3WA9C

The nucleosome containing human h2a.z.1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
KAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wa9C00
3MGQD 3UTAA 2IO5B 3MVDC 3AZGA 4KGCD 1BH8A 2CV5D 1ULYA 4Z5TA 5BNXB 1P3MA 4R8PA 5B31A 3AZKB 3AV1B 5AY8A 5AV6A 3X1TB 4YS3D 4J8WA 1ZLAB 4KUDB 3X1SB 3LZ1C 5B32B 3LJAA 5DNMD 3AZND 5B40D 2IO5C 5CPJA 4NE6A 5B1MD 3TU4A 1M18C 3AZHC 4NFTA 4J8UD 3MGQA 3AV2A 3AZKC 4ZBJB 3REJB 3X1TC 4WU9B 3B6FC 3B0BA 3WKJD 4WU8A 5B1LC 5GT0B 2CV5A 1EQZD 5BNVA 5CPKD 3MGPD 1M19D 1ZLAC 2PYOB 4UUZB 3X1SC 2NQBB 5B32C 4H9SA 5AV5D 4YS3A 3C1CC 4E45A 1ID3A 1P3AD 4WNNB 1TZYB 1P34D 1P3LB 5B40A 3WAAB 3WTPE 1KX4B 3A6NC 5AV8B 3VH6A 3REJC 4WU9C 1P3FB 1P3PB 5F99D 1B6WA 1HTAA 5CP6C 4E44A 1H3OB 3O62B 2PYOC 2NQBC 3MGRD 3WKJA 3UTBB 5AV9D 4WV4B 3REKD 3KUYB 1EQZA 2YFWB 3MGPA 5CPKA 3AZGC 3W97A 2BYMA 1P3IB 5AV5A 4Z5TC 1P3GB 1P3MC 5DNNC 4R8PC 3B6FD 1BH9B 5B31C 3WAAC 4KGCB 1KX3A 5AV6C 1P3AA 3AZFB 1F66D 3AZEA 4H9RA 4XZQB 4J8WC 3MNNA 4H9OA 1P34A 1P3FC 3KWQB 3MGSB 1P3OB 1JFIA 2FJ7B 3W99D 5F99A 5G49B 5CPJC 3AYWA 5DNMB 3MGRA 3TU4C 3AZNB 3A6ND 3C1BA 1P3IC 1M1AB 4KHAB 5AV9A 1P3GC 4ZUXB 3AV2C 3MGQC 4H9PB 5B2JB 3AZIB 5B1MB 5CP6D 4WU8C 2CV5C 5JA4B 4J8UB 4X23B 4H9SC 3UTAD 4YS3C 3REID 1TAFB 1N1JA 4H9NA 1M19B 4Z5TD 5B31D 3MVDB 5AY8D 2HIOD 4XUJD 5DNMC 5B40C 3AN2A 3W99A 5B0YD 1AOID 4G92B 5B2IA 4YM6A 3LJAD 5B0ZA 2F8NH 5B31G 3WKJC 1EQZC 5CPKC 3MGPC 3TU4D 1P3BD 1M19C 5GT3A 5AV5C 3REIA 3REKB 4WU8D 1M18B 1P3AC 3VH6W 3AZEC 1HQ3D 5B24A 3AZHB 4G92C 3MNNC 4XUJA 2HIOA 1P34C 3KXBA 2L5AA 3B6FB 5B1LB 3X1UD 4Z66A 3VH5W 1F66B 2BYKB 5JRGD 5B0YA 1AOIA 1ID3D 4J8XA 3AZMD 3B6GD 5F99C 3AZJD 2JSSA 4QLCA 3C1CB 1S32A 3MGRC 5BS7A 4DRBA 5AV9C 2HUEC 3REKC 4WZSB 1P3BA 3WTPD 1KX5D 4Z2MH 3A6NB 1P3LA 5GSUD 3R45A 1U35A 5CP6B 1F66C 1HQ3A 5FUGB 4NE3A 3W97D 3X1UA 2AROA 3UTAB 5JRGA 3AZGB 5CPIA 1KX3D 1BH8B 3AZED 3X1VA 4CSRA 3W99C 5AVCA 2CWEA 4Z5TB 3AZMA 1P3MB 5DNNB 3AZJA 4R8PB 1KU5A 5B31B 3MNND 3B6GA 4LD9D 3AFAA 5AY8B 5AV6B 3W98D 5B2IC 3RELA 3AZLD 3AZFA 4J8WB 3WTPA 1KX5A 3V9RA 3LJAB 3VH5A 3AYWD 5B33D 5GSUA 3C1BD 1P3KD 3UTAC 3REIC 3NQUA 5CPJB 3WA9A 5AVBD 3TU4B 3VH6T 4JJNA 4J8VA 3AV2B 2F8NB 3MGQB 5AY8C 2HIOC 4XUJC 3LZ0A 4WU8B 3LELD 2CV5B 5BNVB 5C3IC 5B0YC 3REHD 1AOIC 4LD9A 5E5AD 1B67A 3W98A 3LJAC 3NQJA 4YS3B 2F8ND 4QLCC 3AZLA 2NZDA 1S32C 3AN2D 1ID3B 4DRAA 2YFVA 5B33A 1P3BC 5B40B 5B2ID 4YM6D 5B0ZD 3W96A 5GXQA 1P3KA 2F8NG 5AVBA 3KSYA 1U35C 4H9QA 1HQ3C 1BFMA 5GT3D 3WKJB 3LELA 3X1UC 1Q9CA 2AROC 1EQZB 5CPKB 3MGPB 5CPIC 5JRGC 3LZ1A 3REHA 1ID3C 3W97B 5E5AA 2BYMB 5B24D 5AV5B 3AZMC 3UT9A 3B6GC 5BO0A 4CAYA 3AZJC 2F8NA 3KXBD 3AFAC 4Z66D 1KX3B 1P3AB 3RELC 3AZEB 5GT0D 2RVQD 5BNXA 3MNNB 4H9OB 1P34B 5KDMB 3WTPC 4J8XD 3AZKA 5BT1C 4QLCD 3AV1A 3X1TA 1KX5C 1S32D 5GSUC 1JFIB 1ZLAA 5F99B 3X1SA 4KUDA 5B32A 3WA9C 3AYWB 3W97C 3MGRB 1P3LD 3C1BB 1R4VA 3B0DC 5AV9B 4G91C 2HUEB 4J8VC 5AV8D 1WWSA 4Z2MG 3B0CW 1KX3C 3LZ0C 1U35D 1A7WA 1P3PD 4LD9C 3O62D 2AROD 2F8NK 3REJA 4WU9A 3W98C 5CPID 3AZLC 1N1JB 2NZDC 5GT0A 3KUYD 3X1VD 4H9NB 4M6BA 4HGAC 5AVCD 2NQBA 4UUZA 2PYOA 3AFAD 3AYWC 5B33C 3C1BC 3RELD 3AN2B 3W96C 3W99B 5GXQC 4AWLC 3AZFD 1P3KC 4WNNA 4XZQD 5AVBC 5BT1D 5DNNA 1TZYA 5B2IB 4YM6B 5B0ZB 3WAAA 3KWQD 1KX4A 5AV8A 3MGSD 1P3OD 3LELC 2FJ7D 1P3FA 1P3PA 3WA9D 3REHC 4JJND 5E5AC 1H3OA 5GT3B 3O62A 4J8VD 1M1AD 3UTBA 3REIB 3UT9C 3LZ0D 4ZUXD 3KUYA 2YFWA 5B2JD 3AN2C 3AZID 5B24B 1P3IA 1P3GA 4XUJB 2HIOB 3KXBB 1BH9A 4Z66B 4YM6C 5B0ZC 4KGCA 3AV1C 2NZDD 4X23D 5C3IB 5B0YB 1AOIB 4XZQA 4J8XB 4KUDC 4QLCB 3KWQA 1S32B 3MGSA 5GT3C 3MVDD 1P3OA 3W96D 5GXQD 2FJ7A 3B0CT 1P3BB 5G49A 5DNMA 3AZNA 5B24C 1M1AA 4KHAA 4ZUXA 3KXBC 3R45B 3VH5T 4H9PA 4ZBJC 5B2JA 4Z66C 1U35B 2LY8A 3AZIA 1HQ3B 5B1MA 3LZ1D 5GT0C 5JA4A 2RVQC 4J8UA 4J8XC 3X1UB 3UT9D 2AROB 4X23A 5JRGB 5CPIB 1TAFA 5BS7C 3X1VB 4CSRB 1M19A 5AVCB 3AZMB 1M18D 3B6GB 3AZJB 3AZHD 3AFAB 3AZKD 3MVDA 3X1TD 1TZYC 3AV1D 3RELB 1P3LC 5B1LD 1KX4C 5AV8C 1ZLAD 3WTPB 4KUDD 3X1SD 1KX5B 1P3PC 3V9RB 5KDMA 5B32D 5GSUB 3C1CD 3O62C 3UTBC 3NQUB 3WA9B 3KUYC 3X1VC 3B0DB 4JJNB 5AVCC 4G91B 4J8VB 5B32G 3LZ0B 3REKA 3REJD 4WU9D 4KGCC 4H9RB 1M18A 3AZFC 4LD9B 3AZHA 4XZQC 2NQBD 2PYOD 3W98B 3B6FA 3NQJB 5B1LA 3KWQC 3AZLB 2NZDB 4EO5B 1F66A 2BYKA 3MGSC 1P3OC 3AZGD 4HGAB 2FJ7C 1F1EA 2YFVB 5B33B 1P3MD 5DNND 4R8PD 1TZYD 3C1CA 1WWIA 4JJNC 3W96B 3WAAD 5GXQB 5AV6D 4AWLB 3AZNC 1KX4D 1P3KB 1M1AC 5CHLB 4NE5A 4ZUXC 5AVBB 4J8WD 5B2JC 1P3FD 4H9QB 3AZIC 5B1MC 3A6NA 4J8UC 3LELB 3UTBD 4X23C 4EO5C 5CP6A 3LZ1B 3REHB 5FUGA 5CPJD 5E5AB 1P3ID 3UT9B 5BO0B 4CAYB 1P3GD 3AV2D
chains in the Genus database with same CATH superfamily
3MGQD 3UTAA 2IO5B 3MVDC 3AZGA 4KGCD 1BH8A 2CV5D 1ULYA 4Z5TA 5BNXB 1P3MA 4R8PA 5B31A 3AZKB 3AV1B 5AY8A 5AV6A 3X1TB 4YS3D 2Y2OA 4J8WA 1ZLAB 4KUDB 3X1SB 2Y2GA 3LZ1C 5B32B 3LJAA 3H0RC 5DNMD 3AZND 5B40D 2IO5C 5CPJA 4NE6A 5B1MD 3TU4A 1M18C 3AZHC 4NFTA 4J8UD 3MGQA 3AV2A 3AZKC 4ZBJB 3REJB 3X1TC 4WU9B 3B6FC 3B0BA 3WKJD 4WU8A 5B1LC 5GT0B 2CV5A 1EQZD 5BNVA 5CPKD 3MGPD 1M19D 1ZLAC 2PYOB 4UUZB 3X1SC 2NQBB 5B32C 4H9SA 5AV5D 4YS3A 3C1CC 4E45A 3AL0C 1ID3A 1P3AD 4WNNB 2ZY2A 1TZYB 1P34D 1P3LB 5B40A 3WAAB 3WTPE 1KX4B 3A6NC 4WJ3C 5AV8B 3VH6A 3EG5B 3REJC 4WU9C 1P3FB 1P3PB 5F99D 1B6WA 1HTAA 5CP6C 4E44A 1H3OB 3O62B 2PYOC 2NQBC 3MGRD 3WKJA 3UTBB 5AV9D 4WV4B 3REKD 2G5IC 3KUYB 1EQZA 2YFWB 3MGPA 2F2AC 5CPKA 3AZGC 3W97A 2BYMA 1P3IB 5AV5A 4Z5TC 1P3GB 1P3MC 5DNNC 4R8PC 3B6FD 5B31C 1BH9B 3WAAC 4KGCB 1KX3A 5AV6C 1P3AA 3AZFB 1F66D 3AZEA 4H9RA 4XZQB 4J8WC 2Y2IA 3MNNA 4H9OA 1P34A 1P3FC 3KWQB 3MGSB 1P3OB 1JFIA 2FJ7B 3W99D 5F99A 5G49B 5CPJC 3AYWA 5DNMB 3MGRA 3TU4C 3AZNB 3A6ND 2XD1A 3C1BA 1P3IC 1M1AB 4KHAB 5AV9A 1P3GC 4ZUXB 3AV2C 3MGQC 4H9PB 5B2JB 4DQYB 3AZIB 5B1MB 5CP6D 4WU8C 2CV5C 5JA4B 4J8UB 2J8PA 4X23B 4H9SC 3UTAD 4YS3C 3REID 1TAFB 1N1JA 4H9NA 1M19B 3EPHA 4Z5TD 5B31D 3MVDB 5AY8D 2HIOD 4XUJD 5DNMC 5B40C 3AN2A 3W99A 5B0YD 1AOID 4G92B 2VQRA 5B2IA 4YM6A 3LJAD 5B0ZA 2F8NH 2UWXA 5B31G 3WKJC 1EQZC 5CPKC 3MGPC 3TU4D 1P3BD 1M19C 5GT3A 5AV5C 3REIA 3REKB 4WU8D 1M18B 1P3AC 3VH6W 3AZEC 1HQ3D 5B24A 3AZHB 4G92C 3MNNC 4XUJA 2HIOA 1P34C 3KXBA 2L5AA 3B6FB 5B1LB 3X1UD 4Z66A 3VH5W 1F66B 2BYKB 5JRGD 5B0YA 1AOIA 1ID3D 2Y2LA 4J8XA 3AZMD 3B6GD 5F99C 3AZJD 2JSSA 4QLCA 3C1CB 1S32A 3A1KA 3MGRC 5BS7A 4DRBA 5AV9C 2HUEC 3REKC 4WZSB 1P3BA 3WTPD 1KX5D 4Z2MH 3A6NB 1P3LA 5GSUD 3R45A 1U35A 5CP6B 1F66C 1HQ3A 5FUGB 4NE3A 3W97D 3X1UA 2AROA 3UTAB 5JRGA 3P5JB 3EPJA 3AZGB 5CPIA 1KX3D 1BH8B 3F6TA 3AZED 3X1VA 4CSRA 3W99C 5AVCA 2CWEA 4Z5TB 3AZMA 1P3MB 5DNNB 3AZJA 4R8PB 1KU5A 5B31B 3MNND 3B6GA 4LD9D 3AFAA 5AY8B 5AV6B 3W98D 5B2IC 3RELA 3AZLD 3AZFA 4J8WB 3WTPA 1KX5A 3V9RA 3LJAB 3VH5A 3AYWD 5B33D 5GSUA 3C1BD 1P3KD 3UTAC 3REIC 3NQUA 5CPJB 3WA9A 3KFUG 5AVBD 3TU4B 3VH6T 4JJNA 4J8VA 3AV2B 2F8NB 3MGQB 3EPKA 2FFFB 2HIOC 5AY8C 4XUJC 3LZ0A 4WU8B 3LELD 2CV5B 5BNVB 5C3IC 5B0YC 3REHD 1AOIC 4LD9A 5E5AD 1B67A 3W98A 3LJAC 3NQJA 4YS3B 2F8ND 4QLCC 3AZLA 2NZDA 1S32C 3AN2D 1ID3B 4DRAA 2Y2JA 2YFVA 5B33A 1P3BC 5B40B 5B2ID 4YM6D 5B0ZD 3W96A 5GXQA 3A1IA 1P3KA 2F8NG 5AVBA 3KSYA 1U35C 4H9QA 1HQ3C 1BFMA 5GT3D 3WKJB 3LELA 3X1UC 1Q9CA 2AROC 4UPKA 1EQZB 5CPKB 3MGPB 5CPIC 5JRGC 3LZ1A 3REHA 1ID3C 3W97B 5E5AA 2BYMB 5B24D 5AV5B 3AZMC 3UT9A 1W2EA 5BO0A 4CAYA 3AZJC 2F8NA 3B6GC 3KXBD 3AFAC 4Z66D 1KX3B 1P3AB 3RELC 3AZEB 5GT0D 2RVQD 5BNXA 3MNNB 4H9OB 1P34B 5KDMB 3WTPC 4J8XD 3AZKA 5BT1C 4QLCD 3AV1A 3X1TA 1KX5C 1S32D 1T3UA 5GSUC 1JFIB 1ZLAA 5F99B 3X1SA 4KUDA 5B32A 3WA9C 3AYWB 3W97C 3MGRB 1P3LD 3C1BB 1R4VA 3B0DC 2ZY3A 5AV9B 4G91C 2HUEB 4J8VC 5AV8D 1WWSA 4Z2MG 3B0CW 1KX3C 3LZ0C 1U35D 1A7WA 1P3PD 4LD9C 3O62D 2Y2PA 2AROD 2F8NK 3REJA 4WU9A 3W98C 5CPID 3AZLC 1N1JB 2NZDC 5GT0A 3KUYD 3X1VD 2ZY5A 4H9NB 4M6BA 4HGAC 5AVCD 2NQBA 4UUZA 2PYOA 3H0MC 3AFAD 3AYWC 5B33C 3C1BC 3RELD 3AN2B 3W96C 3W99B 5GXQC 2DF4C 4AWLC 3AZFD 1P3KC 4WNNA 4XZQD 5AVBC 5BT1D 5DNNA 1TZYA 5B2IB 4YM6B 5B0ZB 3WAAA 3KWQD 3EPLA 1KX4A 5AV8A 3MGSD 1P3OD 2JCHA 3LELC 2FJ7D 1P3FA 2ZY4A 1P3PA 3WA9D 3REHC 2W8SA 4JJND 2Y2HA 5E5AC 1H3OA 5GT3B 3O62A 4J8VD 1M1AD 3UTBA 3REIB 3UT9C 2Y2MA 4ZUXD 3LZ0D 3KUYA 2YFWA 5B2JD 3AN2C 3AZID 5B24B 1P3IA 2DQNC 1P3GA 4XUJB 2HIOB 3KXBB 1BH9A 4Z66B 4YM6C 5B0ZC 4KGCA 3AV1C 2NZDD 4X23D 5C3IB 5B0YB 2Y2NA 1AOIB 4XZQA 2G5HC 4J8XB 4KUDC 4QLCB 3KWQA 1S32B 3MGSA 5GT3C 3MVDD 1P3OA 3W96D 5GXQD 2FJ7A 3B0CT 1P3BB 5G49A 5DNMA 3AZNA 5B24C 1M1AA 4KHAA 4ZUXA 3KXBC 3R45B 3VH5T 4H9PA 4ZBJC 5B2JA 4Z66C 1U35B 2LY8A 3AZIA 1HQ3B 5B1MA 3LZ1D 5GT0C 5JA4A 2RVQC 4J8UA 4J8XC 3X1UB 3UT9D 2AROB 4X23A 5JRGB 5CPIB 2JE5A 1TAFA 5BS7C 3X1VB 4CSRB 1M19A 5AVCB 3AZMB 1M18D 3B6GB 3AZJB 3AZHD 3AFAB 3AZKD 3MVDA 3X1TD 1TZYC 3AV1D 3RELB 1P3LC 5B1LD 1KX4C 5AV8C 1ZLAD 3WTPB 4KUDD 3X1SD 1KX5B 1P3PC 3V9RB 5KDMA 5B32D 5GSUB 3C1CD 3O62C 2XD5A 3UTBC 3NQUB 3WA9B 3KUYC 3X1VC 3B0DB 4JJNB 5AVCC 3FDDA 4G91B 4J8VB 5B32G 3LZ0B 3REKA 3REJD 4WU9D 3IP4C 4KGCC 4H9RB 1M18A 3AZFC 4LD9B 3AZHA 4XZQC 2NQBD 2PYOD 3W98B 3B6FA 3NQJB 5B1LA 3KWQC 3AZLB 2NZDB 4EO5B 1F66A 2BYKA 3MGSC 1P3OC 3AZGD 4HGAB 2Y2QA 1Z2CB 2FJ7C 1F1EA 2YFVB 5B33B 1P3MD 5DNND 4R8PD 1TZYD 3C1CA 1WWIA 4JJNC 3W96B 3WAAD 5GXQB 5AV6D 4AWLB 3AZNC 1KX4D 1P3KB 1M1AC 5CHLB 4NE5A 4ZUXC 5AVBB 4J8WD 5B2JC 1P3FD 4H9QB 3AZIC 5B1MC 3A6NA 1PZRA 2ZM5A 4J8UC 3LELB 3UTBD 2BG1A 4X23C 4EO5C 5CP6A 3LZ1B 3REHB 5FUGA 2RIQA 5CPJD 5E5AB 3H0LC 2Y2KA 1P3ID 3UT9B 5BO0B 4CAYB 1P3GD 3AV2D
chains in the Genus database with same CATH topology
3MGQD 3UTAA 2IO5B 3MVDC 3AZGA 4KGCD 1BH8A 2CV5D 1ULYA 4Z5TA 5BNXB 1P3MA 4R8PA 5B31A 3AZKB 3AV1B 5AY8A 5AV6A 3X1TB 4YS3D 2Y2OA 4J8WA 1ZLAB 4KUDB 3X1SB 2Y2GA 3LZ1C 5B32B 3LJAA 3H0RC 5DNMD 3AZND 5B40D 2IO5C 5CPJA 4NE6A 5B1MD 3TU4A 1M18C 3AZHC 4NFTA 4J8UD 3MGQA 3AV2A 3AZKC 4ZBJB 3REJB 3X1TC 4WU9B 3B6FC 3B0BA 3WKJD 4WU8A 5B1LC 5GT0B 2CV5A 1EQZD 5BNVA 5CPKD 3MGPD 1M19D 1ZLAC 2PYOB 4UUZB 3X1SC 2NQBB 5B32C 4H9SA 5AV5D 4YS3A 3C1CC 4E45A 3AL0C 1ID3A 1P3AD 4WNNB 2ZY2A 1TZYB 1P34D 1P3LB 5B40A 3WAAB 3WTPE 1KX4B 3A6NC 4WJ3C 5AV8B 3VH6A 3EG5B 3REJC 4WU9C 1P3FB 1P3PB 5F99D 1B6WA 1HTAA 5CP6C 4E44A 1H3OB 3O62B 2PYOC 2NQBC 3MGRD 3WKJA 3UTBB 5AV9D 4WV4B 3REKD 2G5IC 3KUYB 1EQZA 2YFWB 3MGPA 2F2AC 5CPKA 3AZGC 3W97A 2BYMA 1P3IB 5AV5A 4Z5TC 1P3GB 1P3MC 5DNNC 4R8PC 3B6FD 5B31C 1BH9B 3WAAC 4KGCB 1KX3A 5AV6C 1P3AA 3AZFB 1F66D 3AZEA 4H9RA 4XZQB 4J8WC 2Y2IA 3MNNA 4H9OA 1P34A 1P3FC 3KWQB 3MGSB 1P3OB 1JFIA 2FJ7B 3W99D 5F99A 5G49B 5CPJC 3AYWA 5DNMB 3MGRA 3TU4C 3AZNB 3A6ND 2XD1A 3C1BA 1P3IC 1M1AB 4KHAB 5AV9A 1P3GC 4ZUXB 3AV2C 3MGQC 4H9PB 5B2JB 4DQYB 3AZIB 5B1MB 5CP6D 4WU8C 2CV5C 5JA4B 4J8UB 2J8PA 4X23B 4H9SC 3UTAD 4YS3C 3REID 1TAFB 1N1JA 4H9NA 1M19B 3EPHA 4Z5TD 5B31D 3MVDB 5AY8D 2HIOD 4XUJD 5DNMC 5B40C 3AN2A 3W99A 5B0YD 1AOID 4G92B 2VQRA 5B2IA 4YM6A 3LJAD 5B0ZA 2F8NH 2UWXA 5B31G 3WKJC 1EQZC 5CPKC 3MGPC 3TU4D 1P3BD 1M19C 5GT3A 5AV5C 3REIA 3REKB 4WU8D 1M18B 1P3AC 3VH6W 3AZEC 1HQ3D 5B24A 3AZHB 4G92C 3MNNC 4XUJA 2HIOA 1P34C 3KXBA 2L5AA 3B6FB 5B1LB 3X1UD 4Z66A 3VH5W 1F66B 2BYKB 5JRGD 5B0YA 1AOIA 1ID3D 2Y2LA 4J8XA 3AZMD 3B6GD 5F99C 3AZJD 2JSSA 4QLCA 3C1CB 1S32A 3A1KA 3MGRC 5BS7A 4DRBA 5AV9C 2HUEC 3REKC 4WZSB 1P3BA 3WTPD 1KX5D 4Z2MH 3A6NB 1P3LA 5GSUD 3R45A 1U35A 5CP6B 1F66C 1HQ3A 5FUGB 4NE3A 3W97D 3X1UA 2AROA 3UTAB 5JRGA 3P5JB 3EPJA 3AZGB 5CPIA 1KX3D 1BH8B 3F6TA 3AZED 3X1VA 4CSRA 3W99C 5AVCA 2CWEA 4Z5TB 3AZMA 1P3MB 5DNNB 3AZJA 4R8PB 1KU5A 5B31B 3MNND 3B6GA 4LD9D 3AFAA 5AY8B 5AV6B 3W98D 5B2IC 3RELA 3AZLD 3AZFA 4J8WB 3WTPA 1KX5A 3V9RA 3LJAB 3VH5A 3AYWD 5B33D 5GSUA 3C1BD 1P3KD 3UTAC 3REIC 3NQUA 5CPJB 3WA9A 3KFUG 5AVBD 3TU4B 3VH6T 4JJNA 4J8VA 3AV2B 2F8NB 3MGQB 3EPKA 2FFFB 2HIOC 5AY8C 4XUJC 3LZ0A 4WU8B 3LELD 2CV5B 5BNVB 5C3IC 5B0YC 3REHD 1AOIC 4LD9A 5E5AD 1B67A 3W98A 3LJAC 3NQJA 4YS3B 2F8ND 4QLCC 3AZLA 2NZDA 1S32C 3AN2D 1ID3B 4DRAA 2Y2JA 2YFVA 5B33A 1P3BC 5B40B 5B2ID 4YM6D 5B0ZD 3W96A 5GXQA 3A1IA 1P3KA 2F8NG 5AVBA 3KSYA 1U35C 4H9QA 1HQ3C 1BFMA 5GT3D 3WKJB 3LELA 3X1UC 1Q9CA 2AROC 4UPKA 1EQZB 5CPKB 3MGPB 5CPIC 5JRGC 3LZ1A 3REHA 1ID3C 3W97B 5E5AA 2BYMB 5B24D 5AV5B 3AZMC 3UT9A 1W2EA 5BO0A 4CAYA 3AZJC 2F8NA 3B6GC 3KXBD 3AFAC 4Z66D 1KX3B 1P3AB 3RELC 3AZEB 5GT0D 2RVQD 5BNXA 3MNNB 4H9OB 1P34B 5KDMB 3WTPC 4J8XD 3AZKA 5BT1C 4QLCD 3AV1A 3X1TA 1KX5C 1S32D 1T3UA 5GSUC 1JFIB 1ZLAA 5F99B 3X1SA 4KUDA 5B32A 3WA9C 3AYWB 3W97C 3MGRB 1P3LD 3C1BB 1R4VA 3B0DC 2ZY3A 5AV9B 4G91C 2HUEB 4J8VC 5AV8D 1WWSA 4Z2MG 3B0CW 1KX3C 3LZ0C 1U35D 1A7WA 1P3PD 4LD9C 3O62D 2Y2PA 2AROD 2F8NK 3REJA 4WU9A 3W98C 5CPID 3AZLC 1N1JB 2NZDC 5GT0A 3KUYD 3X1VD 2ZY5A 4H9NB 4M6BA 4HGAC 5AVCD 2NQBA 4UUZA 2PYOA 3H0MC 3AFAD 3AYWC 5B33C 3C1BC 3RELD 3AN2B 3W96C 3W99B 5GXQC 2DF4C 4AWLC 3AZFD 1P3KC 4WNNA 4XZQD 5AVBC 5BT1D 5DNNA 1TZYA 5B2IB 4YM6B 5B0ZB 3WAAA 3KWQD 3EPLA 1KX4A 5AV8A 3MGSD 1P3OD 2JCHA 3LELC 2FJ7D 1P3FA 2ZY4A 1P3PA 3WA9D 3REHC 2W8SA 4JJND 2Y2HA 5E5AC 1H3OA 5GT3B 3O62A 4J8VD 1M1AD 3UTBA 3REIB 3UT9C 2Y2MA 4ZUXD 3LZ0D 3KUYA 2YFWA 5B2JD 3AN2C 3AZID 5B24B 1P3IA 2DQNC 1P3GA 4XUJB 2HIOB 3KXBB 1BH9A 4Z66B 4YM6C 5B0ZC 4KGCA 3AV1C 2NZDD 4X23D 5C3IB 5B0YB 2Y2NA 1AOIB 4XZQA 2G5HC 4J8XB 4KUDC 4QLCB 3KWQA 1S32B 3MGSA 5GT3C 3MVDD 1P3OA 3W96D 5GXQD 2FJ7A 3B0CT 1P3BB 5G49A 5DNMA 3AZNA 5B24C 1M1AA 4KHAA 4ZUXA 3KXBC 3R45B 3VH5T 4H9PA 4ZBJC 5B2JA 4Z66C 1U35B 2LY8A 3AZIA 1HQ3B 5B1MA 3LZ1D 5GT0C 5JA4A 2RVQC 4J8UA 4J8XC 3X1UB 3UT9D 2AROB 4X23A 5JRGB 5CPIB 2JE5A 1TAFA 5BS7C 3X1VB 4CSRB 1M19A 5AVCB 3AZMB 1M18D 3B6GB 3AZJB 3AZHD 3AFAB 3AZKD 3MVDA 3X1TD 1TZYC 3AV1D 3RELB 1P3LC 5B1LD 1KX4C 5AV8C 1ZLAD 3WTPB 4KUDD 3X1SD 1KX5B 1P3PC 3V9RB 5KDMA 5B32D 5GSUB 3C1CD 3O62C 2XD5A 3UTBC 3NQUB 3WA9B 3KUYC 3X1VC 3B0DB 4JJNB 5AVCC 3FDDA 4G91B 4J8VB 5B32G 3LZ0B 3REKA 3REJD 4WU9D 3IP4C 4KGCC 4H9RB 1M18A 3AZFC 4LD9B 3AZHA 4XZQC 2NQBD 2PYOD 3W98B 3B6FA 3NQJB 5B1LA 3KWQC 3AZLB 2NZDB 4EO5B 1F66A 2BYKA 3MGSC 1P3OC 3AZGD 4HGAB 2Y2QA 1Z2CB 2FJ7C 1F1EA 2YFVB 5B33B 1P3MD 5DNND 4R8PD 1TZYD 3C1CA 1WWIA 4JJNC 3W96B 3WAAD 5GXQB 5AV6D 4AWLB 3AZNC 1KX4D 1P3KB 1M1AC 5CHLB 4NE5A 4ZUXC 5AVBB 4J8WD 5B2JC 1P3FD 4H9QB 3AZIC 5B1MC 3A6NA 1PZRA 2ZM5A 4J8UC 3LELB 3UTBD 2BG1A 4X23C 4EO5C 5CP6A 3LZ1B 3REHB 5FUGA 2RIQA 5CPJD 5E5AB 3H0LC 2Y2KA 1P3ID 3UT9B 5BO0B 4CAYB 1P3GD 3AV2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGQ D;  3UTA A;  2IO5 B;  3MVD C;  3AZG A;  4KGC D;  1BH8 A;  2CV5 D;  1ULY A;  4Z5T A;  5BNX B;  1P3M A;  4R8P A;  5B31 A;  3AZK B;  3AV1 B;  5AY8 A;  5AV6 A;  3X1T B;  4YS3 D;  4J8W A;  1ZLA B;  4KUD B;  3X1S B;  3LZ1 C;  5B32 B;  3LJA A;  5DNM D;  3AZN D;  5B40 D;  2IO5 C;  5CPJ A;  4NE6 A;  5B1M D;  3TU4 A;  1M18 C;  3AZH C;  4NFT A;  4J8U D;  3MGQ A;  3AV2 A;  3AZK C;  4ZBJ B;  3REJ B;  3X1T C;  4WU9 B;  3B6F C;  3B0B A;  3WKJ D;  4WU8 A;  5B1L C;  5GT0 B;  2CV5 A;  1EQZ D;  5BNV A;  5CPK D;  3MGP D;  1M19 D;  1ZLA C;  2PYO B;  4UUZ B;  3X1S C;  2NQB B;  5B32 C;  4H9S A;  5AV5 D;  4YS3 A;  3C1C C;  4E45 A;  1ID3 A;  1P3A D;  4WNN B;  1TZY B;  1P34 D;  1P3L B;  5B40 A;  3WAA B;  3WTP E;  1KX4 B;  3A6N C;  5AV8 B;  3VH6 A;  3REJ C;  4WU9 C;  1P3F B;  1P3P B;  5F99 D;  1B6W A;  1HTA A;  5CP6 C;  4E44 A;  1H3O B;  3O62 B;  2PYO C;  2NQB C;  3MGR D;  3WKJ A;  3UTB B;  5AV9 D;  4WV4 B;  3REK D;  3KUY B;  1EQZ A;  2YFW B;  3MGP A;  5CPK A;  3AZG C;  3W97 A;  2BYM A;  1P3I B;  5AV5 A;  4Z5T C;  1P3G B;  1P3M C;  5DNN C;  4R8P C;  3B6F D;  1BH9 B;  5B31 C;  3WAA C;  4KGC B;  1KX3 A;  5AV6 C;  1P3A A;  3AZF B;  1F66 D;  3AZE A;  4H9R A;  4XZQ B;  4J8W C;  3MNN A;  4H9O A;  1P34 A;  1P3F C;  3KWQ B;  3MGS B;  1P3O B;  1JFI A;  2FJ7 B;  3W99 D;  5F99 A;  5G49 B;  5CPJ C;  3AYW A;  5DNM B;  3MGR A;  3TU4 C;  3AZN B;  3A6N D;  3C1B A;  1P3I C;  1M1A B;  4KHA B;  5AV9 A;  1P3G C;  4ZUX B;  3AV2 C;  3MGQ C;  4H9P B;  5B2J B;  3AZI B;  5B1M B;  5CP6 D;  4WU8 C;  2CV5 C;  5JA4 B;  4J8U B;  4X23 B;  4H9S C;  3UTA D;  4YS3 C;  3REI D;  1TAF B;  1N1J A;  4H9N A;  1M19 B;  4Z5T D;  5B31 D;  3MVD B;  5AY8 D;  2HIO D;  4XUJ D;  5DNM C;  5B40 C;  3AN2 A;  3W99 A;  5B0Y D;  1AOI D;  4G92 B;  5B2I A;  4YM6 A;  3LJA D;  5B0Z A;  2F8N H;  5B31 G;  3WKJ C;  1EQZ C;  5CPK C;  3MGP C;  3TU4 D;  1P3B D;  1M19 C;  5GT3 A;  5AV5 C;  3REI A;  3REK B;  4WU8 D;  1M18 B;  1P3A C;  3VH6 W;  3AZE C;  1HQ3 D;  5B24 A;  3AZH B;  4G92 C;  3MNN C;  4XUJ A;  2HIO A;  1P34 C;  3KXB A;  2L5A A;  3B6F B;  5B1L B;  3X1U D;  4Z66 A;  3VH5 W;  1F66 B;  2BYK B;  5JRG D;  5B0Y A;  1AOI A;  1ID3 D;  4J8X A;  3AZM D;  3B6G D;  5F99 C;  3AZJ D;  2JSS A;  4QLC A;  3C1C B;  1S32 A;  3MGR C;  5BS7 A;  4DRB A;  5AV9 C;  2HUE C;  3REK C;  4WZS B;  1P3B A;  3WTP D;  1KX5 D;  4Z2M H;  3A6N B;  1P3L A;  5GSU D;  3R45 A;  1U35 A;  5CP6 B;  1F66 C;  1HQ3 A;  5FUG B;  4NE3 A;  3W97 D;  3X1U A;  2ARO A;  3UTA B;  5JRG A;  3AZG B;  5CPI A;  1KX3 D;  1BH8 B;  3AZE D;  3X1V A;  4CSR A;  3W99 C;  5AVC A;  2CWE A;  4Z5T B;  3AZM A;  1P3M B;  5DNN B;  3AZJ A;  4R8P B;  1KU5 A;  5B31 B;  3MNN D;  3B6G A;  4LD9 D;  3AFA A;  5AY8 B;  5AV6 B;  3W98 D;  5B2I C;  3REL A;  3AZL D;  3AZF A;  4J8W B;  3WTP A;  1KX5 A;  3V9R A;  3LJA B;  3VH5 A;  3AYW D;  5B33 D;  5GSU A;  3C1B D;  1P3K D;  3UTA C;  3REI C;  3NQU A;  5CPJ B;  3WA9 A;  5AVB D;  3TU4 B;  3VH6 T;  4JJN A;  4J8V A;  3AV2 B;  2F8N B;  3MGQ B;  5AY8 C;  2HIO C;  4XUJ C;  3LZ0 A;  4WU8 B;  3LEL D;  2CV5 B;  5BNV B;  5C3I C;  5B0Y C;  3REH D;  1AOI C;  4LD9 A;  5E5A D;  1B67 A;  3W98 A;  3LJA C;  3NQJ A;  4YS3 B;  2F8N D;  4QLC C;  3AZL A;  2NZD A;  1S32 C;  3AN2 D;  1ID3 B;  4DRA A;  2YFV A;  5B33 A;  1P3B C;  5B40 B;  5B2I D;  4YM6 D;  5B0Z D;  3W96 A;  5GXQ A;  1P3K A;  2F8N G;  5AVB A;  3KSY A;  1U35 C;  4H9Q A;  1HQ3 C;  1BFM A;  5GT3 D;  3WKJ B;  3LEL A;  3X1U C;  1Q9C A;  2ARO C;  1EQZ B;  5CPK B;  3MGP B;  5CPI C;  5JRG C;  3LZ1 A;  3REH A;  1ID3 C;  3W97 B;  5E5A A;  2BYM B;  5B24 D;  5AV5 B;  3AZM C;  3UT9 A;  3B6G C;  5BO0 A;  4CAY A;  3AZJ C;  2F8N A;  3KXB D;  3AFA C;  4Z66 D;  1KX3 B;  1P3A B;  3REL C;  3AZE B;  5GT0 D;  2RVQ D;  5BNX A;  3MNN B;  4H9O B;  1P34 B;  5KDM B;  3WTP C;  4J8X D;  3AZK A;  5BT1 C;  4QLC D;  3AV1 A;  3X1T A;  1KX5 C;  1S32 D;  5GSU C;  1JFI B;  1ZLA A;  5F99 B;  3X1S A;  4KUD A;  5B32 A;  3WA9 C;  3AYW B;  3W97 C;  3MGR B;  1P3L D;  3C1B B;  1R4V A;  3B0D C;  5AV9 B;  4G91 C;  2HUE B;  4J8V C;  5AV8 D;  1WWS A;  4Z2M G;  3B0C W;  1KX3 C;  3LZ0 C;  1U35 D;  1A7W A;  1P3P D;  4LD9 C;  3O62 D;  2ARO D;  2F8N K;  3REJ A;  4WU9 A;  3W98 C;  5CPI D;  3AZL C;  1N1J B;  2NZD C;  5GT0 A;  3KUY D;  3X1V D;  4H9N B;  4M6B A;  4HGA C;  5AVC D;  2NQB A;  4UUZ A;  2PYO A;  3AFA D;  3AYW C;  5B33 C;  3C1B C;  3REL D;  3AN2 B;  3W96 C;  3W99 B;  5GXQ C;  4AWL C;  3AZF D;  1P3K C;  4WNN A;  4XZQ D;  5AVB C;  5BT1 D;  5DNN A;  1TZY A;  5B2I B;  4YM6 B;  5B0Z B;  3WAA A;  3KWQ D;  1KX4 A;  5AV8 A;  3MGS D;  1P3O D;  3LEL C;  2FJ7 D;  1P3F A;  1P3P A;  3WA9 D;  3REH C;  4JJN D;  5E5A C;  1H3O A;  5GT3 B;  3O62 A;  4J8V D;  1M1A D;  3UTB A;  3REI B;  3UT9 C;  3LZ0 D;  4ZUX D;  3KUY A;  2YFW A;  5B2J D;  3AN2 C;  3AZI D;  5B24 B;  1P3I A;  1P3G A;  4XUJ B;  2HIO B;  3KXB B;  1BH9 A;  4Z66 B;  4YM6 C;  5B0Z C;  4KGC A;  3AV1 C;  2NZD D;  4X23 D;  5C3I B;  5B0Y B;  1AOI B;  4XZQ A;  4J8X B;  4KUD C;  4QLC B;  3KWQ A;  1S32 B;  3MGS A;  5GT3 C;  3MVD D;  1P3O A;  3W96 D;  5GXQ D;  2FJ7 A;  3B0C T;  1P3B B;  5G49 A;  5DNM A;  3AZN A;  5B24 C;  1M1A A;  4KHA A;  4ZUX A;  3KXB C;  3R45 B;  3VH5 T;  4H9P A;  4ZBJ C;  5B2J A;  4Z66 C;  1U35 B;  2LY8 A;  3AZI A;  1HQ3 B;  5B1M A;  3LZ1 D;  5GT0 C;  5JA4 A;  2RVQ C;  4J8U A;  4J8X C;  3X1U B;  3UT9 D;  2ARO B;  4X23 A;  5JRG B;  5CPI B;  1TAF A;  5BS7 C;  3X1V B;  4CSR B;  1M19 A;  5AVC B;  3AZM B;  1M18 D;  3B6G B;  3AZJ B;  3AZH D;  3AFA B;  3AZK D;  3MVD A;  3X1T D;  1TZY C;  3AV1 D;  3REL B;  1P3L C;  5B1L D;  1KX4 C;  5AV8 C;  1ZLA D;  3WTP B;  4KUD D;  3X1S D;  1KX5 B;  1P3P C;  3V9R B;  5KDM A;  5B32 D;  5GSU B;  3C1C D;  3O62 C;  3UTB C;  3NQU B;  3WA9 B;  3KUY C;  3X1V C;  3B0D B;  4JJN B;  5AVC C;  4G91 B;  4J8V B;  5B32 G;  3LZ0 B;  3REK A;  3REJ D;  4WU9 D;  4KGC C;  4H9R B;  1M18 A;  3AZF C;  4LD9 B;  3AZH A;  4XZQ C;  2NQB D;  2PYO D;  3W98 B;  3B6F A;  3NQJ B;  5B1L A;  3KWQ C;  3AZL B;  2NZD B;  4EO5 B;  1F66 A;  2BYK A;  3MGS C;  1P3O C;  3AZG D;  4HGA B;  2FJ7 C;  1F1E A;  2YFV B;  5B33 B;  1P3M D;  5DNN D;  4R8P D;  1TZY D;  3C1C A;  1WWI A;  4JJN C;  3W96 B;  3WAA D;  5GXQ B;  5AV6 D;  4AWL B;  3AZN C;  1KX4 D;  1P3K B;  1M1A C;  5CHL B;  4NE5 A;  4ZUX C;  5AVB B;  4J8W D;  5B2J C;  1P3F D;  4H9Q B;  3AZI C;  5B1M C;  3A6N A;  4J8U C;  3LEL B;  3UTB D;  4X23 C;  4EO5 C;  5CP6 A;  3LZ1 B;  3REH B;  5FUG A;  5CPJ D;  5E5A B;  1P3I D;  3UT9 B;  5BO0 B;  4CAY B;  1P3G D;  3AV2 D; 
#chains in the Genus database with same CATH topology
 3MGQ D;  3UTA A;  2IO5 B;  3MVD C;  3AZG A;  4KGC D;  1BH8 A;  2CV5 D;  1ULY A;  4Z5T A;  5BNX B;  1P3M A;  4R8P A;  5B31 A;  3AZK B;  3AV1 B;  5AY8 A;  5AV6 A;  3X1T B;  4YS3 D;  2Y2O A;  4J8W A;  1ZLA B;  4KUD B;  3X1S B;  2Y2G A;  3LZ1 C;  5B32 B;  3LJA A;  3H0R C;  5DNM D;  3AZN D;  5B40 D;  2IO5 C;  5CPJ A;  4NE6 A;  5B1M D;  3TU4 A;  1M18 C;  3AZH C;  4NFT A;  4J8U D;  3MGQ A;  3AV2 A;  3AZK C;  4ZBJ B;  3REJ B;  3X1T C;  4WU9 B;  3B6F C;  3B0B A;  3WKJ D;  4WU8 A;  5B1L C;  5GT0 B;  2CV5 A;  1EQZ D;  5BNV A;  5CPK D;  3MGP D;  1M19 D;  1ZLA C;  2PYO B;  4UUZ B;  3X1S C;  2NQB B;  5B32 C;  4H9S A;  5AV5 D;  4YS3 A;  3C1C C;  4E45 A;  3AL0 C;  1ID3 A;  1P3A D;  4WNN B;  2ZY2 A;  1TZY B;  1P34 D;  1P3L B;  5B40 A;  3WAA B;  3WTP E;  1KX4 B;  3A6N C;  4WJ3 C;  5AV8 B;  3VH6 A;  3EG5 B;  3REJ C;  4WU9 C;  1P3F B;  1P3P B;  5F99 D;  1B6W A;  1HTA A;  5CP6 C;  4E44 A;  1H3O B;  3O62 B;  2PYO C;  2NQB C;  3MGR D;  3WKJ A;  3UTB B;  5AV9 D;  4WV4 B;  3REK D;  2G5I C;  3KUY B;  1EQZ A;  2YFW B;  3MGP A;  2F2A C;  5CPK A;  3AZG C;  3W97 A;  2BYM A;  1P3I B;  5AV5 A;  4Z5T C;  1P3G B;  1P3M C;  5DNN C;  4R8P C;  3B6F D;  5B31 C;  1BH9 B;  3WAA C;  4KGC B;  1KX3 A;  5AV6 C;  1P3A A;  3AZF B;  1F66 D;  3AZE A;  4H9R A;  4XZQ B;  4J8W C;  2Y2I A;  3MNN A;  4H9O A;  1P34 A;  1P3F C;  3KWQ B;  3MGS B;  1P3O B;  1JFI A;  2FJ7 B;  3W99 D;  5F99 A;  5G49 B;  5CPJ C;  3AYW A;  5DNM B;  3MGR A;  3TU4 C;  3AZN B;  3A6N D;  2XD1 A;  3C1B A;  1P3I C;  1M1A B;  4KHA B;  5AV9 A;  1P3G C;  4ZUX B;  3AV2 C;  3MGQ C;  4H9P B;  5B2J B;  4DQY B;  3AZI B;  5B1M B;  5CP6 D;  4WU8 C;  2CV5 C;  5JA4 B;  4J8U B;  2J8P A;  4X23 B;  4H9S C;  3UTA D;  4YS3 C;  3REI D;  1TAF B;  1N1J A;  4H9N A;  1M19 B;  3EPH A;  4Z5T D;  5B31 D;  3MVD B;  5AY8 D;  2HIO D;  4XUJ D;  5DNM C;  5B40 C;  3AN2 A;  3W99 A;  5B0Y D;  1AOI D;  4G92 B;  2VQR A;  5B2I A;  4YM6 A;  3LJA D;  5B0Z A;  2F8N H;  2UWX A;  5B31 G;  3WKJ C;  1EQZ C;  5CPK C;  3MGP C;  3TU4 D;  1P3B D;  1M19 C;  5GT3 A;  5AV5 C;  3REI A;  3REK B;  4WU8 D;  1M18 B;  1P3A C;  3VH6 W;  3AZE C;  1HQ3 D;  5B24 A;  3AZH B;  4G92 C;  3MNN C;  4XUJ A;  2HIO A;  1P34 C;  3KXB A;  2L5A A;  3B6F B;  5B1L B;  3X1U D;  4Z66 A;  3VH5 W;  1F66 B;  2BYK B;  5JRG D;  5B0Y A;  1AOI A;  1ID3 D;  2Y2L A;  4J8X A;  3AZM D;  3B6G D;  5F99 C;  3AZJ D;  2JSS A;  4QLC A;  3C1C B;  1S32 A;  3A1K A;  3MGR C;  5BS7 A;  4DRB A;  5AV9 C;  2HUE C;  3REK C;  4WZS B;  1P3B A;  3WTP D;  1KX5 D;  4Z2M H;  3A6N B;  1P3L A;  5GSU D;  3R45 A;  1U35 A;  5CP6 B;  1F66 C;  1HQ3 A;  5FUG B;  4NE3 A;  3W97 D;  3X1U A;  2ARO A;  3UTA B;  5JRG A;  3P5J B;  3EPJ A;  3AZG B;  5CPI A;  1KX3 D;  1BH8 B;  3F6T A;  3AZE D;  3X1V A;  4CSR A;  3W99 C;  5AVC A;  2CWE A;  4Z5T B;  3AZM A;  1P3M B;  5DNN B;  3AZJ A;  4R8P B;  1KU5 A;  5B31 B;  3MNN D;  3B6G A;  4LD9 D;  3AFA A;  5AY8 B;  5AV6 B;  3W98 D;  5B2I C;  3REL A;  3AZL D;  3AZF A;  4J8W B;  3WTP A;  1KX5 A;  3V9R A;  3LJA B;  3VH5 A;  3AYW D;  5B33 D;  5GSU A;  3C1B D;  1P3K D;  3UTA C;  3REI C;  3NQU A;  5CPJ B;  3WA9 A;  3KFU G;  5AVB D;  3TU4 B;  3VH6 T;  4JJN A;  4J8V A;  3AV2 B;  2F8N B;  3MGQ B;  3EPK A;  2FFF B;  2HIO C;  5AY8 C;  4XUJ C;  3LZ0 A;  4WU8 B;  3LEL D;  2CV5 B;  5BNV B;  5C3I C;  5B0Y C;  3REH D;  1AOI C;  4LD9 A;  5E5A D;  1B67 A;  3W98 A;  3LJA C;  3NQJ A;  4YS3 B;  2F8N D;  4QLC C;  3AZL A;  2NZD A;  1S32 C;  3AN2 D;  1ID3 B;  4DRA A;  2Y2J A;  2YFV A;  5B33 A;  1P3B C;  5B40 B;  5B2I D;  4YM6 D;  5B0Z D;  3W96 A;  5GXQ A;  3A1I A;  1P3K A;  2F8N G;  5AVB A;  3KSY A;  1U35 C;  4H9Q A;  1HQ3 C;  1BFM A;  5GT3 D;  3WKJ B;  3LEL A;  3X1U C;  1Q9C A;  2ARO C;  4UPK A;  1EQZ B;  5CPK B;  3MGP B;  5CPI C;  5JRG C;  3LZ1 A;  3REH A;  1ID3 C;  3W97 B;  5E5A A;  2BYM B;  5B24 D;  5AV5 B;  3AZM C;  3UT9 A;  1W2E A;  5BO0 A;  4CAY A;  3AZJ C;  2F8N A;  3B6G C;  3KXB D;  3AFA C;  4Z66 D;  1KX3 B;  1P3A B;  3REL C;  3AZE B;  5GT0 D;  2RVQ D;  5BNX A;  3MNN B;  4H9O B;  1P34 B;  5KDM B;  3WTP C;  4J8X D;  3AZK A;  5BT1 C;  4QLC D;  3AV1 A;  3X1T A;  1KX5 C;  1S32 D;  1T3U A;  5GSU C;  1JFI B;  1ZLA A;  5F99 B;  3X1S A;  4KUD A;  5B32 A;  3WA9 C;  3AYW B;  3W97 C;  3MGR B;  1P3L D;  3C1B B;  1R4V A;  3B0D C;  2ZY3 A;  5AV9 B;  4G91 C;  2HUE B;  4J8V C;  5AV8 D;  1WWS A;  4Z2M G;  3B0C W;  1KX3 C;  3LZ0 C;  1U35 D;  1A7W A;  1P3P D;  4LD9 C;  3O62 D;  2Y2P A;  2ARO D;  2F8N K;  3REJ A;  4WU9 A;  3W98 C;  5CPI D;  3AZL C;  1N1J B;  2NZD C;  5GT0 A;  3KUY D;  3X1V D;  2ZY5 A;  4H9N B;  4M6B A;  4HGA C;  5AVC D;  2NQB A;  4UUZ A;  2PYO A;  3H0M C;  3AFA D;  3AYW C;  5B33 C;  3C1B C;  3REL D;  3AN2 B;  3W96 C;  3W99 B;  5GXQ C;  2DF4 C;  4AWL C;  3AZF D;  1P3K C;  4WNN A;  4XZQ D;  5AVB C;  5BT1 D;  5DNN A;  1TZY A;  5B2I B;  4YM6 B;  5B0Z B;  3WAA A;  3KWQ D;  3EPL A;  1KX4 A;  5AV8 A;  3MGS D;  1P3O D;  2JCH A;  3LEL C;  2FJ7 D;  1P3F A;  2ZY4 A;  1P3P A;  3WA9 D;  3REH C;  2W8S A;  4JJN D;  2Y2H A;  5E5A C;  1H3O A;  5GT3 B;  3O62 A;  4J8V D;  1M1A D;  3UTB A;  3REI B;  3UT9 C;  2Y2M A;  4ZUX D;  3LZ0 D;  3KUY A;  2YFW A;  5B2J D;  3AN2 C;  3AZI D;  5B24 B;  1P3I A;  2DQN C;  1P3G A;  4XUJ B;  2HIO B;  3KXB B;  1BH9 A;  4Z66 B;  4YM6 C;  5B0Z C;  4KGC A;  3AV1 C;  2NZD D;  4X23 D;  5C3I B;  5B0Y B;  2Y2N A;  1AOI B;  4XZQ A;  2G5H C;  4J8X B;  4KUD C;  4QLC B;  3KWQ A;  1S32 B;  3MGS A;  5GT3 C;  3MVD D;  1P3O A;  3W96 D;  5GXQ D;  2FJ7 A;  3B0C T;  1P3B B;  5G49 A;  5DNM A;  3AZN A;  5B24 C;  1M1A A;  4KHA A;  4ZUX A;  3KXB C;  3R45 B;  3VH5 T;  4H9P A;  4ZBJ C;  5B2J A;  4Z66 C;  1U35 B;  2LY8 A;  3AZI A;  1HQ3 B;  5B1M A;  3LZ1 D;  5GT0 C;  5JA4 A;  2RVQ C;  4J8U A;  4J8X C;  3X1U B;  3UT9 D;  2ARO B;  4X23 A;  5JRG B;  5CPI B;  2JE5 A;  1TAF A;  5BS7 C;  3X1V B;  4CSR B;  1M19 A;  5AVC B;  3AZM B;  1M18 D;  3B6G B;  3AZJ B;  3AZH D;  3AFA B;  3AZK D;  3MVD A;  3X1T D;  1TZY C;  3AV1 D;  3REL B;  1P3L C;  5B1L D;  1KX4 C;  5AV8 C;  1ZLA D;  3WTP B;  4KUD D;  3X1S D;  1KX5 B;  1P3P C;  3V9R B;  5KDM A;  5B32 D;  5GSU B;  3C1C D;  3O62 C;  2XD5 A;  3UTB C;  3NQU B;  3WA9 B;  3KUY C;  3X1V C;  3B0D B;  4JJN B;  5AVC C;  3FDD A;  4G91 B;  4J8V B;  5B32 G;  3LZ0 B;  3REK A;  3REJ D;  4WU9 D;  3IP4 C;  4KGC C;  4H9R B;  1M18 A;  3AZF C;  4LD9 B;  3AZH A;  4XZQ C;  2NQB D;  2PYO D;  3W98 B;  3B6F A;  3NQJ B;  5B1L A;  3KWQ C;  3AZL B;  2NZD B;  4EO5 B;  1F66 A;  2BYK A;  3MGS C;  1P3O C;  3AZG D;  4HGA B;  2Y2Q A;  1Z2C B;  2FJ7 C;  1F1E A;  2YFV B;  5B33 B;  1P3M D;  5DNN D;  4R8P D;  1TZY D;  3C1C A;  1WWI A;  4JJN C;  3W96 B;  3WAA D;  5GXQ B;  5AV6 D;  4AWL B;  3AZN C;  1KX4 D;  1P3K B;  1M1A C;  5CHL B;  4NE5 A;  4ZUX C;  5AVB B;  4J8W D;  5B2J C;  1P3F D;  4H9Q B;  3AZI C;  5B1M C;  3A6N A;  1PZR A;  2ZM5 A;  4J8U C;  3LEL B;  3UTB D;  2BG1 A;  4X23 C;  4EO5 C;  5CP6 A;  3LZ1 B;  3REH B;  5FUG A;  2RIQ A;  5CPJ D;  5E5A B;  3H0L C;  2Y2K A;  1P3I D;  3UT9 B;  5BO0 B;  4CAY B;  1P3G D;  3AV2 D; 
#chains in the Genus database with same CATH homology
 3MGQ D;  3UTA A;  2IO5 B;  3MVD C;  3AZG A;  4KGC D;  1BH8 A;  2CV5 D;  1ULY A;  4Z5T A;  5BNX B;  1P3M A;  4R8P A;  5B31 A;  3AZK B;  3AV1 B;  5AY8 A;  5AV6 A;  3X1T B;  4YS3 D;  2Y2O A;  4J8W A;  1ZLA B;  4KUD B;  3X1S B;  2Y2G A;  3LZ1 C;  5B32 B;  3LJA A;  3H0R C;  5DNM D;  3AZN D;  5B40 D;  2IO5 C;  5CPJ A;  4NE6 A;  5B1M D;  3TU4 A;  1M18 C;  3AZH C;  4NFT A;  4J8U D;  3MGQ A;  3AV2 A;  3AZK C;  4ZBJ B;  3REJ B;  3X1T C;  4WU9 B;  3B6F C;  3B0B A;  3WKJ D;  4WU8 A;  5B1L C;  5GT0 B;  2CV5 A;  1EQZ D;  5BNV A;  5CPK D;  3MGP D;  1M19 D;  1ZLA C;  2PYO B;  4UUZ B;  3X1S C;  2NQB B;  5B32 C;  4H9S A;  5AV5 D;  4YS3 A;  3C1C C;  4E45 A;  3AL0 C;  1ID3 A;  1P3A D;  4WNN B;  2ZY2 A;  1TZY B;  1P34 D;  1P3L B;  5B40 A;  3WAA B;  3WTP E;  1KX4 B;  3A6N C;  4WJ3 C;  5AV8 B;  3VH6 A;  3EG5 B;  3REJ C;  4WU9 C;  1P3F B;  1P3P B;  5F99 D;  1B6W A;  1HTA A;  5CP6 C;  4E44 A;  1H3O B;  3O62 B;  2PYO C;  2NQB C;  3MGR D;  3WKJ A;  3UTB B;  5AV9 D;  4WV4 B;  3REK D;  2G5I C;  3KUY B;  1EQZ A;  2YFW B;  3MGP A;  2F2A C;  5CPK A;  3AZG C;  3W97 A;  2BYM A;  1P3I B;  5AV5 A;  4Z5T C;  1P3G B;  1P3M C;  5DNN C;  4R8P C;  3B6F D;  5B31 C;  1BH9 B;  3WAA C;  4KGC B;  1KX3 A;  5AV6 C;  1P3A A;  3AZF B;  1F66 D;  3AZE A;  4H9R A;  4XZQ B;  4J8W C;  2Y2I A;  3MNN A;  4H9O A;  1P34 A;  1P3F C;  3KWQ B;  3MGS B;  1P3O B;  1JFI A;  2FJ7 B;  3W99 D;  5F99 A;  5G49 B;  5CPJ C;  3AYW A;  5DNM B;  3MGR A;  3TU4 C;  3AZN B;  3A6N D;  2XD1 A;  3C1B A;  1P3I C;  1M1A B;  4KHA B;  5AV9 A;  1P3G C;  4ZUX B;  3AV2 C;  3MGQ C;  4H9P B;  5B2J B;  4DQY B;  3AZI B;  5B1M B;  5CP6 D;  4WU8 C;  2CV5 C;  5JA4 B;  4J8U B;  2J8P A;  4X23 B;  4H9S C;  3UTA D;  4YS3 C;  3REI D;  1TAF B;  1N1J A;  4H9N A;  1M19 B;  3EPH A;  4Z5T D;  5B31 D;  3MVD B;  5AY8 D;  2HIO D;  4XUJ D;  5DNM C;  5B40 C;  3AN2 A;  3W99 A;  5B0Y D;  1AOI D;  4G92 B;  2VQR A;  5B2I A;  4YM6 A;  3LJA D;  5B0Z A;  2F8N H;  2UWX A;  5B31 G;  3WKJ C;  1EQZ C;  5CPK C;  3MGP C;  3TU4 D;  1P3B D;  1M19 C;  5GT3 A;  5AV5 C;  3REI A;  3REK B;  4WU8 D;  1M18 B;  1P3A C;  3VH6 W;  3AZE C;  1HQ3 D;  5B24 A;  3AZH B;  4G92 C;  3MNN C;  4XUJ A;  2HIO A;  1P34 C;  3KXB A;  2L5A A;  3B6F B;  5B1L B;  3X1U D;  4Z66 A;  3VH5 W;  1F66 B;  2BYK B;  5JRG D;  5B0Y A;  1AOI A;  1ID3 D;  2Y2L A;  4J8X A;  3AZM D;  3B6G D;  5F99 C;  3AZJ D;  2JSS A;  4QLC A;  3C1C B;  1S32 A;  3A1K A;  3MGR C;  5BS7 A;  4DRB A;  5AV9 C;  2HUE C;  3REK C;  4WZS B;  1P3B A;  3WTP D;  1KX5 D;  4Z2M H;  3A6N B;  1P3L A;  5GSU D;  3R45 A;  1U35 A;  5CP6 B;  1F66 C;  1HQ3 A;  5FUG B;  4NE3 A;  3W97 D;  3X1U A;  2ARO A;  3UTA B;  5JRG A;  3P5J B;  3EPJ A;  3AZG B;  5CPI A;  1KX3 D;  1BH8 B;  3F6T A;  3AZE D;  3X1V A;  4CSR A;  3W99 C;  5AVC A;  2CWE A;  4Z5T B;  3AZM A;  1P3M B;  5DNN B;  3AZJ A;  4R8P B;  1KU5 A;  5B31 B;  3MNN D;  3B6G A;  4LD9 D;  3AFA A;  5AY8 B;  5AV6 B;  3W98 D;  5B2I C;  3REL A;  3AZL D;  3AZF A;  4J8W B;  3WTP A;  1KX5 A;  3V9R A;  3LJA B;  3VH5 A;  3AYW D;  5B33 D;  5GSU A;  3C1B D;  1P3K D;  3UTA C;  3REI C;  3NQU A;  5CPJ B;  3WA9 A;  3KFU G;  5AVB D;  3TU4 B;  3VH6 T;  4JJN A;  4J8V A;  3AV2 B;  2F8N B;  3MGQ B;  3EPK A;  2FFF B;  2HIO C;  5AY8 C;  4XUJ C;  3LZ0 A;  4WU8 B;  3LEL D;  2CV5 B;  5BNV B;  5C3I C;  5B0Y C;  3REH D;  1AOI C;  4LD9 A;  5E5A D;  1B67 A;  3W98 A;  3LJA C;  3NQJ A;  4YS3 B;  2F8N D;  4QLC C;  3AZL A;  2NZD A;  1S32 C;  3AN2 D;  1ID3 B;  4DRA A;  2Y2J A;  2YFV A;  5B33 A;  1P3B C;  5B40 B;  5B2I D;  4YM6 D;  5B0Z D;  3W96 A;  5GXQ A;  3A1I A;  1P3K A;  2F8N G;  5AVB A;  3KSY A;  1U35 C;  4H9Q A;  1HQ3 C;  1BFM A;  5GT3 D;  3WKJ B;  3LEL A;  3X1U C;  1Q9C A;  2ARO C;  4UPK A;  1EQZ B;  5CPK B;  3MGP B;  5CPI C;  5JRG C;  3LZ1 A;  3REH A;  1ID3 C;  3W97 B;  5E5A A;  2BYM B;  5B24 D;  5AV5 B;  3AZM C;  3UT9 A;  1W2E A;  5BO0 A;  4CAY A;  3AZJ C;  2F8N A;  3B6G C;  3KXB D;  3AFA C;  4Z66 D;  1KX3 B;  1P3A B;  3REL C;  3AZE B;  5GT0 D;  2RVQ D;  5BNX A;  3MNN B;  4H9O B;  1P34 B;  5KDM B;  3WTP C;  4J8X D;  3AZK A;  5BT1 C;  4QLC D;  3AV1 A;  3X1T A;  1KX5 C;  1S32 D;  1T3U A;  5GSU C;  1JFI B;  1ZLA A;  5F99 B;  3X1S A;  4KUD A;  5B32 A;  3WA9 C;  3AYW B;  3W97 C;  3MGR B;  1P3L D;  3C1B B;  1R4V A;  3B0D C;  2ZY3 A;  5AV9 B;  4G91 C;  2HUE B;  4J8V C;  5AV8 D;  1WWS A;  4Z2M G;  3B0C W;  1KX3 C;  3LZ0 C;  1U35 D;  1A7W A;  1P3P D;  4LD9 C;  3O62 D;  2Y2P A;  2ARO D;  2F8N K;  3REJ A;  4WU9 A;  3W98 C;  5CPI D;  3AZL C;  1N1J B;  2NZD C;  5GT0 A;  3KUY D;  3X1V D;  2ZY5 A;  4H9N B;  4M6B A;  4HGA C;  5AVC D;  2NQB A;  4UUZ A;  2PYO A;  3H0M C;  3AFA D;  3AYW C;  5B33 C;  3C1B C;  3REL D;  3AN2 B;  3W96 C;  3W99 B;  5GXQ C;  2DF4 C;  4AWL C;  3AZF D;  1P3K C;  4WNN A;  4XZQ D;  5AVB C;  5BT1 D;  5DNN A;  1TZY A;  5B2I B;  4YM6 B;  5B0Z B;  3WAA A;  3KWQ D;  3EPL A;  1KX4 A;  5AV8 A;  3MGS D;  1P3O D;  2JCH A;  3LEL C;  2FJ7 D;  1P3F A;  2ZY4 A;  1P3P A;  3WA9 D;  3REH C;  2W8S A;  4JJN D;  2Y2H A;  5E5A C;  1H3O A;  5GT3 B;  3O62 A;  4J8V D;  1M1A D;  3UTB A;  3REI B;  3UT9 C;  2Y2M A;  4ZUX D;  3LZ0 D;  3KUY A;  2YFW A;  5B2J D;  3AN2 C;  3AZI D;  5B24 B;  1P3I A;  2DQN C;  1P3G A;  4XUJ B;  2HIO B;  3KXB B;  1BH9 A;  4Z66 B;  4YM6 C;  5B0Z C;  4KGC A;  3AV1 C;  2NZD D;  4X23 D;  5C3I B;  5B0Y B;  2Y2N A;  1AOI B;  4XZQ A;  2G5H C;  4J8X B;  4KUD C;  4QLC B;  3KWQ A;  1S32 B;  3MGS A;  5GT3 C;  3MVD D;  1P3O A;  3W96 D;  5GXQ D;  2FJ7 A;  3B0C T;  1P3B B;  5G49 A;  5DNM A;  3AZN A;  5B24 C;  1M1A A;  4KHA A;  4ZUX A;  3KXB C;  3R45 B;  3VH5 T;  4H9P A;  4ZBJ C;  5B2J A;  4Z66 C;  1U35 B;  2LY8 A;  3AZI A;  1HQ3 B;  5B1M A;  3LZ1 D;  5GT0 C;  5JA4 A;  2RVQ C;  4J8U A;  4J8X C;  3X1U B;  3UT9 D;  2ARO B;  4X23 A;  5JRG B;  5CPI B;  2JE5 A;  1TAF A;  5BS7 C;  3X1V B;  4CSR B;  1M19 A;  5AVC B;  3AZM B;  1M18 D;  3B6G B;  3AZJ B;  3AZH D;  3AFA B;  3AZK D;  3MVD A;  3X1T D;  1TZY C;  3AV1 D;  3REL B;  1P3L C;  5B1L D;  1KX4 C;  5AV8 C;  1ZLA D;  3WTP B;  4KUD D;  3X1S D;  1KX5 B;  1P3P C;  3V9R B;  5KDM A;  5B32 D;  5GSU B;  3C1C D;  3O62 C;  2XD5 A;  3UTB C;  3NQU B;  3WA9 B;  3KUY C;  3X1V C;  3B0D B;  4JJN B;  5AVC C;  3FDD A;  4G91 B;  4J8V B;  5B32 G;  3LZ0 B;  3REK A;  3REJ D;  4WU9 D;  3IP4 C;  4KGC C;  4H9R B;  1M18 A;  3AZF C;  4LD9 B;  3AZH A;  4XZQ C;  2NQB D;  2PYO D;  3W98 B;  3B6F A;  3NQJ B;  5B1L A;  3KWQ C;  3AZL B;  2NZD B;  4EO5 B;  1F66 A;  2BYK A;  3MGS C;  1P3O C;  3AZG D;  4HGA B;  2Y2Q A;  1Z2C B;  2FJ7 C;  1F1E A;  2YFV B;  5B33 B;  1P3M D;  5DNN D;  4R8P D;  1TZY D;  3C1C A;  1WWI A;  4JJN C;  3W96 B;  3WAA D;  5GXQ B;  5AV6 D;  4AWL B;  3AZN C;  1KX4 D;  1P3K B;  1M1A C;  5CHL B;  4NE5 A;  4ZUX C;  5AVB B;  4J8W D;  5B2J C;  1P3F D;  4H9Q B;  3AZI C;  5B1M C;  3A6N A;  1PZR A;  2ZM5 A;  4J8U C;  3LEL B;  3UTB D;  2BG1 A;  4X23 C;  4EO5 C;  5CP6 A;  3LZ1 B;  3REH B;  5FUG A;  2RIQ A;  5CPJ D;  5E5A B;  3H0L C;  2Y2K A;  1P3I D;  3UT9 B;  5BO0 B;  4CAY B;  1P3G D;  3AV2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...