3RELD

2.7 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b) derivatized with triamminechloroplatinum(ii) chloride
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
b'KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 35
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3relD00
3AZLC 3X1VD 5CP6B 4LD9D 3LELD 3REIC 1M18C 4XZQD 2F8NA 1ID3C 1P3BA 3KXBA 4KUDA 5G49A 3WAAC 3C1CA 4KUDB 3W96C 5AV5C 2AROC 3TU4C 3MGQB 3AFAD 1KX3D 3R45A 3RELD 5AY8A 4WZSB 4Z66B 4DRAA 4KGCA 2BYKB 1U35C 1N1JA 4KGCB 3R45B 1P3LC 4Z5TB 3B0DB 1H3OA 2NQBA 2NZDA 5BNVB 5AVBB 4H9OB 5CPKC 1P34A 5B32B 2NZDB 4AWLC 5E5AA 1P34B 3B6GB 5GSUB 3X1VC 4LD9C 4ZUXC 3LELC 2F8NH 3W99B 4HGAB 5E5AB 4XZQC 3WA9A 3AZHA 3AZGA 3C1BD 3WA9B 3AV2D 3MGRC 1ULYA 1P3AD 3AZHB 3AFAC 5B2JA 1KX3C 4H9RB 3RELC 3WKJD 2HIOD 3AZLB 1F66D 1P3IA 1TAFA 5GXQD 5B0YD 3REIB 1M18B 3NQUB 3LZ1D 5B2ID 4J8WD 1ID3B 1M19D 1BH9A 5AV8D 5AV5B 3W96B 2AROB 3TU4B 3B0CW 3AZIA 5FUGB 5B32G 1TZYA 5AV9A 3REKD 1U35B 5BT1D 1B67A 1P3LB 1AOIA 1TZYB 5B1MD 4G91C 1S32D 3C1BC 5B40D 3MGSA 3AV2C 1P3AC 3AN2A 4XUJA 5CPKB 5CPJD 5B1LD 4J8XA 3WKJC 4AWLB 4ZUXA 3B6FD 5KDMA 4XUJB 1KX4A 4H9PB 2HIOC 1F66C 4CSRA 3X1VB 5B0YC 4ZUXB 5KDMB 2BYMA 3LZ1C 5B2IC 4J8WC 4XZQB 1KX4B 3X1TA 3MGRA 5CPID 2BYMB 4YM6D 3X1TB 2F8ND 5AV8C 3W97D 3MGRB 1KX3B 3C1CD 3RELB 5CHLB 3WTPD 3VH5W 1HQ3C 4QLCD 3REKC 5BT1C 1M1AA 3AZEA 4WU9C 5B33A 3AZND 1S32C 1BH8A 5B40C 3REHD 3AZEB 4Z2MG 4J8UD 5CPJC 3W98A 5B1LC 5GT0A 2LY8A 3B6FC 3AZJD 1WWSA 4CAYB 5GT0B 5AVCD 4X23D 2YFVB 5BS7A 1WWIA 1P3OA 3LZ0A 5CPIC 2YFWB 4G91B 4YM6C 3C1BB 3W97C 3AV2B 1EQZC 1P3AB 3WKJB 5B31D 3WTPC 4QLCC 1P3PC 5DNMA 2HIOB 1F66B 5B0YB 4WNNB 4WU8A 3AZKD 5B2IB 5DNMB 4J8WB 3MNND 3KUYC 3AZNC 5CP6A 5AV6A 4WU8B 3X1SD 1P3MD 4J8UC 4G92B 5AV8B 5AV6B 3O62D 3AZJC 4R8PD 4UUZA 3B0BA 1HQ3B 3X1UD 3MGQA 5AVCC 3REKB 4WU9A 4X23C 4UUZB 3UTBC 4EO5B 4Z66A 3MGPA 2BYKA 4WU9B 4J8VD 5C3IC 1S32B 1ZLAD 5B40B 1R4VA 3MGPB 1P3KC 4H9QB 5CPJB 4Z5TA 5B1LB 5B24D 5B31C 5BNVA 3B6FB 5AVBA 4H9OA 1Q9CA 5B32A 4YS3D 1P3FC 3AZKC 5GT3D 5B0ZD 3MNNC 1BFMA 1B6WA 3B6GA 5GSUA 5CPIB 2PYOD 4YM6B 3X1SC 3KSYA 1P3MC 3W99A 1P3GA 3W97B 5BO0A 1P3PA 3O62C 3VH6T 1EQZB 4R8PC 3LJAD 1P3GB 3WTPB 5BO0B 3X1UC 1P3PB 4H9RA 4J8VC 3KUYB 3REJD 3AZLA 3AYWD 1ZLAC 3REIA 1M18A 3NQUA 4J8UB 1ID3A 5B24C 4NE3A 3AZJB 3WAAA 3W98D 3UTAD 3W96A 5AV5A 2AROA 3MVDD 3TU4A 4YS3C 4H9SC 3WAAB 5GT3C 5B0ZC 3AV1D 3UTBB 5JRGD 3AZMD 2HUEC 5FUGA 2PYOC 3UT9D 3AZFD 1U35A 5C3IB 2RVQD 2CV5D 5F99D 1P3LA 4JJND 1P3KB 3LZ0D 3VH6A 3NQJB 2F8NG 1P3FA 5CPKA 3A6ND 1P3FB 3AZKB 1JFIA 4H9PA 3MNNB 3REJC 1KX5D 3AYWC 3X1VA 4LD9A 3LELA 1JFIB 4XZQA 4NFTA 5DNND 1KU5A 5GXQC 4LD9B 3LELB 4R8PB 3KWQD 2FJ7D 2F8NK 3UTAC 3MVDC 3X1UB 4KHAB 3AFAA 1M19C 1KX3A 3AV1C 1A7WA 3RELA 5JRGC 3AZMC 1P3BD 3KXBD 4KUDD 3UT9C 3AFAB 3AZFC 4J8VB 2RVQC 2CV5C 5F99C 4NE6A 1ZLAB 3V9RB 5B24B 4KGCD 5AY8D 5B1MC 3A6NC 5B31G 4YS3B 5GT3B 5B0ZB 1KX5C 4CAYA 2NQBD 2HUEB 2JSSA 2PYOB 2NZDD 2YFVA 5DNNC 1P34D 2YFWA 3C1BA 3KWQC 2FJ7C 5E5AD 3AV2A 1P3AA 1F1EA 3WKJA 3WA9D 1P3BC 3KXBC 4ZBJC 3AZHD 2HIOA 4DRBA 3REJB 3AZGD 1F66A 3C1CC 3AYWB 5GXQA 5B0YA 4WNNA 3LZ1A 4M6BA 5B2IA 4J8WA 2CWEA 5B2JD 5GXQB 4KGCC 5AY8C 3LZ1B 5AV8A 1P3ID 3REHC 1M19B 3AV1B 5JRGB 3AZMB 2NQBC 1HQ3A 5AV5D 3AZFB 3REKA 2NZDC 2CV5B 1P34C 5B1MA 1S32A 4HGAC 5E5AC 5B40A 3AZID 4E44A 1P3LD 4H9QA 1TZYD 5B1MB 5AV9D 5CPJA 5B1LA 3VH5A 3WA9C 3B6FA 1AOID 3AZGC 3MGSD 3AN2D 4XUJD 2IO5C 5DNNB 4J8XD 5B2JC 5CPIA 4ZUXD 4YM6A 3KWQB 2FJ7B 1KX4D 3W97A 1P3IC 1EQZA 3VH6W 2F8NB 3X1TD 3WTPA 3KXBB 4QLCA 1P3BB 4ZBJB 5G49B 3MGRD 3C1CB 4QLCB 3AZNA 3KUYA 3AZIC 5AY8B 3REHA 1TZYC 5AV9C 4WV4B 4J8UA 3AZNB 1N1JB 1M1AD 3REHB 3AZJA 3AZED 1AOIC 5B33D 2NQBB 1H3OB 5AVCA 3MGSC 4X23A 3AN2C 4XUJC 1HTAA 3UTBA 4J8XC 5GT0D 5AVCB 4X23B 1KX4C 1P3KA 3NQJA 5B31A 3X1TC 1P3OD 3LJAC 3AZGB 5B31B 3AZKA 3MNNA 2IO5B 5B2JB 5BNXA 3X1SA 1P3MA 5DNMD 1P3IB 5BNXB 1TAFB 3O62A 1M1AC 3X1SB 3AZEC 4R8PA 4WU8D 1P3MB 5B33C 3X1UA 3O62B 4KHAA 5CP6D 5AV6D 1BH9B 3B0CT 3W98C 5GT0C 1HQ3D 4J8VA 1ZLAA 3AZIB 5AV9B 3MGQD 4WU9D 5BS7C 3V9RA 5B24A 2L5AA 4JJNC 1P3OC 4Z66D 3LZ0C 3MGPD 4Z2MH 1AOIB 4YS3A 3MGSB 4H9SA 5GT3A 3AN2B 5B0ZA 4Z5TD 4J8XB 2PYOA 5AVBD 5DNMC 4CSRB 5B32D 4WU8C 3LJAA 3WTPE 4G92C 3B6GD 5GSUD 5CP6C 5AV6C 1EQZD 3LJAB 3W99D 4H9NA 1P3GD 1P3PD 3REJA 3VH5T 3AYWA 4H9NB 4KUDC 4EO5C 3MGQC 4NE5A 3KUYD 1M1AB 4Z66C 3MGPC 5B33B 3AZLD 3UTAA 1BH8B 3MVDA 3REID 1M18D 1M19A 3AV1A 3W98B 4Z5TC 5JRGA 3UTAB 3B0DC 3MVDB 3AZMA 1ID3D 3UT9A 3AZFA 3WAAD 5AVBC 2CV5A 5F99A 4JJNA 3UTBD 3W96D 2AROD 3UT9B 5B32C 5JA4A 3TU4D 5F99B 4JJNB 1P3OB 3B6GC 5GSUC 3LZ0B 1P3KD 5JA4B 3A6NA 1U35D 3W99C 1P3GC 4E45A 3A6NB 1KX5A 1P3FD 3AZHC 5CPKD 1KX5B 5DNNA 3KWQA 2FJ7A
chains in the Genus database with same CATH superfamily
3AZLC 3X1VD 5CP6B 4LD9D 3LELD 3REIC 1M18C 4XZQD 2F8NA 1ID3C 1P3BA 3KXBA 4KUDA 5G49A 3WAAC 3C1CA 4KUDB 2ZM5A 3W96C 5AV5C 2AROC 3TU4C 3MGQB 3AFAD 1KX3D 3R45A 3RELD 5AY8A 4WZSB 4Z66B 4DRAA 4KGCA 2BYKB 1U35C 1N1JA 4KGCB 3R45B 1P3LC 4Z5TB 3B0DB 1H3OA 2NQBA 2UWXA 2NZDA 5BNVB 5AVBB 4H9OB 5CPKC 1P34A 5B32B 2NZDB 4AWLC 5E5AA 1P34B 3B6GB 5GSUB 3X1VC 4LD9C 4ZUXC 3LELC 2F8NH 3EPKA 3W99B 4HGAB 5E5AB 4XZQC 3WA9A 3AZHA 3AZGA 3C1BD 3WA9B 3AV2D 3MGRC 1ULYA 1P3AD 3AZHB 3AFAC 5B2JA 1KX3C 4H9RB 3RELC 3WKJD 2HIOD 3AZLB 1F66D 1P3IA 2DQNC 1TAFA 2RIQA 5GXQD 5B0YD 3REIB 1M18B 3NQUB 3LZ1D 5B2ID 4J8WD 1ID3B 3EPJA 3A1KA 1M19D 1BH9A 5AV8D 5AV5B 1Z2CB 2AROB 3TU4B 3W96B 3B0CW 2ZY3A 3AZIA 5FUGB 5B32G 1TZYA 5AV9A 3REKD 1U35B 5BT1D 1B67A 1P3LB 1AOIA 1TZYB 5B1MD 4G91C 1S32D 3C1BC 2Y2IA 5B40D 3MGSA 3AV2C 2XD5A 1P3AC 3AN2A 4XUJA 5CPKB 5CPJD 5B1LD 4J8XA 3WKJC 4AWLB 4ZUXA 3B6FD 5KDMA 4XUJB 1KX4A 2HIOC 4H9PB 1F66C 4CSRA 3X1VB 5B0YC 4ZUXB 5KDMB 2BYMA 3LZ1C 5B2IC 4J8WC 4XZQB 1KX4B 3X1TA 3MGRA 5CPID 2BYMB 4YM6D 4DQYB 3X1TB 2F8ND 5AV8C 3W97D 3MGRB 2G5HC 1KX3B 3C1CD 3RELB 5CHLB 3WTPD 3VH5W 1HQ3C 4QLCD 3REKC 5BT1C 2XD1A 1M1AA 3AZEA 3KFUG 4WU9C 5B33A 3AZND 1S32C 1BH8A 5B40C 3REHD 3AZEB 2BG1A 4Z2MG 4J8UD 5CPJC 3W98A 5B1LC 5GT0A 2LY8A 3B6FC 3AZJD 1WWSA 4CAYB 5GT0B 2J8PA 5AVCD 4X23D 2YFVB 5BS7A 1WWIA 1P3OA 3LZ0A 5CPIC 2YFWB 4G91B 4YM6C 3C1BB 3W97C 3AV2B 1EQZC 1P3AB 2VQRA 3WKJB 5B31D 3WTPC 4QLCC 1P3PC 5DNMA 2HIOB 1F66B 5B0YB 4WNNB 4WU8A 3EPHA 3AZKD 5B2IB 5DNMB 4J8WB 3F6TA 3MNND 3KUYC 3AZNC 3H0RC 5CP6A 5AV6A 4WU8B 3X1SD 1P3MD 4J8UC 4G92B 5AV8B 5AV6B 3O62D 3AZJC 4R8PD 4UUZA 3B0BA 1HQ3B 3X1UD 3MGQA 5AVCC 3REKB 4WU9A 4X23C 4UUZB 3UTBC 4EO5B 4Z66A 3MGPA 3AL0C 2BYKA 4WU9B 4J8VD 5C3IC 1S32B 1ZLAD 5B40B 1R4VA 3MGPB 1P3KC 4H9QB 5CPJB 4Z5TA 5B1LB 5B24D 5B31C 5BNVA 3B6FB 5AVBA 4H9OA 1Q9CA 2ZY5A 5B32A 4YS3D 1P3FC 3AZKC 5GT3D 5B0ZD 3MNNC 1BFMA 1B6WA 3B6GA 5GSUA 5CPIB 2PYOD 4YM6B 3X1SC 3KSYA 1P3MC 3W99A 3H0MC 1P3GA 3W97B 5BO0A 1P3PA 3O62C 3VH6T 1EQZB 4R8PC 3LJAD 1P3GB 3WTPB 5BO0B 3X1UC 1P3PB 4H9RA 3A1IA 4J8VC 3KUYB 3REJD 3AZLA 3AYWD 1ZLAC 3REIA 1M18A 3NQUA 4J8UB 3EPLA 1ID3A 1PZRA 5B24C 4NE3A 3AZJB 3WAAA 3W98D 3UTAD 3W96A 5AV5A 2AROA 3MVDD 3TU4A 4YS3C 4H9SC 3WAAB 5GT3C 5B0ZC 3AV1D 3UTBB 5JRGD 3AZMD 2HUEC 5FUGA 2PYOC 3UT9D 2Y2GA 3AZFD 4WJ3C 1U35A 5C3IB 2RVQD 2CV5D 5F99D 1P3LA 4JJND 1P3KB 3LZ0D 3VH6A 3NQJB 2F8NG 1P3FA 5CPKA 3A6ND 1P3FB 3AZKB 1JFIA 4H9PA 3MNNB 3REJC 1KX5D 3AYWC 3X1VA 4LD9A 3LELA 1JFIB 4XZQA 4NFTA 5DNND 1KU5A 2FFFB 2Y2QA 5GXQC 3LELB 4LD9B 4R8PB 3KWQD 2FJ7D 2F8NK 3UTAC 3MVDC 3X1UB 4UPKA 4KHAB 3AFAA 1M19C 1KX3A 3AV1C 1A7WA 3RELA 5JRGC 3AZMC 1P3BD 3KXBD 4KUDD 3UT9C 3AFAB 3AZFC 4J8VB 2RVQC 2CV5C 5F99C 4NE6A 1ZLAB 2Y2OA 3V9RB 5B24B 4KGCD 5AY8D 5B1MC 3A6NC 5B31G 4YS3B 5GT3B 2Y2NA 5B0ZB 1KX5C 4CAYA 2NQBD 2HUEB 2JSSA 2PYOB 2NZDD 2YFVA 5DNNC 1P34D 2YFWA 3C1BA 3KWQC 2FJ7C 5E5AD 3AV2A 1P3AA 2Y2JA 1F1EA 3WKJA 3WA9D 1P3BC 3KXBC 4ZBJC 3AZHD 2HIOA 4DRBA 3REJB 3AZGD 1F66A 3C1CC 3AYWB 5GXQA 5B0YA 4WNNA 3LZ1A 4M6BA 5B2IA 4J8WA 2CWEA 5B2JD 5GXQB 4KGCC 5AY8C 3LZ1B 5AV8A 3IP4C 1P3ID 2ZY2A 3REHC 2G5IC 1M19B 3AV1B 5JRGB 3AZMB 2NQBC 1HQ3A 5AV5D 3AZFB 3REKA 2NZDC 2CV5B 1P34C 5B1MA 3H0LC 1S32A 4HGAC 5E5AC 5B40A 3AZID 4E44A 1P3LD 2Y2HA 4H9QA 1TZYD 5B1MB 5AV9D 5CPJA 5B1LA 3VH5A 3FDDA 2DF4C 3WA9C 3B6FA 1AOID 3AZGC 3MGSD 3AN2D 4XUJD 2IO5C 2Y2MA 5DNNB 4J8XD 5B2JC 5CPIA 4ZUXD 4YM6A 3KWQB 2FJ7B 1KX4D 3W97A 1P3IC 1EQZA 3VH6W 2F8NB 3X1TD 3WTPA 3KXBB 4QLCA 1P3BB 2JCHA 4ZBJB 5G49B 3MGRD 3C1CB 4QLCB 3EG5B 2JE5A 3AZNA 3KUYA 3AZIC 5AY8B 3REHA 1TZYC 5AV9C 4WV4B 4J8UA 3AZNB 1N1JB 1M1AD 3REHB 3AZJA 3AZED 1AOIC 5B33D 2NQBB 1H3OB 5AVCA 3MGSC 2W8SA 4X23A 3AN2C 4XUJC 1HTAA 3UTBA 4J8XC 5GT0D 5AVCB 4X23B 1KX4C 1W2EA 1P3KA 3NQJA 5B31A 3P5JB 3X1TC 1P3OD 3LJAC 3AZGB 5B31B 3AZKA 3MNNA 2IO5B 5B2JB 2Y2LA 5BNXA 2ZY4A 3X1SA 1P3MA 5DNMD 1P3IB 5BNXB 1TAFB 3O62A 1M1AC 3X1SB 3AZEC 4R8PA 4WU8D 1P3MB 5B33C 1T3UA 3X1UA 3O62B 4KHAA 5CP6D 5AV6D 1BH9B 3B0CT 3W98C 5GT0C 1HQ3D 4J8VA 1ZLAA 3AZIB 5AV9B 3MGQD 4WU9D 5BS7C 3V9RA 5B24A 2L5AA 4JJNC 1P3OC 4Z66D 2Y2PA 3LZ0C 4Z2MH 3MGPD 1AOIB 4YS3A 3MGSB 4H9SA 5GT3A 3AN2B 5B0ZA 4Z5TD 4J8XB 2PYOA 5AVBD 5DNMC 4CSRB 5B32D 4WU8C 3LJAA 3WTPE 4G92C 3B6GD 5GSUD 5CP6C 5AV6C 1EQZD 3LJAB 3W99D 4H9NA 1P3GD 1P3PD 3REJA 3VH5T 3AYWA 4H9NB 4KUDC 4EO5C 3MGQC 4NE5A 3KUYD 1M1AB 4Z66C 3MGPC 2Y2KA 5B33B 3AZLD 3UTAA 1BH8B 3MVDA 3REID 1M18D 1M19A 3AV1A 3W98B 4Z5TC 5JRGA 3UTAB 3B0DC 3MVDB 3AZMA 1ID3D 3UT9A 3AZFA 3WAAD 5AVBC 2CV5A 5F99A 4JJNA 3UTBD 3W96D 2AROD 3UT9B 5B32C 5JA4A 3TU4D 5F99B 4JJNB 1P3OB 3B6GC 5GSUC 3LZ0B 1P3KD 5JA4B 3A6NA 1U35D 3W99C 1P3GC 4E45A 3A6NB 1KX5A 2F2AC 1P3FD 3AZHC 5CPKD 1KX5B 5DNNA 3KWQA 2FJ7A
chains in the Genus database with same CATH topology
3AZLC 3X1VD 5CP6B 4LD9D 3LELD 3REIC 1M18C 4XZQD 2F8NA 1ID3C 1P3BA 3KXBA 4KUDA 5G49A 3WAAC 3C1CA 4KUDB 2ZM5A 3W96C 5AV5C 2AROC 3TU4C 3MGQB 3AFAD 1KX3D 3R45A 3RELD 5AY8A 4WZSB 4Z66B 4DRAA 4KGCA 2BYKB 1U35C 1N1JA 4KGCB 3R45B 1P3LC 4Z5TB 3B0DB 1H3OA 2NQBA 2UWXA 2NZDA 5BNVB 5AVBB 4H9OB 5CPKC 1P34A 5B32B 2NZDB 4AWLC 5E5AA 1P34B 3B6GB 5GSUB 3X1VC 4LD9C 4ZUXC 3LELC 2F8NH 3EPKA 3W99B 4HGAB 5E5AB 4XZQC 3WA9A 3AZHA 3AZGA 3C1BD 3WA9B 3AV2D 3MGRC 1ULYA 1P3AD 3AZHB 3AFAC 5B2JA 1KX3C 4H9RB 3RELC 3WKJD 2HIOD 3AZLB 1F66D 1P3IA 2DQNC 1TAFA 2RIQA 5GXQD 5B0YD 3REIB 1M18B 3NQUB 3LZ1D 5B2ID 4J8WD 1ID3B 3EPJA 3A1KA 1M19D 1BH9A 5AV8D 5AV5B 1Z2CB 2AROB 3TU4B 3W96B 3B0CW 2ZY3A 3AZIA 5FUGB 5B32G 1TZYA 5AV9A 3REKD 1U35B 5BT1D 1B67A 1P3LB 1AOIA 1TZYB 5B1MD 4G91C 1S32D 3C1BC 2Y2IA 5B40D 3MGSA 3AV2C 2XD5A 1P3AC 3AN2A 4XUJA 5CPKB 5CPJD 5B1LD 4J8XA 3WKJC 4AWLB 4ZUXA 3B6FD 5KDMA 4XUJB 1KX4A 2HIOC 4H9PB 1F66C 4CSRA 3X1VB 5B0YC 4ZUXB 5KDMB 2BYMA 3LZ1C 5B2IC 4J8WC 4XZQB 1KX4B 3X1TA 3MGRA 5CPID 2BYMB 4YM6D 4DQYB 3X1TB 2F8ND 5AV8C 3W97D 3MGRB 2G5HC 1KX3B 3C1CD 3RELB 5CHLB 3WTPD 3VH5W 1HQ3C 4QLCD 3REKC 5BT1C 2XD1A 1M1AA 3AZEA 3KFUG 4WU9C 5B33A 3AZND 1S32C 1BH8A 5B40C 3REHD 3AZEB 2BG1A 4Z2MG 4J8UD 5CPJC 3W98A 5B1LC 5GT0A 2LY8A 3B6FC 3AZJD 1WWSA 4CAYB 5GT0B 2J8PA 5AVCD 4X23D 2YFVB 5BS7A 1WWIA 1P3OA 3LZ0A 5CPIC 2YFWB 4G91B 4YM6C 3C1BB 3W97C 3AV2B 1EQZC 1P3AB 2VQRA 3WKJB 5B31D 3WTPC 4QLCC 1P3PC 5DNMA 2HIOB 1F66B 5B0YB 4WNNB 4WU8A 3EPHA 3AZKD 5B2IB 5DNMB 4J8WB 3F6TA 3MNND 3KUYC 3AZNC 3H0RC 5CP6A 5AV6A 4WU8B 3X1SD 1P3MD 4J8UC 4G92B 5AV8B 5AV6B 3O62D 3AZJC 4R8PD 4UUZA 3B0BA 1HQ3B 3X1UD 3MGQA 5AVCC 3REKB 4WU9A 4X23C 4UUZB 3UTBC 4EO5B 4Z66A 3MGPA 3AL0C 2BYKA 4WU9B 4J8VD 5C3IC 1S32B 1ZLAD 5B40B 1R4VA 3MGPB 1P3KC 4H9QB 5CPJB 4Z5TA 5B1LB 5B24D 5B31C 5BNVA 3B6FB 5AVBA 4H9OA 1Q9CA 2ZY5A 5B32A 4YS3D 1P3FC 3AZKC 5GT3D 5B0ZD 3MNNC 1BFMA 1B6WA 3B6GA 5GSUA 5CPIB 2PYOD 4YM6B 3X1SC 3KSYA 1P3MC 3W99A 3H0MC 1P3GA 3W97B 5BO0A 1P3PA 3O62C 3VH6T 1EQZB 4R8PC 3LJAD 1P3GB 3WTPB 5BO0B 3X1UC 1P3PB 4H9RA 3A1IA 4J8VC 3KUYB 3REJD 3AZLA 3AYWD 1ZLAC 3REIA 1M18A 3NQUA 4J8UB 3EPLA 1ID3A 1PZRA 5B24C 4NE3A 3AZJB 3WAAA 3W98D 3UTAD 3W96A 5AV5A 2AROA 3MVDD 3TU4A 4YS3C 4H9SC 3WAAB 5GT3C 5B0ZC 3AV1D 3UTBB 5JRGD 3AZMD 2HUEC 5FUGA 2PYOC 3UT9D 2Y2GA 3AZFD 4WJ3C 1U35A 5C3IB 2RVQD 2CV5D 5F99D 1P3LA 4JJND 1P3KB 3LZ0D 3VH6A 3NQJB 2F8NG 1P3FA 5CPKA 3A6ND 1P3FB 3AZKB 1JFIA 4H9PA 3MNNB 3REJC 1KX5D 3AYWC 3X1VA 4LD9A 3LELA 1JFIB 4XZQA 4NFTA 5DNND 1KU5A 2FFFB 2Y2QA 5GXQC 3LELB 4LD9B 4R8PB 3KWQD 2FJ7D 2F8NK 3UTAC 3MVDC 3X1UB 4UPKA 4KHAB 3AFAA 1M19C 1KX3A 3AV1C 1A7WA 3RELA 5JRGC 3AZMC 1P3BD 3KXBD 4KUDD 3UT9C 3AFAB 3AZFC 4J8VB 2RVQC 2CV5C 5F99C 4NE6A 1ZLAB 2Y2OA 3V9RB 5B24B 4KGCD 5AY8D 5B1MC 3A6NC 5B31G 4YS3B 5GT3B 2Y2NA 5B0ZB 1KX5C 4CAYA 2NQBD 2HUEB 2JSSA 2PYOB 2NZDD 2YFVA 5DNNC 1P34D 2YFWA 3C1BA 3KWQC 2FJ7C 5E5AD 3AV2A 1P3AA 2Y2JA 1F1EA 3WKJA 3WA9D 1P3BC 3KXBC 4ZBJC 3AZHD 2HIOA 4DRBA 3REJB 3AZGD 1F66A 3C1CC 3AYWB 5GXQA 5B0YA 4WNNA 3LZ1A 4M6BA 5B2IA 4J8WA 2CWEA 5B2JD 5GXQB 4KGCC 5AY8C 3LZ1B 5AV8A 3IP4C 1P3ID 2ZY2A 3REHC 2G5IC 1M19B 3AV1B 5JRGB 3AZMB 2NQBC 1HQ3A 5AV5D 3AZFB 3REKA 2NZDC 2CV5B 1P34C 5B1MA 3H0LC 1S32A 4HGAC 5E5AC 5B40A 3AZID 4E44A 1P3LD 2Y2HA 4H9QA 1TZYD 5B1MB 5AV9D 5CPJA 5B1LA 3VH5A 3FDDA 2DF4C 3WA9C 3B6FA 1AOID 3AZGC 3MGSD 3AN2D 4XUJD 2IO5C 2Y2MA 5DNNB 4J8XD 5B2JC 5CPIA 4ZUXD 4YM6A 3KWQB 2FJ7B 1KX4D 3W97A 1P3IC 1EQZA 3VH6W 2F8NB 3X1TD 3WTPA 3KXBB 4QLCA 1P3BB 2JCHA 4ZBJB 5G49B 3MGRD 3C1CB 4QLCB 3EG5B 2JE5A 3AZNA 3KUYA 3AZIC 5AY8B 3REHA 1TZYC 5AV9C 4WV4B 4J8UA 3AZNB 1N1JB 1M1AD 3REHB 3AZJA 3AZED 1AOIC 5B33D 2NQBB 1H3OB 5AVCA 3MGSC 2W8SA 4X23A 3AN2C 4XUJC 1HTAA 3UTBA 4J8XC 5GT0D 5AVCB 4X23B 1KX4C 1W2EA 1P3KA 3NQJA 5B31A 3P5JB 3X1TC 1P3OD 3LJAC 3AZGB 5B31B 3AZKA 3MNNA 2IO5B 5B2JB 2Y2LA 5BNXA 2ZY4A 3X1SA 1P3MA 5DNMD 1P3IB 5BNXB 1TAFB 3O62A 1M1AC 3X1SB 3AZEC 4R8PA 4WU8D 1P3MB 5B33C 1T3UA 3X1UA 3O62B 4KHAA 5CP6D 5AV6D 1BH9B 3B0CT 3W98C 5GT0C 1HQ3D 4J8VA 1ZLAA 3AZIB 5AV9B 3MGQD 4WU9D 5BS7C 3V9RA 5B24A 2L5AA 4JJNC 1P3OC 4Z66D 2Y2PA 3LZ0C 4Z2MH 3MGPD 1AOIB 4YS3A 3MGSB 4H9SA 5GT3A 3AN2B 5B0ZA 4Z5TD 4J8XB 2PYOA 5AVBD 5DNMC 4CSRB 5B32D 4WU8C 3LJAA 3WTPE 4G92C 3B6GD 5GSUD 5CP6C 5AV6C 1EQZD 3LJAB 3W99D 4H9NA 1P3GD 1P3PD 3REJA 3VH5T 3AYWA 4H9NB 4KUDC 4EO5C 3MGQC 4NE5A 3KUYD 1M1AB 4Z66C 3MGPC 2Y2KA 5B33B 3AZLD 3UTAA 1BH8B 3MVDA 3REID 1M18D 1M19A 3AV1A 3W98B 4Z5TC 5JRGA 3UTAB 3B0DC 3MVDB 3AZMA 1ID3D 3UT9A 3AZFA 3WAAD 5AVBC 2CV5A 5F99A 4JJNA 3UTBD 3W96D 2AROD 3UT9B 5B32C 5JA4A 3TU4D 5F99B 4JJNB 1P3OB 3B6GC 5GSUC 3LZ0B 1P3KD 5JA4B 3A6NA 1U35D 3W99C 1P3GC 4E45A 3A6NB 1KX5A 2F2AC 1P3FD 3AZHC 5CPKD 1KX5B 5DNNA 3KWQA 2FJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZL C;  3X1V D;  5CP6 B;  4LD9 D;  3LEL D;  3REI C;  1M18 C;  4XZQ D;  2F8N A;  1ID3 C;  1P3B A;  3KXB A;  4KUD A;  5G49 A;  3WAA C;  3C1C A;  4KUD B;  3W96 C;  5AV5 C;  2ARO C;  3TU4 C;  3MGQ B;  3AFA D;  1KX3 D;  3R45 A;  3REL D;  5AY8 A;  4WZS B;  4Z66 B;  4DRA A;  4KGC A;  2BYK B;  1U35 C;  1N1J A;  4KGC B;  3R45 B;  1P3L C;  4Z5T B;  3B0D B;  1H3O A;  2NQB A;  2NZD A;  5BNV B;  5AVB B;  4H9O B;  5CPK C;  1P34 A;  5B32 B;  2NZD B;  4AWL C;  5E5A A;  1P34 B;  3B6G B;  5GSU B;  3X1V C;  4LD9 C;  4ZUX C;  3LEL C;  2F8N H;  3W99 B;  4HGA B;  5E5A B;  4XZQ C;  3WA9 A;  3AZH A;  3AZG A;  3C1B D;  3WA9 B;  3AV2 D;  3MGR C;  1ULY A;  1P3A D;  3AZH B;  3AFA C;  5B2J A;  1KX3 C;  4H9R B;  3REL C;  3WKJ D;  2HIO D;  3AZL B;  1F66 D;  1P3I A;  1TAF A;  5GXQ D;  5B0Y D;  3REI B;  1M18 B;  3NQU B;  3LZ1 D;  5B2I D;  4J8W D;  1ID3 B;  1M19 D;  1BH9 A;  5AV8 D;  5AV5 B;  3W96 B;  2ARO B;  3TU4 B;  3B0C W;  3AZI A;  5FUG B;  5B32 G;  1TZY A;  5AV9 A;  3REK D;  1U35 B;  5BT1 D;  1B67 A;  1P3L B;  1AOI A;  1TZY B;  5B1M D;  4G91 C;  1S32 D;  3C1B C;  5B40 D;  3MGS A;  3AV2 C;  1P3A C;  3AN2 A;  4XUJ A;  5CPK B;  5CPJ D;  5B1L D;  4J8X A;  3WKJ C;  4AWL B;  4ZUX A;  3B6F D;  5KDM A;  4XUJ B;  1KX4 A;  4H9P B;  2HIO C;  1F66 C;  4CSR A;  3X1V B;  5B0Y C;  4ZUX B;  5KDM B;  2BYM A;  3LZ1 C;  5B2I C;  4J8W C;  4XZQ B;  1KX4 B;  3X1T A;  3MGR A;  5CPI D;  2BYM B;  4YM6 D;  3X1T B;  2F8N D;  5AV8 C;  3W97 D;  3MGR B;  1KX3 B;  3C1C D;  3REL B;  5CHL B;  3WTP D;  3VH5 W;  1HQ3 C;  4QLC D;  3REK C;  5BT1 C;  1M1A A;  3AZE A;  4WU9 C;  5B33 A;  3AZN D;  1S32 C;  1BH8 A;  5B40 C;  3REH D;  3AZE B;  4Z2M G;  4J8U D;  5CPJ C;  3W98 A;  5B1L C;  5GT0 A;  2LY8 A;  3B6F C;  3AZJ D;  1WWS A;  4CAY B;  5GT0 B;  5AVC D;  4X23 D;  2YFV B;  5BS7 A;  1WWI A;  1P3O A;  3LZ0 A;  5CPI C;  2YFW B;  4G91 B;  4YM6 C;  3C1B B;  3W97 C;  3AV2 B;  1EQZ C;  1P3A B;  3WKJ B;  5B31 D;  3WTP C;  4QLC C;  1P3P C;  5DNM A;  2HIO B;  1F66 B;  5B0Y B;  4WNN B;  4WU8 A;  3AZK D;  5B2I B;  5DNM B;  4J8W B;  3MNN D;  3KUY C;  3AZN C;  5CP6 A;  5AV6 A;  4WU8 B;  3X1S D;  1P3M D;  4J8U C;  4G92 B;  5AV8 B;  5AV6 B;  3O62 D;  3AZJ C;  4R8P D;  4UUZ A;  3B0B A;  1HQ3 B;  3X1U D;  3MGQ A;  5AVC C;  3REK B;  4WU9 A;  4X23 C;  4UUZ B;  3UTB C;  4EO5 B;  4Z66 A;  3MGP A;  2BYK A;  4WU9 B;  4J8V D;  5C3I C;  1S32 B;  1ZLA D;  5B40 B;  1R4V A;  3MGP B;  1P3K C;  4H9Q B;  5CPJ B;  4Z5T A;  5B1L B;  5B24 D;  5B31 C;  5BNV A;  3B6F B;  5AVB A;  4H9O A;  1Q9C A;  5B32 A;  4YS3 D;  1P3F C;  3AZK C;  5GT3 D;  5B0Z D;  3MNN C;  1BFM A;  1B6W A;  3B6G A;  5GSU A;  5CPI B;  2PYO D;  4YM6 B;  3X1S C;  3KSY A;  1P3M C;  3W99 A;  1P3G A;  3W97 B;  5BO0 A;  1P3P A;  3O62 C;  3VH6 T;  1EQZ B;  4R8P C;  3LJA D;  1P3G B;  3WTP B;  5BO0 B;  3X1U C;  1P3P B;  4H9R A;  4J8V C;  3KUY B;  3REJ D;  3AZL A;  3AYW D;  1ZLA C;  3REI A;  1M18 A;  3NQU A;  4J8U B;  1ID3 A;  5B24 C;  4NE3 A;  3AZJ B;  3WAA A;  3W98 D;  3UTA D;  3W96 A;  5AV5 A;  2ARO A;  3MVD D;  3TU4 A;  4YS3 C;  4H9S C;  3WAA B;  5GT3 C;  5B0Z C;  3AV1 D;  3UTB B;  5JRG D;  3AZM D;  2HUE C;  5FUG A;  2PYO C;  3UT9 D;  3AZF D;  1U35 A;  5C3I B;  2RVQ D;  2CV5 D;  5F99 D;  1P3L A;  4JJN D;  1P3K B;  3LZ0 D;  3VH6 A;  3NQJ B;  2F8N G;  1P3F A;  5CPK A;  3A6N D;  1P3F B;  3AZK B;  1JFI A;  4H9P A;  3MNN B;  3REJ C;  1KX5 D;  3AYW C;  3X1V A;  4LD9 A;  3LEL A;  1JFI B;  4XZQ A;  4NFT A;  5DNN D;  1KU5 A;  5GXQ C;  4LD9 B;  3LEL B;  4R8P B;  3KWQ D;  2FJ7 D;  2F8N K;  3UTA C;  3MVD C;  3X1U B;  4KHA B;  3AFA A;  1M19 C;  1KX3 A;  3AV1 C;  1A7W A;  3REL A;  5JRG C;  3AZM C;  1P3B D;  3KXB D;  4KUD D;  3UT9 C;  3AFA B;  3AZF C;  4J8V B;  2RVQ C;  2CV5 C;  5F99 C;  4NE6 A;  1ZLA B;  3V9R B;  5B24 B;  4KGC D;  5AY8 D;  5B1M C;  3A6N C;  5B31 G;  4YS3 B;  5GT3 B;  5B0Z B;  1KX5 C;  4CAY A;  2NQB D;  2HUE B;  2JSS A;  2PYO B;  2NZD D;  2YFV A;  5DNN C;  1P34 D;  2YFW A;  3C1B A;  3KWQ C;  2FJ7 C;  5E5A D;  3AV2 A;  1P3A A;  1F1E A;  3WKJ A;  3WA9 D;  1P3B C;  3KXB C;  4ZBJ C;  3AZH D;  2HIO A;  4DRB A;  3REJ B;  3AZG D;  1F66 A;  3C1C C;  3AYW B;  5GXQ A;  5B0Y A;  4WNN A;  3LZ1 A;  4M6B A;  5B2I A;  4J8W A;  2CWE A;  5B2J D;  5GXQ B;  4KGC C;  5AY8 C;  3LZ1 B;  5AV8 A;  1P3I D;  3REH C;  1M19 B;  3AV1 B;  5JRG B;  3AZM B;  2NQB C;  1HQ3 A;  5AV5 D;  3AZF B;  3REK A;  2NZD C;  2CV5 B;  1P34 C;  5B1M A;  1S32 A;  4HGA C;  5E5A C;  5B40 A;  3AZI D;  4E44 A;  1P3L D;  4H9Q A;  1TZY D;  5B1M B;  5AV9 D;  5CPJ A;  5B1L A;  3VH5 A;  3WA9 C;  3B6F A;  1AOI D;  3AZG C;  3MGS D;  3AN2 D;  4XUJ D;  2IO5 C;  5DNN B;  4J8X D;  5B2J C;  5CPI A;  4ZUX D;  4YM6 A;  3KWQ B;  2FJ7 B;  1KX4 D;  3W97 A;  1P3I C;  1EQZ A;  3VH6 W;  2F8N B;  3X1T D;  3WTP A;  3KXB B;  4QLC A;  1P3B B;  4ZBJ B;  5G49 B;  3MGR D;  3C1C B;  4QLC B;  3AZN A;  3KUY A;  3AZI C;  5AY8 B;  3REH A;  1TZY C;  5AV9 C;  4WV4 B;  4J8U A;  3AZN B;  1N1J B;  1M1A D;  3REH B;  3AZJ A;  3AZE D;  1AOI C;  5B33 D;  2NQB B;  1H3O B;  5AVC A;  3MGS C;  4X23 A;  3AN2 C;  4XUJ C;  1HTA A;  3UTB A;  4J8X C;  5GT0 D;  5AVC B;  4X23 B;  1KX4 C;  1P3K A;  3NQJ A;  5B31 A;  3X1T C;  1P3O D;  3LJA C;  3AZG B;  5B31 B;  3AZK A;  3MNN A;  2IO5 B;  5B2J B;  5BNX A;  3X1S A;  1P3M A;  5DNM D;  1P3I B;  5BNX B;  1TAF B;  3O62 A;  1M1A C;  3X1S B;  3AZE C;  4R8P A;  4WU8 D;  1P3M B;  5B33 C;  3X1U A;  3O62 B;  4KHA A;  5CP6 D;  5AV6 D;  1BH9 B;  3B0C T;  3W98 C;  5GT0 C;  1HQ3 D;  4J8V A;  1ZLA A;  3AZI B;  5AV9 B;  3MGQ D;  4WU9 D;  5BS7 C;  3V9R A;  5B24 A;  2L5A A;  4JJN C;  1P3O C;  4Z66 D;  3LZ0 C;  3MGP D;  4Z2M H;  1AOI B;  4YS3 A;  3MGS B;  4H9S A;  5GT3 A;  3AN2 B;  5B0Z A;  4Z5T D;  4J8X B;  2PYO A;  5AVB D;  5DNM C;  4CSR B;  5B32 D;  4WU8 C;  3LJA A;  3WTP E;  4G92 C;  3B6G D;  5GSU D;  5CP6 C;  5AV6 C;  1EQZ D;  3LJA B;  3W99 D;  4H9N A;  1P3G D;  1P3P D;  3REJ A;  3VH5 T;  3AYW A;  4H9N B;  4KUD C;  4EO5 C;  3MGQ C;  4NE5 A;  3KUY D;  1M1A B;  4Z66 C;  3MGP C;  5B33 B;  3AZL D;  3UTA A;  1BH8 B;  3MVD A;  3REI D;  1M18 D;  1M19 A;  3AV1 A;  3W98 B;  4Z5T C;  5JRG A;  3UTA B;  3B0D C;  3MVD B;  3AZM A;  1ID3 D;  3UT9 A;  3AZF A;  3WAA D;  5AVB C;  2CV5 A;  5F99 A;  4JJN A;  3UTB D;  3W96 D;  2ARO D;  3UT9 B;  5B32 C;  5JA4 A;  3TU4 D;  5F99 B;  4JJN B;  1P3O B;  3B6G C;  5GSU C;  3LZ0 B;  1P3K D;  5JA4 B;  3A6N A;  1U35 D;  3W99 C;  1P3G C;  4E45 A;  3A6N B;  1KX5 A;  1P3F D;  3AZH C;  5CPK D;  1KX5 B;  5DNN A;  3KWQ A;  2FJ7 A; 
#chains in the Genus database with same CATH topology
 3AZL C;  3X1V D;  5CP6 B;  4LD9 D;  3LEL D;  3REI C;  1M18 C;  4XZQ D;  2F8N A;  1ID3 C;  1P3B A;  3KXB A;  4KUD A;  5G49 A;  3WAA C;  3C1C A;  4KUD B;  2ZM5 A;  3W96 C;  5AV5 C;  2ARO C;  3TU4 C;  3MGQ B;  3AFA D;  1KX3 D;  3R45 A;  3REL D;  5AY8 A;  4WZS B;  4Z66 B;  4DRA A;  4KGC A;  2BYK B;  1U35 C;  1N1J A;  4KGC B;  3R45 B;  1P3L C;  4Z5T B;  3B0D B;  1H3O A;  2NQB A;  2UWX A;  2NZD A;  5BNV B;  5AVB B;  4H9O B;  5CPK C;  1P34 A;  5B32 B;  2NZD B;  4AWL C;  5E5A A;  1P34 B;  3B6G B;  5GSU B;  3X1V C;  4LD9 C;  4ZUX C;  3LEL C;  2F8N H;  3EPK A;  3W99 B;  4HGA B;  5E5A B;  4XZQ C;  3WA9 A;  3AZH A;  3AZG A;  3C1B D;  3WA9 B;  3AV2 D;  3MGR C;  1ULY A;  1P3A D;  3AZH B;  3AFA C;  5B2J A;  1KX3 C;  4H9R B;  3REL C;  3WKJ D;  2HIO D;  3AZL B;  1F66 D;  1P3I A;  2DQN C;  1TAF A;  2RIQ A;  5GXQ D;  5B0Y D;  3REI B;  1M18 B;  3NQU B;  3LZ1 D;  5B2I D;  4J8W D;  1ID3 B;  3EPJ A;  3A1K A;  1M19 D;  1BH9 A;  5AV8 D;  5AV5 B;  1Z2C B;  2ARO B;  3TU4 B;  3W96 B;  3B0C W;  2ZY3 A;  3AZI A;  5FUG B;  5B32 G;  1TZY A;  5AV9 A;  3REK D;  1U35 B;  5BT1 D;  1B67 A;  1P3L B;  1AOI A;  1TZY B;  5B1M D;  4G91 C;  1S32 D;  3C1B C;  2Y2I A;  5B40 D;  3MGS A;  3AV2 C;  2XD5 A;  1P3A C;  3AN2 A;  4XUJ A;  5CPK B;  5CPJ D;  5B1L D;  4J8X A;  3WKJ C;  4AWL B;  4ZUX A;  3B6F D;  5KDM A;  4XUJ B;  1KX4 A;  2HIO C;  4H9P B;  1F66 C;  4CSR A;  3X1V B;  5B0Y C;  4ZUX B;  5KDM B;  2BYM A;  3LZ1 C;  5B2I C;  4J8W C;  4XZQ B;  1KX4 B;  3X1T A;  3MGR A;  5CPI D;  2BYM B;  4YM6 D;  4DQY B;  3X1T B;  2F8N D;  5AV8 C;  3W97 D;  3MGR B;  2G5H C;  1KX3 B;  3C1C D;  3REL B;  5CHL B;  3WTP D;  3VH5 W;  1HQ3 C;  4QLC D;  3REK C;  5BT1 C;  2XD1 A;  1M1A A;  3AZE A;  3KFU G;  4WU9 C;  5B33 A;  3AZN D;  1S32 C;  1BH8 A;  5B40 C;  3REH D;  3AZE B;  2BG1 A;  4Z2M G;  4J8U D;  5CPJ C;  3W98 A;  5B1L C;  5GT0 A;  2LY8 A;  3B6F C;  3AZJ D;  1WWS A;  4CAY B;  5GT0 B;  2J8P A;  5AVC D;  4X23 D;  2YFV B;  5BS7 A;  1WWI A;  1P3O A;  3LZ0 A;  5CPI C;  2YFW B;  4G91 B;  4YM6 C;  3C1B B;  3W97 C;  3AV2 B;  1EQZ C;  1P3A B;  2VQR A;  3WKJ B;  5B31 D;  3WTP C;  4QLC C;  1P3P C;  5DNM A;  2HIO B;  1F66 B;  5B0Y B;  4WNN B;  4WU8 A;  3EPH A;  3AZK D;  5B2I B;  5DNM B;  4J8W B;  3F6T A;  3MNN D;  3KUY C;  3AZN C;  3H0R C;  5CP6 A;  5AV6 A;  4WU8 B;  3X1S D;  1P3M D;  4J8U C;  4G92 B;  5AV8 B;  5AV6 B;  3O62 D;  3AZJ C;  4R8P D;  4UUZ A;  3B0B A;  1HQ3 B;  3X1U D;  3MGQ A;  5AVC C;  3REK B;  4WU9 A;  4X23 C;  4UUZ B;  3UTB C;  4EO5 B;  4Z66 A;  3MGP A;  3AL0 C;  2BYK A;  4WU9 B;  4J8V D;  5C3I C;  1S32 B;  1ZLA D;  5B40 B;  1R4V A;  3MGP B;  1P3K C;  4H9Q B;  5CPJ B;  4Z5T A;  5B1L B;  5B24 D;  5B31 C;  5BNV A;  3B6F B;  5AVB A;  4H9O A;  1Q9C A;  2ZY5 A;  5B32 A;  4YS3 D;  1P3F C;  3AZK C;  5GT3 D;  5B0Z D;  3MNN C;  1BFM A;  1B6W A;  3B6G A;  5GSU A;  5CPI B;  2PYO D;  4YM6 B;  3X1S C;  3KSY A;  1P3M C;  3W99 A;  3H0M C;  1P3G A;  3W97 B;  5BO0 A;  1P3P A;  3O62 C;  3VH6 T;  1EQZ B;  4R8P C;  3LJA D;  1P3G B;  3WTP B;  5BO0 B;  3X1U C;  1P3P B;  4H9R A;  3A1I A;  4J8V C;  3KUY B;  3REJ D;  3AZL A;  3AYW D;  1ZLA C;  3REI A;  1M18 A;  3NQU A;  4J8U B;  3EPL A;  1ID3 A;  1PZR A;  5B24 C;  4NE3 A;  3AZJ B;  3WAA A;  3W98 D;  3UTA D;  3W96 A;  5AV5 A;  2ARO A;  3MVD D;  3TU4 A;  4YS3 C;  4H9S C;  3WAA B;  5GT3 C;  5B0Z C;  3AV1 D;  3UTB B;  5JRG D;  3AZM D;  2HUE C;  5FUG A;  2PYO C;  3UT9 D;  2Y2G A;  3AZF D;  4WJ3 C;  1U35 A;  5C3I B;  2RVQ D;  2CV5 D;  5F99 D;  1P3L A;  4JJN D;  1P3K B;  3LZ0 D;  3VH6 A;  3NQJ B;  2F8N G;  1P3F A;  5CPK A;  3A6N D;  1P3F B;  3AZK B;  1JFI A;  4H9P A;  3MNN B;  3REJ C;  1KX5 D;  3AYW C;  3X1V A;  4LD9 A;  3LEL A;  1JFI B;  4XZQ A;  4NFT A;  5DNN D;  1KU5 A;  2FFF B;  2Y2Q A;  5GXQ C;  3LEL B;  4LD9 B;  4R8P B;  3KWQ D;  2FJ7 D;  2F8N K;  3UTA C;  3MVD C;  3X1U B;  4UPK A;  4KHA B;  3AFA A;  1M19 C;  1KX3 A;  3AV1 C;  1A7W A;  3REL A;  5JRG C;  3AZM C;  1P3B D;  3KXB D;  4KUD D;  3UT9 C;  3AFA B;  3AZF C;  4J8V B;  2RVQ C;  2CV5 C;  5F99 C;  4NE6 A;  1ZLA B;  2Y2O A;  3V9R B;  5B24 B;  4KGC D;  5AY8 D;  5B1M C;  3A6N C;  5B31 G;  4YS3 B;  5GT3 B;  2Y2N A;  5B0Z B;  1KX5 C;  4CAY A;  2NQB D;  2HUE B;  2JSS A;  2PYO B;  2NZD D;  2YFV A;  5DNN C;  1P34 D;  2YFW A;  3C1B A;  3KWQ C;  2FJ7 C;  5E5A D;  3AV2 A;  1P3A A;  2Y2J A;  1F1E A;  3WKJ A;  3WA9 D;  1P3B C;  3KXB C;  4ZBJ C;  3AZH D;  2HIO A;  4DRB A;  3REJ B;  3AZG D;  1F66 A;  3C1C C;  3AYW B;  5GXQ A;  5B0Y A;  4WNN A;  3LZ1 A;  4M6B A;  5B2I A;  4J8W A;  2CWE A;  5B2J D;  5GXQ B;  4KGC C;  5AY8 C;  3LZ1 B;  5AV8 A;  3IP4 C;  1P3I D;  2ZY2 A;  3REH C;  2G5I C;  1M19 B;  3AV1 B;  5JRG B;  3AZM B;  2NQB C;  1HQ3 A;  5AV5 D;  3AZF B;  3REK A;  2NZD C;  2CV5 B;  1P34 C;  5B1M A;  3H0L C;  1S32 A;  4HGA C;  5E5A C;  5B40 A;  3AZI D;  4E44 A;  1P3L D;  2Y2H A;  4H9Q A;  1TZY D;  5B1M B;  5AV9 D;  5CPJ A;  5B1L A;  3VH5 A;  3FDD A;  2DF4 C;  3WA9 C;  3B6F A;  1AOI D;  3AZG C;  3MGS D;  3AN2 D;  4XUJ D;  2IO5 C;  2Y2M A;  5DNN B;  4J8X D;  5B2J C;  5CPI A;  4ZUX D;  4YM6 A;  3KWQ B;  2FJ7 B;  1KX4 D;  3W97 A;  1P3I C;  1EQZ A;  3VH6 W;  2F8N B;  3X1T D;  3WTP A;  3KXB B;  4QLC A;  1P3B B;  2JCH A;  4ZBJ B;  5G49 B;  3MGR D;  3C1C B;  4QLC B;  3EG5 B;  2JE5 A;  3AZN A;  3KUY A;  3AZI C;  5AY8 B;  3REH A;  1TZY C;  5AV9 C;  4WV4 B;  4J8U A;  3AZN B;  1N1J B;  1M1A D;  3REH B;  3AZJ A;  3AZE D;  1AOI C;  5B33 D;  2NQB B;  1H3O B;  5AVC A;  3MGS C;  2W8S A;  4X23 A;  3AN2 C;  4XUJ C;  1HTA A;  3UTB A;  4J8X C;  5GT0 D;  5AVC B;  4X23 B;  1KX4 C;  1W2E A;  1P3K A;  3NQJ A;  5B31 A;  3P5J B;  3X1T C;  1P3O D;  3LJA C;  3AZG B;  5B31 B;  3AZK A;  3MNN A;  2IO5 B;  5B2J B;  2Y2L A;  5BNX A;  2ZY4 A;  3X1S A;  1P3M A;  5DNM D;  1P3I B;  5BNX B;  1TAF B;  3O62 A;  1M1A C;  3X1S B;  3AZE C;  4R8P A;  4WU8 D;  1P3M B;  5B33 C;  1T3U A;  3X1U A;  3O62 B;  4KHA A;  5CP6 D;  5AV6 D;  1BH9 B;  3B0C T;  3W98 C;  5GT0 C;  1HQ3 D;  4J8V A;  1ZLA A;  3AZI B;  5AV9 B;  3MGQ D;  4WU9 D;  5BS7 C;  3V9R A;  5B24 A;  2L5A A;  4JJN C;  1P3O C;  4Z66 D;  2Y2P A;  3LZ0 C;  4Z2M H;  3MGP D;  1AOI B;  4YS3 A;  3MGS B;  4H9S A;  5GT3 A;  3AN2 B;  5B0Z A;  4Z5T D;  4J8X B;  2PYO A;  5AVB D;  5DNM C;  4CSR B;  5B32 D;  4WU8 C;  3LJA A;  3WTP E;  4G92 C;  3B6G D;  5GSU D;  5CP6 C;  5AV6 C;  1EQZ D;  3LJA B;  3W99 D;  4H9N A;  1P3G D;  1P3P D;  3REJ A;  3VH5 T;  3AYW A;  4H9N B;  4KUD C;  4EO5 C;  3MGQ C;  4NE5 A;  3KUY D;  1M1A B;  4Z66 C;  3MGP C;  2Y2K A;  5B33 B;  3AZL D;  3UTA A;  1BH8 B;  3MVD A;  3REI D;  1M18 D;  1M19 A;  3AV1 A;  3W98 B;  4Z5T C;  5JRG A;  3UTA B;  3B0D C;  3MVD B;  3AZM A;  1ID3 D;  3UT9 A;  3AZF A;  3WAA D;  5AVB C;  2CV5 A;  5F99 A;  4JJN A;  3UTB D;  3W96 D;  2ARO D;  3UT9 B;  5B32 C;  5JA4 A;  3TU4 D;  5F99 B;  4JJN B;  1P3O B;  3B6G C;  5GSU C;  3LZ0 B;  1P3K D;  5JA4 B;  3A6N A;  1U35 D;  3W99 C;  1P3G C;  4E45 A;  3A6N B;  1KX5 A;  2F2A C;  1P3F D;  3AZH C;  5CPK D;  1KX5 B;  5DNN A;  3KWQ A;  2FJ7 A; 
#chains in the Genus database with same CATH homology
 3AZL C;  3X1V D;  5CP6 B;  4LD9 D;  3LEL D;  3REI C;  1M18 C;  4XZQ D;  2F8N A;  1ID3 C;  1P3B A;  3KXB A;  4KUD A;  5G49 A;  3WAA C;  3C1C A;  4KUD B;  2ZM5 A;  3W96 C;  5AV5 C;  2ARO C;  3TU4 C;  3MGQ B;  3AFA D;  1KX3 D;  3R45 A;  3REL D;  5AY8 A;  4WZS B;  4Z66 B;  4DRA A;  4KGC A;  2BYK B;  1U35 C;  1N1J A;  4KGC B;  3R45 B;  1P3L C;  4Z5T B;  3B0D B;  1H3O A;  2NQB A;  2UWX A;  2NZD A;  5BNV B;  5AVB B;  4H9O B;  5CPK C;  1P34 A;  5B32 B;  2NZD B;  4AWL C;  5E5A A;  1P34 B;  3B6G B;  5GSU B;  3X1V C;  4LD9 C;  4ZUX C;  3LEL C;  2F8N H;  3EPK A;  3W99 B;  4HGA B;  5E5A B;  4XZQ C;  3WA9 A;  3AZH A;  3AZG A;  3C1B D;  3WA9 B;  3AV2 D;  3MGR C;  1ULY A;  1P3A D;  3AZH B;  3AFA C;  5B2J A;  1KX3 C;  4H9R B;  3REL C;  3WKJ D;  2HIO D;  3AZL B;  1F66 D;  1P3I A;  2DQN C;  1TAF A;  2RIQ A;  5GXQ D;  5B0Y D;  3REI B;  1M18 B;  3NQU B;  3LZ1 D;  5B2I D;  4J8W D;  1ID3 B;  3EPJ A;  3A1K A;  1M19 D;  1BH9 A;  5AV8 D;  5AV5 B;  1Z2C B;  2ARO B;  3TU4 B;  3W96 B;  3B0C W;  2ZY3 A;  3AZI A;  5FUG B;  5B32 G;  1TZY A;  5AV9 A;  3REK D;  1U35 B;  5BT1 D;  1B67 A;  1P3L B;  1AOI A;  1TZY B;  5B1M D;  4G91 C;  1S32 D;  3C1B C;  2Y2I A;  5B40 D;  3MGS A;  3AV2 C;  2XD5 A;  1P3A C;  3AN2 A;  4XUJ A;  5CPK B;  5CPJ D;  5B1L D;  4J8X A;  3WKJ C;  4AWL B;  4ZUX A;  3B6F D;  5KDM A;  4XUJ B;  1KX4 A;  2HIO C;  4H9P B;  1F66 C;  4CSR A;  3X1V B;  5B0Y C;  4ZUX B;  5KDM B;  2BYM A;  3LZ1 C;  5B2I C;  4J8W C;  4XZQ B;  1KX4 B;  3X1T A;  3MGR A;  5CPI D;  2BYM B;  4YM6 D;  4DQY B;  3X1T B;  2F8N D;  5AV8 C;  3W97 D;  3MGR B;  2G5H C;  1KX3 B;  3C1C D;  3REL B;  5CHL B;  3WTP D;  3VH5 W;  1HQ3 C;  4QLC D;  3REK C;  5BT1 C;  2XD1 A;  1M1A A;  3AZE A;  3KFU G;  4WU9 C;  5B33 A;  3AZN D;  1S32 C;  1BH8 A;  5B40 C;  3REH D;  3AZE B;  2BG1 A;  4Z2M G;  4J8U D;  5CPJ C;  3W98 A;  5B1L C;  5GT0 A;  2LY8 A;  3B6F C;  3AZJ D;  1WWS A;  4CAY B;  5GT0 B;  2J8P A;  5AVC D;  4X23 D;  2YFV B;  5BS7 A;  1WWI A;  1P3O A;  3LZ0 A;  5CPI C;  2YFW B;  4G91 B;  4YM6 C;  3C1B B;  3W97 C;  3AV2 B;  1EQZ C;  1P3A B;  2VQR A;  3WKJ B;  5B31 D;  3WTP C;  4QLC C;  1P3P C;  5DNM A;  2HIO B;  1F66 B;  5B0Y B;  4WNN B;  4WU8 A;  3EPH A;  3AZK D;  5B2I B;  5DNM B;  4J8W B;  3F6T A;  3MNN D;  3KUY C;  3AZN C;  3H0R C;  5CP6 A;  5AV6 A;  4WU8 B;  3X1S D;  1P3M D;  4J8U C;  4G92 B;  5AV8 B;  5AV6 B;  3O62 D;  3AZJ C;  4R8P D;  4UUZ A;  3B0B A;  1HQ3 B;  3X1U D;  3MGQ A;  5AVC C;  3REK B;  4WU9 A;  4X23 C;  4UUZ B;  3UTB C;  4EO5 B;  4Z66 A;  3MGP A;  3AL0 C;  2BYK A;  4WU9 B;  4J8V D;  5C3I C;  1S32 B;  1ZLA D;  5B40 B;  1R4V A;  3MGP B;  1P3K C;  4H9Q B;  5CPJ B;  4Z5T A;  5B1L B;  5B24 D;  5B31 C;  5BNV A;  3B6F B;  5AVB A;  4H9O A;  1Q9C A;  2ZY5 A;  5B32 A;  4YS3 D;  1P3F C;  3AZK C;  5GT3 D;  5B0Z D;  3MNN C;  1BFM A;  1B6W A;  3B6G A;  5GSU A;  5CPI B;  2PYO D;  4YM6 B;  3X1S C;  3KSY A;  1P3M C;  3W99 A;  3H0M C;  1P3G A;  3W97 B;  5BO0 A;  1P3P A;  3O62 C;  3VH6 T;  1EQZ B;  4R8P C;  3LJA D;  1P3G B;  3WTP B;  5BO0 B;  3X1U C;  1P3P B;  4H9R A;  3A1I A;  4J8V C;  3KUY B;  3REJ D;  3AZL A;  3AYW D;  1ZLA C;  3REI A;  1M18 A;  3NQU A;  4J8U B;  3EPL A;  1ID3 A;  1PZR A;  5B24 C;  4NE3 A;  3AZJ B;  3WAA A;  3W98 D;  3UTA D;  3W96 A;  5AV5 A;  2ARO A;  3MVD D;  3TU4 A;  4YS3 C;  4H9S C;  3WAA B;  5GT3 C;  5B0Z C;  3AV1 D;  3UTB B;  5JRG D;  3AZM D;  2HUE C;  5FUG A;  2PYO C;  3UT9 D;  2Y2G A;  3AZF D;  4WJ3 C;  1U35 A;  5C3I B;  2RVQ D;  2CV5 D;  5F99 D;  1P3L A;  4JJN D;  1P3K B;  3LZ0 D;  3VH6 A;  3NQJ B;  2F8N G;  1P3F A;  5CPK A;  3A6N D;  1P3F B;  3AZK B;  1JFI A;  4H9P A;  3MNN B;  3REJ C;  1KX5 D;  3AYW C;  3X1V A;  4LD9 A;  3LEL A;  1JFI B;  4XZQ A;  4NFT A;  5DNN D;  1KU5 A;  2FFF B;  2Y2Q A;  5GXQ C;  3LEL B;  4LD9 B;  4R8P B;  3KWQ D;  2FJ7 D;  2F8N K;  3UTA C;  3MVD C;  3X1U B;  4UPK A;  4KHA B;  3AFA A;  1M19 C;  1KX3 A;  3AV1 C;  1A7W A;  3REL A;  5JRG C;  3AZM C;  1P3B D;  3KXB D;  4KUD D;  3UT9 C;  3AFA B;  3AZF C;  4J8V B;  2RVQ C;  2CV5 C;  5F99 C;  4NE6 A;  1ZLA B;  2Y2O A;  3V9R B;  5B24 B;  4KGC D;  5AY8 D;  5B1M C;  3A6N C;  5B31 G;  4YS3 B;  5GT3 B;  2Y2N A;  5B0Z B;  1KX5 C;  4CAY A;  2NQB D;  2HUE B;  2JSS A;  2PYO B;  2NZD D;  2YFV A;  5DNN C;  1P34 D;  2YFW A;  3C1B A;  3KWQ C;  2FJ7 C;  5E5A D;  3AV2 A;  1P3A A;  2Y2J A;  1F1E A;  3WKJ A;  3WA9 D;  1P3B C;  3KXB C;  4ZBJ C;  3AZH D;  2HIO A;  4DRB A;  3REJ B;  3AZG D;  1F66 A;  3C1C C;  3AYW B;  5GXQ A;  5B0Y A;  4WNN A;  3LZ1 A;  4M6B A;  5B2I A;  4J8W A;  2CWE A;  5B2J D;  5GXQ B;  4KGC C;  5AY8 C;  3LZ1 B;  5AV8 A;  3IP4 C;  1P3I D;  2ZY2 A;  3REH C;  2G5I C;  1M19 B;  3AV1 B;  5JRG B;  3AZM B;  2NQB C;  1HQ3 A;  5AV5 D;  3AZF B;  3REK A;  2NZD C;  2CV5 B;  1P34 C;  5B1M A;  3H0L C;  1S32 A;  4HGA C;  5E5A C;  5B40 A;  3AZI D;  4E44 A;  1P3L D;  2Y2H A;  4H9Q A;  1TZY D;  5B1M B;  5AV9 D;  5CPJ A;  5B1L A;  3VH5 A;  3FDD A;  2DF4 C;  3WA9 C;  3B6F A;  1AOI D;  3AZG C;  3MGS D;  3AN2 D;  4XUJ D;  2IO5 C;  2Y2M A;  5DNN B;  4J8X D;  5B2J C;  5CPI A;  4ZUX D;  4YM6 A;  3KWQ B;  2FJ7 B;  1KX4 D;  3W97 A;  1P3I C;  1EQZ A;  3VH6 W;  2F8N B;  3X1T D;  3WTP A;  3KXB B;  4QLC A;  1P3B B;  2JCH A;  4ZBJ B;  5G49 B;  3MGR D;  3C1C B;  4QLC B;  3EG5 B;  2JE5 A;  3AZN A;  3KUY A;  3AZI C;  5AY8 B;  3REH A;  1TZY C;  5AV9 C;  4WV4 B;  4J8U A;  3AZN B;  1N1J B;  1M1A D;  3REH B;  3AZJ A;  3AZE D;  1AOI C;  5B33 D;  2NQB B;  1H3O B;  5AVC A;  3MGS C;  2W8S A;  4X23 A;  3AN2 C;  4XUJ C;  1HTA A;  3UTB A;  4J8X C;  5GT0 D;  5AVC B;  4X23 B;  1KX4 C;  1W2E A;  1P3K A;  3NQJ A;  5B31 A;  3P5J B;  3X1T C;  1P3O D;  3LJA C;  3AZG B;  5B31 B;  3AZK A;  3MNN A;  2IO5 B;  5B2J B;  2Y2L A;  5BNX A;  2ZY4 A;  3X1S A;  1P3M A;  5DNM D;  1P3I B;  5BNX B;  1TAF B;  3O62 A;  1M1A C;  3X1S B;  3AZE C;  4R8P A;  4WU8 D;  1P3M B;  5B33 C;  1T3U A;  3X1U A;  3O62 B;  4KHA A;  5CP6 D;  5AV6 D;  1BH9 B;  3B0C T;  3W98 C;  5GT0 C;  1HQ3 D;  4J8V A;  1ZLA A;  3AZI B;  5AV9 B;  3MGQ D;  4WU9 D;  5BS7 C;  3V9R A;  5B24 A;  2L5A A;  4JJN C;  1P3O C;  4Z66 D;  2Y2P A;  3LZ0 C;  4Z2M H;  3MGP D;  1AOI B;  4YS3 A;  3MGS B;  4H9S A;  5GT3 A;  3AN2 B;  5B0Z A;  4Z5T D;  4J8X B;  2PYO A;  5AVB D;  5DNM C;  4CSR B;  5B32 D;  4WU8 C;  3LJA A;  3WTP E;  4G92 C;  3B6G D;  5GSU D;  5CP6 C;  5AV6 C;  1EQZ D;  3LJA B;  3W99 D;  4H9N A;  1P3G D;  1P3P D;  3REJ A;  3VH5 T;  3AYW A;  4H9N B;  4KUD C;  4EO5 C;  3MGQ C;  4NE5 A;  3KUY D;  1M1A B;  4Z66 C;  3MGP C;  2Y2K A;  5B33 B;  3AZL D;  3UTA A;  1BH8 B;  3MVD A;  3REI D;  1M18 D;  1M19 A;  3AV1 A;  3W98 B;  4Z5T C;  5JRG A;  3UTA B;  3B0D C;  3MVD B;  3AZM A;  1ID3 D;  3UT9 A;  3AZF A;  3WAA D;  5AVB C;  2CV5 A;  5F99 A;  4JJN A;  3UTB D;  3W96 D;  2ARO D;  3UT9 B;  5B32 C;  5JA4 A;  3TU4 D;  5F99 B;  4JJN B;  1P3O B;  3B6G C;  5GSU C;  3LZ0 B;  1P3K D;  5JA4 B;  3A6N A;  1U35 D;  3W99 C;  1P3G C;  4E45 A;  3A6N B;  1KX5 A;  2F2A C;  1P3F D;  3AZH C;  5CPK D;  1KX5 B;  5DNN A;  3KWQ A;  2FJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...