3RELD

2.7 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b) derivatized with triamminechloroplatinum(ii) chloride
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 35
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3relD00
1P3OC 3W96A 1BH8A 3C1CC 4YS3A 3W97B 1P3LC 1AOIB 1HTAA 3MNNA 3C1BB 3RELB 5B40D 1U35C 3AZEB 3AZMB 5KDMB 4QLCB 3MGQD 1P3PB 1WWSA 4H9NB 3AZGC 5AV5B 2PYOD 3W97A 3B0BA 5GSUC 3C1CD 1AOIA 3KUYD 2HIOA 3C1BA 3RELA 1P3BB 4LD9C 3AZIA 5DNMD 1U35D 4Z66C 3UT9C 3AZEA 1ZLAD 5BNXB 3AZMA 3WKJA 4UUZB 5KDMA 4QLCA 5AVCB 5B24D 1P3PA 4R8PD 1KX4B 3B6GB 4Z2MH 5CPJD 5AV5A 3AN2B 5AV8D 2BYKB 3B0DC 4YM6D 4XUJC 1KX5D 3WAAD 1F66C 5GXQC 4J8XD 3X1SC 2F8NH 5B31B 5CPIB 4WU9D 3REJB 4H9SA 2RVQC 5B33A 3LELC 3AFAA 3MGSC 4G92C 1KX3C 5AVCA 3AZKB 3B6GA 3X1VD 2LY8A 3AN2A 4EO5C 2BYKA 4XUJD 3KWQD 1P3AC 5AV9D 2AROB 4YS3D 3MVDC 1P3IB 4JJNC 1P3MC 5B2JC 3W99B 5B31A 4DRAA 5B32C 3REJA 1P3GC 3X1UC 5AY8C 3LELD 4XZQD 3AZFC 3AZKA 4H9PA 3MGRD 4Z5TC 5B40B 2AROA 3VH6T 3MVDD 1P3KB 3MGQB 4JJND 5B2JD 3LZ0B 2HIOD 3RELD 5E5AD 3W99A 1ID3C 3X1UD 3C1CB 3AZID 1P3FC 1P3LB 3AZED 3B6FC 4WU8D 3AZMD 3WKJD 5B40A 1U35B 5B0YC 2HUEB 1ZLAB 4NE5A 4KUDC 1P3KA 3VH6W 5CHLB 3MGPD 5B24B 3LZ0A 4R8PB 3REKA 3AZGB 5CPJB 5GSUB 3C1CA 1P3OA 4YM6B 1KU5A 3WAAB 5BT1C 1P3LA 5JRGC 1N1JB 4J8XB 1EQZD 4M6BA 5B33D 3AFAD 1U35A 4Z66B 4WU9B 3UT9B 1HQ3C 1ZLAA 4NE3A 3X1VB 5DNNC 3AZGA 5B2IC 2BYMB 5GSUA 3B0DB 4YM6A 5B31D 4XUJB 5B0ZC 5BT1D 5AV9B 5GXQB 1N1JA 3X1SB 4LD9A 3AZKD 4Z66A 4WU9A 3UT9A 3LELB 1KX3B 4G92B 4XZQB 5CP6C 3WA9C 5B1LC 2FJ7C 2BYMA 3MGRB 1M18C 2L5AA 3W99D 4XUJA 1P3AB 5AV9A 3MVDB 5GXQA 3AV1C 3X1SA 1JFIB 4JJNB 3B0CW 5CPKC 5B2JB 2HIOB 3AV2D 5BS7C 5E5AB 5B31G 5GT0C 1P3GB 3X1UB 3AZIB 3W98D 5AY8B 1M1AC 3LELA 1KX3A 4XZQA 4WU8B 3AZFB 3WKJB 1P3KD 2FJ7D 3LZ0D 3MGRA 1P34C 4Z5TB 3REHC 3REKD 5GT3C 1P3AA 1P3OD 3MVDA 1TZYC 1P3LD 3AZNC 4JJNA 1JFIA 3MGPB 5CPKD 5B2JA 5E5AA 5B32A 5GT0D 1P3GA 1ID3B 3X1UA 1ULYA 5AY8A 1S32C 1M19C 4WU8A 3AZFA 1EQZB 5JA4A 5B33B 3AFAB 4NE6A 1P34D 4Z5TA 3AZGD 5GSUD 4KUDB 4WNNB 2IO5C 3MGPA 5C3IB 3TU4C 1ID3A 4LD9D 4WV4B 4DRBA 1P3FA 4Z66D 5JRGB 2CWEA 3UT9D 3V9RA 3B6FA 1EQZA 3O62C 5B0YA 4H9PB 1HQ3B 4KUDA 1F66D 3AZHC 4WNNA 5GXQD 2F8NK 3X1SD 2CV5C 3A6NC 5B2IB 4J8VC 5JRGA 4KGCC 2RVQD 3MNNC 5B1MC 3MGSD 1KX3D 3AV2B 1A7WA 1HQ3A 3LZ1C 3KXBC 5F99C 3W98B 2YFWB 1P3AD 4J8UC 5B1LB 5DNNA 2FJ7B 1P3MD 5B2IA 4ZUXC 3WTPC 1M18B 3W97C 3REKB 5B32D 4KGCD 1P3GD 1P3OB 3AYWC 1AOIC 5AY8D 4CSRB 5CPKB 4H9QA 3AV2A 3AZFD 3X1TC 5GT0B 4ZBJC 3W98A 4Z5TD 2YFWA 3VH6A 4J8UD 5CP6A 3WA9A 4WZSB 5B1LA 2FJ7A 3KSYA 3WTPD 1P34B 1M18A 3LJAC 1ID3D 3AV1A 1P3FD 4CSRA 3AZNB 5CPKA 1P3BC 3B6FD 5BS7A 4J8WC 3X1TD 2NZDC 5AVBC 5AV6C 4X23C 5GT0A 4LD9B 5B32G 3NQUB 5B0YD 1M1AA 1M19B 4KUDD 5AVCC 1KX4C 3B6GC 2NQBC 1P34A 3LJAD 3REHA 3AN2C 1F66B 5JRGD 4AWLC 3AZNA 2IO5B 3REIC 1B67A 5AVBD 5AV6D 5CPIC 3NQUA 3REJC 1S32A 3UTBC 1HQ3D 1M19A 3MGSB 2NQBD 5DNND 3AZJC 5B2ID 4H9OB 3VH5T 4EO5B 2AROC 5B0ZD 1P3IC 1F66A 1H3OA 2CV5B 1P3MB 4HGAC 3AZLC 1WWIA 4J8VB 5B32B 4KGCB 3UTBD 5B1MB 3MGSA 3WA9D 5CP6D 5JA4B 2F8ND 5B1LD 4H9OA 1M18D 3KXBB 5F99B 1TAFB 3UTAC 4J8UB 3MGQC 3AV1D 2CV5A 1P3MA 4ZUXB 3WTPB 2PYOC 4J8VA 4KGCA 3AYWB 1P3FB 3KUYC 1R4VA 1M1AD 5B1MA 4G91C 3V9RB 3B6FB 4Z2MG 3X1TB 5DNMC 4ZBJB 3LZ1A 2HUEC 5F99A 3KXBA 1ZLAC 3REHD 5B0YB 3UTAD 1TAFA 1BFMA 5GT3D 4J8UA 1TZYD 3R45B 5B24C 2F8NG 3AZND 4R8PC 4ZUXA 3WTPA 5CPJC 3LJAB 3WAAC 5AV8C 4YM6C 1KX5C 3NQJB 3AYWA 4KHAB 4J8XC 1S32D 1M19D 4J8WB 2NZDB 3X1TA 5AVBB 5AV6B 4X23B 4WU9C 2JSSA 4E44A 3R45A 3X1VC 2NQBB 5FUGB 4H9NA 3LJAA 5DNNB 3TU4D 3KWQC 3NQJA 5AV9C 5B0ZB 4KHAA 3W96C 4YS3C 4AWLB 1P3BA 5G49B 4J8WA 3REIB 2NZDA 5AVBA 5AV6A 4H9QB 4X23A 3O62D 5BNXA 3UTBB 4UUZA 1F1EA 4XZQC 3AZHD 1KX4A 3WA9B 5CP6B 2NQBA 5FUGA 2CV5D 2F8NB 3MGRC 3A6ND 3AZJB 3WTPE 5B0ZA 3W96D 4J8VD 5BO0B 3AV1B 5G49A 3REIA 2HIOC 5B1MD 3MNND 3C1BC 5E5AC 4HGAB 3RELC 3AZLB 5CPIA 3AZIC 3UTBA 3LZ1D 3KXBD 5F99D 3AZEC 1M1AB 4WU8C 3AZMC 3WKJC 4QLCC 2F8NA 5BNVB 1P3PC 3AZJA 4ZUXD 4H9RB 5AV5C 3REHB 3W97D 3UTAB 1P3IA 5GT3B 5BO0A 3AYWD 1AOID 1TZYB 3MGPC 1Q9CA 3C1BD 3AZLA 2PYOB 3KUYB 4H9SC 1S32B 4G91B 1EQZC 5B33C 4QLCD 3AFAC 1BH9B 1P3PD 2YFVB 5BNVA 5DNMB 4H9RA 5AV5D 3UTAA 5GT3A 3MGQA 1TZYA 5C3IC 1H3OB 1P3BD 4J8WD 2PYOA 2NZDD 5AV8B 3TU4B 5B31C 4X23D 1KX5B 4NFTA 3KUYA 5AVCD 1BH9A 1KX4D 2YFVA 3AZKC 5DNMA 3B6GD 3O62B 3AN2D 5B24A 3AZHB 4R8PA 5CPJA 3REID 5AV8A 3A6NB 3W99C 4E45A 3TU4A 4CAYB 3KWQB 5CPID 1KX5A 3WAAA 3REJD 3REKC 4YS3B 1BH8B 3B0CT 4J8XA 3W96B 3MNNB 3AV2C 3O62A 3W98C 3AZJD 5B40C 3VH5A 3LZ1B 2AROD 1P3ID 3AZHA 1P3KC 1B6WA 3VH5W 3X1VA 3LZ0C 3A6NA 3AZLD 4CAYA 3KWQA
chains in the Genus database with same CATH superfamily
1P3OC 3W96A 1BH8A 3C1CC 4YS3A 3W97B 1P3LC 2FFFB 1AOIB 1HTAA 3MNNA 3C1BB 3RELB 2ZY5A 2VQRA 5B40D 1U35C 3AZEB 3AZMB 5KDMB 4QLCB 3MGQD 1P3PB 1WWSA 4H9NB 3AZGC 5AV5B 2PYOD 3W97A 3B0BA 5GSUC 3C1CD 1AOIA 3KUYD 2HIOA 3C1BA 2Y2HA 3RELA 1P3BB 4LD9C 3AZIA 5DNMD 1U35D 4Z66C 3UT9C 3AZEA 1ZLAD 5BNXB 3AZMA 3WKJA 4UUZB 5KDMA 4QLCA 5AVCB 5B24D 1P3PA 4R8PD 1KX4B 3B6GB 4Z2MH 5CPJD 5AV5A 3AN2B 5AV8D 2BYKB 3B0DC 4YM6D 4XUJC 1KX5D 3WAAD 1F66C 5GXQC 4J8XD 3X1SC 2F8NH 5B31B 5CPIB 4WU9D 3REJB 4H9SA 2RVQC 5B33A 3LELC 3AFAA 3MGSC 4G92C 1KX3C 5AVCA 3EPHA 3AZKB 3B6GA 3X1VD 2G5IC 2LY8A 3AN2A 4EO5C 2BYKA 4XUJD 3KWQD 1P3AC 5AV9D 2AROB 2Y2IA 4YS3D 3MVDC 1P3IB 4JJNC 1P3MC 3A1KA 5B2JC 3W99B 5B31A 4DRAA 5B32C 3REJA 1P3GC 3X1UC 5AY8C 3LELD 4XZQD 3AZFC 3AZKA 4H9PA 3MGRD 4Z5TC 5B40B 2AROA 3VH6T 3MVDD 1P3KB 3MGQB 4JJND 5B2JD 3LZ0B 2HIOD 3RELD 5E5AD 3W99A 1ID3C 3X1UD 3C1CB 3AZID 1P3FC 1P3LB 2DF4C 3H0LC 3AZED 3B6FC 4WU8D 3AZMD 3WKJD 5B40A 1U35B 5B0YC 2Y2LA 2HUEB 1ZLAB 4NE5A 4KUDC 1P3KA 1W2EA 3VH6W 5CHLB 3MGPD 5B24B 3LZ0A 4R8PB 3REKA 3AZGB 5CPJB 5GSUB 3C1CA 1P3OA 4YM6B 1KU5A 3WAAB 5BT1C 1P3LA 5JRGC 1N1JB 4J8XB 1EQZD 4M6BA 5B33D 3AFAD 1U35A 4Z66B 4WU9B 3UT9B 1HQ3C 1ZLAA 4NE3A 2J8PA 3X1VB 5DNNC 3AZGA 5B2IC 2BYMB 5GSUA 3B0DB 4YM6A 5B31D 4XUJB 5B0ZC 5BT1D 2BG1A 5AV9B 5GXQB 1N1JA 3X1SB 2XD5A 4LD9A 3AZKD 4Z66A 4WU9A 3UT9A 3LELB 1KX3B 4G92B 4XZQB 5CP6C 3WA9C 5B1LC 2FJ7C 2BYMA 3MGRB 1M18C 2L5AA 3W99D 2JCHA 4XUJA 1P3AB 5AV9A 3MVDB 5GXQA 3AV1C 3X1SA 1JFIB 4JJNB 3B0CW 5CPKC 5B2JB 2HIOB 3AV2D 5BS7C 5E5AB 5B31G 5GT0C 1P3GB 3X1UB 3AZIB 3W98D 3AL0C 5AY8B 3F6TA 1M1AC 3LELA 1KX3A 4XZQA 4WU8B 3AZFB 3WKJB 1P3KD 2FJ7D 3LZ0D 3MGRA 2JE5A 4Z5TB 1P34C 3REHC 3REKD 5GT3C 1P3AA 1P3OD 3IP4C 3MVDA 1TZYC 1P3LD 3AZNC 4JJNA 1JFIA 3MGPB 5CPKD 5B2JA 2Y2JA 5E5AA 5B32A 5GT0D 1P3GA 1ID3B 3X1UA 1ULYA 5AY8A 1S32C 1M19C 4WU8A 3AZFA 1EQZB 5JA4A 5B33B 3AFAB 3EPKA 4NE6A 1P34D 4Z5TA 3AZGD 5GSUD 4KUDB 1Z2CB 4WNNB 2IO5C 3MGPA 1PZRA 5C3IB 3TU4C 1ID3A 4LD9D 4WV4B 4DRBA 2ZM5A 1P3FA 4Z66D 5JRGB 2CWEA 3UT9D 3V9RA 3B6FA 1EQZA 3O62C 5B0YA 4H9PB 1HQ3B 4KUDA 2Y2PA 1F66D 3AZHC 4WNNA 5GXQD 2F8NK 3X1SD 2CV5C 3A6NC 5B2IB 4J8VC 5JRGA 4KGCC 3A1IA 2RVQD 3MNNC 5B1MC 3MGSD 3EPJA 1KX3D 3AV2B 1A7WA 1HQ3A 3LZ1C 3KXBC 5F99C 3W98B 2YFWB 1P3AD 4J8UC 5B1LB 5DNNA 2FJ7B 1P3MD 5B2IA 4ZUXC 3WTPC 1M18B 3W97C 3REKB 5B32D 4KGCD 1P3GD 1P3OB 3AYWC 1AOIC 5AY8D 2G5HC 4CSRB 5CPKB 4H9QA 3AV2A 3AZFD 3X1TC 5GT0B 4ZBJC 3W98A 4Z5TD 2YFWA 3VH6A 4J8UD 5CP6A 3WA9A 4WZSB 5B1LA 2FJ7A 3KSYA 3WTPD 1P34B 1M18A 3LJAC 1ID3D 3AV1A 1P3FD 4CSRA 3AZNB 5CPKA 1P3BC 3B6FD 5BS7A 4J8WC 3X1TD 2NZDC 5AVBC 5AV6C 4X23C 5GT0A 4LD9B 5B32G 3NQUB 5B0YD 1M1AA 1M19B 4KUDD 3EG5B 5AVCC 1KX4C 3B6GC 2NQBC 1P34A 3LJAD 3REHA 3AN2C 1F66B 5JRGD 4AWLC 3AZNA 2IO5B 2Y2OA 3REIC 1B67A 5AVBD 5AV6D 5CPIC 3NQUA 3REJC 1S32A 3UTBC 1HQ3D 1M19A 3MGSB 2NQBD 5DNND 3AZJC 5B2ID 4H9OB 3VH5T 4EO5B 2AROC 5B0ZD 2F2AC 1P3IC 1F66A 1H3OA 2CV5B 1P3MB 4HGAC 3AZLC 1WWIA 4J8VB 5B32B 4KGCB 3UTBD 5B1MB 3MGSA 3WA9D 5CP6D 5JA4B 2F8ND 5B1LD 4H9OA 1M18D 3KXBB 5F99B 1TAFB 3UTAC 4J8UB 3MGQC 3AV1D 2CV5A 1P3MA 4ZUXB 3WTPB 2PYOC 4J8VA 4KGCA 3AYWB 1P3FB 3KUYC 1R4VA 1M1AD 5B1MA 4G91C 3V9RB 3B6FB 4Z2MG 3X1TB 2Y2MA 5DNMC 4ZBJB 3LZ1A 2HUEC 2ZY3A 5F99A 3KXBA 4DQYB 5B0YB 3REHD 1TAFA 3UTAD 5GT3D 1ZLAC 1BFMA 4J8UA 1TZYD 3R45B 5B24C 2F8NG 3AZND 4R8PC 4ZUXA 3WTPA 1T3UA 5CPJC 3LJAB 3WAAC 5AV8C 4YM6C 1KX5C 3NQJB 3AYWA 4KHAB 2ZY4A 4J8XC 1S32D 1M19D 4J8WB 2NZDB 3X1TA 5AVBB 5AV6B 4X23B 4WU9C 2Y2KA 2JSSA 4E44A 3R45A 3X1VC 2NQBB 5FUGB 4H9NA 3LJAA 5DNNB 3TU4D 3KWQC 3NQJA 5AV9C 5B0ZB 4KHAA 3W96C 4YS3C 3KFUG 2RIQA 4AWLB 1P3BA 5G49B 4J8WA 3REIB 2NZDA 5AVBA 5AV6A 4H9QB 4X23A 2Y2QA 3O62D 5BNXA 3UTBB 4UUZA 1F1EA 4XZQC 3AZHD 1KX4A 3WA9B 5CP6B 2W8SA 5FUGA 2CV5D 2F8NB 2NQBA 3MGRC 3A6ND 3AZJB 3WTPE 5B0ZA 3W96D 4J8VD 5BO0B 3AV1B 5G49A 3REIA 2HIOC 5B1MD 3MNND 3C1BC 5E5AC 4HGAB 3RELC 3AZLB 5CPIA 2Y2GA 3AZIC 3UTBA 4UPKA 3LZ1D 3KXBD 5F99D 4WJ3C 3AZEC 1M1AB 4WU8C 3AZMC 3WKJC 4QLCC 2F8NA 5BNVB 1P3PC 3AZJA 4ZUXD 4H9RB 5AV5C 3REHB 3W97D 3UTAB 1P3IA 5GT3B 5BO0A 3AYWD 1AOID 3EPLA 1TZYB 3MGPC 1Q9CA 3C1BD 3AZLA 2PYOB 2DQNC 3KUYB 4H9SC 1S32B 4G91B 1EQZC 5B33C 4QLCD 3AFAC 1BH9B 1P3PD 2YFVB 5BNVA 5DNMB 3FDDA 4H9RA 5AV5D 3UTAA 2UWXA 5GT3A 3MGQA 1TZYA 5C3IC 1H3OB 3H0MC 1P3BD 4J8WD 2PYOA 2NZDD 5AV8B 3TU4B 5B31C 4X23D 1KX5B 4NFTA 3KUYA 3P5JB 2ZY2A 5AVCD 1BH9A 1KX4D 2YFVA 3AZKC 5DNMA 3B6GD 3O62B 3AN2D 5B24A 3AZHB 4R8PA 5CPJA 3REID 5AV8A 3A6NB 3W99C 4E45A 3TU4A 4CAYB 3KWQB 5CPID 1KX5A 3WAAA 3REJD 3REKC 4YS3B 1BH8B 3B0CT 4J8XA 3W96B 2XD1A 3MNNB 3AV2C 3O62A 3W98C 3AZJD 5B40C 3VH5A 3LZ1B 2AROD 1P3ID 3AZHA 1P3KC 1B6WA 3VH5W 2Y2NA 3X1VA 3LZ0C 3A6NA 3AZLD 4CAYA 3KWQA 3H0RC
chains in the Genus database with same CATH topology
1P3OC 3W96A 1BH8A 3C1CC 4YS3A 3W97B 1P3LC 2FFFB 1AOIB 1HTAA 3MNNA 3C1BB 3RELB 2ZY5A 2VQRA 5B40D 1U35C 3AZEB 3AZMB 5KDMB 4QLCB 3MGQD 1P3PB 1WWSA 4H9NB 3AZGC 5AV5B 2PYOD 3W97A 3B0BA 5GSUC 3C1CD 1AOIA 3KUYD 2HIOA 3C1BA 2Y2HA 3RELA 1P3BB 4LD9C 3AZIA 5DNMD 1U35D 4Z66C 3UT9C 3AZEA 1ZLAD 5BNXB 3AZMA 3WKJA 4UUZB 5KDMA 4QLCA 5AVCB 5B24D 1P3PA 4R8PD 1KX4B 3B6GB 4Z2MH 5CPJD 5AV5A 3AN2B 5AV8D 2BYKB 3B0DC 4YM6D 4XUJC 1KX5D 3WAAD 1F66C 5GXQC 4J8XD 3X1SC 2F8NH 5B31B 5CPIB 4WU9D 3REJB 4H9SA 2RVQC 5B33A 3LELC 3AFAA 3MGSC 4G92C 1KX3C 5AVCA 3EPHA 3AZKB 3B6GA 3X1VD 2G5IC 2LY8A 3AN2A 4EO5C 2BYKA 4XUJD 3KWQD 1P3AC 5AV9D 2AROB 2Y2IA 4YS3D 3MVDC 1P3IB 4JJNC 1P3MC 3A1KA 5B2JC 3W99B 5B31A 4DRAA 5B32C 3REJA 1P3GC 3X1UC 5AY8C 3LELD 4XZQD 3AZFC 3AZKA 4H9PA 3MGRD 4Z5TC 5B40B 2AROA 3VH6T 3MVDD 1P3KB 3MGQB 4JJND 5B2JD 3LZ0B 2HIOD 3RELD 5E5AD 3W99A 1ID3C 3X1UD 3C1CB 3AZID 1P3FC 1P3LB 2DF4C 3H0LC 3AZED 3B6FC 4WU8D 3AZMD 3WKJD 5B40A 1U35B 5B0YC 2Y2LA 2HUEB 1ZLAB 4NE5A 4KUDC 1P3KA 1W2EA 3VH6W 5CHLB 3MGPD 5B24B 3LZ0A 4R8PB 3REKA 3AZGB 5CPJB 5GSUB 3C1CA 1P3OA 4YM6B 1KU5A 3WAAB 5BT1C 1P3LA 5JRGC 1N1JB 4J8XB 1EQZD 4M6BA 5B33D 3AFAD 1U35A 4Z66B 4WU9B 3UT9B 1HQ3C 1ZLAA 4NE3A 2J8PA 3X1VB 5DNNC 3AZGA 5B2IC 2BYMB 5GSUA 3B0DB 4YM6A 5B31D 4XUJB 5B0ZC 5BT1D 2BG1A 5AV9B 5GXQB 1N1JA 3X1SB 2XD5A 4LD9A 3AZKD 4Z66A 4WU9A 3UT9A 3LELB 1KX3B 4G92B 4XZQB 5CP6C 3WA9C 5B1LC 2FJ7C 2BYMA 3MGRB 1M18C 2L5AA 3W99D 2JCHA 4XUJA 1P3AB 5AV9A 3MVDB 5GXQA 3AV1C 3X1SA 1JFIB 4JJNB 3B0CW 5CPKC 5B2JB 2HIOB 3AV2D 5BS7C 5E5AB 5B31G 5GT0C 1P3GB 3X1UB 3AZIB 3W98D 3AL0C 5AY8B 3F6TA 1M1AC 3LELA 1KX3A 4XZQA 4WU8B 3AZFB 3WKJB 1P3KD 2FJ7D 3LZ0D 3MGRA 2JE5A 4Z5TB 1P34C 3REHC 3REKD 5GT3C 1P3AA 1P3OD 3IP4C 3MVDA 1TZYC 1P3LD 3AZNC 4JJNA 1JFIA 3MGPB 5CPKD 5B2JA 2Y2JA 5E5AA 5B32A 5GT0D 1P3GA 1ID3B 3X1UA 1ULYA 5AY8A 1S32C 1M19C 4WU8A 3AZFA 1EQZB 5JA4A 5B33B 3AFAB 3EPKA 4NE6A 1P34D 4Z5TA 3AZGD 5GSUD 4KUDB 1Z2CB 4WNNB 2IO5C 3MGPA 1PZRA 5C3IB 3TU4C 1ID3A 4LD9D 4WV4B 4DRBA 2ZM5A 1P3FA 4Z66D 5JRGB 2CWEA 3UT9D 3V9RA 3B6FA 1EQZA 3O62C 5B0YA 4H9PB 1HQ3B 4KUDA 2Y2PA 1F66D 3AZHC 4WNNA 5GXQD 2F8NK 3X1SD 2CV5C 3A6NC 5B2IB 4J8VC 5JRGA 4KGCC 3A1IA 2RVQD 3MNNC 5B1MC 3MGSD 3EPJA 1KX3D 3AV2B 1A7WA 1HQ3A 3LZ1C 3KXBC 5F99C 3W98B 2YFWB 1P3AD 4J8UC 5B1LB 5DNNA 2FJ7B 1P3MD 5B2IA 4ZUXC 3WTPC 1M18B 3W97C 3REKB 5B32D 4KGCD 1P3GD 1P3OB 3AYWC 1AOIC 5AY8D 2G5HC 4CSRB 5CPKB 4H9QA 3AV2A 3AZFD 3X1TC 5GT0B 4ZBJC 3W98A 4Z5TD 2YFWA 3VH6A 4J8UD 5CP6A 3WA9A 4WZSB 5B1LA 2FJ7A 3KSYA 3WTPD 1P34B 1M18A 3LJAC 1ID3D 3AV1A 1P3FD 4CSRA 3AZNB 5CPKA 1P3BC 3B6FD 5BS7A 4J8WC 3X1TD 2NZDC 5AVBC 5AV6C 4X23C 5GT0A 4LD9B 5B32G 3NQUB 5B0YD 1M1AA 1M19B 4KUDD 3EG5B 5AVCC 1KX4C 3B6GC 2NQBC 1P34A 3LJAD 3REHA 3AN2C 1F66B 5JRGD 4AWLC 3AZNA 2IO5B 2Y2OA 3REIC 1B67A 5AVBD 5AV6D 5CPIC 3NQUA 3REJC 1S32A 3UTBC 1HQ3D 1M19A 3MGSB 2NQBD 5DNND 3AZJC 5B2ID 4H9OB 3VH5T 4EO5B 2AROC 5B0ZD 2F2AC 1P3IC 1F66A 1H3OA 2CV5B 1P3MB 4HGAC 3AZLC 1WWIA 4J8VB 5B32B 4KGCB 3UTBD 5B1MB 3MGSA 3WA9D 5CP6D 5JA4B 2F8ND 5B1LD 4H9OA 1M18D 3KXBB 5F99B 1TAFB 3UTAC 4J8UB 3MGQC 3AV1D 2CV5A 1P3MA 4ZUXB 3WTPB 2PYOC 4J8VA 4KGCA 3AYWB 1P3FB 3KUYC 1R4VA 1M1AD 5B1MA 4G91C 3V9RB 3B6FB 4Z2MG 3X1TB 2Y2MA 5DNMC 4ZBJB 3LZ1A 2HUEC 2ZY3A 5F99A 3KXBA 4DQYB 5B0YB 3REHD 1TAFA 3UTAD 5GT3D 1ZLAC 1BFMA 4J8UA 1TZYD 3R45B 5B24C 2F8NG 3AZND 4R8PC 4ZUXA 3WTPA 1T3UA 5CPJC 3LJAB 3WAAC 5AV8C 4YM6C 1KX5C 3NQJB 3AYWA 4KHAB 2ZY4A 4J8XC 1S32D 1M19D 4J8WB 2NZDB 3X1TA 5AVBB 5AV6B 4X23B 4WU9C 2Y2KA 2JSSA 4E44A 3R45A 3X1VC 2NQBB 5FUGB 4H9NA 3LJAA 5DNNB 3TU4D 3KWQC 3NQJA 5AV9C 5B0ZB 4KHAA 3W96C 4YS3C 3KFUG 2RIQA 4AWLB 1P3BA 5G49B 4J8WA 3REIB 2NZDA 5AVBA 5AV6A 4H9QB 4X23A 2Y2QA 3O62D 5BNXA 3UTBB 4UUZA 1F1EA 4XZQC 3AZHD 1KX4A 3WA9B 5CP6B 2W8SA 5FUGA 2CV5D 2F8NB 2NQBA 3MGRC 3A6ND 3AZJB 3WTPE 5B0ZA 3W96D 4J8VD 5BO0B 3AV1B 5G49A 3REIA 2HIOC 5B1MD 3MNND 3C1BC 5E5AC 4HGAB 3RELC 3AZLB 5CPIA 2Y2GA 3AZIC 3UTBA 4UPKA 3LZ1D 3KXBD 5F99D 4WJ3C 3AZEC 1M1AB 4WU8C 3AZMC 3WKJC 4QLCC 2F8NA 5BNVB 1P3PC 3AZJA 4ZUXD 4H9RB 5AV5C 3REHB 3W97D 3UTAB 1P3IA 5GT3B 5BO0A 3AYWD 1AOID 3EPLA 1TZYB 3MGPC 1Q9CA 3C1BD 3AZLA 2PYOB 2DQNC 3KUYB 4H9SC 1S32B 4G91B 1EQZC 5B33C 4QLCD 3AFAC 1BH9B 1P3PD 2YFVB 5BNVA 5DNMB 3FDDA 4H9RA 5AV5D 3UTAA 2UWXA 5GT3A 3MGQA 1TZYA 5C3IC 1H3OB 3H0MC 1P3BD 4J8WD 2PYOA 2NZDD 5AV8B 3TU4B 5B31C 4X23D 1KX5B 4NFTA 3KUYA 3P5JB 2ZY2A 5AVCD 1BH9A 1KX4D 2YFVA 3AZKC 5DNMA 3B6GD 3O62B 3AN2D 5B24A 3AZHB 4R8PA 5CPJA 3REID 5AV8A 3A6NB 3W99C 4E45A 3TU4A 4CAYB 3KWQB 5CPID 1KX5A 3WAAA 3REJD 3REKC 4YS3B 1BH8B 3B0CT 4J8XA 3W96B 2XD1A 3MNNB 3AV2C 3O62A 3W98C 3AZJD 5B40C 3VH5A 3LZ1B 2AROD 1P3ID 3AZHA 1P3KC 1B6WA 3VH5W 2Y2NA 3X1VA 3LZ0C 3A6NA 3AZLD 4CAYA 3KWQA 3H0RC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3O C;  3W96 A;  1BH8 A;  3C1C C;  4YS3 A;  3W97 B;  1P3L C;  1AOI B;  1HTA A;  3MNN A;  3C1B B;  3REL B;  5B40 D;  1U35 C;  3AZE B;  3AZM B;  5KDM B;  4QLC B;  3MGQ D;  1P3P B;  1WWS A;  4H9N B;  3AZG C;  5AV5 B;  2PYO D;  3W97 A;  3B0B A;  5GSU C;  3C1C D;  1AOI A;  3KUY D;  2HIO A;  3C1B A;  3REL A;  1P3B B;  4LD9 C;  3AZI A;  5DNM D;  1U35 D;  4Z66 C;  3UT9 C;  3AZE A;  1ZLA D;  5BNX B;  3AZM A;  3WKJ A;  4UUZ B;  5KDM A;  4QLC A;  5AVC B;  5B24 D;  1P3P A;  4R8P D;  1KX4 B;  3B6G B;  4Z2M H;  5CPJ D;  5AV5 A;  3AN2 B;  5AV8 D;  2BYK B;  3B0D C;  4YM6 D;  4XUJ C;  1KX5 D;  3WAA D;  1F66 C;  5GXQ C;  4J8X D;  3X1S C;  2F8N H;  5B31 B;  5CPI B;  4WU9 D;  3REJ B;  4H9S A;  2RVQ C;  5B33 A;  3LEL C;  3AFA A;  3MGS C;  4G92 C;  1KX3 C;  5AVC A;  3AZK B;  3B6G A;  3X1V D;  2LY8 A;  3AN2 A;  4EO5 C;  2BYK A;  4XUJ D;  3KWQ D;  1P3A C;  5AV9 D;  2ARO B;  4YS3 D;  3MVD C;  1P3I B;  4JJN C;  1P3M C;  5B2J C;  3W99 B;  5B31 A;  4DRA A;  5B32 C;  3REJ A;  1P3G C;  3X1U C;  5AY8 C;  3LEL D;  4XZQ D;  3AZF C;  3AZK A;  4H9P A;  3MGR D;  4Z5T C;  5B40 B;  2ARO A;  3VH6 T;  3MVD D;  1P3K B;  3MGQ B;  4JJN D;  5B2J D;  3LZ0 B;  2HIO D;  3REL D;  5E5A D;  3W99 A;  1ID3 C;  3X1U D;  3C1C B;  3AZI D;  1P3F C;  1P3L B;  3AZE D;  3B6F C;  4WU8 D;  3AZM D;  3WKJ D;  5B40 A;  1U35 B;  5B0Y C;  2HUE B;  1ZLA B;  4NE5 A;  4KUD C;  1P3K A;  3VH6 W;  5CHL B;  3MGP D;  5B24 B;  3LZ0 A;  4R8P B;  3REK A;  3AZG B;  5CPJ B;  5GSU B;  3C1C A;  1P3O A;  4YM6 B;  1KU5 A;  3WAA B;  5BT1 C;  1P3L A;  5JRG C;  1N1J B;  4J8X B;  1EQZ D;  4M6B A;  5B33 D;  3AFA D;  1U35 A;  4Z66 B;  4WU9 B;  3UT9 B;  1HQ3 C;  1ZLA A;  4NE3 A;  3X1V B;  5DNN C;  3AZG A;  5B2I C;  2BYM B;  5GSU A;  3B0D B;  4YM6 A;  5B31 D;  4XUJ B;  5B0Z C;  5BT1 D;  5AV9 B;  5GXQ B;  1N1J A;  3X1S B;  4LD9 A;  3AZK D;  4Z66 A;  4WU9 A;  3UT9 A;  3LEL B;  1KX3 B;  4G92 B;  4XZQ B;  5CP6 C;  3WA9 C;  5B1L C;  2FJ7 C;  2BYM A;  3MGR B;  1M18 C;  2L5A A;  3W99 D;  4XUJ A;  1P3A B;  5AV9 A;  3MVD B;  5GXQ A;  3AV1 C;  3X1S A;  1JFI B;  4JJN B;  3B0C W;  5CPK C;  5B2J B;  2HIO B;  3AV2 D;  5BS7 C;  5E5A B;  5B31 G;  5GT0 C;  1P3G B;  3X1U B;  3AZI B;  3W98 D;  5AY8 B;  1M1A C;  3LEL A;  1KX3 A;  4XZQ A;  4WU8 B;  3AZF B;  3WKJ B;  1P3K D;  2FJ7 D;  3LZ0 D;  3MGR A;  1P34 C;  4Z5T B;  3REH C;  3REK D;  5GT3 C;  1P3A A;  1P3O D;  3MVD A;  1TZY C;  1P3L D;  3AZN C;  4JJN A;  1JFI A;  3MGP B;  5CPK D;  5B2J A;  5E5A A;  5B32 A;  5GT0 D;  1P3G A;  1ID3 B;  3X1U A;  1ULY A;  5AY8 A;  1S32 C;  1M19 C;  4WU8 A;  3AZF A;  1EQZ B;  5JA4 A;  5B33 B;  3AFA B;  4NE6 A;  1P34 D;  4Z5T A;  3AZG D;  5GSU D;  4KUD B;  4WNN B;  2IO5 C;  3MGP A;  5C3I B;  3TU4 C;  1ID3 A;  4LD9 D;  4WV4 B;  4DRB A;  1P3F A;  4Z66 D;  5JRG B;  2CWE A;  3UT9 D;  3V9R A;  3B6F A;  1EQZ A;  3O62 C;  5B0Y A;  4H9P B;  1HQ3 B;  4KUD A;  1F66 D;  3AZH C;  4WNN A;  5GXQ D;  2F8N K;  3X1S D;  2CV5 C;  3A6N C;  5B2I B;  4J8V C;  5JRG A;  4KGC C;  2RVQ D;  3MNN C;  5B1M C;  3MGS D;  1KX3 D;  3AV2 B;  1A7W A;  1HQ3 A;  3LZ1 C;  3KXB C;  5F99 C;  3W98 B;  2YFW B;  1P3A D;  4J8U C;  5B1L B;  5DNN A;  2FJ7 B;  1P3M D;  5B2I A;  4ZUX C;  3WTP C;  1M18 B;  3W97 C;  3REK B;  5B32 D;  4KGC D;  1P3G D;  1P3O B;  3AYW C;  1AOI C;  5AY8 D;  4CSR B;  5CPK B;  4H9Q A;  3AV2 A;  3AZF D;  3X1T C;  5GT0 B;  4ZBJ C;  3W98 A;  4Z5T D;  2YFW A;  3VH6 A;  4J8U D;  5CP6 A;  3WA9 A;  4WZS B;  5B1L A;  2FJ7 A;  3KSY A;  3WTP D;  1P34 B;  1M18 A;  3LJA C;  1ID3 D;  3AV1 A;  1P3F D;  4CSR A;  3AZN B;  5CPK A;  1P3B C;  3B6F D;  5BS7 A;  4J8W C;  3X1T D;  2NZD C;  5AVB C;  5AV6 C;  4X23 C;  5GT0 A;  4LD9 B;  5B32 G;  3NQU B;  5B0Y D;  1M1A A;  1M19 B;  4KUD D;  5AVC C;  1KX4 C;  3B6G C;  2NQB C;  1P34 A;  3LJA D;  3REH A;  3AN2 C;  1F66 B;  5JRG D;  4AWL C;  3AZN A;  2IO5 B;  3REI C;  1B67 A;  5AVB D;  5AV6 D;  5CPI C;  3NQU A;  3REJ C;  1S32 A;  3UTB C;  1HQ3 D;  1M19 A;  3MGS B;  2NQB D;  5DNN D;  3AZJ C;  5B2I D;  4H9O B;  3VH5 T;  4EO5 B;  2ARO C;  5B0Z D;  1P3I C;  1F66 A;  1H3O A;  2CV5 B;  1P3M B;  4HGA C;  3AZL C;  1WWI A;  4J8V B;  5B32 B;  4KGC B;  3UTB D;  5B1M B;  3MGS A;  3WA9 D;  5CP6 D;  5JA4 B;  2F8N D;  5B1L D;  4H9O A;  1M18 D;  3KXB B;  5F99 B;  1TAF B;  3UTA C;  4J8U B;  3MGQ C;  3AV1 D;  2CV5 A;  1P3M A;  4ZUX B;  3WTP B;  2PYO C;  4J8V A;  4KGC A;  3AYW B;  1P3F B;  3KUY C;  1R4V A;  1M1A D;  5B1M A;  4G91 C;  3V9R B;  3B6F B;  4Z2M G;  3X1T B;  5DNM C;  4ZBJ B;  3LZ1 A;  2HUE C;  5F99 A;  3KXB A;  1ZLA C;  3REH D;  5B0Y B;  3UTA D;  1TAF A;  1BFM A;  5GT3 D;  4J8U A;  1TZY D;  3R45 B;  5B24 C;  2F8N G;  3AZN D;  4R8P C;  4ZUX A;  3WTP A;  5CPJ C;  3LJA B;  3WAA C;  5AV8 C;  4YM6 C;  1KX5 C;  3NQJ B;  3AYW A;  4KHA B;  4J8X C;  1S32 D;  1M19 D;  4J8W B;  2NZD B;  3X1T A;  5AVB B;  5AV6 B;  4X23 B;  4WU9 C;  2JSS A;  4E44 A;  3R45 A;  3X1V C;  2NQB B;  5FUG B;  4H9N A;  3LJA A;  5DNN B;  3TU4 D;  3KWQ C;  3NQJ A;  5AV9 C;  5B0Z B;  4KHA A;  3W96 C;  4YS3 C;  4AWL B;  1P3B A;  5G49 B;  4J8W A;  3REI B;  2NZD A;  5AVB A;  5AV6 A;  4H9Q B;  4X23 A;  3O62 D;  5BNX A;  3UTB B;  4UUZ A;  1F1E A;  4XZQ C;  3AZH D;  1KX4 A;  3WA9 B;  5CP6 B;  2NQB A;  5FUG A;  2CV5 D;  2F8N B;  3MGR C;  3A6N D;  3AZJ B;  3WTP E;  5B0Z A;  3W96 D;  4J8V D;  5BO0 B;  3AV1 B;  5G49 A;  3REI A;  2HIO C;  5B1M D;  3MNN D;  3C1B C;  5E5A C;  4HGA B;  3REL C;  3AZL B;  5CPI A;  3AZI C;  3UTB A;  3LZ1 D;  3KXB D;  5F99 D;  3AZE C;  1M1A B;  4WU8 C;  3AZM C;  3WKJ C;  4QLC C;  2F8N A;  5BNV B;  1P3P C;  3AZJ A;  4ZUX D;  4H9R B;  5AV5 C;  3REH B;  3W97 D;  3UTA B;  1P3I A;  5GT3 B;  5BO0 A;  3AYW D;  1AOI D;  1TZY B;  3MGP C;  1Q9C A;  3C1B D;  3AZL A;  2PYO B;  3KUY B;  4H9S C;  1S32 B;  4G91 B;  1EQZ C;  5B33 C;  4QLC D;  3AFA C;  1BH9 B;  1P3P D;  2YFV B;  5BNV A;  5DNM B;  4H9R A;  5AV5 D;  3UTA A;  5GT3 A;  3MGQ A;  1TZY A;  5C3I C;  1H3O B;  1P3B D;  4J8W D;  2PYO A;  2NZD D;  5AV8 B;  3TU4 B;  5B31 C;  4X23 D;  1KX5 B;  4NFT A;  3KUY A;  5AVC D;  1BH9 A;  1KX4 D;  2YFV A;  3AZK C;  5DNM A;  3B6G D;  3O62 B;  3AN2 D;  5B24 A;  3AZH B;  4R8P A;  5CPJ A;  3REI D;  5AV8 A;  3A6N B;  3W99 C;  4E45 A;  3TU4 A;  4CAY B;  3KWQ B;  5CPI D;  1KX5 A;  3WAA A;  3REJ D;  3REK C;  4YS3 B;  1BH8 B;  3B0C T;  4J8X A;  3W96 B;  3MNN B;  3AV2 C;  3O62 A;  3W98 C;  3AZJ D;  5B40 C;  3VH5 A;  3LZ1 B;  2ARO D;  1P3I D;  3AZH A;  1P3K C;  1B6W A;  3VH5 W;  3X1V A;  3LZ0 C;  3A6N A;  3AZL D;  4CAY A;  3KWQ A; 
#chains in the Genus database with same CATH topology
 1P3O C;  3W96 A;  1BH8 A;  3C1C C;  4YS3 A;  3W97 B;  1P3L C;  2FFF B;  1AOI B;  1HTA A;  3MNN A;  3C1B B;  3REL B;  2ZY5 A;  2VQR A;  5B40 D;  1U35 C;  3AZE B;  3AZM B;  5KDM B;  4QLC B;  3MGQ D;  1P3P B;  1WWS A;  4H9N B;  3AZG C;  5AV5 B;  2PYO D;  3W97 A;  3B0B A;  5GSU C;  3C1C D;  1AOI A;  3KUY D;  2HIO A;  3C1B A;  2Y2H A;  3REL A;  1P3B B;  4LD9 C;  3AZI A;  5DNM D;  1U35 D;  4Z66 C;  3UT9 C;  3AZE A;  1ZLA D;  5BNX B;  3AZM A;  3WKJ A;  4UUZ B;  5KDM A;  4QLC A;  5AVC B;  5B24 D;  1P3P A;  4R8P D;  1KX4 B;  3B6G B;  4Z2M H;  5CPJ D;  5AV5 A;  3AN2 B;  5AV8 D;  2BYK B;  3B0D C;  4YM6 D;  4XUJ C;  1KX5 D;  3WAA D;  1F66 C;  5GXQ C;  4J8X D;  3X1S C;  2F8N H;  5B31 B;  5CPI B;  4WU9 D;  3REJ B;  4H9S A;  2RVQ C;  5B33 A;  3LEL C;  3AFA A;  3MGS C;  4G92 C;  1KX3 C;  5AVC A;  3EPH A;  3AZK B;  3B6G A;  3X1V D;  2G5I C;  2LY8 A;  3AN2 A;  4EO5 C;  2BYK A;  4XUJ D;  3KWQ D;  1P3A C;  5AV9 D;  2ARO B;  2Y2I A;  4YS3 D;  3MVD C;  1P3I B;  4JJN C;  1P3M C;  3A1K A;  5B2J C;  3W99 B;  5B31 A;  4DRA A;  5B32 C;  3REJ A;  1P3G C;  3X1U C;  5AY8 C;  3LEL D;  4XZQ D;  3AZF C;  3AZK A;  4H9P A;  3MGR D;  4Z5T C;  5B40 B;  2ARO A;  3VH6 T;  3MVD D;  1P3K B;  3MGQ B;  4JJN D;  5B2J D;  3LZ0 B;  2HIO D;  3REL D;  5E5A D;  3W99 A;  1ID3 C;  3X1U D;  3C1C B;  3AZI D;  1P3F C;  1P3L B;  2DF4 C;  3H0L C;  3AZE D;  3B6F C;  4WU8 D;  3AZM D;  3WKJ D;  5B40 A;  1U35 B;  5B0Y C;  2Y2L A;  2HUE B;  1ZLA B;  4NE5 A;  4KUD C;  1P3K A;  1W2E A;  3VH6 W;  5CHL B;  3MGP D;  5B24 B;  3LZ0 A;  4R8P B;  3REK A;  3AZG B;  5CPJ B;  5GSU B;  3C1C A;  1P3O A;  4YM6 B;  1KU5 A;  3WAA B;  5BT1 C;  1P3L A;  5JRG C;  1N1J B;  4J8X B;  1EQZ D;  4M6B A;  5B33 D;  3AFA D;  1U35 A;  4Z66 B;  4WU9 B;  3UT9 B;  1HQ3 C;  1ZLA A;  4NE3 A;  2J8P A;  3X1V B;  5DNN C;  3AZG A;  5B2I C;  2BYM B;  5GSU A;  3B0D B;  4YM6 A;  5B31 D;  4XUJ B;  5B0Z C;  5BT1 D;  2BG1 A;  5AV9 B;  5GXQ B;  1N1J A;  3X1S B;  2XD5 A;  4LD9 A;  3AZK D;  4Z66 A;  4WU9 A;  3UT9 A;  3LEL B;  1KX3 B;  4G92 B;  4XZQ B;  5CP6 C;  3WA9 C;  5B1L C;  2FJ7 C;  2BYM A;  3MGR B;  1M18 C;  2L5A A;  3W99 D;  2JCH A;  4XUJ A;  1P3A B;  5AV9 A;  3MVD B;  5GXQ A;  3AV1 C;  3X1S A;  1JFI B;  4JJN B;  3B0C W;  5CPK C;  5B2J B;  2HIO B;  3AV2 D;  5BS7 C;  5E5A B;  5B31 G;  5GT0 C;  1P3G B;  3X1U B;  3AZI B;  3W98 D;  3AL0 C;  5AY8 B;  3F6T A;  1M1A C;  3LEL A;  1KX3 A;  4XZQ A;  4WU8 B;  3AZF B;  3WKJ B;  1P3K D;  2FJ7 D;  3LZ0 D;  3MGR A;  2JE5 A;  4Z5T B;  1P34 C;  3REH C;  3REK D;  5GT3 C;  1P3A A;  1P3O D;  3IP4 C;  3MVD A;  1TZY C;  1P3L D;  3AZN C;  4JJN A;  1JFI A;  3MGP B;  5CPK D;  5B2J A;  2Y2J A;  5E5A A;  5B32 A;  5GT0 D;  1P3G A;  1ID3 B;  3X1U A;  1ULY A;  5AY8 A;  1S32 C;  1M19 C;  4WU8 A;  3AZF A;  1EQZ B;  5JA4 A;  5B33 B;  3AFA B;  3EPK A;  4NE6 A;  1P34 D;  4Z5T A;  3AZG D;  5GSU D;  4KUD B;  1Z2C B;  4WNN B;  2IO5 C;  3MGP A;  1PZR A;  5C3I B;  3TU4 C;  1ID3 A;  4LD9 D;  4WV4 B;  4DRB A;  2ZM5 A;  1P3F A;  4Z66 D;  5JRG B;  2CWE A;  3UT9 D;  3V9R A;  3B6F A;  1EQZ A;  3O62 C;  5B0Y A;  4H9P B;  1HQ3 B;  4KUD A;  2Y2P A;  1F66 D;  3AZH C;  4WNN A;  5GXQ D;  2F8N K;  3X1S D;  2CV5 C;  3A6N C;  5B2I B;  4J8V C;  5JRG A;  4KGC C;  3A1I A;  2RVQ D;  3MNN C;  5B1M C;  3MGS D;  3EPJ A;  1KX3 D;  3AV2 B;  1A7W A;  1HQ3 A;  3LZ1 C;  3KXB C;  5F99 C;  3W98 B;  2YFW B;  1P3A D;  4J8U C;  5B1L B;  5DNN A;  2FJ7 B;  1P3M D;  5B2I A;  4ZUX C;  3WTP C;  1M18 B;  3W97 C;  3REK B;  5B32 D;  4KGC D;  1P3G D;  1P3O B;  3AYW C;  1AOI C;  5AY8 D;  2G5H C;  4CSR B;  5CPK B;  4H9Q A;  3AV2 A;  3AZF D;  3X1T C;  5GT0 B;  4ZBJ C;  3W98 A;  4Z5T D;  2YFW A;  3VH6 A;  4J8U D;  5CP6 A;  3WA9 A;  4WZS B;  5B1L A;  2FJ7 A;  3KSY A;  3WTP D;  1P34 B;  1M18 A;  3LJA C;  1ID3 D;  3AV1 A;  1P3F D;  4CSR A;  3AZN B;  5CPK A;  1P3B C;  3B6F D;  5BS7 A;  4J8W C;  3X1T D;  2NZD C;  5AVB C;  5AV6 C;  4X23 C;  5GT0 A;  4LD9 B;  5B32 G;  3NQU B;  5B0Y D;  1M1A A;  1M19 B;  4KUD D;  3EG5 B;  5AVC C;  1KX4 C;  3B6G C;  2NQB C;  1P34 A;  3LJA D;  3REH A;  3AN2 C;  1F66 B;  5JRG D;  4AWL C;  3AZN A;  2IO5 B;  2Y2O A;  3REI C;  1B67 A;  5AVB D;  5AV6 D;  5CPI C;  3NQU A;  3REJ C;  1S32 A;  3UTB C;  1HQ3 D;  1M19 A;  3MGS B;  2NQB D;  5DNN D;  3AZJ C;  5B2I D;  4H9O B;  3VH5 T;  4EO5 B;  2ARO C;  5B0Z D;  2F2A C;  1P3I C;  1F66 A;  1H3O A;  2CV5 B;  1P3M B;  4HGA C;  3AZL C;  1WWI A;  4J8V B;  5B32 B;  4KGC B;  3UTB D;  5B1M B;  3MGS A;  3WA9 D;  5CP6 D;  5JA4 B;  2F8N D;  5B1L D;  4H9O A;  1M18 D;  3KXB B;  5F99 B;  1TAF B;  3UTA C;  4J8U B;  3MGQ C;  3AV1 D;  2CV5 A;  1P3M A;  4ZUX B;  3WTP B;  2PYO C;  4J8V A;  4KGC A;  3AYW B;  1P3F B;  3KUY C;  1R4V A;  1M1A D;  5B1M A;  4G91 C;  3V9R B;  3B6F B;  4Z2M G;  3X1T B;  2Y2M A;  5DNM C;  4ZBJ B;  3LZ1 A;  2HUE C;  2ZY3 A;  5F99 A;  3KXB A;  4DQY B;  5B0Y B;  3REH D;  1TAF A;  3UTA D;  5GT3 D;  1ZLA C;  1BFM A;  4J8U A;  1TZY D;  3R45 B;  5B24 C;  2F8N G;  3AZN D;  4R8P C;  4ZUX A;  3WTP A;  1T3U A;  5CPJ C;  3LJA B;  3WAA C;  5AV8 C;  4YM6 C;  1KX5 C;  3NQJ B;  3AYW A;  4KHA B;  2ZY4 A;  4J8X C;  1S32 D;  1M19 D;  4J8W B;  2NZD B;  3X1T A;  5AVB B;  5AV6 B;  4X23 B;  4WU9 C;  2Y2K A;  2JSS A;  4E44 A;  3R45 A;  3X1V C;  2NQB B;  5FUG B;  4H9N A;  3LJA A;  5DNN B;  3TU4 D;  3KWQ C;  3NQJ A;  5AV9 C;  5B0Z B;  4KHA A;  3W96 C;  4YS3 C;  3KFU G;  2RIQ A;  4AWL B;  1P3B A;  5G49 B;  4J8W A;  3REI B;  2NZD A;  5AVB A;  5AV6 A;  4H9Q B;  4X23 A;  2Y2Q A;  3O62 D;  5BNX A;  3UTB B;  4UUZ A;  1F1E A;  4XZQ C;  3AZH D;  1KX4 A;  3WA9 B;  5CP6 B;  2W8S A;  5FUG A;  2CV5 D;  2F8N B;  2NQB A;  3MGR C;  3A6N D;  3AZJ B;  3WTP E;  5B0Z A;  3W96 D;  4J8V D;  5BO0 B;  3AV1 B;  5G49 A;  3REI A;  2HIO C;  5B1M D;  3MNN D;  3C1B C;  5E5A C;  4HGA B;  3REL C;  3AZL B;  5CPI A;  2Y2G A;  3AZI C;  3UTB A;  4UPK A;  3LZ1 D;  3KXB D;  5F99 D;  4WJ3 C;  3AZE C;  1M1A B;  4WU8 C;  3AZM C;  3WKJ C;  4QLC C;  2F8N A;  5BNV B;  1P3P C;  3AZJ A;  4ZUX D;  4H9R B;  5AV5 C;  3REH B;  3W97 D;  3UTA B;  1P3I A;  5GT3 B;  5BO0 A;  3AYW D;  1AOI D;  3EPL A;  1TZY B;  3MGP C;  1Q9C A;  3C1B D;  3AZL A;  2PYO B;  2DQN C;  3KUY B;  4H9S C;  1S32 B;  4G91 B;  1EQZ C;  5B33 C;  4QLC D;  3AFA C;  1BH9 B;  1P3P D;  2YFV B;  5BNV A;  5DNM B;  3FDD A;  4H9R A;  5AV5 D;  3UTA A;  2UWX A;  5GT3 A;  3MGQ A;  1TZY A;  5C3I C;  1H3O B;  3H0M C;  1P3B D;  4J8W D;  2PYO A;  2NZD D;  5AV8 B;  3TU4 B;  5B31 C;  4X23 D;  1KX5 B;  4NFT A;  3KUY A;  3P5J B;  2ZY2 A;  5AVC D;  1BH9 A;  1KX4 D;  2YFV A;  3AZK C;  5DNM A;  3B6G D;  3O62 B;  3AN2 D;  5B24 A;  3AZH B;  4R8P A;  5CPJ A;  3REI D;  5AV8 A;  3A6N B;  3W99 C;  4E45 A;  3TU4 A;  4CAY B;  3KWQ B;  5CPI D;  1KX5 A;  3WAA A;  3REJ D;  3REK C;  4YS3 B;  1BH8 B;  3B0C T;  4J8X A;  3W96 B;  2XD1 A;  3MNN B;  3AV2 C;  3O62 A;  3W98 C;  3AZJ D;  5B40 C;  3VH5 A;  3LZ1 B;  2ARO D;  1P3I D;  3AZH A;  1P3K C;  1B6W A;  3VH5 W;  2Y2N A;  3X1V A;  3LZ0 C;  3A6N A;  3AZL D;  4CAY A;  3KWQ A;  3H0R C; 
#chains in the Genus database with same CATH homology
 1P3O C;  3W96 A;  1BH8 A;  3C1C C;  4YS3 A;  3W97 B;  1P3L C;  2FFF B;  1AOI B;  1HTA A;  3MNN A;  3C1B B;  3REL B;  2ZY5 A;  2VQR A;  5B40 D;  1U35 C;  3AZE B;  3AZM B;  5KDM B;  4QLC B;  3MGQ D;  1P3P B;  1WWS A;  4H9N B;  3AZG C;  5AV5 B;  2PYO D;  3W97 A;  3B0B A;  5GSU C;  3C1C D;  1AOI A;  3KUY D;  2HIO A;  3C1B A;  2Y2H A;  3REL A;  1P3B B;  4LD9 C;  3AZI A;  5DNM D;  1U35 D;  4Z66 C;  3UT9 C;  3AZE A;  1ZLA D;  5BNX B;  3AZM A;  3WKJ A;  4UUZ B;  5KDM A;  4QLC A;  5AVC B;  5B24 D;  1P3P A;  4R8P D;  1KX4 B;  3B6G B;  4Z2M H;  5CPJ D;  5AV5 A;  3AN2 B;  5AV8 D;  2BYK B;  3B0D C;  4YM6 D;  4XUJ C;  1KX5 D;  3WAA D;  1F66 C;  5GXQ C;  4J8X D;  3X1S C;  2F8N H;  5B31 B;  5CPI B;  4WU9 D;  3REJ B;  4H9S A;  2RVQ C;  5B33 A;  3LEL C;  3AFA A;  3MGS C;  4G92 C;  1KX3 C;  5AVC A;  3EPH A;  3AZK B;  3B6G A;  3X1V D;  2G5I C;  2LY8 A;  3AN2 A;  4EO5 C;  2BYK A;  4XUJ D;  3KWQ D;  1P3A C;  5AV9 D;  2ARO B;  2Y2I A;  4YS3 D;  3MVD C;  1P3I B;  4JJN C;  1P3M C;  3A1K A;  5B2J C;  3W99 B;  5B31 A;  4DRA A;  5B32 C;  3REJ A;  1P3G C;  3X1U C;  5AY8 C;  3LEL D;  4XZQ D;  3AZF C;  3AZK A;  4H9P A;  3MGR D;  4Z5T C;  5B40 B;  2ARO A;  3VH6 T;  3MVD D;  1P3K B;  3MGQ B;  4JJN D;  5B2J D;  3LZ0 B;  2HIO D;  3REL D;  5E5A D;  3W99 A;  1ID3 C;  3X1U D;  3C1C B;  3AZI D;  1P3F C;  1P3L B;  2DF4 C;  3H0L C;  3AZE D;  3B6F C;  4WU8 D;  3AZM D;  3WKJ D;  5B40 A;  1U35 B;  5B0Y C;  2Y2L A;  2HUE B;  1ZLA B;  4NE5 A;  4KUD C;  1P3K A;  1W2E A;  3VH6 W;  5CHL B;  3MGP D;  5B24 B;  3LZ0 A;  4R8P B;  3REK A;  3AZG B;  5CPJ B;  5GSU B;  3C1C A;  1P3O A;  4YM6 B;  1KU5 A;  3WAA B;  5BT1 C;  1P3L A;  5JRG C;  1N1J B;  4J8X B;  1EQZ D;  4M6B A;  5B33 D;  3AFA D;  1U35 A;  4Z66 B;  4WU9 B;  3UT9 B;  1HQ3 C;  1ZLA A;  4NE3 A;  2J8P A;  3X1V B;  5DNN C;  3AZG A;  5B2I C;  2BYM B;  5GSU A;  3B0D B;  4YM6 A;  5B31 D;  4XUJ B;  5B0Z C;  5BT1 D;  2BG1 A;  5AV9 B;  5GXQ B;  1N1J A;  3X1S B;  2XD5 A;  4LD9 A;  3AZK D;  4Z66 A;  4WU9 A;  3UT9 A;  3LEL B;  1KX3 B;  4G92 B;  4XZQ B;  5CP6 C;  3WA9 C;  5B1L C;  2FJ7 C;  2BYM A;  3MGR B;  1M18 C;  2L5A A;  3W99 D;  2JCH A;  4XUJ A;  1P3A B;  5AV9 A;  3MVD B;  5GXQ A;  3AV1 C;  3X1S A;  1JFI B;  4JJN B;  3B0C W;  5CPK C;  5B2J B;  2HIO B;  3AV2 D;  5BS7 C;  5E5A B;  5B31 G;  5GT0 C;  1P3G B;  3X1U B;  3AZI B;  3W98 D;  3AL0 C;  5AY8 B;  3F6T A;  1M1A C;  3LEL A;  1KX3 A;  4XZQ A;  4WU8 B;  3AZF B;  3WKJ B;  1P3K D;  2FJ7 D;  3LZ0 D;  3MGR A;  2JE5 A;  4Z5T B;  1P34 C;  3REH C;  3REK D;  5GT3 C;  1P3A A;  1P3O D;  3IP4 C;  3MVD A;  1TZY C;  1P3L D;  3AZN C;  4JJN A;  1JFI A;  3MGP B;  5CPK D;  5B2J A;  2Y2J A;  5E5A A;  5B32 A;  5GT0 D;  1P3G A;  1ID3 B;  3X1U A;  1ULY A;  5AY8 A;  1S32 C;  1M19 C;  4WU8 A;  3AZF A;  1EQZ B;  5JA4 A;  5B33 B;  3AFA B;  3EPK A;  4NE6 A;  1P34 D;  4Z5T A;  3AZG D;  5GSU D;  4KUD B;  1Z2C B;  4WNN B;  2IO5 C;  3MGP A;  1PZR A;  5C3I B;  3TU4 C;  1ID3 A;  4LD9 D;  4WV4 B;  4DRB A;  2ZM5 A;  1P3F A;  4Z66 D;  5JRG B;  2CWE A;  3UT9 D;  3V9R A;  3B6F A;  1EQZ A;  3O62 C;  5B0Y A;  4H9P B;  1HQ3 B;  4KUD A;  2Y2P A;  1F66 D;  3AZH C;  4WNN A;  5GXQ D;  2F8N K;  3X1S D;  2CV5 C;  3A6N C;  5B2I B;  4J8V C;  5JRG A;  4KGC C;  3A1I A;  2RVQ D;  3MNN C;  5B1M C;  3MGS D;  3EPJ A;  1KX3 D;  3AV2 B;  1A7W A;  1HQ3 A;  3LZ1 C;  3KXB C;  5F99 C;  3W98 B;  2YFW B;  1P3A D;  4J8U C;  5B1L B;  5DNN A;  2FJ7 B;  1P3M D;  5B2I A;  4ZUX C;  3WTP C;  1M18 B;  3W97 C;  3REK B;  5B32 D;  4KGC D;  1P3G D;  1P3O B;  3AYW C;  1AOI C;  5AY8 D;  2G5H C;  4CSR B;  5CPK B;  4H9Q A;  3AV2 A;  3AZF D;  3X1T C;  5GT0 B;  4ZBJ C;  3W98 A;  4Z5T D;  2YFW A;  3VH6 A;  4J8U D;  5CP6 A;  3WA9 A;  4WZS B;  5B1L A;  2FJ7 A;  3KSY A;  3WTP D;  1P34 B;  1M18 A;  3LJA C;  1ID3 D;  3AV1 A;  1P3F D;  4CSR A;  3AZN B;  5CPK A;  1P3B C;  3B6F D;  5BS7 A;  4J8W C;  3X1T D;  2NZD C;  5AVB C;  5AV6 C;  4X23 C;  5GT0 A;  4LD9 B;  5B32 G;  3NQU B;  5B0Y D;  1M1A A;  1M19 B;  4KUD D;  3EG5 B;  5AVC C;  1KX4 C;  3B6G C;  2NQB C;  1P34 A;  3LJA D;  3REH A;  3AN2 C;  1F66 B;  5JRG D;  4AWL C;  3AZN A;  2IO5 B;  2Y2O A;  3REI C;  1B67 A;  5AVB D;  5AV6 D;  5CPI C;  3NQU A;  3REJ C;  1S32 A;  3UTB C;  1HQ3 D;  1M19 A;  3MGS B;  2NQB D;  5DNN D;  3AZJ C;  5B2I D;  4H9O B;  3VH5 T;  4EO5 B;  2ARO C;  5B0Z D;  2F2A C;  1P3I C;  1F66 A;  1H3O A;  2CV5 B;  1P3M B;  4HGA C;  3AZL C;  1WWI A;  4J8V B;  5B32 B;  4KGC B;  3UTB D;  5B1M B;  3MGS A;  3WA9 D;  5CP6 D;  5JA4 B;  2F8N D;  5B1L D;  4H9O A;  1M18 D;  3KXB B;  5F99 B;  1TAF B;  3UTA C;  4J8U B;  3MGQ C;  3AV1 D;  2CV5 A;  1P3M A;  4ZUX B;  3WTP B;  2PYO C;  4J8V A;  4KGC A;  3AYW B;  1P3F B;  3KUY C;  1R4V A;  1M1A D;  5B1M A;  4G91 C;  3V9R B;  3B6F B;  4Z2M G;  3X1T B;  2Y2M A;  5DNM C;  4ZBJ B;  3LZ1 A;  2HUE C;  2ZY3 A;  5F99 A;  3KXB A;  4DQY B;  5B0Y B;  3REH D;  1TAF A;  3UTA D;  5GT3 D;  1ZLA C;  1BFM A;  4J8U A;  1TZY D;  3R45 B;  5B24 C;  2F8N G;  3AZN D;  4R8P C;  4ZUX A;  3WTP A;  1T3U A;  5CPJ C;  3LJA B;  3WAA C;  5AV8 C;  4YM6 C;  1KX5 C;  3NQJ B;  3AYW A;  4KHA B;  2ZY4 A;  4J8X C;  1S32 D;  1M19 D;  4J8W B;  2NZD B;  3X1T A;  5AVB B;  5AV6 B;  4X23 B;  4WU9 C;  2Y2K A;  2JSS A;  4E44 A;  3R45 A;  3X1V C;  2NQB B;  5FUG B;  4H9N A;  3LJA A;  5DNN B;  3TU4 D;  3KWQ C;  3NQJ A;  5AV9 C;  5B0Z B;  4KHA A;  3W96 C;  4YS3 C;  3KFU G;  2RIQ A;  4AWL B;  1P3B A;  5G49 B;  4J8W A;  3REI B;  2NZD A;  5AVB A;  5AV6 A;  4H9Q B;  4X23 A;  2Y2Q A;  3O62 D;  5BNX A;  3UTB B;  4UUZ A;  1F1E A;  4XZQ C;  3AZH D;  1KX4 A;  3WA9 B;  5CP6 B;  2W8S A;  5FUG A;  2CV5 D;  2F8N B;  2NQB A;  3MGR C;  3A6N D;  3AZJ B;  3WTP E;  5B0Z A;  3W96 D;  4J8V D;  5BO0 B;  3AV1 B;  5G49 A;  3REI A;  2HIO C;  5B1M D;  3MNN D;  3C1B C;  5E5A C;  4HGA B;  3REL C;  3AZL B;  5CPI A;  2Y2G A;  3AZI C;  3UTB A;  4UPK A;  3LZ1 D;  3KXB D;  5F99 D;  4WJ3 C;  3AZE C;  1M1A B;  4WU8 C;  3AZM C;  3WKJ C;  4QLC C;  2F8N A;  5BNV B;  1P3P C;  3AZJ A;  4ZUX D;  4H9R B;  5AV5 C;  3REH B;  3W97 D;  3UTA B;  1P3I A;  5GT3 B;  5BO0 A;  3AYW D;  1AOI D;  3EPL A;  1TZY B;  3MGP C;  1Q9C A;  3C1B D;  3AZL A;  2PYO B;  2DQN C;  3KUY B;  4H9S C;  1S32 B;  4G91 B;  1EQZ C;  5B33 C;  4QLC D;  3AFA C;  1BH9 B;  1P3P D;  2YFV B;  5BNV A;  5DNM B;  3FDD A;  4H9R A;  5AV5 D;  3UTA A;  2UWX A;  5GT3 A;  3MGQ A;  1TZY A;  5C3I C;  1H3O B;  3H0M C;  1P3B D;  4J8W D;  2PYO A;  2NZD D;  5AV8 B;  3TU4 B;  5B31 C;  4X23 D;  1KX5 B;  4NFT A;  3KUY A;  3P5J B;  2ZY2 A;  5AVC D;  1BH9 A;  1KX4 D;  2YFV A;  3AZK C;  5DNM A;  3B6G D;  3O62 B;  3AN2 D;  5B24 A;  3AZH B;  4R8P A;  5CPJ A;  3REI D;  5AV8 A;  3A6N B;  3W99 C;  4E45 A;  3TU4 A;  4CAY B;  3KWQ B;  5CPI D;  1KX5 A;  3WAA A;  3REJ D;  3REK C;  4YS3 B;  1BH8 B;  3B0C T;  4J8X A;  3W96 B;  2XD1 A;  3MNN B;  3AV2 C;  3O62 A;  3W98 C;  3AZJ D;  5B40 C;  3VH5 A;  3LZ1 B;  2ARO D;  1P3I D;  3AZH A;  1P3K C;  1B6W A;  3VH5 W;  2Y2N A;  3X1V A;  3LZ0 C;  3A6N A;  3AZL D;  4CAY A;  3KWQ A;  3H0R C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...