3RELD

2.7 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b) derivatized with triamminechloroplatinum(ii) chloride
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
total genus 35
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3relD00
3X1TC 4Z5TD 5JRGD 4YM6A 2FJ7C 3AV1B 3B6GC 4DRAA 3MGRB 3WTPC 3AZJB 2F8NG 3VH6A 4R8PA 1HQ3D 5AVBD 4QLCC 1P3GD 1N1JB 3WAAC 1P3KD 1ZLAD 4CAYB 1P3IA 5JA4B 4G92B 5AY8B 3KXBB 4WU9C 4WU8D 3AZLD 1P3FC 4XZQD 4KHAB 3MVDC 3B6FC 1F1EA 3C1CC 5B40B 5B2ID 5B32B 3LZ1D 1P3AB 1P3PD 3AZKB 3AV2B 2NZDD 1WWSA 5DNND 5BS7A 4EO5B 5AV6D 3X1UD 5B0YD 5CP6C 5B24C 1M19A 3KWQA 5B1LA 3X1VB 1P3MC 1M19B 5AV8D 4Z66B 5GXQA 3AZIB 5GXQB 5DNMC 3LJAC 3LELC 4JJNC 3KUYD 3AYWD 1KX3D 1P34B 2YFVA 3VH6T 5B0ZB 5AVCC 4J8XB 2BYMB 4X23D 1AOIC 3MGQD 1WWIA 1U35D 4KUDC 1P3OB 1M18B 2CV5A 3W97C 1B6WA 4ZUXA 3WKJC 4H9RA 5GT0A 4YM6D 4UUZA 4R8PD 3UT9C 3NQUB 1KX4B 3AZEC 3MGPA 3UTAC 3O62B 1P3ID 4WZSB 2F8NK 3UTBC 3RELC 5B31A 5B31B 4J8UA 3A6NC 4G91C 5E5AB 3AN2A 3AN2B 4LD9A 5GSUC 3REKA 4LD9B 3MNNA 1M1AA 3AZNC 4HGAC 2HUEB 3X1TA 4Z5TB 5JRGB 3MGSC 5F99A 3REIA 2IO5B 2FJ7A 4ZBJB 3B6GA 5F99B 3REIB 3WTPA 2AROC 3AZMC 1M19D 5BT1D 1HQ3B 4XUJC 5B1LD 2HIOA 5AVBB 3KWQD 4G92C 5AY8C 3KXBC 1P3GB 5BNVA 1ID3C 3R45A 5B2JC 1ZLAB 3WAAA 4DRBA 5GXQD 3LZ0A 4WU8B 4WU9A 4H9SA 1BH8B 3AZLB 1P3FA 4XZQB 5B32C 5BNXA 5BNXB 3AV2C 4WNNA 5B2IB 3WTPE 3LZ1B 3TU4A 3REJA 4EO5C 1P3PB 3REJB 2NZDB 5AV6B 3C1BC 3X1UB 5B0YB 2PYOC 5CP6A 4AWLC 3AZFC 1F66C 2CV5D 5B24A 4ZUXD 5AV8B 5GT0D 4H9PB 5DNMA 4Z2MH 3LJAA 3W96C 3KUYB 3MGPD 4JJNA 1EQZA 5B0ZC 1P3BC 3AYWB 4E45A 5CPKA 4H9NA 5CPKB 4NFTA 5B31D 2NQBC 3W99C 4H9QA 4J8UD 4X23B 1AOIA 3AN2D 3MGQB 3W98C 4LD9D 3REKD 5B33C 1U35B 5CPIC 1P3LC 2CWEA 3MNND 1KX5A 1M1AD 3REHA 5AV9C 3X1TD 1HTAA 5GT3C 4YM6B 5F99D 5B32G 3REID 2FJ7D 3B6GD 3WTPD 4R8PB 3UT9A 2HIOD 3UTAA 3X1SC 3WAAD 1P3IB 4Z2MG 3RELA 4KGCC 2BYKA 4WU9D 3LZ0D 2BYKB 1P3FD 4J8VC 2YFWA 4J8WC 5GSUA 4YS3C 3TU4D 3REJD 4ZBJC 1TZYA 3MGSA 1TZYB 1P3GC 5CP6D 1P3KC 5B1MC 2AROA 3AZMA 5B24D 3AZGA 3KWQB 5B1LB 4XUJA 3AZGB 1ID3A 5B2JA 1S32C 5DNMD 3LJAD 5AV5C 4JJND 3V9RA 1EQZD 3V9RB 5CPKD 4NE5A 2YFVB 2F8NA 3WA9C 2NZDC 1Q9CA 2F8NB 5DNNC 4CSRA 3B0DC 5B0YC 1AOID 5AV8C 1KX5D 2CV5B 3REHD 4ZUXB 4H9RB 3KSYA 5GT0B 5C3IB 3AFAA 3KUYC 4UUZB 1KX3C 3UT9D 3W96A 3MGPB 3UTAD 1P3BA 3RELD 1KU5A 3AZHC 5CPJC 2NQBA 3W99A 4J8UB 5CHLB 3W98A 5BO0A 5GSUD 5B33A 3REKB 1H3OA 5BO0B 5CPIA 3MNNB 1H3OB 1M1AB 3AV1C 4YM6C 5KDMA 5AV9A 3MGRC 3AZJC 1TZYD 3X1TB 3MGSD 5GT3A 4R8PC 2FJ7B 3B6GB 4M6BA 3WTPB 2AROD 3AZMD 4QLCA 3AZGD 1P3IC 4XUJD 2HIOB 4QLCB 3X1SA 1ID3D 3WAAB 5BNVB 3R45B 5B2JD 4KGCA 3LZ0B 4WU9B 1R4VA 5B40C 3MVDA 3B6FA 1P3FB 1P3AC 3B6FB 3C1CA 3AZKC 1B67A 3C1CB 2F8ND 3B0BA 4WNNB 3VH5W 3TU4B 5BS7C 1TAFA 4H9OA 3X1VC 1M19C 5CP6B 3VH5A 5B1MA 4Z66C 5B24B 3AZIC 1P3MA 5GXQC 1S32A 3AFAD 2RVQC 5DNMB 3LELA 3LJAB 1P34C 5AV5A 3W96D 4JJNB 4J8XC 1EQZB 1P3BD 4H9NB 3WA9A 4E44A 5AVCA 2NQBD 4H9QB 3W99D 1P3OC 1M18C 1AOIB 3W98D 4KUDA 5B33D 5CPID 3W97A 4KUDB 1KX5B 3W97B 5GT0C 3REHB 3WKJA 5AV9D 1KX4C 5GT3D 5G49A 3O62C 4QLCD 3AZEA 3UT9B 3AZEB 3UTAB 3X1SD 5B31C 3UTBA 3VH5T 5E5AC 3RELB 4KGCD 3AN2C 3AZHA 4LD9C 5CPJA 3A6NA 3MVDD 3B6FD 3A6NB 4G91B 2YFWB 1BH9A 3C1CD 5GSUB 2HUEC 4Z5TC 5JRGC 3AZNA 2IO5C 3AV1A 3AZNB 5F99C 1A7WA 3REIC 3NQJA 3MGRA 3NQJB 4HGAB 3AZJA 4NE6A 3MGSB 1HQ3C 5AVBC 1N1JA 2HIOC 1ZLAC 4CAYA 5B1MD 2AROB 3AZMB 5JA4A 1P3MD 5AY8A 4XUJB 3KXBA 4WU8C 1ID3B 3LZ0C 4H9SC 5B2JB 3AZLC 1S32D 4XZQC 4KHAA 3LELD 5B40A 5AV5D 5B2IC 5B32A 3LZ1C 1P3AA 1P3PC 3TU4C 3REJC 3AZKA 3AV2A 5FUGA 3WA9D 5FUGB 4NE3A 5AV6C 5AVCD 3X1UC 4CSRB 3C1BA 5B31G 3X1VA 2PYOA 3C1BB 2PYOB 4KUDD 3AZFA 1F66A 3W97D 4AWLB 3AZFB 4Z66A 1F66B 3AZIA 3WKJD 3AFAB 1EQZC 3AYWC 1P34A 4WV4B 3AZED 5CPKC 3W96B 4J8XA 5B0ZA 3B0CW 1P3BB 3UTBD 2BYMA 4X23C 3MGQC 3AZHD 1U35C 5CPJD 2NQBB 3W99B 3A6ND 1P3OA 1M18A 1KX5C 1JFIA 3W98B 3REHC 1JFIB 1P3LA 5B33B 5CPIB 1P3LB 3AZND 3AV1D 5KDMB 5AV9B 3MGRD 3AZJD 3NQUA 5GT3B 1KX4A 3O62A 5AY8D 3KXBD 3X1SB 5E5AA 4KGCB 5B40D 3MVDB 4J8VA 4J8WA 5B32D 1P3AD 4J8VB 4J8WB 4YS3A 3AZKD 3AV2D 4YS3B 4Z5TA 5JRGA 1TZYC 5BT1C 1HQ3A 1TAFB 4H9OB 5B1LC 5AVBA 3KWQC 3C1BD 3AZGC 3X1VD 1P3KA 2PYOD 3AZFD 1ZLAA 1P3KB 1F66D 5B1MB 4Z66D 1P3MB 3AZID 4WU8A 2JSSA 3B0CT 1BH8A 3AZLA 1S32B 4XZQA 2RVQD 3LELB 1P34D 5AV5B 5B2IA 3LZ1A 4J8XD 5B0ZD 1P3PA 2NZDA 3WA9B 5DNNA 2LY8A 5AVCB 2L5AA 5AV6A 5DNNB 5B0YA 3X1UA 3B0DB 1P3OD 1M18D 2CV5C 4ZUXC 2F8NH 1P3LD 5AV8A 1BFMA 4H9PA 5C3IC 3WKJB 3AFAC 1KX4D 5G49B 3MGPC 3KUYA 3O62D 3AYWA 1KX3A 1KX3B 1P3GA 4J8UC 3UTBB 4X23A 5E5AD 3MGQA 3REKC 3AZHB 5CPJB 1U35A 3MNNC 4J8VD 1M1AC 4J8WD 3VH6W 1BH9B 4YS3D 1ULYA
chains in the Genus database with same CATH superfamily
3X1TC 4Z5TD 5JRGD 4YM6A 2FJ7C 3AV1B 3B6GC 4DRAA 3MGRB 3WTPC 3AZJB 2F8NG 3VH6A 4R8PA 1HQ3D 5AVBD 4QLCC 1P3GD 1N1JB 3WAAC 1P3KD 1W2EA 1ZLAD 4CAYB 1P3IA 5JA4B 4G92B 5AY8B 3KXBB 4WU9C 4WU8D 3EPLA 3AZLD 1P3FC 4XZQD 4KHAB 3MVDC 3B6FC 1F1EA 3C1CC 5B40B 5B2ID 5B32B 3LZ1D 1P3AB 1P3PD 3AZKB 3AV2B 2NZDD 1WWSA 5DNND 5BS7A 4EO5B 5AV6D 3X1UD 5B0YD 5CP6C 2Y2IA 5B24C 1M19A 3KWQA 5B1LA 3X1VB 1P3MC 1M19B 5AV8D 4Z66B 5GXQA 3AZIB 5GXQB 5DNMC 3LJAC 3LELC 4JJNC 3KUYD 3AYWD 1KX3D 1P34B 2YFVA 3VH6T 2XD5A 5AVCC 5B0ZB 4J8XB 2BYMB 4X23D 1AOIC 3MGQD 1WWIA 1U35D 4KUDC 1P3OB 1M18B 2CV5A 3W97C 1B6WA 4ZUXA 3WKJC 4H9RA 2XD1A 5GT0A 4YM6D 2UWXA 4UUZA 4R8PD 3UT9C 3NQUB 1KX4B 3AZEC 3MGPA 3UTAC 2Y2GA 3O62B 1P3ID 4WZSB 2F8NK 3UTBC 3RELC 5B31A 5B31B 4J8UA 3A6NC 4G91C 5E5AB 3AN2A 3AN2B 4LD9A 5GSUC 3REKA 4LD9B 3MNNA 1M1AA 3AZNC 2ZY4A 4HGAC 2HUEB 3X1TA 4Z5TB 5JRGB 3MGSC 5F99A 3REIA 2IO5B 2FJ7A 4ZBJB 3B6GA 5F99B 3REIB 3WTPA 2AROC 3AZMC 1M19D 5BT1D 1HQ3B 4XUJC 5B1LD 2HIOA 5AVBB 3KWQD 4G92C 5AY8C 3KXBC 1P3GB 5BNVA 1ID3C 3R45A 5B2JC 1ZLAB 3WAAA 4DRBA 5GXQD 3LZ0A 4WU8B 4WU9A 4H9SA 1BH8B 2DF4C 3AZLB 1P3FA 4XZQB 4WJ3C 5B32C 5BNXA 5BNXB 3AV2C 4WNNA 5B2IB 3WTPE 3LZ1B 3TU4A 3REJA 4EO5C 1P3PB 3REJB 2NZDB 5AV6B 3C1BC 3X1UB 5B0YB 2PYOC 5CP6A 4AWLC 3AZFC 1F66C 2F2AC 5B24A 2CV5D 4ZUXD 5AV8B 2J8PA 5GT0D 4H9PB 5DNMA 4Z2MH 2Y2LA 3LJAA 3W96C 3KUYB 3MGPD 4JJNA 2ZM5A 1EQZA 5B0ZC 1P3BC 3AYWB 4E45A 5CPKA 4H9NA 5CPKB 4NFTA 5B31D 2NQBC 3W99C 4H9QA 4J8UD 4X23B 1AOIA 3AN2D 3MGQB 3W98C 4LD9D 3REKD 5B33C 1U35B 5CPIC 1P3LC 2CWEA 3MNND 1KX5A 1M1AD 3REHA 5AV9C 3X1TD 1HTAA 5GT3C 4YM6B 5F99D 5B32G 3REID 2FJ7D 3B6GD 2JCHA 2VQRA 3WTPD 4R8PB 3UT9A 2HIOD 3UTAA 3X1SC 3FDDA 3WAAD 1P3IB 4Z2MG 3RELA 4KGCC 2BYKA 4WU9D 3LZ0D 2BYKB 2FFFB 4DQYB 1P3FD 4J8VC 2YFWA 4J8WC 5GSUA 4YS3C 3TU4D 3REJD 4ZBJC 1TZYA 3MGSA 1TZYB 1P3GC 5CP6D 2Y2KA 1P3KC 5B1MC 2AROA 3AZMA 5B24D 3AZGA 3KWQB 5B1LB 4XUJA 3AZGB 1ID3A 5B2JA 1S32C 5DNMD 3LJAD 5AV5C 3EG5B 4JJND 3V9RA 1EQZD 3AL0C 3V9RB 5CPKD 4NE5A 2YFVB 2F8NA 3WA9C 2NZDC 1Q9CA 2F8NB 5DNNC 4CSRA 3B0DC 5B0YC 1AOID 5AV8C 1KX5D 2CV5B 3REHD 4ZUXB 4H9RB 3KSYA 5GT0B 5C3IB 3AFAA 3KUYC 4UUZB 3EPKA 1KX3C 2G5IC 3W96A 3UT9D 3MGPB 3UTAD 1P3BA 3RELD 1KU5A 3AZHC 5CPJC 2NQBA 3W99A 4J8UB 5CHLB 3W98A 5BO0A 5GSUD 5B33A 3REKB 1H3OA 5BO0B 5CPIA 3MNNB 1H3OB 1M1AB 3AV1C 4YM6C 5KDMA 5AV9A 3MGRC 3AZJC 1TZYD 3X1TB 3MGSD 5GT3A 4R8PC 2FJ7B 3B6GB 4M6BA 3WTPB 2AROD 3AZMD 4QLCA 3AZGD 1P3IC 4XUJD 2HIOB 4QLCB 3X1SA 1ID3D 3WAAB 5BNVB 3R45B 5B2JD 4KGCA 3LZ0B 4WU9B 1R4VA 5B40C 3MVDA 3B6FA 1P3FB 1P3AC 3B6FB 3C1CA 3AZKC 1B67A 3C1CB 2F8ND 3B0BA 2JE5A 4WNNB 3VH5W 3TU4B 5BS7C 1TAFA 4H9OA 3X1VC 1M19C 5CP6B 3VH5A 5B1MA 4Z66C 5B24B 3AZIC 1P3MA 5GXQC 2ZY3A 1S32A 3AFAD 2RVQC 5DNMB 2Y2HA 3LELA 3LJAB 1P34C 5AV5A 2Y2NA 3W96D 4JJNB 4J8XC 1EQZB 1P3BD 3H0RC 4H9NB 3WA9A 4E44A 5AVCA 2Y2QA 2NQBD 4H9QB 3W99D 1P3OC 1M18C 1AOIB 3A1IA 3W98D 4KUDA 5B33D 5CPID 3W97A 4KUDB 1KX5B 3W97B 5GT0C 3REHB 3WKJA 2BG1A 5AV9D 1KX4C 5GT3D 5G49A 3O62C 4QLCD 3AZEA 3UT9B 3AZEB 3UTAB 3X1SD 5B31C 3UTBA 3VH5T 5E5AC 3RELB 4KGCD 3AN2C 3AZHA 4LD9C 5CPJA 3A6NA 3MVDD 3B6FD 3A6NB 4G91B 2YFWB 1BH9A 3C1CD 5GSUB 2HUEC 4Z5TC 5JRGC 3AZNA 2IO5C 3AV1A 3AZNB 5F99C 1A7WA 3REIC 3NQJA 3MGRA 3NQJB 4HGAB 3AZJA 4NE6A 3MGSB 1HQ3C 5AVBC 1N1JA 2HIOC 1ZLAC 4CAYA 5B1MD 2AROB 3AZMB 5JA4A 1P3MD 5AY8A 4XUJB 3KXBA 4WU8C 1ID3B 3LZ0C 4H9SC 1PZRA 5B2JB 3AZLC 1S32D 4XZQC 4KHAA 2ZY2A 3LELD 5B40A 5AV5D 5B2IC 5B32A 3LZ1C 1P3AA 1P3PC 3TU4C 3REJC 3AZKA 3AV2A 5FUGA 3WA9D 5FUGB 4NE3A 5AV6C 5AVCD 3X1UC 4CSRB 1Z2CB 3C1BA 5B31G 3X1VA 2PYOA 3C1BB 2PYOB 4KUDD 3AZFA 1F66A 3W97D 4AWLB 3AZFB 4Z66A 1F66B 3AZIA 3WKJD 2Y2JA 2DQNC 2G5HC 3AFAB 2Y2PA 2Y2MA 1EQZC 3AYWC 1P34A 4WV4B 3AZED 5CPKC 3W96B 4J8XA 5B0ZA 3B0CW 1P3BB 3UTBD 2BYMA 4X23C 3MGQC 3AZHD 1U35C 5CPJD 2NQBB 3W99B 3A6ND 1P3OA 1M18A 1KX5C 1JFIA 3W98B 3REHC 1JFIB 1P3LA 5B33B 5CPIB 1P3LB 3AZND 3F6TA 3AV1D 5KDMB 5AV9B 3MGRD 3AZJD 3NQUA 5GT3B 1KX4A 3O62A 3EPJA 2Y2OA 1T3UA 5AY8D 3KXBD 3X1SB 5E5AA 4KGCB 3H0MC 5B40D 3MVDB 3P5JB 4J8VA 4J8WA 5B32D 1P3AD 4J8VB 4J8WB 4UPKA 4YS3A 3AZKD 3H0LC 3AV2D 4YS3B 4Z5TA 5JRGA 1TZYC 3EPHA 3A1KA 2ZY5A 5BT1C 5AVBA 1HQ3A 1TAFB 4H9OB 5B1LC 3KWQC 3C1BD 3AZGC 3X1VD 1P3KA 2PYOD 3AZFD 1ZLAA 1P3KB 1F66D 5B1MB 4Z66D 1P3MB 3AZID 4WU8A 2JSSA 3B0CT 1BH8A 3AZLA 1S32B 4XZQA 2RVQD 3LELB 1P34D 5AV5B 5B2IA 3LZ1A 4J8XD 5B0ZD 1P3PA 2NZDA 2W8SA 3WA9B 5DNNA 2LY8A 5AVCB 2L5AA 5AV6A 5DNNB 5B0YA 3X1UA 3B0DB 1P3OD 2RIQA 1M18D 2CV5C 4ZUXC 2F8NH 1P3LD 5AV8A 1BFMA 4H9PA 5C3IC 3WKJB 3AFAC 1KX4D 5G49B 3MGPC 3KUYA 3O62D 3AYWA 1KX3A 1KX3B 3IP4C 1P3GA 4J8UC 3UTBB 4X23A 5E5AD 3MGQA 3KFUG 3REKC 3AZHB 5CPJB 1U35A 3MNNC 4J8VD 1M1AC 4J8WD 3VH6W 1BH9B 4YS3D 1ULYA
chains in the Genus database with same CATH topology
3X1TC 4Z5TD 5JRGD 4YM6A 2FJ7C 3AV1B 3B6GC 4DRAA 3MGRB 3WTPC 3AZJB 2F8NG 3VH6A 4R8PA 1HQ3D 5AVBD 4QLCC 1P3GD 1N1JB 3WAAC 1P3KD 1W2EA 1ZLAD 4CAYB 1P3IA 5JA4B 4G92B 5AY8B 3KXBB 4WU9C 4WU8D 3EPLA 3AZLD 1P3FC 4XZQD 4KHAB 3MVDC 3B6FC 1F1EA 3C1CC 5B40B 5B2ID 5B32B 3LZ1D 1P3AB 1P3PD 3AZKB 3AV2B 2NZDD 1WWSA 5DNND 5BS7A 4EO5B 5AV6D 3X1UD 5B0YD 5CP6C 2Y2IA 5B24C 1M19A 3KWQA 5B1LA 3X1VB 1P3MC 1M19B 5AV8D 4Z66B 5GXQA 3AZIB 5GXQB 5DNMC 3LJAC 3LELC 4JJNC 3KUYD 3AYWD 1KX3D 1P34B 2YFVA 3VH6T 2XD5A 5AVCC 5B0ZB 4J8XB 2BYMB 4X23D 1AOIC 3MGQD 1WWIA 1U35D 4KUDC 1P3OB 1M18B 2CV5A 3W97C 1B6WA 4ZUXA 3WKJC 4H9RA 2XD1A 5GT0A 4YM6D 2UWXA 4UUZA 4R8PD 3UT9C 3NQUB 1KX4B 3AZEC 3MGPA 3UTAC 2Y2GA 3O62B 1P3ID 4WZSB 2F8NK 3UTBC 3RELC 5B31A 5B31B 4J8UA 3A6NC 4G91C 5E5AB 3AN2A 3AN2B 4LD9A 5GSUC 3REKA 4LD9B 3MNNA 1M1AA 3AZNC 2ZY4A 4HGAC 2HUEB 3X1TA 4Z5TB 5JRGB 3MGSC 5F99A 3REIA 2IO5B 2FJ7A 4ZBJB 3B6GA 5F99B 3REIB 3WTPA 2AROC 3AZMC 1M19D 5BT1D 1HQ3B 4XUJC 5B1LD 2HIOA 5AVBB 3KWQD 4G92C 5AY8C 3KXBC 1P3GB 5BNVA 1ID3C 3R45A 5B2JC 1ZLAB 3WAAA 4DRBA 5GXQD 3LZ0A 4WU8B 4WU9A 4H9SA 1BH8B 2DF4C 3AZLB 1P3FA 4XZQB 4WJ3C 5B32C 5BNXA 5BNXB 3AV2C 4WNNA 5B2IB 3WTPE 3LZ1B 3TU4A 3REJA 4EO5C 1P3PB 3REJB 2NZDB 5AV6B 3C1BC 3X1UB 5B0YB 2PYOC 5CP6A 4AWLC 3AZFC 1F66C 2F2AC 5B24A 2CV5D 4ZUXD 5AV8B 2J8PA 5GT0D 4H9PB 5DNMA 4Z2MH 2Y2LA 3LJAA 3W96C 3KUYB 3MGPD 4JJNA 2ZM5A 1EQZA 5B0ZC 1P3BC 3AYWB 4E45A 5CPKA 4H9NA 5CPKB 4NFTA 5B31D 2NQBC 3W99C 4H9QA 4J8UD 4X23B 1AOIA 3AN2D 3MGQB 3W98C 4LD9D 3REKD 5B33C 1U35B 5CPIC 1P3LC 2CWEA 3MNND 1KX5A 1M1AD 3REHA 5AV9C 3X1TD 1HTAA 5GT3C 4YM6B 5F99D 5B32G 3REID 2FJ7D 3B6GD 2JCHA 2VQRA 3WTPD 4R8PB 3UT9A 2HIOD 3UTAA 3X1SC 3FDDA 3WAAD 1P3IB 4Z2MG 3RELA 4KGCC 2BYKA 4WU9D 3LZ0D 2BYKB 2FFFB 4DQYB 1P3FD 4J8VC 2YFWA 4J8WC 5GSUA 4YS3C 3TU4D 3REJD 4ZBJC 1TZYA 3MGSA 1TZYB 1P3GC 5CP6D 2Y2KA 1P3KC 5B1MC 2AROA 3AZMA 5B24D 3AZGA 3KWQB 5B1LB 4XUJA 3AZGB 1ID3A 5B2JA 1S32C 5DNMD 3LJAD 5AV5C 3EG5B 4JJND 3V9RA 1EQZD 3AL0C 3V9RB 5CPKD 4NE5A 2YFVB 2F8NA 3WA9C 2NZDC 1Q9CA 2F8NB 5DNNC 4CSRA 3B0DC 5B0YC 1AOID 5AV8C 1KX5D 2CV5B 3REHD 4ZUXB 4H9RB 3KSYA 5GT0B 5C3IB 3AFAA 3KUYC 4UUZB 3EPKA 1KX3C 2G5IC 3W96A 3UT9D 3MGPB 3UTAD 1P3BA 3RELD 1KU5A 3AZHC 5CPJC 2NQBA 3W99A 4J8UB 5CHLB 3W98A 5BO0A 5GSUD 5B33A 3REKB 1H3OA 5BO0B 5CPIA 3MNNB 1H3OB 1M1AB 3AV1C 4YM6C 5KDMA 5AV9A 3MGRC 3AZJC 1TZYD 3X1TB 3MGSD 5GT3A 4R8PC 2FJ7B 3B6GB 4M6BA 3WTPB 2AROD 3AZMD 4QLCA 3AZGD 1P3IC 4XUJD 2HIOB 4QLCB 3X1SA 1ID3D 3WAAB 5BNVB 3R45B 5B2JD 4KGCA 3LZ0B 4WU9B 1R4VA 5B40C 3MVDA 3B6FA 1P3FB 1P3AC 3B6FB 3C1CA 3AZKC 1B67A 3C1CB 2F8ND 3B0BA 2JE5A 4WNNB 3VH5W 3TU4B 5BS7C 1TAFA 4H9OA 3X1VC 1M19C 5CP6B 3VH5A 5B1MA 4Z66C 5B24B 3AZIC 1P3MA 5GXQC 2ZY3A 1S32A 3AFAD 2RVQC 5DNMB 2Y2HA 3LELA 3LJAB 1P34C 5AV5A 2Y2NA 3W96D 4JJNB 4J8XC 1EQZB 1P3BD 3H0RC 4H9NB 3WA9A 4E44A 5AVCA 2Y2QA 2NQBD 4H9QB 3W99D 1P3OC 1M18C 1AOIB 3A1IA 3W98D 4KUDA 5B33D 5CPID 3W97A 4KUDB 1KX5B 3W97B 5GT0C 3REHB 3WKJA 2BG1A 5AV9D 1KX4C 5GT3D 5G49A 3O62C 4QLCD 3AZEA 3UT9B 3AZEB 3UTAB 3X1SD 5B31C 3UTBA 3VH5T 5E5AC 3RELB 4KGCD 3AN2C 3AZHA 4LD9C 5CPJA 3A6NA 3MVDD 3B6FD 3A6NB 4G91B 2YFWB 1BH9A 3C1CD 5GSUB 2HUEC 4Z5TC 5JRGC 3AZNA 2IO5C 3AV1A 3AZNB 5F99C 1A7WA 3REIC 3NQJA 3MGRA 3NQJB 4HGAB 3AZJA 4NE6A 3MGSB 1HQ3C 5AVBC 1N1JA 2HIOC 1ZLAC 4CAYA 5B1MD 2AROB 3AZMB 5JA4A 1P3MD 5AY8A 4XUJB 3KXBA 4WU8C 1ID3B 3LZ0C 4H9SC 1PZRA 5B2JB 3AZLC 1S32D 4XZQC 4KHAA 2ZY2A 3LELD 5B40A 5AV5D 5B2IC 5B32A 3LZ1C 1P3AA 1P3PC 3TU4C 3REJC 3AZKA 3AV2A 5FUGA 3WA9D 5FUGB 4NE3A 5AV6C 5AVCD 3X1UC 4CSRB 1Z2CB 3C1BA 5B31G 3X1VA 2PYOA 3C1BB 2PYOB 4KUDD 3AZFA 1F66A 3W97D 4AWLB 3AZFB 4Z66A 1F66B 3AZIA 3WKJD 2Y2JA 2DQNC 2G5HC 3AFAB 2Y2PA 2Y2MA 1EQZC 3AYWC 1P34A 4WV4B 3AZED 5CPKC 3W96B 4J8XA 5B0ZA 3B0CW 1P3BB 3UTBD 2BYMA 4X23C 3MGQC 3AZHD 1U35C 5CPJD 2NQBB 3W99B 3A6ND 1P3OA 1M18A 1KX5C 1JFIA 3W98B 3REHC 1JFIB 1P3LA 5B33B 5CPIB 1P3LB 3AZND 3F6TA 3AV1D 5KDMB 5AV9B 3MGRD 3AZJD 3NQUA 5GT3B 1KX4A 3O62A 3EPJA 2Y2OA 1T3UA 5AY8D 3KXBD 3X1SB 5E5AA 4KGCB 3H0MC 5B40D 3MVDB 3P5JB 4J8VA 4J8WA 5B32D 1P3AD 4J8VB 4J8WB 4UPKA 4YS3A 3AZKD 3H0LC 3AV2D 4YS3B 4Z5TA 5JRGA 1TZYC 3EPHA 3A1KA 2ZY5A 5BT1C 5AVBA 1HQ3A 1TAFB 4H9OB 5B1LC 3KWQC 3C1BD 3AZGC 3X1VD 1P3KA 2PYOD 3AZFD 1ZLAA 1P3KB 1F66D 5B1MB 4Z66D 1P3MB 3AZID 4WU8A 2JSSA 3B0CT 1BH8A 3AZLA 1S32B 4XZQA 2RVQD 3LELB 1P34D 5AV5B 5B2IA 3LZ1A 4J8XD 5B0ZD 1P3PA 2NZDA 2W8SA 3WA9B 5DNNA 2LY8A 5AVCB 2L5AA 5AV6A 5DNNB 5B0YA 3X1UA 3B0DB 1P3OD 2RIQA 1M18D 2CV5C 4ZUXC 2F8NH 1P3LD 5AV8A 1BFMA 4H9PA 5C3IC 3WKJB 3AFAC 1KX4D 5G49B 3MGPC 3KUYA 3O62D 3AYWA 1KX3A 1KX3B 3IP4C 1P3GA 4J8UC 3UTBB 4X23A 5E5AD 3MGQA 3KFUG 3REKC 3AZHB 5CPJB 1U35A 3MNNC 4J8VD 1M1AC 4J8WD 3VH6W 1BH9B 4YS3D 1ULYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1T C;  4Z5T D;  5JRG D;  4YM6 A;  2FJ7 C;  3AV1 B;  3B6G C;  4DRA A;  3MGR B;  3WTP C;  3AZJ B;  2F8N G;  3VH6 A;  4R8P A;  1HQ3 D;  5AVB D;  4QLC C;  1P3G D;  1N1J B;  3WAA C;  1P3K D;  1ZLA D;  4CAY B;  1P3I A;  5JA4 B;  4G92 B;  5AY8 B;  3KXB B;  4WU9 C;  4WU8 D;  3AZL D;  1P3F C;  4XZQ D;  4KHA B;  3MVD C;  3B6F C;  1F1E A;  3C1C C;  5B40 B;  5B2I D;  5B32 B;  3LZ1 D;  1P3A B;  1P3P D;  3AZK B;  3AV2 B;  2NZD D;  1WWS A;  5DNN D;  5BS7 A;  4EO5 B;  5AV6 D;  3X1U D;  5B0Y D;  5CP6 C;  5B24 C;  1M19 A;  3KWQ A;  5B1L A;  3X1V B;  1P3M C;  1M19 B;  5AV8 D;  4Z66 B;  5GXQ A;  3AZI B;  5GXQ B;  5DNM C;  3LJA C;  3LEL C;  4JJN C;  3KUY D;  3AYW D;  1KX3 D;  1P34 B;  2YFV A;  3VH6 T;  5B0Z B;  5AVC C;  4J8X B;  2BYM B;  4X23 D;  1AOI C;  3MGQ D;  1WWI A;  1U35 D;  4KUD C;  1P3O B;  1M18 B;  2CV5 A;  3W97 C;  1B6W A;  4ZUX A;  3WKJ C;  4H9R A;  5GT0 A;  4YM6 D;  4UUZ A;  4R8P D;  3UT9 C;  3NQU B;  1KX4 B;  3AZE C;  3MGP A;  3UTA C;  3O62 B;  1P3I D;  4WZS B;  2F8N K;  3UTB C;  3REL C;  5B31 A;  5B31 B;  4J8U A;  3A6N C;  4G91 C;  5E5A B;  3AN2 A;  3AN2 B;  4LD9 A;  5GSU C;  3REK A;  4LD9 B;  3MNN A;  1M1A A;  3AZN C;  4HGA C;  2HUE B;  3X1T A;  4Z5T B;  5JRG B;  3MGS C;  5F99 A;  3REI A;  2IO5 B;  2FJ7 A;  4ZBJ B;  3B6G A;  5F99 B;  3REI B;  3WTP A;  2ARO C;  3AZM C;  1M19 D;  5BT1 D;  1HQ3 B;  4XUJ C;  5B1L D;  2HIO A;  5AVB B;  3KWQ D;  4G92 C;  5AY8 C;  3KXB C;  1P3G B;  5BNV A;  1ID3 C;  3R45 A;  5B2J C;  1ZLA B;  3WAA A;  4DRB A;  5GXQ D;  3LZ0 A;  4WU8 B;  4WU9 A;  4H9S A;  1BH8 B;  3AZL B;  1P3F A;  4XZQ B;  5B32 C;  5BNX A;  5BNX B;  3AV2 C;  4WNN A;  5B2I B;  3WTP E;  3LZ1 B;  3TU4 A;  3REJ A;  4EO5 C;  1P3P B;  3REJ B;  2NZD B;  5AV6 B;  3C1B C;  3X1U B;  5B0Y B;  2PYO C;  5CP6 A;  4AWL C;  3AZF C;  1F66 C;  2CV5 D;  5B24 A;  4ZUX D;  5AV8 B;  5GT0 D;  4H9P B;  5DNM A;  4Z2M H;  3LJA A;  3W96 C;  3KUY B;  3MGP D;  4JJN A;  1EQZ A;  5B0Z C;  1P3B C;  3AYW B;  4E45 A;  5CPK A;  4H9N A;  5CPK B;  4NFT A;  5B31 D;  2NQB C;  3W99 C;  4H9Q A;  4J8U D;  4X23 B;  1AOI A;  3AN2 D;  3MGQ B;  3W98 C;  4LD9 D;  3REK D;  5B33 C;  1U35 B;  5CPI C;  1P3L C;  2CWE A;  3MNN D;  1KX5 A;  1M1A D;  3REH A;  5AV9 C;  3X1T D;  1HTA A;  5GT3 C;  4YM6 B;  5F99 D;  5B32 G;  3REI D;  2FJ7 D;  3B6G D;  3WTP D;  4R8P B;  3UT9 A;  2HIO D;  3UTA A;  3X1S C;  3WAA D;  1P3I B;  4Z2M G;  3REL A;  4KGC C;  2BYK A;  4WU9 D;  3LZ0 D;  2BYK B;  1P3F D;  4J8V C;  2YFW A;  4J8W C;  5GSU A;  4YS3 C;  3TU4 D;  3REJ D;  4ZBJ C;  1TZY A;  3MGS A;  1TZY B;  1P3G C;  5CP6 D;  1P3K C;  5B1M C;  2ARO A;  3AZM A;  5B24 D;  3AZG A;  3KWQ B;  5B1L B;  4XUJ A;  3AZG B;  1ID3 A;  5B2J A;  1S32 C;  5DNM D;  3LJA D;  5AV5 C;  4JJN D;  3V9R A;  1EQZ D;  3V9R B;  5CPK D;  4NE5 A;  2YFV B;  2F8N A;  3WA9 C;  2NZD C;  1Q9C A;  2F8N B;  5DNN C;  4CSR A;  3B0D C;  5B0Y C;  1AOI D;  5AV8 C;  1KX5 D;  2CV5 B;  3REH D;  4ZUX B;  4H9R B;  3KSY A;  5GT0 B;  5C3I B;  3AFA A;  3KUY C;  4UUZ B;  1KX3 C;  3UT9 D;  3W96 A;  3MGP B;  3UTA D;  1P3B A;  3REL D;  1KU5 A;  3AZH C;  5CPJ C;  2NQB A;  3W99 A;  4J8U B;  5CHL B;  3W98 A;  5BO0 A;  5GSU D;  5B33 A;  3REK B;  1H3O A;  5BO0 B;  5CPI A;  3MNN B;  1H3O B;  1M1A B;  3AV1 C;  4YM6 C;  5KDM A;  5AV9 A;  3MGR C;  3AZJ C;  1TZY D;  3X1T B;  3MGS D;  5GT3 A;  4R8P C;  2FJ7 B;  3B6G B;  4M6B A;  3WTP B;  2ARO D;  3AZM D;  4QLC A;  3AZG D;  1P3I C;  4XUJ D;  2HIO B;  4QLC B;  3X1S A;  1ID3 D;  3WAA B;  5BNV B;  3R45 B;  5B2J D;  4KGC A;  3LZ0 B;  4WU9 B;  1R4V A;  5B40 C;  3MVD A;  3B6F A;  1P3F B;  1P3A C;  3B6F B;  3C1C A;  3AZK C;  1B67 A;  3C1C B;  2F8N D;  3B0B A;  4WNN B;  3VH5 W;  3TU4 B;  5BS7 C;  1TAF A;  4H9O A;  3X1V C;  1M19 C;  5CP6 B;  3VH5 A;  5B1M A;  4Z66 C;  5B24 B;  3AZI C;  1P3M A;  5GXQ C;  1S32 A;  3AFA D;  2RVQ C;  5DNM B;  3LEL A;  3LJA B;  1P34 C;  5AV5 A;  3W96 D;  4JJN B;  4J8X C;  1EQZ B;  1P3B D;  4H9N B;  3WA9 A;  4E44 A;  5AVC A;  2NQB D;  4H9Q B;  3W99 D;  1P3O C;  1M18 C;  1AOI B;  3W98 D;  4KUD A;  5B33 D;  5CPI D;  3W97 A;  4KUD B;  1KX5 B;  3W97 B;  5GT0 C;  3REH B;  3WKJ A;  5AV9 D;  1KX4 C;  5GT3 D;  5G49 A;  3O62 C;  4QLC D;  3AZE A;  3UT9 B;  3AZE B;  3UTA B;  3X1S D;  5B31 C;  3UTB A;  3VH5 T;  5E5A C;  3REL B;  4KGC D;  3AN2 C;  3AZH A;  4LD9 C;  5CPJ A;  3A6N A;  3MVD D;  3B6F D;  3A6N B;  4G91 B;  2YFW B;  1BH9 A;  3C1C D;  5GSU B;  2HUE C;  4Z5T C;  5JRG C;  3AZN A;  2IO5 C;  3AV1 A;  3AZN B;  5F99 C;  1A7W A;  3REI C;  3NQJ A;  3MGR A;  3NQJ B;  4HGA B;  3AZJ A;  4NE6 A;  3MGS B;  1HQ3 C;  5AVB C;  1N1J A;  2HIO C;  1ZLA C;  4CAY A;  5B1M D;  2ARO B;  3AZM B;  5JA4 A;  1P3M D;  5AY8 A;  4XUJ B;  3KXB A;  4WU8 C;  1ID3 B;  3LZ0 C;  4H9S C;  5B2J B;  3AZL C;  1S32 D;  4XZQ C;  4KHA A;  3LEL D;  5B40 A;  5AV5 D;  5B2I C;  5B32 A;  3LZ1 C;  1P3A A;  1P3P C;  3TU4 C;  3REJ C;  3AZK A;  3AV2 A;  5FUG A;  3WA9 D;  5FUG B;  4NE3 A;  5AV6 C;  5AVC D;  3X1U C;  4CSR B;  3C1B A;  5B31 G;  3X1V A;  2PYO A;  3C1B B;  2PYO B;  4KUD D;  3AZF A;  1F66 A;  3W97 D;  4AWL B;  3AZF B;  4Z66 A;  1F66 B;  3AZI A;  3WKJ D;  3AFA B;  1EQZ C;  3AYW C;  1P34 A;  4WV4 B;  3AZE D;  5CPK C;  3W96 B;  4J8X A;  5B0Z A;  3B0C W;  1P3B B;  3UTB D;  2BYM A;  4X23 C;  3MGQ C;  3AZH D;  1U35 C;  5CPJ D;  2NQB B;  3W99 B;  3A6N D;  1P3O A;  1M18 A;  1KX5 C;  1JFI A;  3W98 B;  3REH C;  1JFI B;  1P3L A;  5B33 B;  5CPI B;  1P3L B;  3AZN D;  3AV1 D;  5KDM B;  5AV9 B;  3MGR D;  3AZJ D;  3NQU A;  5GT3 B;  1KX4 A;  3O62 A;  5AY8 D;  3KXB D;  3X1S B;  5E5A A;  4KGC B;  5B40 D;  3MVD B;  4J8V A;  4J8W A;  5B32 D;  1P3A D;  4J8V B;  4J8W B;  4YS3 A;  3AZK D;  3AV2 D;  4YS3 B;  4Z5T A;  5JRG A;  1TZY C;  5BT1 C;  1HQ3 A;  1TAF B;  4H9O B;  5B1L C;  5AVB A;  3KWQ C;  3C1B D;  3AZG C;  3X1V D;  1P3K A;  2PYO D;  3AZF D;  1ZLA A;  1P3K B;  1F66 D;  5B1M B;  4Z66 D;  1P3M B;  3AZI D;  4WU8 A;  2JSS A;  3B0C T;  1BH8 A;  3AZL A;  1S32 B;  4XZQ A;  2RVQ D;  3LEL B;  1P34 D;  5AV5 B;  5B2I A;  3LZ1 A;  4J8X D;  5B0Z D;  1P3P A;  2NZD A;  3WA9 B;  5DNN A;  2LY8 A;  5AVC B;  2L5A A;  5AV6 A;  5DNN B;  5B0Y A;  3X1U A;  3B0D B;  1P3O D;  1M18 D;  2CV5 C;  4ZUX C;  2F8N H;  1P3L D;  5AV8 A;  1BFM A;  4H9P A;  5C3I C;  3WKJ B;  3AFA C;  1KX4 D;  5G49 B;  3MGP C;  3KUY A;  3O62 D;  3AYW A;  1KX3 A;  1KX3 B;  1P3G A;  4J8U C;  3UTB B;  4X23 A;  5E5A D;  3MGQ A;  3REK C;  3AZH B;  5CPJ B;  1U35 A;  3MNN C;  4J8V D;  1M1A C;  4J8W D;  3VH6 W;  1BH9 B;  4YS3 D;  1ULY A; 
#chains in the Genus database with same CATH topology
 3X1T C;  4Z5T D;  5JRG D;  4YM6 A;  2FJ7 C;  3AV1 B;  3B6G C;  4DRA A;  3MGR B;  3WTP C;  3AZJ B;  2F8N G;  3VH6 A;  4R8P A;  1HQ3 D;  5AVB D;  4QLC C;  1P3G D;  1N1J B;  3WAA C;  1P3K D;  1W2E A;  1ZLA D;  4CAY B;  1P3I A;  5JA4 B;  4G92 B;  5AY8 B;  3KXB B;  4WU9 C;  4WU8 D;  3EPL A;  3AZL D;  1P3F C;  4XZQ D;  4KHA B;  3MVD C;  3B6F C;  1F1E A;  3C1C C;  5B40 B;  5B2I D;  5B32 B;  3LZ1 D;  1P3A B;  1P3P D;  3AZK B;  3AV2 B;  2NZD D;  1WWS A;  5DNN D;  5BS7 A;  4EO5 B;  5AV6 D;  3X1U D;  5B0Y D;  5CP6 C;  2Y2I A;  5B24 C;  1M19 A;  3KWQ A;  5B1L A;  3X1V B;  1P3M C;  1M19 B;  5AV8 D;  4Z66 B;  5GXQ A;  3AZI B;  5GXQ B;  5DNM C;  3LJA C;  3LEL C;  4JJN C;  3KUY D;  3AYW D;  1KX3 D;  1P34 B;  2YFV A;  3VH6 T;  2XD5 A;  5AVC C;  5B0Z B;  4J8X B;  2BYM B;  4X23 D;  1AOI C;  3MGQ D;  1WWI A;  1U35 D;  4KUD C;  1P3O B;  1M18 B;  2CV5 A;  3W97 C;  1B6W A;  4ZUX A;  3WKJ C;  4H9R A;  2XD1 A;  5GT0 A;  4YM6 D;  2UWX A;  4UUZ A;  4R8P D;  3UT9 C;  3NQU B;  1KX4 B;  3AZE C;  3MGP A;  3UTA C;  2Y2G A;  3O62 B;  1P3I D;  4WZS B;  2F8N K;  3UTB C;  3REL C;  5B31 A;  5B31 B;  4J8U A;  3A6N C;  4G91 C;  5E5A B;  3AN2 A;  3AN2 B;  4LD9 A;  5GSU C;  3REK A;  4LD9 B;  3MNN A;  1M1A A;  3AZN C;  2ZY4 A;  4HGA C;  2HUE B;  3X1T A;  4Z5T B;  5JRG B;  3MGS C;  5F99 A;  3REI A;  2IO5 B;  2FJ7 A;  4ZBJ B;  3B6G A;  5F99 B;  3REI B;  3WTP A;  2ARO C;  3AZM C;  1M19 D;  5BT1 D;  1HQ3 B;  4XUJ C;  5B1L D;  2HIO A;  5AVB B;  3KWQ D;  4G92 C;  5AY8 C;  3KXB C;  1P3G B;  5BNV A;  1ID3 C;  3R45 A;  5B2J C;  1ZLA B;  3WAA A;  4DRB A;  5GXQ D;  3LZ0 A;  4WU8 B;  4WU9 A;  4H9S A;  1BH8 B;  2DF4 C;  3AZL B;  1P3F A;  4XZQ B;  4WJ3 C;  5B32 C;  5BNX A;  5BNX B;  3AV2 C;  4WNN A;  5B2I B;  3WTP E;  3LZ1 B;  3TU4 A;  3REJ A;  4EO5 C;  1P3P B;  3REJ B;  2NZD B;  5AV6 B;  3C1B C;  3X1U B;  5B0Y B;  2PYO C;  5CP6 A;  4AWL C;  3AZF C;  1F66 C;  2F2A C;  5B24 A;  2CV5 D;  4ZUX D;  5AV8 B;  2J8P A;  5GT0 D;  4H9P B;  5DNM A;  4Z2M H;  2Y2L A;  3LJA A;  3W96 C;  3KUY B;  3MGP D;  4JJN A;  2ZM5 A;  1EQZ A;  5B0Z C;  1P3B C;  3AYW B;  4E45 A;  5CPK A;  4H9N A;  5CPK B;  4NFT A;  5B31 D;  2NQB C;  3W99 C;  4H9Q A;  4J8U D;  4X23 B;  1AOI A;  3AN2 D;  3MGQ B;  3W98 C;  4LD9 D;  3REK D;  5B33 C;  1U35 B;  5CPI C;  1P3L C;  2CWE A;  3MNN D;  1KX5 A;  1M1A D;  3REH A;  5AV9 C;  3X1T D;  1HTA A;  5GT3 C;  4YM6 B;  5F99 D;  5B32 G;  3REI D;  2FJ7 D;  3B6G D;  2JCH A;  2VQR A;  3WTP D;  4R8P B;  3UT9 A;  2HIO D;  3UTA A;  3X1S C;  3FDD A;  3WAA D;  1P3I B;  4Z2M G;  3REL A;  4KGC C;  2BYK A;  4WU9 D;  3LZ0 D;  2BYK B;  2FFF B;  4DQY B;  1P3F D;  4J8V C;  2YFW A;  4J8W C;  5GSU A;  4YS3 C;  3TU4 D;  3REJ D;  4ZBJ C;  1TZY A;  3MGS A;  1TZY B;  1P3G C;  5CP6 D;  2Y2K A;  1P3K C;  5B1M C;  2ARO A;  3AZM A;  5B24 D;  3AZG A;  3KWQ B;  5B1L B;  4XUJ A;  3AZG B;  1ID3 A;  5B2J A;  1S32 C;  5DNM D;  3LJA D;  5AV5 C;  3EG5 B;  4JJN D;  3V9R A;  1EQZ D;  3AL0 C;  3V9R B;  5CPK D;  4NE5 A;  2YFV B;  2F8N A;  3WA9 C;  2NZD C;  1Q9C A;  2F8N B;  5DNN C;  4CSR A;  3B0D C;  5B0Y C;  1AOI D;  5AV8 C;  1KX5 D;  2CV5 B;  3REH D;  4ZUX B;  4H9R B;  3KSY A;  5GT0 B;  5C3I B;  3AFA A;  3KUY C;  4UUZ B;  3EPK A;  1KX3 C;  2G5I C;  3W96 A;  3UT9 D;  3MGP B;  3UTA D;  1P3B A;  3REL D;  1KU5 A;  3AZH C;  5CPJ C;  2NQB A;  3W99 A;  4J8U B;  5CHL B;  3W98 A;  5BO0 A;  5GSU D;  5B33 A;  3REK B;  1H3O A;  5BO0 B;  5CPI A;  3MNN B;  1H3O B;  1M1A B;  3AV1 C;  4YM6 C;  5KDM A;  5AV9 A;  3MGR C;  3AZJ C;  1TZY D;  3X1T B;  3MGS D;  5GT3 A;  4R8P C;  2FJ7 B;  3B6G B;  4M6B A;  3WTP B;  2ARO D;  3AZM D;  4QLC A;  3AZG D;  1P3I C;  4XUJ D;  2HIO B;  4QLC B;  3X1S A;  1ID3 D;  3WAA B;  5BNV B;  3R45 B;  5B2J D;  4KGC A;  3LZ0 B;  4WU9 B;  1R4V A;  5B40 C;  3MVD A;  3B6F A;  1P3F B;  1P3A C;  3B6F B;  3C1C A;  3AZK C;  1B67 A;  3C1C B;  2F8N D;  3B0B A;  2JE5 A;  4WNN B;  3VH5 W;  3TU4 B;  5BS7 C;  1TAF A;  4H9O A;  3X1V C;  1M19 C;  5CP6 B;  3VH5 A;  5B1M A;  4Z66 C;  5B24 B;  3AZI C;  1P3M A;  5GXQ C;  2ZY3 A;  1S32 A;  3AFA D;  2RVQ C;  5DNM B;  2Y2H A;  3LEL A;  3LJA B;  1P34 C;  5AV5 A;  2Y2N A;  3W96 D;  4JJN B;  4J8X C;  1EQZ B;  1P3B D;  3H0R C;  4H9N B;  3WA9 A;  4E44 A;  5AVC A;  2Y2Q A;  2NQB D;  4H9Q B;  3W99 D;  1P3O C;  1M18 C;  1AOI B;  3A1I A;  3W98 D;  4KUD A;  5B33 D;  5CPI D;  3W97 A;  4KUD B;  1KX5 B;  3W97 B;  5GT0 C;  3REH B;  3WKJ A;  2BG1 A;  5AV9 D;  1KX4 C;  5GT3 D;  5G49 A;  3O62 C;  4QLC D;  3AZE A;  3UT9 B;  3AZE B;  3UTA B;  3X1S D;  5B31 C;  3UTB A;  3VH5 T;  5E5A C;  3REL B;  4KGC D;  3AN2 C;  3AZH A;  4LD9 C;  5CPJ A;  3A6N A;  3MVD D;  3B6F D;  3A6N B;  4G91 B;  2YFW B;  1BH9 A;  3C1C D;  5GSU B;  2HUE C;  4Z5T C;  5JRG C;  3AZN A;  2IO5 C;  3AV1 A;  3AZN B;  5F99 C;  1A7W A;  3REI C;  3NQJ A;  3MGR A;  3NQJ B;  4HGA B;  3AZJ A;  4NE6 A;  3MGS B;  1HQ3 C;  5AVB C;  1N1J A;  2HIO C;  1ZLA C;  4CAY A;  5B1M D;  2ARO B;  3AZM B;  5JA4 A;  1P3M D;  5AY8 A;  4XUJ B;  3KXB A;  4WU8 C;  1ID3 B;  3LZ0 C;  4H9S C;  1PZR A;  5B2J B;  3AZL C;  1S32 D;  4XZQ C;  4KHA A;  2ZY2 A;  3LEL D;  5B40 A;  5AV5 D;  5B2I C;  5B32 A;  3LZ1 C;  1P3A A;  1P3P C;  3TU4 C;  3REJ C;  3AZK A;  3AV2 A;  5FUG A;  3WA9 D;  5FUG B;  4NE3 A;  5AV6 C;  5AVC D;  3X1U C;  4CSR B;  1Z2C B;  3C1B A;  5B31 G;  3X1V A;  2PYO A;  3C1B B;  2PYO B;  4KUD D;  3AZF A;  1F66 A;  3W97 D;  4AWL B;  3AZF B;  4Z66 A;  1F66 B;  3AZI A;  3WKJ D;  2Y2J A;  2DQN C;  2G5H C;  3AFA B;  2Y2P A;  2Y2M A;  1EQZ C;  3AYW C;  1P34 A;  4WV4 B;  3AZE D;  5CPK C;  3W96 B;  4J8X A;  5B0Z A;  3B0C W;  1P3B B;  3UTB D;  2BYM A;  4X23 C;  3MGQ C;  3AZH D;  1U35 C;  5CPJ D;  2NQB B;  3W99 B;  3A6N D;  1P3O A;  1M18 A;  1KX5 C;  1JFI A;  3W98 B;  3REH C;  1JFI B;  1P3L A;  5B33 B;  5CPI B;  1P3L B;  3AZN D;  3F6T A;  3AV1 D;  5KDM B;  5AV9 B;  3MGR D;  3AZJ D;  3NQU A;  5GT3 B;  1KX4 A;  3O62 A;  3EPJ A;  2Y2O A;  1T3U A;  5AY8 D;  3KXB D;  3X1S B;  5E5A A;  4KGC B;  3H0M C;  5B40 D;  3MVD B;  3P5J B;  4J8V A;  4J8W A;  5B32 D;  1P3A D;  4J8V B;  4J8W B;  4UPK A;  4YS3 A;  3AZK D;  3H0L C;  3AV2 D;  4YS3 B;  4Z5T A;  5JRG A;  1TZY C;  3EPH A;  3A1K A;  2ZY5 A;  5BT1 C;  5AVB A;  1HQ3 A;  1TAF B;  4H9O B;  5B1L C;  3KWQ C;  3C1B D;  3AZG C;  3X1V D;  1P3K A;  2PYO D;  3AZF D;  1ZLA A;  1P3K B;  1F66 D;  5B1M B;  4Z66 D;  1P3M B;  3AZI D;  4WU8 A;  2JSS A;  3B0C T;  1BH8 A;  3AZL A;  1S32 B;  4XZQ A;  2RVQ D;  3LEL B;  1P34 D;  5AV5 B;  5B2I A;  3LZ1 A;  4J8X D;  5B0Z D;  1P3P A;  2NZD A;  2W8S A;  3WA9 B;  5DNN A;  2LY8 A;  5AVC B;  2L5A A;  5AV6 A;  5DNN B;  5B0Y A;  3X1U A;  3B0D B;  1P3O D;  2RIQ A;  1M18 D;  2CV5 C;  4ZUX C;  2F8N H;  1P3L D;  5AV8 A;  1BFM A;  4H9P A;  5C3I C;  3WKJ B;  3AFA C;  1KX4 D;  5G49 B;  3MGP C;  3KUY A;  3O62 D;  3AYW A;  1KX3 A;  1KX3 B;  3IP4 C;  1P3G A;  4J8U C;  3UTB B;  4X23 A;  5E5A D;  3MGQ A;  3KFU G;  3REK C;  3AZH B;  5CPJ B;  1U35 A;  3MNN C;  4J8V D;  1M1A C;  4J8W D;  3VH6 W;  1BH9 B;  4YS3 D;  1ULY A; 
#chains in the Genus database with same CATH homology
 3X1T C;  4Z5T D;  5JRG D;  4YM6 A;  2FJ7 C;  3AV1 B;  3B6G C;  4DRA A;  3MGR B;  3WTP C;  3AZJ B;  2F8N G;  3VH6 A;  4R8P A;  1HQ3 D;  5AVB D;  4QLC C;  1P3G D;  1N1J B;  3WAA C;  1P3K D;  1W2E A;  1ZLA D;  4CAY B;  1P3I A;  5JA4 B;  4G92 B;  5AY8 B;  3KXB B;  4WU9 C;  4WU8 D;  3EPL A;  3AZL D;  1P3F C;  4XZQ D;  4KHA B;  3MVD C;  3B6F C;  1F1E A;  3C1C C;  5B40 B;  5B2I D;  5B32 B;  3LZ1 D;  1P3A B;  1P3P D;  3AZK B;  3AV2 B;  2NZD D;  1WWS A;  5DNN D;  5BS7 A;  4EO5 B;  5AV6 D;  3X1U D;  5B0Y D;  5CP6 C;  2Y2I A;  5B24 C;  1M19 A;  3KWQ A;  5B1L A;  3X1V B;  1P3M C;  1M19 B;  5AV8 D;  4Z66 B;  5GXQ A;  3AZI B;  5GXQ B;  5DNM C;  3LJA C;  3LEL C;  4JJN C;  3KUY D;  3AYW D;  1KX3 D;  1P34 B;  2YFV A;  3VH6 T;  2XD5 A;  5AVC C;  5B0Z B;  4J8X B;  2BYM B;  4X23 D;  1AOI C;  3MGQ D;  1WWI A;  1U35 D;  4KUD C;  1P3O B;  1M18 B;  2CV5 A;  3W97 C;  1B6W A;  4ZUX A;  3WKJ C;  4H9R A;  2XD1 A;  5GT0 A;  4YM6 D;  2UWX A;  4UUZ A;  4R8P D;  3UT9 C;  3NQU B;  1KX4 B;  3AZE C;  3MGP A;  3UTA C;  2Y2G A;  3O62 B;  1P3I D;  4WZS B;  2F8N K;  3UTB C;  3REL C;  5B31 A;  5B31 B;  4J8U A;  3A6N C;  4G91 C;  5E5A B;  3AN2 A;  3AN2 B;  4LD9 A;  5GSU C;  3REK A;  4LD9 B;  3MNN A;  1M1A A;  3AZN C;  2ZY4 A;  4HGA C;  2HUE B;  3X1T A;  4Z5T B;  5JRG B;  3MGS C;  5F99 A;  3REI A;  2IO5 B;  2FJ7 A;  4ZBJ B;  3B6G A;  5F99 B;  3REI B;  3WTP A;  2ARO C;  3AZM C;  1M19 D;  5BT1 D;  1HQ3 B;  4XUJ C;  5B1L D;  2HIO A;  5AVB B;  3KWQ D;  4G92 C;  5AY8 C;  3KXB C;  1P3G B;  5BNV A;  1ID3 C;  3R45 A;  5B2J C;  1ZLA B;  3WAA A;  4DRB A;  5GXQ D;  3LZ0 A;  4WU8 B;  4WU9 A;  4H9S A;  1BH8 B;  2DF4 C;  3AZL B;  1P3F A;  4XZQ B;  4WJ3 C;  5B32 C;  5BNX A;  5BNX B;  3AV2 C;  4WNN A;  5B2I B;  3WTP E;  3LZ1 B;  3TU4 A;  3REJ A;  4EO5 C;  1P3P B;  3REJ B;  2NZD B;  5AV6 B;  3C1B C;  3X1U B;  5B0Y B;  2PYO C;  5CP6 A;  4AWL C;  3AZF C;  1F66 C;  2F2A C;  5B24 A;  2CV5 D;  4ZUX D;  5AV8 B;  2J8P A;  5GT0 D;  4H9P B;  5DNM A;  4Z2M H;  2Y2L A;  3LJA A;  3W96 C;  3KUY B;  3MGP D;  4JJN A;  2ZM5 A;  1EQZ A;  5B0Z C;  1P3B C;  3AYW B;  4E45 A;  5CPK A;  4H9N A;  5CPK B;  4NFT A;  5B31 D;  2NQB C;  3W99 C;  4H9Q A;  4J8U D;  4X23 B;  1AOI A;  3AN2 D;  3MGQ B;  3W98 C;  4LD9 D;  3REK D;  5B33 C;  1U35 B;  5CPI C;  1P3L C;  2CWE A;  3MNN D;  1KX5 A;  1M1A D;  3REH A;  5AV9 C;  3X1T D;  1HTA A;  5GT3 C;  4YM6 B;  5F99 D;  5B32 G;  3REI D;  2FJ7 D;  3B6G D;  2JCH A;  2VQR A;  3WTP D;  4R8P B;  3UT9 A;  2HIO D;  3UTA A;  3X1S C;  3FDD A;  3WAA D;  1P3I B;  4Z2M G;  3REL A;  4KGC C;  2BYK A;  4WU9 D;  3LZ0 D;  2BYK B;  2FFF B;  4DQY B;  1P3F D;  4J8V C;  2YFW A;  4J8W C;  5GSU A;  4YS3 C;  3TU4 D;  3REJ D;  4ZBJ C;  1TZY A;  3MGS A;  1TZY B;  1P3G C;  5CP6 D;  2Y2K A;  1P3K C;  5B1M C;  2ARO A;  3AZM A;  5B24 D;  3AZG A;  3KWQ B;  5B1L B;  4XUJ A;  3AZG B;  1ID3 A;  5B2J A;  1S32 C;  5DNM D;  3LJA D;  5AV5 C;  3EG5 B;  4JJN D;  3V9R A;  1EQZ D;  3AL0 C;  3V9R B;  5CPK D;  4NE5 A;  2YFV B;  2F8N A;  3WA9 C;  2NZD C;  1Q9C A;  2F8N B;  5DNN C;  4CSR A;  3B0D C;  5B0Y C;  1AOI D;  5AV8 C;  1KX5 D;  2CV5 B;  3REH D;  4ZUX B;  4H9R B;  3KSY A;  5GT0 B;  5C3I B;  3AFA A;  3KUY C;  4UUZ B;  3EPK A;  1KX3 C;  2G5I C;  3W96 A;  3UT9 D;  3MGP B;  3UTA D;  1P3B A;  3REL D;  1KU5 A;  3AZH C;  5CPJ C;  2NQB A;  3W99 A;  4J8U B;  5CHL B;  3W98 A;  5BO0 A;  5GSU D;  5B33 A;  3REK B;  1H3O A;  5BO0 B;  5CPI A;  3MNN B;  1H3O B;  1M1A B;  3AV1 C;  4YM6 C;  5KDM A;  5AV9 A;  3MGR C;  3AZJ C;  1TZY D;  3X1T B;  3MGS D;  5GT3 A;  4R8P C;  2FJ7 B;  3B6G B;  4M6B A;  3WTP B;  2ARO D;  3AZM D;  4QLC A;  3AZG D;  1P3I C;  4XUJ D;  2HIO B;  4QLC B;  3X1S A;  1ID3 D;  3WAA B;  5BNV B;  3R45 B;  5B2J D;  4KGC A;  3LZ0 B;  4WU9 B;  1R4V A;  5B40 C;  3MVD A;  3B6F A;  1P3F B;  1P3A C;  3B6F B;  3C1C A;  3AZK C;  1B67 A;  3C1C B;  2F8N D;  3B0B A;  2JE5 A;  4WNN B;  3VH5 W;  3TU4 B;  5BS7 C;  1TAF A;  4H9O A;  3X1V C;  1M19 C;  5CP6 B;  3VH5 A;  5B1M A;  4Z66 C;  5B24 B;  3AZI C;  1P3M A;  5GXQ C;  2ZY3 A;  1S32 A;  3AFA D;  2RVQ C;  5DNM B;  2Y2H A;  3LEL A;  3LJA B;  1P34 C;  5AV5 A;  2Y2N A;  3W96 D;  4JJN B;  4J8X C;  1EQZ B;  1P3B D;  3H0R C;  4H9N B;  3WA9 A;  4E44 A;  5AVC A;  2Y2Q A;  2NQB D;  4H9Q B;  3W99 D;  1P3O C;  1M18 C;  1AOI B;  3A1I A;  3W98 D;  4KUD A;  5B33 D;  5CPI D;  3W97 A;  4KUD B;  1KX5 B;  3W97 B;  5GT0 C;  3REH B;  3WKJ A;  2BG1 A;  5AV9 D;  1KX4 C;  5GT3 D;  5G49 A;  3O62 C;  4QLC D;  3AZE A;  3UT9 B;  3AZE B;  3UTA B;  3X1S D;  5B31 C;  3UTB A;  3VH5 T;  5E5A C;  3REL B;  4KGC D;  3AN2 C;  3AZH A;  4LD9 C;  5CPJ A;  3A6N A;  3MVD D;  3B6F D;  3A6N B;  4G91 B;  2YFW B;  1BH9 A;  3C1C D;  5GSU B;  2HUE C;  4Z5T C;  5JRG C;  3AZN A;  2IO5 C;  3AV1 A;  3AZN B;  5F99 C;  1A7W A;  3REI C;  3NQJ A;  3MGR A;  3NQJ B;  4HGA B;  3AZJ A;  4NE6 A;  3MGS B;  1HQ3 C;  5AVB C;  1N1J A;  2HIO C;  1ZLA C;  4CAY A;  5B1M D;  2ARO B;  3AZM B;  5JA4 A;  1P3M D;  5AY8 A;  4XUJ B;  3KXB A;  4WU8 C;  1ID3 B;  3LZ0 C;  4H9S C;  1PZR A;  5B2J B;  3AZL C;  1S32 D;  4XZQ C;  4KHA A;  2ZY2 A;  3LEL D;  5B40 A;  5AV5 D;  5B2I C;  5B32 A;  3LZ1 C;  1P3A A;  1P3P C;  3TU4 C;  3REJ C;  3AZK A;  3AV2 A;  5FUG A;  3WA9 D;  5FUG B;  4NE3 A;  5AV6 C;  5AVC D;  3X1U C;  4CSR B;  1Z2C B;  3C1B A;  5B31 G;  3X1V A;  2PYO A;  3C1B B;  2PYO B;  4KUD D;  3AZF A;  1F66 A;  3W97 D;  4AWL B;  3AZF B;  4Z66 A;  1F66 B;  3AZI A;  3WKJ D;  2Y2J A;  2DQN C;  2G5H C;  3AFA B;  2Y2P A;  2Y2M A;  1EQZ C;  3AYW C;  1P34 A;  4WV4 B;  3AZE D;  5CPK C;  3W96 B;  4J8X A;  5B0Z A;  3B0C W;  1P3B B;  3UTB D;  2BYM A;  4X23 C;  3MGQ C;  3AZH D;  1U35 C;  5CPJ D;  2NQB B;  3W99 B;  3A6N D;  1P3O A;  1M18 A;  1KX5 C;  1JFI A;  3W98 B;  3REH C;  1JFI B;  1P3L A;  5B33 B;  5CPI B;  1P3L B;  3AZN D;  3F6T A;  3AV1 D;  5KDM B;  5AV9 B;  3MGR D;  3AZJ D;  3NQU A;  5GT3 B;  1KX4 A;  3O62 A;  3EPJ A;  2Y2O A;  1T3U A;  5AY8 D;  3KXB D;  3X1S B;  5E5A A;  4KGC B;  3H0M C;  5B40 D;  3MVD B;  3P5J B;  4J8V A;  4J8W A;  5B32 D;  1P3A D;  4J8V B;  4J8W B;  4UPK A;  4YS3 A;  3AZK D;  3H0L C;  3AV2 D;  4YS3 B;  4Z5T A;  5JRG A;  1TZY C;  3EPH A;  3A1K A;  2ZY5 A;  5BT1 C;  5AVB A;  1HQ3 A;  1TAF B;  4H9O B;  5B1L C;  3KWQ C;  3C1B D;  3AZG C;  3X1V D;  1P3K A;  2PYO D;  3AZF D;  1ZLA A;  1P3K B;  1F66 D;  5B1M B;  4Z66 D;  1P3M B;  3AZI D;  4WU8 A;  2JSS A;  3B0C T;  1BH8 A;  3AZL A;  1S32 B;  4XZQ A;  2RVQ D;  3LEL B;  1P34 D;  5AV5 B;  5B2I A;  3LZ1 A;  4J8X D;  5B0Z D;  1P3P A;  2NZD A;  2W8S A;  3WA9 B;  5DNN A;  2LY8 A;  5AVC B;  2L5A A;  5AV6 A;  5DNN B;  5B0Y A;  3X1U A;  3B0D B;  1P3O D;  2RIQ A;  1M18 D;  2CV5 C;  4ZUX C;  2F8N H;  1P3L D;  5AV8 A;  1BFM A;  4H9P A;  5C3I C;  3WKJ B;  3AFA C;  1KX4 D;  5G49 B;  3MGP C;  3KUY A;  3O62 D;  3AYW A;  1KX3 A;  1KX3 B;  3IP4 C;  1P3G A;  4J8U C;  3UTB B;  4X23 A;  5E5A D;  3MGQ A;  3KFU G;  3REK C;  3AZH B;  5CPJ B;  1U35 A;  3MNN C;  4J8V D;  1M1A C;  4J8W D;  3VH6 W;  1BH9 B;  4YS3 D;  1ULY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...