHA 5CPJC 3VH6A 2XD5A 4NE3A 2YFVA 4KGCD 5AV9C 5DNND 5C3IB 3MGPB 2CV5D 2F8ND 3W99C 4WU8C 3B6FB 2F2AC 4WNNA 2BYKA 3V9RB 3TU4B 2JE5A 5AVCA 1P3PB 1ZLAD 5GT0A 3AZEC 4KHAB 3A6ND 4Z5TA 3WTPC 3X1VB 4NE6A 1P3FD 1P3OA 2HUEB 3R45A 3AZFA 5CPKC 4YS3A 1M18B 3AZIA 3AN2A 3AZLC 1AOIC 1KX4D 3LZ0C 3AFAC 2RIQA 4H9QA 3LELD 4J8WC 1P3AA 4UUZA 3AZHC 5B40D 1KX5A 1H3OB 5B2JC 4E45A 5BT1C 1S32A 3A1IA 4WU9D 4H9NB 4QLCA 5KDMA 5B1LB 4CSRA 1P3KD 4Z5TC 3UTAD 1M1AB 3AZFC 3AV1B 5B31B 4YS3C 3AZIC 3MVDB 3AZGB 4KGCA 5DNNA 2J8PA 3NQUA 5CP6D 5AV6B 4WV4B 2CV5A 2F8NA 2NQBB 1KX5C 3A6NA 1T3UA 3C1BD 1KX3C 5BS7A 3MNND 4EO5C 4QLCC 1P3LD 4Z66B 4YM6D 5B33D 1KX4A 3F6TA 1BH8B 4G91C 2IO5C 2NZDD 1TZYC 1TAFA 4JJNB 3AV2D 4R8PD 3WKJB 5GXQD 3B0CW 5B40A 3X1TC 4J8UB 4KGCC 5DNNC 4XZQD 3MGRA 5CPIB 4LD9B 4H9RB 4X23B 1P34B 4WU9A 1HQ3D 1KU5A 1ZLAC 2AROB 3A6NC 2L5AA 1P3FC 3UTAA 1P3MA 5BS7C 4J8XB 5AV8C 3KUYD 3W98B 3REID 1KX4C 5AV5D 1F1EA 5CP6A 4H9PB 3REKB 3LELC 5B40C 1P3IB 5B0ZA 1P3BB 3WAAB 5B2JD 1U35B 3C1BA 4WU9C 2HIOB 5B1MD 4Z2MH 3MNNA 3AZND 5B2IC 1P3LA 5B32G 4YM6A 5B33A 1P3KC 2PYOB 4XUJD 2NZDA 3NQJB 3MGQB 4R8PA 3X1UD 3WTPE 5GXQA 4G92B 5CPJA 4XZQA 4KUDB 3UTBC 5B32C 1HQ3A 4ZUXB 3MGSB 3W99A 4WU8A 2DF4C 3AZKB 1F66D 2FJ7D 3C1BC 3AZEA 3B6GD 5AVBC 1WWSA 2LY8A 3MNNC 5CPJB 5AY8B 1KX3D 5E5AB 1P3LC 5AV9B 5GT3B 4YM6C 1W2EA 3REHD 1P3GD 3W99B 2NZDC 3AV2C 2XD1A 3RELD 1TZYD 5GXQC 3WTPB 2F8NK 4XZQC 3C1CD 2YFWA 2Y2PA 3X1TD 5CPKB 5B2JA 1HQ3C 3H0RC 4M6BA 1JFIA 3WA9D 3AZLB 1AOIB 4J8VC 3LZ0B 5BNVA 3AFAB 2RVQD 4J8WB 1M19D 3IP4C 3AZHB 3KXBD 2YFVB 3KUYC 3LZ1D 2JSSA 3REIC 3X1UA 5AV8D 3AL0C 5AV5C 4WNNB 3AZJD 2BYKB 5GSUD 5AVCB 5GT0B 4Z5TB 5DNMD 1EQZD 3VH6W 1F66A 1P3OB 3LJAD 3O62D 3AZFB 3R45B 2FJ7A 2F8NH 2BG1A 5B1MC 4YS3B 5JRGD 3AZIB 3AZNC 2ZY3A 3AN2B 1KX3A 5B2ID 4JJND 4XUJC 3REHA 1P3GA 4H9QB 1P3AB 4UUZB 1KX5B 5C3IC 4LD9D 3RELA 3W97D 1TZYA 2Y2NA 3X1UC 3FDDA 1S32B 3C1CA 3X1TA 4EO5B 4QLCB 3WA9A 3UTBD 5KDMB 4CSRB 5B32D 2FFFB 2HUEC 4G91B 1F66C 2FJ7C 2IO5B 1ZLAA 3B6GC 1BH9A 1P3FA 1M19A 5AVBD 3KXBA 5BNXA 5B24D 4KGCB 2Y2OA 3P5JB 5DNNB 3LZ1A 3NQUB 5G49A 5AV8A 5CHLB 3REHC 3AZMD 1P3GC 3H0MC 3EG5B 2CV5B 2F8NB 2JCHA 3KWQD 5B31G 5GSUA 3RELC 3WAAD 3A6NB 3LELA 5DNMA 1P3FB 1EQZA 3C1CC 5B0YD 3LJAA 3O62A 5B1LC 5BO0A 5JRGA 3WA9C 2G5HC 3VH5T 3W96D 3B0DC 4AWLC 1KX4B 1ID3D 1PZRA 3AV1C 3AYWD 4HGAB 5JA4A 5B2IA 2RVQC 4J8VD 1TAFB 1P3KA 3AZGC 1M19C 5B40B 3KXBC 3W97A 3LZ1C 2F8NG 5AV6C 3MGRB 3REJD 4WU9B 1B6WA 2UWXA 2Y2JA 3AZJC 5GSUC 4WJ3C 5F99D 3UTBA 5B32A 5DNMC 1EQZC 3UTAB 3X1SD 3LJAC 3O62C 1P3MB 5JRGC 3UT9D 1N1JA 5AVBA 4JJNC 5CP6B 3AZMA 1B67A 5FUGA 3KWQA 5CPIC 4LD9C 4E44A 5B0ZB 3W97C 3AV2A 3MGPD 3C1BB 2Y2LA 5B0YA 3MNNB 3B6FD 3TU4D 1P3LB 3VH5A 1P3PD 4YM6B 5B33B 5FUGB 3W96A 3X1VD 2ZY5A 1ID3A 4J8XC 3AYWA 2Y2MA 4J8VA 2NZDB 4DRAA 4R8PB 1M18D 5GXQB 5B24C 4XZQB 4DQYB 3REJA 3KUYA 3AZMC 2BYMA 3REIA 1HQ3B 1P3IC 3KWQC 1P3OD 4WU8B 3WAAC 5AV5A 5F99A 3AZEB 5B0YC 3X1SA 3UT9A 4H9OA 5B1LD 5B1MA 3W96C 4CAYA 1ID3C 2ZY4A 3AZNA 1M1AD 3MGQC 3AYWC 3AV1D 5B31D 4G92C 4XUJA 3MVDD 1WWIA 3AZGD 1A7WA 4WZSB 2YFWB 3REJC 5B2JB 5AV6D 1JFIB 2NQBD 4Z2MG 3B6FA 3V9RA 3TU4A 5F99C 1P3PA 5BNVB 4KHAA 3X1VA 1HTAA 1Q9CA 4XUJB 5AY8C 3X1SC 5E5AC 3B0CT 5GT3C 1M18A 3UT9C 4Z66D 2VQRA 3X1UB 3B6GA 4ZBJC 3WKJD 4J8UD 1H3OA 1F66B 2FJ7B 2CWEA 3MGPC 5CPID 1BFMA 4X23D 1P34D 3B6GB 4H9NA 3B6FC 1KX3B 3TU4C 1P3PC 2AROD 5B1LA 3X1VC 3REHB 1P3GB 1M1AA 3MGRD 5B31A 4J8XD 3AV1A 3RELB 2ZM5A 1M18C 3W98D 3MVDA 1TZYB 4NE5A 3AZGA 3C1CB 1ULYA 3X1TB 5AVCC 5GT0C 3REKD 5AV6A 3EPLA 3WA9B 2NQBA 1P3OC 1P3MD 3B0DB 4AWLB 1P3ID 3KFUG 3AZJA 1P3BD 3EPJA 1ZLAB 1U35D 2HIOD 3AN2C 1BH9B 1M19B 3KXBB 5BNXB 4NFTA 4Z66A 3LZ1B 3H0LC 5G49B 3KSYA 5AV8B 1P3AC 2PYOD 1BH8A 1M1AC 2Y2HA 5B0ZD 3AZJB 5GSUB 5B31C 3MGQD 1S32C 4JJNA 3WKJA 1Z2CB 3MVDC 3LELB 5DNMB 1EQZB 2Y2GA 4J8UA 4KUDD 3LJAB 3O62B 5CPIA 4LD9A 4H9RA 4X23A 1P34A 5BO0B 5JRGB 2NQBC 4ZUXD 3MGSD 2AROA 3AZKD 5JA4B 5B2IB 1P3KB 5CPJD 5AY8D 5E5AD 4J8XA 5AV9D 3W97B 4Z66C 5GT3D 3W98A 2CV5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W99 D;  5B24 A;  4WU8 D;  4H9P A;  3REK A;  3WKJ C;  3UTB B;  3AZE D;  5B32 B;  3WTP D;  4J8U C;  1P3I A;  1P3B A;  5CPK D;  4X23 C;  1P34 C;  1U35 A;  3WAA A;  2HIO A;  1N1J B;  5AVB B;  3AZL D;  4HGA C;  5B24 B;  1AOI D;  3LZ0 D;  2ARO C;  3AFA D;  2PYO A;  3AZM B;  4J8W D;  3KWQ B;  3AZH D;  3MGR C;  3NQJ A;  3VH6 T;  3MGQ A;  3W98 C;  3AV2 B;  5BT1 D;  5B0Y B;  4KUD A;  1R4V A;  3REK C;  5AVC D;  3UTA C;  5GT0 D;  4DRB A;  4Z5T D;  4ZUX A;  3MGS A;  1P3M C;  3W96 B;  1ID3 B;  3AZK A;  3AYW B;  1P3B C;  4H9S A;  4J8V B;  3AZF D;  1U35 C;  2HIO C;  4YS3 D;  3AZI D;  5AY8 A;  3AN2 D;  5E5A A;  5CP6 C;  5AV9 A;  5GT3 A;  3REJ B;  3KUY B;  2PYO C;  3VH5 W;  2BYM B;  3REI B;  1P3A D;  5B0Z C;  1KX5 D;  5AV5 B;  5F99 B;  1S32 D;  3WTP A;  4KUD C;  3X1S B;  5CPK A;  5B33 C;  4QLC D;  3MGP A;  3UT9 B;  4H9O B;  5B1M B;  4ZUX C;  3MGS C;  3AZL A;  4ZBJ B;  4CAY B;  1AOI A;  3LZ0 A;  3AZK C;  3AZN B;  3B0B A;  3AFA A;  4H9S C;  4R8P C;  4J8W A;  3AZH A;  5CPJ C;  3VH6 A;  4NE3 A;  2YFV A;  4KGC D;  5AV9 C;  5DNN D;  5C3I B;  3MGP B;  2CV5 D;  2F8N D;  3W99 C;  4WU8 C;  3B6F B;  4WNN A;  3V9R B;  2BYK A;  3TU4 B;  5AVC A;  1P3P B;  1ZLA D;  5GT0 A;  3AZE C;  4KHA B;  3A6N D;  4Z5T A;  3WTP C;  3X1V B;  4NE6 A;  1P3F D;  1P3O A;  2HUE B;  3R45 A;  3AZF A;  5CPK C;  4YS3 A;  1M18 B;  3AZI A;  3AN2 A;  3AZL C;  1AOI C;  1KX4 D;  3LZ0 C;  3AFA C;  4H9Q A;  4J8W C;  3LEL D;  1P3A A;  4UUZ A;  3AZH C;  5B40 D;  1KX5 A;  1H3O B;  5B2J C;  4E45 A;  5BT1 C;  1S32 A;  4WU9 D;  4H9N B;  4QLC A;  5KDM A;  5B1L B;  4CSR A;  1P3K D;  4Z5T C;  3UTA D;  1M1A B;  3AZF C;  3AV1 B;  5B31 B;  4YS3 C;  3AZI C;  3MVD B;  3AZG B;  4KGC A;  5DNN A;  3NQU A;  5CP6 D;  5AV6 B;  4WV4 B;  2CV5 A;  2F8N A;  2NQB B;  1KX5 C;  3A6N A;  3C1B D;  1KX3 C;  5BS7 A;  3MNN D;  4EO5 C;  4QLC C;  1P3L D;  4Z66 B;  4YM6 D;  5B33 D;  1KX4 A;  1BH8 B;  4G91 C;  2IO5 C;  2NZD D;  1TZY C;  1TAF A;  4JJN B;  3AV2 D;  4R8P D;  3WKJ B;  5GXQ D;  3B0C W;  5B40 A;  3X1T C;  4J8U B;  4KGC C;  5DNN C;  4XZQ D;  3MGR A;  5CPI B;  4LD9 B;  4H9R B;  4X23 B;  1P34 B;  4WU9 A;  1HQ3 D;  1KU5 A;  1ZLA C;  2ARO B;  3A6N C;  2L5A A;  1P3F C;  3UTA A;  1P3M A;  5BS7 C;  4J8X B;  5AV8 C;  3KUY D;  3W98 B;  3REI D;  1KX4 C;  5AV5 D;  1F1E A;  5CP6 A;  4H9P B;  3REK B;  3LEL C;  5B40 C;  1P3I B;  5B0Z A;  1P3B B;  3WAA B;  5B2J D;  1U35 B;  3C1B A;  4WU9 C;  2HIO B;  5B1M D;  4Z2M H;  3MNN A;  3AZN D;  5B2I C;  1P3L A;  5B32 G;  4YM6 A;  5B33 A;  1P3K C;  2PYO B;  4XUJ D;  2NZD A;  3NQJ B;  3MGQ B;  4R8P A;  3X1U D;  3WTP E;  5GXQ A;  4G92 B;  5CPJ A;  4XZQ A;  4KUD B;  3UTB C;  5B32 C;  1HQ3 A;  4ZUX B;  3MGS B;  3W99 A;  4WU8 A;  3AZK B;  1F66 D;  2FJ7 D;  3C1B C;  3AZE A;  3B6G D;  5AVB C;  1WWS A;  2LY8 A;  3MNN C;  5CPJ B;  5AY8 B;  1KX3 D;  5E5A B;  1P3L C;  5AV9 B;  5GT3 B;  4YM6 C;  3REH D;  1P3G D;  3W99 B;  2NZD C;  3AV2 C;  3REL D;  1TZY D;  5GXQ C;  3WTP B;  2F8N K;  4XZQ C;  3C1C D;  2YFW A;  3X1T D;  5CPK B;  5B2J A;  1HQ3 C;  4M6B A;  1JFI A;  3WA9 D;  3AZL B;  1AOI B;  4J8V C;  3LZ0 B;  5BNV A;  3AFA B;  2RVQ D;  4J8W B;  1M19 D;  3AZH B;  3KXB D;  2YFV B;  3KUY C;  3LZ1 D;  2JSS A;  3REI C;  3X1U A;  5AV8 D;  5AV5 C;  4WNN B;  3AZJ D;  2BYK B;  5GSU D;  5AVC B;  5GT0 B;  4Z5T B;  5DNM D;  1EQZ D;  3VH6 W;  1F66 A;  1P3O B;  3LJA D;  3O62 D;  3AZF B;  3R45 B;  2FJ7 A;  2F8N H;  5B1M C;  4YS3 B;  5JRG D;  3AZI B;  3AZN C;  3AN2 B;  1KX3 A;  5B2I D;  4JJN D;  4XUJ C;  3REH A;  1P3G A;  4H9Q B;  1P3A B;  4UUZ B;  1KX5 B;  5C3I C;  4LD9 D;  3REL A;  3W97 D;  1TZY A;  3X1U C;  1S32 B;  3C1C A;  3X1T A;  4EO5 B;  4QLC B;  3WA9 A;  3UTB D;  5KDM B;  4CSR B;  5B32 D;  2HUE C;  4G91 B;  1F66 C;  2FJ7 C;  2IO5 B;  1ZLA A;  3B6G C;  1BH9 A;  1P3F A;  1M19 A;  5AVB D;  3KXB A;  5BNX A;  5B24 D;  4KGC B;  5DNN B;  3LZ1 A;  3NQU B;  5G49 A;  5AV8 A;  5CHL B;  3REH C;  3AZM D;  1P3G C;  2CV5 B;  2F8N B;  3KWQ D;  5B31 G;  5GSU A;  3REL C;  3WAA D;  3A6N B;  3LEL A;  5DNM A;  1P3F B;  1EQZ A;  3C1C C;  5B0Y D;  3LJA A;  3O62 A;  5B1L C;  5BO0 A;  5JRG A;  3WA9 C;  3VH5 T;  3W96 D;  3B0D C;  4AWL C;  1KX4 B;  1ID3 D;  3AV1 C;  3AYW D;  4HGA B;  5JA4 A;  5B2I A;  2RVQ C;  4J8V D;  1TAF B;  1P3K A;  3AZG C;  1M19 C;  5B40 B;  3KXB C;  3W97 A;  3LZ1 C;  2F8N G;  5AV6 C;  3MGR B;  3REJ D;  4WU9 B;  1B6W A;  3AZJ C;  5GSU C;  5F99 D;  3UTB A;  5B32 A;  5DNM C;  1EQZ C;  3UTA B;  3X1S D;  3LJA C;  3O62 C;  1P3M B;  5JRG C;  3UT9 D;  1N1J A;  5AVB A;  4JJN C;  5CP6 B;  3AZM A;  1B67 A;  5FUG A;  3KWQ A;  5CPI C;  4LD9 C;  4E44 A;  5B0Z B;  3W97 C;  3AV2 A;  3MGP D;  3C1B B;  5B0Y A;  3MNN B;  3B6F D;  3TU4 D;  1P3L B;  3VH5 A;  1P3P D;  4YM6 B;  5B33 B;  5FUG B;  3W96 A;  3X1V D;  1ID3 A;  4J8X C;  3AYW A;  4J8V A;  2NZD B;  4DRA A;  4R8P B;  1M18 D;  5GXQ B;  5B24 C;  4XZQ B;  3REJ A;  3KUY A;  3AZM C;  2BYM A;  3REI A;  1HQ3 B;  1P3I C;  3KWQ C;  1P3O D;  4WU8 B;  3WAA C;  5AV5 A;  5F99 A;  3AZE B;  5B0Y C;  3X1S A;  3UT9 A;  4H9O A;  5B1L D;  5B1M A;  3W96 C;  4CAY A;  1ID3 C;  3AZN A;  1M1A D;  3MGQ C;  3AYW C;  3AV1 D;  5B31 D;  4G92 C;  4XUJ A;  3MVD D;  1WWI A;  3AZG D;  1A7W A;  4WZS B;  2YFW B;  3REJ C;  5B2J B;  5AV6 D;  1JFI B;  2NQB D;  4Z2M G;  3B6F A;  3V9R A;  3TU4 A;  5F99 C;  1P3P A;  5BNV B;  4KHA A;  3X1V A;  1Q9C A;  1HTA A;  4XUJ B;  5AY8 C;  3X1S C;  5E5A C;  3B0C T;  5GT3 C;  1M18 A;  3UT9 C;  4Z66 D;  3X1U B;  3B6G A;  4ZBJ C;  3WKJ D;  4J8U D;  1H3O A;  1F66 B;  2FJ7 B;  2CWE A;  3MGP C;  5CPI D;  1BFM A;  4X23 D;  1P34 D;  3B6G B;  4H9N A;  3B6F C;  1KX3 B;  3TU4 C;  1P3P C;  2ARO D;  5B1L A;  3X1V C;  3REH B;  1P3G B;  1M1A A;  3MGR D;  5B31 A;  4J8X D;  3AV1 A;  3REL B;  1M18 C;  3W98 D;  3MVD A;  1TZY B;  4NE5 A;  3AZG A;  3C1C B;  1ULY A;  3X1T B;  5AVC C;  5GT0 C;  3REK D;  5AV6 A;  3WA9 B;  2NQB A;  1P3O C;  1P3M D;  3B0D B;  4AWL B;  1P3I D;  3AZJ A;  1P3B D;  1ZLA B;  1U35 D;  2HIO D;  3AN2 C;  1BH9 B;  1M19 B;  3KXB B;  5BNX B;  4NFT A;  4Z66 A;  3LZ1 B;  5G49 B;  5AV8 B;  3KSY A;  1P3A C;  2PYO D;  1BH8 A;  1M1A C;  5B0Z D;  3AZJ B;  5GSU B;  5B31 C;  3MGQ D;  1S32 C;  4JJN A;  3WKJ A;  3MVD C;  3LEL B;  5DNM B;  1EQZ B;  4J8U A;  4KUD D;  3LJA B;  3O62 B;  5CPI A;  4LD9 A;  4H9R A;  4X23 A;  1P34 A;  5BO0 B;  5JRG B;  2NQB C;  4ZUX D;  3MGS D;  2ARO A;  3AZK D;  5JA4 B;  5B2I B;  1P3K B;  5CPJ D;  5AY8 D;  5E5A D;  4J8X A;  5AV9 D;  3W97 B;  4Z66 C;  5GT3 D;  3W98 A;  2CV5 C; 
#chains in the Genus database with same CATH topology
 3W99 D;  5B24 A;  4WU8 D;  2W8S A;  4H9P A;  3REK A;  3WKJ C;  3UTB B;  3AZE D;  5B32 B;  3WTP D;  4J8U C;  1P3I A;  2Y2K A;  1P3B A;  5CPK D;  4X23 C;  2ZY2 A;  1U35 A;  1P34 C;  3WAA A;  2HIO A;  3A1K A;  1N1J B;  5AVB B;  3AZL D;  4HGA C;  5B24 B;  1AOI D;  3EPK A;  3LZ0 D;  2ARO C;  3AFA D;  2PYO A;  3AZM B;  2G5I C;  4J8W D;  3KWQ B;  3AZH D;  3EPH A;  3MGR C;  3NQJ A;  3VH6 T;  3MGQ A;  3W98 C;  3AV2 B;  5BT1 D;  5B0Y B;  4KUD A;  1R4V A;  3REK C;  5AVC D;  2DQN C;  3UTA C;  2Y2Q A;  5GT0 D;  4DRB A;  4Z5T D;  4ZUX A;  3MGS A;  1P3M C;  3W96 B;  1ID3 B;  3AZK A;  2Y2I A;  3AYW B;  1P3B C;  4H9S A;  4J8V B;  3AZF D;  1U35 C;  2HIO C;  4YS3 D;  3AZI D;  4UPK A;  5AY8 A;  3AN2 D;  5E5A A;  5CP6 C;  5AV9 A;  5GT3 A;  3REJ B;  3KUY B;  2PYO C;  3VH5 W;  2BYM B;  3REI B;  1P3A D;  5B0Z C;  1KX5 D;  5AV5 B;  5F99 B;  1S32 D;  3WTP A;  4KUD C;  3X1S B;  5CPK A;  5B33 C;  4QLC D;  3MGP A;  3UT9 B;  4H9O B;  5B1M B;  4ZUX C;  3MGS C;  3AZL A;  4ZBJ B;  4CAY B;  1AOI A;  3LZ0 A;  3AZK C;  3AZN B;  3B0B A;  3AFA A;  4H9S C;  4R8P C;  4J8W A;  3AZH A;  5CPJ C;  3VH6 A;  2XD5 A;  4NE3 A;  2YFV A;  4KGC D;  5AV9 C;  5DNN D;  5C3I B;  3MGP B;  2CV5 D;  2F8N D;  3W99 C;  4WU8 C;  3B6F B;  2F2A C;  4WNN A;  2BYK A;  3V9R B;  3TU4 B;  2JE5 A;  5AVC A;  1P3P B;  1ZLA D;  5GT0 A;  3AZE C;  4KHA B;  3A6N D;  4Z5T A;  3WTP C;  3X1V B;  4NE6 A;  1P3F D;  1P3O A;  2HUE B;  3R45 A;  3AZF A;  5CPK C;  4YS3 A;  1M18 B;  3AZI A;  3AN2 A;  3AZL C;  1AOI C;  1KX4 D;  3LZ0 C;  3AFA C;  2RIQ A;  4H9Q A;  3LEL D;  4J8W C;  1P3A A;  4UUZ A;  3AZH C;  5B40 D;  1KX5 A;  1H3O B;  5B2J C;  4E45 A;  5BT1 C;  1S32 A;  3A1I A;  4WU9 D;  4H9N B;  4QLC A;  5KDM A;  5B1L B;  4CSR A;  1P3K D;  4Z5T C;  3UTA D;  1M1A B;  3AZF C;  3AV1 B;  5B31 B;  4YS3 C;  3AZI C;  3MVD B;  3AZG B;  4KGC A;  5DNN A;  2J8P A;  3NQU A;  5CP6 D;  5AV6 B;  4WV4 B;  2CV5 A;  2F8N A;  2NQB B;  1KX5 C;  3A6N A;  1T3U A;  3C1B D;  1KX3 C;  5BS7 A;  3MNN D;  4EO5 C;  4QLC C;  1P3L D;  4Z66 B;  4YM6 D;  5B33 D;  1KX4 A;  3F6T A;  1BH8 B;  4G91 C;  2IO5 C;  2NZD D;  1TZY C;  1TAF A;  4JJN B;  3AV2 D;  4R8P D;  3WKJ B;  5GXQ D;  3B0C W;  5B40 A;  3X1T C;  4J8U B;  4KGC C;  5DNN C;  4XZQ D;  3MGR A;  5CPI B;  4LD9 B;  4H9R B;  4X23 B;  1P34 B;  4WU9 A;  1HQ3 D;  1KU5 A;  1ZLA C;  2ARO B;  3A6N C;  2L5A A;  1P3F C;  3UTA A;  1P3M A;  5BS7 C;  4J8X B;  5AV8 C;  3KUY D;  3W98 B;  3REI D;  1KX4 C;  5AV5 D;  1F1E A;  5CP6 A;  4H9P B;  3REK B;  3LEL C;  5B40 C;  1P3I B;  5B0Z A;  1P3B B;  3WAA B;  5B2J D;  1U35 B;  3C1B A;  4WU9 C;  2HIO B;  5B1M D;  4Z2M H;  3MNN A;  3AZN D;  5B2I C;  1P3L A;  5B32 G;  4YM6 A;  5B33 A;  1P3K C;  2PYO B;  4XUJ D;  2NZD A;  3NQJ B;  3MGQ B;  4R8P A;  3X1U D;  3WTP E;  5GXQ A;  4G92 B;  5CPJ A;  4XZQ A;  4KUD B;  3UTB C;  5B32 C;  1HQ3 A;  4ZUX B;  3MGS B;  3W99 A;  4WU8 A;  2DF4 C;  3AZK B;  1F66 D;  2FJ7 D;  3C1B C;  3AZE A;  3B6G D;  5AVB C;  1WWS A;  2LY8 A;  3MNN C;  5CPJ B;  5AY8 B;  1KX3 D;  5E5A B;  1P3L C;  5AV9 B;  5GT3 B;  4YM6 C;  1W2E A;  3REH D;  1P3G D;  3W99 B;  2NZD C;  3AV2 C;  2XD1 A;  3REL D;  1TZY D;  5GXQ C;  3WTP B;  2F8N K;  4XZQ C;  3C1C D;  2YFW A;  2Y2P A;  3X1T D;  5CPK B;  5B2J A;  1HQ3 C;  3H0R C;  4M6B A;  1JFI A;  3WA9 D;  3AZL B;  1AOI B;  4J8V C;  3LZ0 B;  5BNV A;  3AFA B;  2RVQ D;  4J8W B;  1M19 D;  3IP4 C;  3AZH B;  3KXB D;  2YFV B;  3KUY C;  3LZ1 D;  2JSS A;  3REI C;  3X1U A;  5AV8 D;  3AL0 C;  5AV5 C;  4WNN B;  3AZJ D;  2BYK B;  5GSU D;  5AVC B;  5GT0 B;  4Z5T B;  5DNM D;  1EQZ D;  3VH6 W;  1F66 A;  1P3O B;  3LJA D;  3O62 D;  3AZF B;  3R45 B;  2FJ7 A;  2F8N H;  2BG1 A;  5B1M C;  4YS3 B;  5JRG D;  3AZI B;  3AZN C;  2ZY3 A;  3AN2 B;  1KX3 A;  5B2I D;  4JJN D;  4XUJ C;  3REH A;  1P3G A;  4H9Q B;  1P3A B;  4UUZ B;  1KX5 B;  5C3I C;  4LD9 D;  3REL A;  3W97 D;  1TZY A;  2Y2N A;  3X1U C;  3FDD A;  1S32 B;  3C1C A;  3X1T A;  4EO5 B;  4QLC B;  3WA9 A;  3UTB D;  5KDM B;  4CSR B;  5B32 D;  2FFF B;  2HUE C;  4G91 B;  1F66 C;  2FJ7 C;  2IO5 B;  1ZLA A;  3B6G C;  1BH9 A;  1P3F A;  1M19 A;  5AVB D;  3KXB A;  5BNX A;  5B24 D;  4KGC B;  2Y2O A;  3P5J B;  5DNN B;  3LZ1 A;  3NQU B;  5G49 A;  5AV8 A;  5CHL B;  3REH C;  3AZM D;  1P3G C;  3H0M C;  3EG5 B;  2CV5 B;  2F8N B;  2JCH A;  3KWQ D;  5B31 G;  5GSU A;  3REL C;  3WAA D;  3A6N B;  3LEL A;  5DNM A;  1P3F B;  1EQZ A;  3C1C C;  5B0Y D;  3LJA A;  3O62 A;  5B1L C;  5BO0 A;  5JRG A;  3WA9 C;  2G5H C;  3VH5 T;  3W96 D;  3B0D C;  4AWL C;  1KX4 B;  1ID3 D;  1PZR A;  3AV1 C;  3AYW D;  4HGA B;  5JA4 A;  5B2I A;  2RVQ C;  4J8V D;  1TAF B;  1P3K A;  3AZG C;  1M19 C;  5B40 B;  3KXB C;  3W97 A;  3LZ1 C;  2F8N G;  5AV6 C;  3MGR B;  3REJ D;  4WU9 B;  1B6W A;  2UWX A;  2Y2J A;  3AZJ C;  5GSU C;  4WJ3 C;  5F99 D;  3UTB A;  5B32 A;  5DNM C;  1EQZ C;  3UTA B;  3X1S D;  3LJA C;  3O62 C;  1P3M B;  5JRG C;  3UT9 D;  1N1J A;  5AVB A;  4JJN C;  5CP6 B;  3AZM A;  1B67 A;  5FUG A;  3KWQ A;  5CPI C;  4LD9 C;  4E44 A;  5B0Z B;  3W97 C;  3AV2 A;  3MGP D;  3C1B B;  2Y2L A;  5B0Y A;  3MNN B;  3B6F D;  3TU4 D;  1P3L B;  3VH5 A;  1P3P D;  4YM6 B;  5B33 B;  5FUG B;  3W96 A;  3X1V D;  2ZY5 A;  1ID3 A;  4J8X C;  3AYW A;  2Y2M A;  4J8V A;  2NZD B;  4DRA A;  4R8P B;  1M18 D;  5GXQ B;  5B24 C;  4XZQ B;  4DQY B;  3REJ A;  3KUY A;  3AZM C;  2BYM A;  3REI A;  1HQ3 B;  1P3I C;  3KWQ C;  1P3O D;  4WU8 B;  3WAA C;  5AV5 A;  5F99 A;  3AZE B;  5B0Y C;  3X1S A;  3UT9 A;  4H9O A;  5B1L D;  5B1M A;  3W96 C;  4CAY A;  1ID3 C;  2ZY4 A;  3AZN A;  1M1A D;  3MGQ C;  3AYW C;  3AV1 D;  5B31 D;  4G92 C;  4XUJ A;  3MVD D;  1WWI A;  3AZG D;  1A7W A;  4WZS B;  2YFW B;  3REJ C;  5B2J B;  5AV6 D;  1JFI B;  2NQB D;  4Z2M G;  3B6F A;  3V9R A;  3TU4 A;  5F99 C;  1P3P A;  5BNV B;  4KHA A;  3X1V A;  1HTA A;  1Q9C A;  4XUJ B;  5AY8 C;  3X1S C;  5E5A C;  3B0C T;  5GT3 C;  1M18 A;  3UT9 C;  4Z66 D;  2VQR A;  3X1U B;  3B6G A;  4ZBJ C;  3WKJ D;  4J8U D;  1H3O A;  1F66 B;  2FJ7 B;  2CWE A;  3MGP C;  5CPI D;  1BFM A;  4X23 D;  1P34 D;  3B6G B;  4H9N A;  3B6F C;  1KX3 B;  3TU4 C;  1P3P C;  2ARO D;  5B1L A;  3X1V C;  3REH B;  1P3G B;  1M1A A;  3MGR D;  5B31 A;  4J8X D;  3AV1 A;  3REL B;  2ZM5 A;  1M18 C;  3W98 D;  3MVD A;  1TZY B;  4NE5 A;  3AZG A;  3C1C B;  1ULY A;  3X1T B;  5AVC C;  5GT0 C;  3REK D;  5AV6 A;  3EPL A;  3WA9 B;  2NQB A;  1P3O C;  1P3M D;  3B0D B;  4AWL B;  1P3I D;  3KFU G;  3AZJ A;  1P3B D;  3EPJ A;  1ZLA B;  1U35 D;  2HIO D;  3AN2 C;  1BH9 B;  1M19 B;  3KXB B;  5BNX B;  4NFT A;  4Z66 A;  3LZ1 B;  3H0L C;  5G49 B;  3KSY A;  5AV8 B;  1P3A C;  2PYO D;  1BH8 A;  1M1A C;  2Y2H A;  5B0Z D;  3AZJ B;  5GSU B;  5B31 C;  3MGQ D;  1S32 C;  4JJN A;  3WKJ A;  1Z2C B;  3MVD C;  3LEL B;  5DNM B;  1EQZ B;  2Y2G A;  4J8U A;  4KUD D;  3LJA B;  3O62 B;  5CPI A;  4LD9 A;  4H9R A;  4X23 A;  1P34 A;  5BO0 B;  5JRG B;  2NQB C;  4ZUX D;  3MGS D;  2ARO A;  3AZK D;  5JA4 B;  5B2I B;  1P3K B;  5CPJ D;  5AY8 D;  5E5A D;  4J8X A;  5AV9 D;  3W97 B;  4Z66 C;  5GT3 D;  3W98 A;  2CV5 C; 
#chains in the Genus database with same CATH homology
 3W99 D;  5B24 A;  4WU8 D;  2W8S A;  4H9P A;  3REK A;  3WKJ C;  3UTB B;  3AZE D;  5B32 B;  3WTP D;  4J8U C;  1P3I A;  2Y2K A;  1P3B A;  5CPK D;  4X23 C;  2ZY2 A;  1U35 A;  1P34 C;  3WAA A;  2HIO A;  3A1K A;  1N1J B;  5AVB B;  3AZL D;  4HGA C;  5B24 B;  1AOI D;  3EPK A;  3LZ0 D;  2ARO C;  3AFA D;  2PYO A;  3AZM B;  2G5I C;  4J8W D;  3KWQ B;  3AZH D;  3EPH A;  3MGR C;  3NQJ A;  3VH6 T;  3MGQ A;  3W98 C;  3AV2 B;  5BT1 D;  5B0Y B;  4KUD A;  1R4V A;  3REK C;  5AVC D;  2DQN C;  3UTA C;  2Y2Q A;  5GT0 D;  4DRB A;  4Z5T D;  4ZUX A;  3MGS A;  1P3M C;  3W96 B;  1ID3 B;  3AZK A;  2Y2I A;  3AYW B;  1P3B C;  4H9S A;  4J8V B;  3AZF D;  1U35 C;  2HIO C;  4YS3 D;  3AZI D;  4UPK A;  5AY8 A;  3AN2 D;  5E5A A;  5CP6 C;  5AV9 A;  5GT3 A;  3REJ B;  3KUY B;  2PYO C;  3VH5 W;  2BYM B;  3REI B;  1P3A D;  5B0Z C;  1KX5 D;  5AV5 B;  5F99 B;  1S32 D;  3WTP A;  4KUD C;  3X1S B;  5CPK A;  5B33 C;  4QLC D;  3MGP A;  3UT9 B;  4H9O B;  5B1M B;  4ZUX C;  3MGS C;  3AZL A;  4ZBJ B;  4CAY B;  1AOI A;  3LZ0 A;  3AZK C;  3AZN B;  3B0B A;  3AFA A;  4H9S C;  4R8P C;  4J8W A;  3AZH A;  5CPJ C;  3VH6 A;  2XD5 A;  4NE3 A;  2YFV A;  4KGC D;  5AV9 C;  5DNN D;  5C3I B;  3MGP B;  2CV5 D;  2F8N D;  3W99 C;  4WU8 C;  3B6F B;  2F2A C;  4WNN A;  2BYK A;  3V9R B;  3TU4 B;  2JE5 A;  5AVC A;  1P3P B;  1ZLA D;  5GT0 A;  3AZE C;  4KHA B;  3A6N D;  4Z5T A;  3WTP C;  3X1V B;  4NE6 A;  1P3F D;  1P3O A;  2HUE B;  3R45 A;  3AZF A;  5CPK C;  4YS3 A;  1M18 B;  3AZI A;  3AN2 A;  3AZL C;  1AOI C;  1KX4 D;  3LZ0 C;  3AFA C;  2RIQ A;  4H9Q A;  3LEL D;  4J8W C;  1P3A A;  4UUZ A;  3AZH C;  5B40 D;  1KX5 A;  1H3O B;  5B2J C;  4E45 A;  5BT1 C;  1S32 A;  3A1I A;  4WU9 D;  4H9N B;  4QLC A;  5KDM A;  5B1L B;  4CSR A;  1P3K D;  4Z5T C;  3UTA D;  1M1A B;  3AZF C;  3AV1 B;  5B31 B;  4YS3 C;  3AZI C;  3MVD B;  3AZG B;  4KGC A;  5DNN A;  2J8P A;  3NQU A;  5CP6 D;  5AV6 B;  4WV4 B;  2CV5 A;  2F8N A;  2NQB B;  1KX5 C;  3A6N A;  1T3U A;  3C1B D;  1KX3 C;  5BS7 A;  3MNN D;  4EO5 C;  4QLC C;  1P3L D;  4Z66 B;  4YM6 D;  5B33 D;  1KX4 A;  3F6T A;  1BH8 B;  4G91 C;  2IO5 C;  2NZD D;  1TZY C;  1TAF A;  4JJN B;  3AV2 D;  4R8P D;  3WKJ B;  5GXQ D;  3B0C W;  5B40 A;  3X1T C;  4J8U B;  4KGC C;  5DNN C;  4XZQ D;  3MGR A;  5CPI B;  4LD9 B;  4H9R B;  4X23 B;  1P34 B;  4WU9 A;  1HQ3 D;  1KU5 A;  1ZLA C;  2ARO B;  3A6N C;  2L5A A;  1P3F C;  3UTA A;  1P3M A;  5BS7 C;  4J8X B;  5AV8 C;  3KUY D;  3W98 B;  3REI D;  1KX4 C;  5AV5 D;  1F1E A;  5CP6 A;  4H9P B;  3REK B;  3LEL C;  5B40 C;  1P3I B;  5B0Z A;  1P3B B;  3WAA B;  5B2J D;  1U35 B;  3C1B A;  4WU9 C;  2HIO B;  5B1M D;  4Z2M H;  3MNN A;  3AZN D;  5B2I C;  1P3L A;  5B32 G;  4YM6 A;  5B33 A;  1P3K C;  2PYO B;  4XUJ D;  2NZD A;  3NQJ B;  3MGQ B;  4R8P A;  3X1U D;  3WTP E;  5GXQ A;  4G92 B;  5CPJ A;  4XZQ A;  4KUD B;  3UTB C;  5B32 C;  1HQ3 A;  4ZUX B;  3MGS B;  3W99 A;  4WU8 A;  2DF4 C;  3AZK B;  1F66 D;  2FJ7 D;  3C1B C;  3AZE A;  3B6G D;  5AVB C;  1WWS A;  2LY8 A;  3MNN C;  5CPJ B;  5AY8 B;  1KX3 D;  5E5A B;  1P3L C;  5AV9 B;  5GT3 B;  4YM6 C;  1W2E A;  3REH D;  1P3G D;  3W99 B;  2NZD C;  3AV2 C;  2XD1 A;  3REL D;  1TZY D;  5GXQ C;  3WTP B;  2F8N K;  4XZQ C;  3C1C D;  2YFW A;  2Y2P A;  3X1T D;  5CPK B;  5B2J A;  1HQ3 C;  3H0R C;  4M6B A;  1JFI A;  3WA9 D;  3AZL B;  1AOI B;  4J8V C;  3LZ0 B;  5BNV A;  3AFA B;  2RVQ D;  4J8W B;  1M19 D;  3IP4 C;  3AZH B;  3KXB D;  2YFV B;  3KUY C;  3LZ1 D;  2JSS A;  3REI C;  3X1U A;  5AV8 D;  3AL0 C;  5AV5 C;  4WNN B;  3AZJ D;  2BYK B;  5GSU D;  5AVC B;  5GT0 B;  4Z5T B;  5DNM D;  1EQZ D;  3VH6 W;  1F66 A;  1P3O B;  3LJA D;  3O62 D;  3AZF B;  3R45 B;  2FJ7 A;  2F8N H;  2BG1 A;  5B1M C;  4YS3 B;  5JRG D;  3AZI B;  3AZN C;  2ZY3 A;  3AN2 B;  1KX3 A;  5B2I D;  4JJN D;  4XUJ C;  3REH A;  1P3G A;  4H9Q B;  1P3A B;  4UUZ B;  1KX5 B;  5C3I C;  4LD9 D;  3REL A;  3W97 D;  1TZY A;  2Y2N A;  3X1U C;  3FDD A;  1S32 B;  3C1C A;  3X1T A;  4EO5 B;  4QLC B;  3WA9 A;  3UTB D;  5KDM B;  4CSR B;  5B32 D;  2FFF B;  2HUE C;  4G91 B;  1F66 C;  2FJ7 C;  2IO5 B;  1ZLA A;  3B6G C;  1BH9 A;  1P3F A;  1M19 A;  5AVB D;  3KXB A;  5BNX A;  5B24 D;  4KGC B;  2Y2O A;  3P5J B;  5DNN B;  3LZ1 A;  3NQU B;  5G49 A;  5AV8 A;  5CHL B;  3REH C;  3AZM D;  1P3G C;  3H0M C;  3EG5 B;  2CV5 B;  2F8N B;  2JCH A;  3KWQ D;  5B31 G;  5GSU A;  3REL C;  3WAA D;  3A6N B;  3LEL A;  5DNM A;  1P3F B;  1EQZ A;  3C1C C;  5B0Y D;  3LJA A;  3O62 A;  5B1L C;  5BO0 A;  5JRG A;  3WA9 C;  2G5H C;  3VH5 T;  3W96 D;  3B0D C;  4AWL C;  1KX4 B;  1ID3 D;  1PZR A;  3AV1 C;  3AYW D;  4HGA B;  5JA4 A;  5B2I A;  2RVQ C;  4J8V D;  1TAF B;  1P3K A;  3AZG C;  1M19 C;  5B40 B;  3KXB C;  3W97 A;  3LZ1 C;  2F8N G;  5AV6 C;  3MGR B;  3REJ D;  4WU9 B;  1B6W A;  2UWX A;  2Y2J A;  3AZJ C;  5GSU C;  4WJ3 C;  5F99 D;  3UTB A;  5B32 A;  5DNM C;  1EQZ C;  3UTA B;  3X1S D;  3LJA C;  3O62 C;  1P3M B;  5JRG C;  3UT9 D;  1N1J A;  5AVB A;  4JJN C;  5CP6 B;  3AZM A;  1B67 A;  5FUG A;  3KWQ A;  5CPI C;  4LD9 C;  4E44 A;  5B0Z B;  3W97 C;  3AV2 A;  3MGP D;  3C1B B;  2Y2L A;  5B0Y A;  3MNN B;  3B6F D;  3TU4 D;  1P3L B;  3VH5 A;  1P3P D;  4YM6 B;  5B33 B;  5FUG B;  3W96 A;  3X1V D;  2ZY5 A;  1ID3 A;  4J8X C;  3AYW A;  2Y2M A;  4J8V A;  2NZD B;  4DRA A;  4R8P B;  1M18 D;  5GXQ B;  5B24 C;  4XZQ B;  4DQY B;  3REJ A;  3KUY A;  3AZM C;  2BYM A;  3REI A;  1HQ3 B;  1P3I C;  3KWQ C;  1P3O D;  4WU8 B;  3WAA C;  5AV5 A;  5F99 A;  3AZE B;  5B0Y C;  3X1S A;  3UT9 A;  4H9O A;  5B1L D;  5B1M A;  3W96 C;  4CAY A;  1ID3 C;  2ZY4 A;  3AZN A;  1M1A D;  3MGQ C;  3AYW C;  3AV1 D;  5B31 D;  4G92 C;  4XUJ A;  3MVD D;  1WWI A;  3AZG D;  1A7W A;  4WZS B;  2YFW B;  3REJ C;  5B2J B;  5AV6 D;  1JFI B;  2NQB D;  4Z2M G;  3B6F A;  3V9R A;  3TU4 A;  5F99 C;  1P3P A;  5BNV B;  4KHA A;  3X1V A;  1HTA A;  1Q9C A;  4XUJ B;  5AY8 C;  3X1S C;  5E5A C;  3B0C T;  5GT3 C;  1M18 A;  3UT9 C;  4Z66 D;  2VQR A;  3X1U B;  3B6G A;  4ZBJ C;  3WKJ D;  4J8U D;  1H3O A;  1F66 B;  2FJ7 B;  2CWE A;  3MGP C;  5CPI D;  1BFM A;  4X23 D;  1P34 D;  3B6G B;  4H9N A;  3B6F C;  1KX3 B;  3TU4 C;  1P3P C;  2ARO D;  5B1L A;  3X1V C;  3REH B;  1P3G B;  1M1A A;  3MGR D;  5B31 A;  4J8X D;  3AV1 A;  3REL B;  2ZM5 A;  1M18 C;  3W98 D;  3MVD A;  1TZY B;  4NE5 A;  3AZG A;  3C1C B;  1ULY A;  3X1T B;  5AVC C;  5GT0 C;  3REK D;  5AV6 A;  3EPL A;  3WA9 B;  2NQB A;  1P3O C;  1P3M D;  3B0D B;  4AWL B;  1P3I D;  3KFU G;  3AZJ A;  1P3B D;  3EPJ A;  1ZLA B;  1U35 D;  2HIO D;  3AN2 C;  1BH9 B;  1M19 B;  3KXB B;  5BNX B;  4NFT A;  4Z66 A;  3LZ1 B;  3H0L C;  5G49 B;  3KSY A;  5AV8 B;  1P3A C;  2PYO D;  1BH8 A;  1M1A C;  2Y2H A;  5B0Z D;  3AZJ B;  5GSU B;  5B31 C;  3MGQ D;  1S32 C;  4JJN A;  3WKJ A;  1Z2C B;  3MVD C;  3LEL B;  5DNM B;  1EQZ B;  2Y2G A;  4J8U A;  4KUD D;  3LJA B;  3O62 B;  5CPI A;  4LD9 A;  4H9R A;  4X23 A;  1P34 A;  5BO0 B;  5JRG B;  2NQB C;  4ZUX D;  3MGS D;  2ARO A;  3AZK D;  5JA4 B;  5B2I B;  1P3K B;  5CPJ D;  5AY8 D;  5E5A D;  4J8X A;  5AV9 D;  3W97 B;  4Z66 C;  5GT3 D;  3W98 A;  2CV5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...