3WA9C

The nucleosome containing human h2a.z.1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
KAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wa9C00
1S32A 3TU4D 2F8NB 5G49A 3VH5T 5B31B 3X1VB 2HUEB 5GXQA 1KX5D 1P3OA 4J8VD 3NQUB 1U35B 1R4VA 4KGCD 3X1UA 3VH6T 3KUYC 2F8ND 2NQBC 3KWQC 1P34B 3NQJB 5BNVB 3AZJD 4KHAA 3AZGA 1WWIA 3AV1B 5B2IB 4ZUXB 1TZYC 4ZBJB 4J8UA 3LJAB 3MGRC 3AZMB 3REJC 1P34D 5BS7C 5GSUA 4EO5C 3C1BC 2AROD 2NZDC 5CPKA 1N1JB 4YS3B 4LD9C 5B32B 1KX3B 2YFVB 3AV1D 1ID3B 5KDMB 3LJAD 3R45B 3V9RB 3WAAB 4YS3D 3MVDA 1ID3D 1JFIB 3MNNB 4JJNC 5GT3B 4H9OA 3REIC 5AV5D 5JRGA 4H9SC 4HGAC 3WAAD 3AN2D 5E5AD 1F1EA 2HIOB 3O62C 4H9NB 3B6FC 3AZIB 1M18A 2PYOD 5C3IB 4XZQB 3AV2B 3TU4A 3REKC 3MGQB 1BH9A 3AZHB 2F8NG 1P3MB 5CPIB 1KX5A 4J8VA 5B31G 3C1CC 3AZID 1P3GB 2YFWA 3A6ND 3B0DB 1M1AC 1TAFB 4WU9B 5AY8C 3AZHD 2LY8A 3AZJA 4DRBA 4XUJA 3AFAB 3UTAB 4X23B 3LZ0B 4J8XD 1P3AC 2F8NH 5AV8D 4R8PC 2CV5C 4WU9D 1P3IC 2AROA 1P3BD 3W99C 5DNMC 1S32B 5B33C 3B6GC 5G49B 1Q9CA 1EQZA 5GXQB 1KX4C 1P3OB 3UTBC 5B1LC 5AVBD 3RELA 4WU8C 3MGPD 4YM6D 3MGSC 5B0ZD 3X1UB 1M19C 5AVCC 3W96C 5AV5A 3AZGB 3AN2A 5CP6C 1P3LC 5B1MD 5E5AA 4J8UB 1HQ3C 1BH8A 2PYOA 3WA9C 5CPKB 3AZGD 3WKJC 3REHC 2F8NK 5B24D 3B0BA 1ZLAD 3LELD 4J8UD 5B40B 5BS7A 3AZEC 2NZDA 5GSUD 4NE6A 3A6NA 2FJ7C 3AZND 4J8XA 4H9OB 3X1TC 5AV8A 3W97D 3AZLD 4Z66D 5JRGB 1P3FA 2RVQD 5AV6C 1B6WA 3MVDD 5DNNC 4J8WD 3REIA 5AV9A 4G92B 1P3BA 1M18B 2IO5B 4H9SA 3TU4B 5JRGD 3X1SD 5B0YC 4KUDA 1BH9B 3WTPC 1KX5B 4J8VB 4KGCC 5AVBA 5F99D 3MGPA 3W98A 3AZKD 4YM6A 5B0ZA 2YFWB 5B31C 3X1VC 2HUEC 1AOID 3AZJB 4XUJB 1U35C 4CAYA 1F66A 5B1MA 3KXBD 1P34C 3LZ1D 3UT9A 4XUJD 2AROB 3AV1C 5B2IC 3B0CW 4ZUXC 4UUZA 4ZBJC 3LJAC 1P3PD 5B24A 3AZMC 1ZLAA 3LELA 1EQZB 5B2JD 4YS3C 3RELB 5B32C 1KX3C 5GT0D 1ID3C 4Z5TD 3AZNA 4QLCD 5BO0A 1EQZD 5AV5B 3WAAC 3W97A 3AZLA 4Z66A 2FJ7D 3RELD 3AZFA 1ULYA 3AN2B 5E5AB 1M19A 4NE5A 3MNNC 5AVCA 5GT3C 4J8WA 1P3KA 1BH8B 2PYOB 3X1SA 2HIOC 3KUYD 2NQBD 3AZIC 5C3IC 5F99A 4XZQC 3AV2C 4H9RA 3AZKA 5CPJA 3A6NB 3MGQC 3AZHC 1P3MC 1AOIA 5CPIC 1TZYD 5BT1D 3MGRD 3REJD 4CSRA 4J8XB 1P3GC 5AV8B 2NZDD 3B0DC 3KXBA 4WU9C 1P3FB 3AYWA 3AFAC 3UTAC 3LZ1A 4X23C 3LZ0C 5AV9B 1P3BB 1P3PA 4KUDB 1P3FD 5FUGA 5B2JA 5AVBB 3REID 5AV9D 5CHLB 3MGPB 1S32C 3W98B 5GT0A 4YM6B 5B0ZB 4H9PA 4Z5TA 5GXQC 4QLCA 4H9QA 3O62D 1P3OC 4KUDD 1H3OA 4CAYB 2FJ7A 3X1UC 1F66B 3W98D 5B1MB 3REKD 3NQUA 3UT9B 3AZGC 4AWLB 3C1CD 4KHAB 1M1AD 3KUYA 1F66D 2NQBA 4UUZB 3KWQA 4J8UC 5BNVA 5AY8D 5B24B 1ZLAB 3LELB 5CPKC 3UT9D 5GSUB 1P3AD 4ZUXA 4R8PD 1TZYA 2CV5D 3MGRA 3AZNB 5B40C 1P3ID 3REJA 1BFMA 5BO0B 1N1JA 4G91B 3C1BA 1KX3A 3AZLB 3W97B 4Z66B 5JA4A 4LD9A 3AZFB 4WNNA 3MVDB 4J8WB 1P3KB 3UTBD 5JRGC 5B1LD 4WU8D 3AZFD 3X1SB 3MGSD 1M19D 4JJNA 4NE3A 2BYMA 5AVCD 3VH5W 4G92C 1M18C 2IO5C 5F99B 1P3KD 4H9RB 3TU4C 3AZKB 5CPJB 5CP6D 1P3LD 1AOIB 1KX5C 3O62A 4J8VC 3VH6W 4XZQA 3B6FA 1HQ3D 4CSRB 3WA9D 3WTPE 3KXBB 5CPJD 3WKJD 3REKA 3REHD 3AZJC 3AYWB 4XUJC 3LZ1B 4E44A 3C1CA 1M1AA 5AY8A 1P3PB 5FUGB 3AYWD 2AROC 5B2JB 4M6BA 3X1TD 1P3AA 5GT0B 4R8PA 2CWEA 4DRAA 4H9PB 4Z5TB 2CV5A 1P3IA 5AV6D 1EQZC 4QLCB 4H9QB 5DNND 3RELC 1H3OB 3VH5A 2FJ7B 3W99A 5DNMA 5B33A 5B0YD 3KSYA 3B6GA 3WTPD 1KX4A 5AV5C 3UTBA 3VH6A 5B1LA 4WU8A 3AN2C 3MGSA 5E5AC 3KUYB 2NQBB 3KWQB 5B31D 3X1VD 2PYOC 3W96A 2JSSA 1U35D 5CP6A 5BT1C 1P3LA 1TZYB 3KWQD 3MGRB 1HQ3A 1KU5A 3REJB 3WA9A 4EO5B 3C1BB 3A6NC 2NZDB 5JA4B 5B2ID 4LD9B 3WKJA 4ZUXD 3REHA 4WNNB 5B40A 3AZMD 4J8XC 3B0CT 5AV8C 3AZEA 5B32D 3C1BD 1KX3D 1P3FC 4LD9D 4JJNB 5AV9C 2BYMB 1P3BC 3X1TA 3REIB 4HGAB 1A7WA 4KUDC 5AV6A 3MNND 3O62B 4WV4B 5GT3D 5DNNA 5AVBC 4JJND 3B6FB 3MGPC 2BYKA 3W98C 4YM6C 5B0ZC 5B0YA 3REKB 2HIOD 3WTPA 5BNXA 4KGCA 4XZQD 3AV2D 3C1CB 3B6FD 1F66C 5B1MC 2F8NA 1M1AB 3MGQD 5B31A 1P3MD 5AY8B 3X1VA 5CPID 3UT9C 1U35A 4AWLC 1P3AB 1P3GD 4R8PB 5B24C 1P34A 2CV5B 1ZLAC 3LELC 3NQJA 1P3IB 3AFAD 3UTAD 4X23D 3LZ0D 5GSUC 3AV1A 5B2IA 3W99B 5B32G 5DNMB 5B33B 3LJAA 4WZSB 3AZNC 3AZMA 3B6GB 4G91C 1KX4B 3UTBB 3AZLC 3W97C 4Z66C 4YS3A 5B1LB 5B32A 4WU8B 3AZFC 2YFVA 1S32D 2RVQC 3W99D 1ID3A 3MGSB 5DNMD 3MVDC 5KDMA 5B33D 1M19B 4J8WC 5GXQD 5AVCB 3B6GD 3R45A 1P3KC 1P3OD 3W96B 1KX4D 3V9RA 3WAAA 3X1SC 5CP6B 3X1UD 1P3LB 1JFIA 3MNNA 5GT3A 1WWSA 5F99C 1HQ3B 3AZKC 3W96D 3WA9B 5CPJC 3WKJB 1AOIC 2HIOA 3REHB 1B67A 1HTAA 4H9NA 3AZIA 3AV2A 4Z2MG 3AZEB 3KXBC 5CPKD 3MGQA 4NFTA 3AZHA 1P3MA 3AYWC 5CPIA 2L5AA 3LZ1C 5B40D 4E45A 3X1TB 1P3GA 3AZED 1TAFA 4WU9A 1P3PC 4Z2MH 5AV6B 3AFAA 3UTAA 5B2JC 5DNNB 4X23A 3LZ0A 2BYKB 5GT0C 4Z5TC 5B0YB 4QLCC 3WTPB 5BNXB 4KGCB 1M18D
chains in the Genus database with same CATH superfamily
1S32A 3TU4D 2F8NB 2Y2OA 5G49A 3VH5T 5B31B 3X1VB 2HUEB 5GXQA 1KX5D 1P3OA 4J8VD 3NQUB 1U35B 1R4VA 4KGCD 3X1UA 3VH6T 3KUYC 2F8ND 2NQBC 3KWQC 1P34B 2ZY2A 3NQJB 5BNVB 3AZJD 4KHAA 3AZGA 1WWIA 3AV1B 5B2IB 2F2AC 4ZUXB 1TZYC 4ZBJB 4J8UA 3LJAB 3MGRC 3AZMB 3REJC 1P34D 2ZY3A 5BS7C 5GSUA 4EO5C 3C1BC 2AROD 2NZDC 5CPKA 1N1JB 4YS3B 2G5IC 4LD9C 5B32B 3IP4C 1KX3B 2YFVB 3AV1D 1ID3B 5KDMB 3LJAD 3R45B 3V9RB 3WAAB 4YS3D 3MVDA 1ID3D 1JFIB 3MNNB 4JJNC 5GT3B 4H9OA 3REIC 5AV5D 5JRGA 4H9SC 4HGAC 3WAAD 3AN2D 5E5AD 1F1EA 2HIOB 3O62C 4H9NB 3B6FC 3AZIB 2UWXA 1M18A 5C3IB 4XZQB 3AV2B 2PYOD 3TU4A 2Y2HA 3REKC 3MGQB 1BH9A 3AZHB 2F8NG 1P3MB 5CPIB 1KX5A 4J8VA 5B31G 1W2EA 3FDDA 3C1CC 3AZID 2VQRA 1P3GB 2YFWA 3A6ND 3B0DB 1M1AC 1TAFB 4WU9B 5AY8C 3AZHD 2LY8A 3AZJA 4DRBA 4XUJA 3AFAB 3UTAB 4X23B 3LZ0B 4J8XD 1P3AC 2F8NH 5AV8D 4R8PC 2CV5C 4WU9D 1P3IC 2AROA 1P3BD 3W99C 5DNMC 1S32B 2Y2NA 5B33C 3B6GC 5G49B 1Q9CA 1EQZA 5GXQB 1KX4C 1P3OB 3UTBC 5B1LC 5AVBD 3RELA 4WU8C 3MGPD 4YM6D 3MGSC 5B0ZD 3X1UB 1M19C 5AVCC 3W96C 5AV5A 3AZGB 3AN2A 5CP6C 1P3LC 5B1MD 5E5AA 4J8UB 1HQ3C 1BH8A 2PYOA 3WA9C 5CPKB 3AZGD 3WKJC 3REHC 2F8NK 5B24D 3B0BA 1ZLAD 3LELD 4J8UD 5B40B 5BS7A 3AZEC 2NZDA 5GSUD 4NE6A 3A6NA 3KFUG 2FJ7C 3AZND 4J8XA 4H9OB 3X1TC 5AV8A 3W97D 3EPLA 3AZLD 4Z66D 5JRGB 1P3FA 2RVQD 5AV6C 1B6WA 3MVDD 5DNNC 3A1IA 4J8WD 3REIA 5AV9A 4G92B 1P3BA 1M18B 2IO5B 4H9SA 3TU4B 5JRGD 3X1SD 5B0YC 4KUDA 1BH9B 3WTPC 1KX5B 4J8VB 4KGCC 5AVBA 5F99D 3MGPA 3W98A 3AZKD 4YM6A 5B0ZA 2YFWB 5B31C 3X1VC 2HUEC 1AOID 3AZJB 4XUJB 1U35C 4CAYA 1Z2CB 1F66A 5B1MA 3KXBD 1P34C 4UPKA 3LZ1D 3UT9A 4XUJD 3F6TA 2AROB 3AV1C 5B2IC 3B0CW 4ZUXC 4UUZA 4ZBJC 3LJAC 1P3PD 5B24A 3AZMC 1ZLAA 3LELA 1EQZB 5B2JD 2Y2KA 4YS3C 3RELB 5B32C 1KX3C 5GT0D 1ID3C 4Z5TD 3AZNA 4QLCD 5BO0A 1EQZD 5AV5B 3WAAC 3W97A 3AZLA 4Z66A 2FJ7D 3RELD 3AZFA 1ULYA 3AN2B 5E5AB 1M19A 4NE5A 3MNNC 5AVCA 5GT3C 4J8WA 1P3KA 1BH8B 2PYOB 3X1SA 3H0RC 2HIOC 3KUYD 2NQBD 4WJ3C 3AZIC 5C3IC 5F99A 4XZQC 3AV2C 4H9RA 3AZKA 2JE5A 5CPJA 3A6NB 3MGQC 3AZHC 1P3MC 1AOIA 5CPIC 1TZYD 5BT1D 3MGRD 3REJD 4CSRA 4J8XB 1P3GC 5AV8B 2NZDD 3B0DC 3KXBA 4WU9C 1P3FB 3P5JB 3AYWA 3AFAC 3UTAC 3LZ1A 4X23C 3LZ0C 5AV9B 1P3BB 1P3PA 4KUDB 1P3FD 5FUGA 5B2JA 5AVBB 3REID 5AV9D 5CHLB 3MGPB 1S32C 3W98B 5GT0A 4YM6B 5B0ZB 4H9PA 4Z5TA 5GXQC 4QLCA 4H9QA 3O62D 1P3OC 4KUDD 1H3OA 4CAYB 2FJ7A 3X1UC 1F66B 3W98D 5B1MB 3REKD 3NQUA 3UT9B 3AZGC 4AWLB 3C1CD 4KHAB 1M1AD 3KUYA 1F66D 2NQBA 4UUZB 3KWQA 4J8UC 5BNVA 5AY8D 5B24B 1ZLAB 3LELB 2DF4C 5CPKC 2Y2MA 2Y2JA 5GSUB 3UT9D 1P3AD 4ZUXA 4R8PD 1TZYA 2CV5D 3MGRA 3AZNB 5B40C 1P3ID 3REJA 1BFMA 5BO0B 1N1JA 4G91B 3C1BA 1KX3A 3AZLB 3W97B 2DQNC 2J8PA 2ZY4A 4Z66B 5JA4A 3AZFB 4LD9A 4WNNA 3MVDB 4J8WB 1P3KB 3UTBD 2JCHA 5B1LD 5JRGC 4WU8D 3AZFD 3X1SB 3MGSD 1M19D 4JJNA 4NE3A 2BYMA 5AVCD 3VH5W 4G92C 1M18C 2IO5C 5F99B 1P3KD 4H9RB 3TU4C 3AZKB 5CPJB 5CP6D 1P3LD 1AOIB 1KX5C 3O62A 4J8VC 3VH6W 4XZQA 3B6FA 1HQ3D 4CSRB 1PZRA 3WA9D 3WTPE 3KXBB 2Y2IA 5CPJD 2ZM5A 3WKJD 3REKA 3REHD 3AZJC 3AYWB 4XUJC 3LZ1B 4E44A 3C1CA 1M1AA 2RIQA 5AY8A 1P3PB 5FUGB 3AYWD 2AROC 5B2JB 4M6BA 3X1TD 1P3AA 5GT0B 4R8PA 2CWEA 4DRAA 4H9PB 4Z5TB 2CV5A 4DQYB 1P3IA 5AV6D 1EQZC 4QLCB 4H9QB 5DNND 3RELC 1H3OB 3VH5A 2FJ7B 3W99A 2Y2QA 5DNMA 5B33A 5B0YD 3KSYA 3B6GA 3WTPD 1KX4A 5AV5C 3UTBA 3VH6A 2Y2GA 5B1LA 4WU8A 3AN2C 3MGSA 5E5AC 3KUYB 2NQBB 3KWQB 5B31D 3X1VD 2PYOC 3W96A 2JSSA 1U35D 5CP6A 5BT1C 1P3LA 1TZYB 3KWQD 3MGRB 1HQ3A 1KU5A 3REJB 3H0LC 3WA9A 4EO5B 3C1BB 3A6NC 2NZDB 5JA4B 5B2ID 4LD9B 3WKJA 4ZUXD 3REHA 4WNNB 5B40A 3AL0C 3AZMD 4J8XC 3B0CT 5AV8C 3AZEA 2Y2PA 5B32D 3C1BD 1KX3D 1P3FC 4LD9D 2FFFB 4JJNB 5AV9C 2BYMB 1T3UA 1P3BC 3X1TA 3REIB 4HGAB 1A7WA 4KUDC 5AV6A 3MNND 3O62B 4WV4B 5GT3D 5DNNA 5AVBC 4JJND 3B6FB 3MGPC 2BYKA 3W98C 4YM6C 5B0ZC 5B0YA 3REKB 2HIOD 3WTPA 5BNXA 4KGCA 4XZQD 3AV2D 3C1CB 3B6FD 1F66C 5B1MC 2F8NA 1M1AB 3MGQD 5B31A 1P3MD 5AY8B 3X1VA 5CPID 3EG5B 3UT9C 1U35A 4AWLC 1P3AB 1P3GD 4R8PB 5B24C 1P34A 2CV5B 1ZLAC 3LELC 3NQJA 1P3IB 3AFAD 3UTAD 4X23D 3LZ0D 5GSUC 3AV1A 5B2IA 3W99B 5B32G 5DNMB 5B33B 3LJAA 4WZSB 3AZNC 3AZMA 2XD1A 3B6GB 4G91C 3EPKA 1KX4B 3UTBB 3AZLC 3W97C 4Z66C 4YS3A 5B1LB 5B32A 4WU8B 3AZFC 2YFVA 3A1KA 1S32D 2RVQC 3W99D 1ID3A 3MGSB 5DNMD 2W8SA 3MVDC 5KDMA 5B33D 1M19B 4J8WC 5GXQD 5AVCB 3B6GD 3R45A 1P3KC 1P3OD 3W96B 1KX4D 3V9RA 3WAAA 3X1SC 5CP6B 2BG1A 3X1UD 1P3LB 1JFIA 3MNNA 5GT3A 1WWSA 5F99C 1HQ3B 3AZKC 3W96D 3WA9B 5CPJC 2XD5A 3EPJA 3WKJB 1AOIC 2HIOA 3REHB 1B67A 1HTAA 4H9NA 3AZIA 3AV2A 4Z2MG 3AZEB 3KXBC 5CPKD 3MGQA 4NFTA 3AZHA 1P3MA 3AYWC 5CPIA 2L5AA 3LZ1C 3EPHA 5B40D 4E45A 3X1TB 1P3GA 2G5HC 3AZED 1TAFA 4WU9A 1P3PC 3H0MC 4Z2MH 5AV6B 3AFAA 3UTAA 5B2JC 5DNNB 4X23A 3LZ0A 2BYKB 5GT0C 2Y2LA 4Z5TC 5B0YB 4QLCC 3WTPB 2ZY5A 5BNXB 4KGCB 1M18D
chains in the Genus database with same CATH topology
1S32A 3TU4D 2F8NB 2Y2OA 5G49A 3VH5T 5B31B 3X1VB 2HUEB 5GXQA 1KX5D 1P3OA 4J8VD 3NQUB 1U35B 1R4VA 4KGCD 3X1UA 3VH6T 3KUYC 2F8ND 2NQBC 3KWQC 1P34B 2ZY2A 3NQJB 5BNVB 3AZJD 4KHAA 3AZGA 1WWIA 3AV1B 5B2IB 2F2AC 4ZUXB 1TZYC 4ZBJB 4J8UA 3LJAB 3MGRC 3AZMB 3REJC 1P34D 2ZY3A 5BS7C 5GSUA 4EO5C 3C1BC 2AROD 2NZDC 5CPKA 1N1JB 4YS3B 2G5IC 4LD9C 5B32B 3IP4C 1KX3B 2YFVB 3AV1D 1ID3B 5KDMB 3LJAD 3R45B 3V9RB 3WAAB 4YS3D 3MVDA 1ID3D 1JFIB 3MNNB 4JJNC 5GT3B 4H9OA 3REIC 5AV5D 5JRGA 4H9SC 4HGAC 3WAAD 3AN2D 5E5AD 1F1EA 2HIOB 3O62C 4H9NB 3B6FC 3AZIB 2UWXA 1M18A 5C3IB 4XZQB 3AV2B 2PYOD 3TU4A 2Y2HA 3REKC 3MGQB 1BH9A 3AZHB 2F8NG 1P3MB 5CPIB 1KX5A 4J8VA 5B31G 1W2EA 3FDDA 3C1CC 3AZID 2VQRA 1P3GB 2YFWA 3A6ND 3B0DB 1M1AC 1TAFB 4WU9B 5AY8C 3AZHD 2LY8A 3AZJA 4DRBA 4XUJA 3AFAB 3UTAB 4X23B 3LZ0B 4J8XD 1P3AC 2F8NH 5AV8D 4R8PC 2CV5C 4WU9D 1P3IC 2AROA 1P3BD 3W99C 5DNMC 1S32B 2Y2NA 5B33C 3B6GC 5G49B 1Q9CA 1EQZA 5GXQB 1KX4C 1P3OB 3UTBC 5B1LC 5AVBD 3RELA 4WU8C 3MGPD 4YM6D 3MGSC 5B0ZD 3X1UB 1M19C 5AVCC 3W96C 5AV5A 3AZGB 3AN2A 5CP6C 1P3LC 5B1MD 5E5AA 4J8UB 1HQ3C 1BH8A 2PYOA 3WA9C 5CPKB 3AZGD 3WKJC 3REHC 2F8NK 5B24D 3B0BA 1ZLAD 3LELD 4J8UD 5B40B 5BS7A 3AZEC 2NZDA 5GSUD 4NE6A 3A6NA 3KFUG 2FJ7C 3AZND 4J8XA 4H9OB 3X1TC 5AV8A 3W97D 3EPLA 3AZLD 4Z66D 5JRGB 1P3FA 2RVQD 5AV6C 1B6WA 3MVDD 5DNNC 3A1IA 4J8WD 3REIA 5AV9A 4G92B 1P3BA 1M18B 2IO5B 4H9SA 3TU4B 5JRGD 3X1SD 5B0YC 4KUDA 1BH9B 3WTPC 1KX5B 4J8VB 4KGCC 5AVBA 5F99D 3MGPA 3W98A 3AZKD 4YM6A 5B0ZA 2YFWB 5B31C 3X1VC 2HUEC 1AOID 3AZJB 4XUJB 1U35C 4CAYA 1Z2CB 1F66A 5B1MA 3KXBD 1P34C 4UPKA 3LZ1D 3UT9A 4XUJD 3F6TA 2AROB 3AV1C 5B2IC 3B0CW 4ZUXC 4UUZA 4ZBJC 3LJAC 1P3PD 5B24A 3AZMC 1ZLAA 3LELA 1EQZB 5B2JD 2Y2KA 4YS3C 3RELB 5B32C 1KX3C 5GT0D 1ID3C 4Z5TD 3AZNA 4QLCD 5BO0A 1EQZD 5AV5B 3WAAC 3W97A 3AZLA 4Z66A 2FJ7D 3RELD 3AZFA 1ULYA 3AN2B 5E5AB 1M19A 4NE5A 3MNNC 5AVCA 5GT3C 4J8WA 1P3KA 1BH8B 2PYOB 3X1SA 3H0RC 2HIOC 3KUYD 2NQBD 4WJ3C 3AZIC 5C3IC 5F99A 4XZQC 3AV2C 4H9RA 3AZKA 2JE5A 5CPJA 3A6NB 3MGQC 3AZHC 1P3MC 1AOIA 5CPIC 1TZYD 5BT1D 3MGRD 3REJD 4CSRA 4J8XB 1P3GC 5AV8B 2NZDD 3B0DC 3KXBA 4WU9C 1P3FB 3P5JB 3AYWA 3AFAC 3UTAC 3LZ1A 4X23C 3LZ0C 5AV9B 1P3BB 1P3PA 4KUDB 1P3FD 5FUGA 5B2JA 5AVBB 3REID 5AV9D 5CHLB 3MGPB 1S32C 3W98B 5GT0A 4YM6B 5B0ZB 4H9PA 4Z5TA 5GXQC 4QLCA 4H9QA 3O62D 1P3OC 4KUDD 1H3OA 4CAYB 2FJ7A 3X1UC 1F66B 3W98D 5B1MB 3REKD 3NQUA 3UT9B 3AZGC 4AWLB 3C1CD 4KHAB 1M1AD 3KUYA 1F66D 2NQBA 4UUZB 3KWQA 4J8UC 5BNVA 5AY8D 5B24B 1ZLAB 3LELB 2DF4C 5CPKC 2Y2MA 2Y2JA 5GSUB 3UT9D 1P3AD 4ZUXA 4R8PD 1TZYA 2CV5D 3MGRA 3AZNB 5B40C 1P3ID 3REJA 1BFMA 5BO0B 1N1JA 4G91B 3C1BA 1KX3A 3AZLB 3W97B 2DQNC 2J8PA 2ZY4A 4Z66B 5JA4A 3AZFB 4LD9A 4WNNA 3MVDB 4J8WB 1P3KB 3UTBD 2JCHA 5B1LD 5JRGC 4WU8D 3AZFD 3X1SB 3MGSD 1M19D 4JJNA 4NE3A 2BYMA 5AVCD 3VH5W 4G92C 1M18C 2IO5C 5F99B 1P3KD 4H9RB 3TU4C 3AZKB 5CPJB 5CP6D 1P3LD 1AOIB 1KX5C 3O62A 4J8VC 3VH6W 4XZQA 3B6FA 1HQ3D 4CSRB 1PZRA 3WA9D 3WTPE 3KXBB 2Y2IA 5CPJD 2ZM5A 3WKJD 3REKA 3REHD 3AZJC 3AYWB 4XUJC 3LZ1B 4E44A 3C1CA 1M1AA 2RIQA 5AY8A 1P3PB 5FUGB 3AYWD 2AROC 5B2JB 4M6BA 3X1TD 1P3AA 5GT0B 4R8PA 2CWEA 4DRAA 4H9PB 4Z5TB 2CV5A 4DQYB 1P3IA 5AV6D 1EQZC 4QLCB 4H9QB 5DNND 3RELC 1H3OB 3VH5A 2FJ7B 3W99A 2Y2QA 5DNMA 5B33A 5B0YD 3KSYA 3B6GA 3WTPD 1KX4A 5AV5C 3UTBA 3VH6A 2Y2GA 5B1LA 4WU8A 3AN2C 3MGSA 5E5AC 3KUYB 2NQBB 3KWQB 5B31D 3X1VD 2PYOC 3W96A 2JSSA 1U35D 5CP6A 5BT1C 1P3LA 1TZYB 3KWQD 3MGRB 1HQ3A 1KU5A 3REJB 3H0LC 3WA9A 4EO5B 3C1BB 3A6NC 2NZDB 5JA4B 5B2ID 4LD9B 3WKJA 4ZUXD 3REHA 4WNNB 5B40A 3AL0C 3AZMD 4J8XC 3B0CT 5AV8C 3AZEA 2Y2PA 5B32D 3C1BD 1KX3D 1P3FC 4LD9D 2FFFB 4JJNB 5AV9C 2BYMB 1T3UA 1P3BC 3X1TA 3REIB 4HGAB 1A7WA 4KUDC 5AV6A 3MNND 3O62B 4WV4B 5GT3D 5DNNA 5AVBC 4JJND 3B6FB 3MGPC 2BYKA 3W98C 4YM6C 5B0ZC 5B0YA 3REKB 2HIOD 3WTPA 5BNXA 4KGCA 4XZQD 3AV2D 3C1CB 3B6FD 1F66C 5B1MC 2F8NA 1M1AB 3MGQD 5B31A 1P3MD 5AY8B 3X1VA 5CPID 3EG5B 3UT9C 1U35A 4AWLC 1P3AB 1P3GD 4R8PB 5B24C 1P34A 2CV5B 1ZLAC 3LELC 3NQJA 1P3IB 3AFAD 3UTAD 4X23D 3LZ0D 5GSUC 3AV1A 5B2IA 3W99B 5B32G 5DNMB 5B33B 3LJAA 4WZSB 3AZNC 3AZMA 2XD1A 3B6GB 4G91C 3EPKA 1KX4B 3UTBB 3AZLC 3W97C 4Z66C 4YS3A 5B1LB 5B32A 4WU8B 3AZFC 2YFVA 3A1KA 1S32D 2RVQC 3W99D 1ID3A 3MGSB 5DNMD 2W8SA 3MVDC 5KDMA 5B33D 1M19B 4J8WC 5GXQD 5AVCB 3B6GD 3R45A 1P3KC 1P3OD 3W96B 1KX4D 3V9RA 3WAAA 3X1SC 5CP6B 2BG1A 3X1UD 1P3LB 1JFIA 3MNNA 5GT3A 1WWSA 5F99C 1HQ3B 3AZKC 3W96D 3WA9B 5CPJC 2XD5A 3EPJA 3WKJB 1AOIC 2HIOA 3REHB 1B67A 1HTAA 4H9NA 3AZIA 3AV2A 4Z2MG 3AZEB 3KXBC 5CPKD 3MGQA 4NFTA 3AZHA 1P3MA 3AYWC 5CPIA 2L5AA 3LZ1C 3EPHA 5B40D 4E45A 3X1TB 1P3GA 2G5HC 3AZED 1TAFA 4WU9A 1P3PC 3H0MC 4Z2MH 5AV6B 3AFAA 3UTAA 5B2JC 5DNNB 4X23A 3LZ0A 2BYKB 5GT0C 2Y2LA 4Z5TC 5B0YB 4QLCC 3WTPB 2ZY5A 5BNXB 4KGCB 1M18D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S32 A;  3TU4 D;  2F8N B;  5G49 A;  3VH5 T;  5B31 B;  3X1V B;  2HUE B;  5GXQ A;  1KX5 D;  1P3O A;  4J8V D;  3NQU B;  1U35 B;  1R4V A;  4KGC D;  3X1U A;  3VH6 T;  3KUY C;  2F8N D;  2NQB C;  3KWQ C;  1P34 B;  3NQJ B;  5BNV B;  3AZJ D;  4KHA A;  3AZG A;  1WWI A;  3AV1 B;  5B2I B;  4ZUX B;  1TZY C;  4ZBJ B;  4J8U A;  3LJA B;  3MGR C;  3AZM B;  3REJ C;  1P34 D;  5BS7 C;  5GSU A;  4EO5 C;  3C1B C;  2ARO D;  2NZD C;  5CPK A;  1N1J B;  4YS3 B;  4LD9 C;  5B32 B;  1KX3 B;  2YFV B;  3AV1 D;  1ID3 B;  5KDM B;  3LJA D;  3R45 B;  3V9R B;  3WAA B;  4YS3 D;  3MVD A;  1ID3 D;  1JFI B;  3MNN B;  4JJN C;  5GT3 B;  4H9O A;  3REI C;  5AV5 D;  5JRG A;  4H9S C;  4HGA C;  3WAA D;  3AN2 D;  5E5A D;  1F1E A;  2HIO B;  3O62 C;  4H9N B;  3B6F C;  3AZI B;  1M18 A;  2PYO D;  5C3I B;  4XZQ B;  3AV2 B;  3TU4 A;  3REK C;  3MGQ B;  1BH9 A;  3AZH B;  2F8N G;  1P3M B;  5CPI B;  1KX5 A;  4J8V A;  5B31 G;  3C1C C;  3AZI D;  1P3G B;  2YFW A;  3A6N D;  3B0D B;  1M1A C;  1TAF B;  4WU9 B;  5AY8 C;  3AZH D;  2LY8 A;  3AZJ A;  4DRB A;  4XUJ A;  3AFA B;  3UTA B;  4X23 B;  3LZ0 B;  4J8X D;  1P3A C;  2F8N H;  5AV8 D;  4R8P C;  2CV5 C;  4WU9 D;  1P3I C;  2ARO A;  1P3B D;  3W99 C;  5DNM C;  1S32 B;  5B33 C;  3B6G C;  5G49 B;  1Q9C A;  1EQZ A;  5GXQ B;  1KX4 C;  1P3O B;  3UTB C;  5B1L C;  5AVB D;  3REL A;  4WU8 C;  3MGP D;  4YM6 D;  3MGS C;  5B0Z D;  3X1U B;  1M19 C;  5AVC C;  3W96 C;  5AV5 A;  3AZG B;  3AN2 A;  5CP6 C;  1P3L C;  5B1M D;  5E5A A;  4J8U B;  1HQ3 C;  1BH8 A;  2PYO A;  3WA9 C;  5CPK B;  3AZG D;  3WKJ C;  3REH C;  2F8N K;  5B24 D;  3B0B A;  1ZLA D;  3LEL D;  4J8U D;  5B40 B;  5BS7 A;  3AZE C;  2NZD A;  5GSU D;  4NE6 A;  3A6N A;  2FJ7 C;  3AZN D;  4J8X A;  4H9O B;  3X1T C;  5AV8 A;  3W97 D;  3AZL D;  4Z66 D;  5JRG B;  1P3F A;  2RVQ D;  5AV6 C;  1B6W A;  3MVD D;  5DNN C;  4J8W D;  3REI A;  5AV9 A;  4G92 B;  1P3B A;  1M18 B;  2IO5 B;  4H9S A;  3TU4 B;  5JRG D;  3X1S D;  5B0Y C;  4KUD A;  1BH9 B;  3WTP C;  1KX5 B;  4J8V B;  4KGC C;  5AVB A;  5F99 D;  3MGP A;  3W98 A;  3AZK D;  4YM6 A;  5B0Z A;  2YFW B;  5B31 C;  3X1V C;  2HUE C;  1AOI D;  3AZJ B;  4XUJ B;  1U35 C;  4CAY A;  1F66 A;  5B1M A;  3KXB D;  1P34 C;  3LZ1 D;  3UT9 A;  4XUJ D;  2ARO B;  3AV1 C;  5B2I C;  3B0C W;  4ZUX C;  4UUZ A;  4ZBJ C;  3LJA C;  1P3P D;  5B24 A;  3AZM C;  1ZLA A;  3LEL A;  1EQZ B;  5B2J D;  4YS3 C;  3REL B;  5B32 C;  1KX3 C;  5GT0 D;  1ID3 C;  4Z5T D;  3AZN A;  4QLC D;  5BO0 A;  1EQZ D;  5AV5 B;  3WAA C;  3W97 A;  3AZL A;  4Z66 A;  2FJ7 D;  3REL D;  3AZF A;  1ULY A;  3AN2 B;  5E5A B;  1M19 A;  4NE5 A;  3MNN C;  5AVC A;  5GT3 C;  4J8W A;  1P3K A;  1BH8 B;  2PYO B;  3X1S A;  2HIO C;  3KUY D;  2NQB D;  3AZI C;  5C3I C;  5F99 A;  4XZQ C;  3AV2 C;  4H9R A;  3AZK A;  5CPJ A;  3A6N B;  3MGQ C;  3AZH C;  1P3M C;  1AOI A;  5CPI C;  1TZY D;  5BT1 D;  3MGR D;  3REJ D;  4CSR A;  4J8X B;  1P3G C;  5AV8 B;  2NZD D;  3B0D C;  3KXB A;  4WU9 C;  1P3F B;  3AYW A;  3AFA C;  3UTA C;  3LZ1 A;  4X23 C;  3LZ0 C;  5AV9 B;  1P3B B;  1P3P A;  4KUD B;  1P3F D;  5FUG A;  5B2J A;  5AVB B;  3REI D;  5AV9 D;  5CHL B;  3MGP B;  1S32 C;  3W98 B;  5GT0 A;  4YM6 B;  5B0Z B;  4H9P A;  4Z5T A;  5GXQ C;  4QLC A;  4H9Q A;  3O62 D;  1P3O C;  4KUD D;  1H3O A;  4CAY B;  2FJ7 A;  3X1U C;  1F66 B;  3W98 D;  5B1M B;  3REK D;  3NQU A;  3UT9 B;  3AZG C;  4AWL B;  3C1C D;  4KHA B;  1M1A D;  3KUY A;  1F66 D;  2NQB A;  4UUZ B;  3KWQ A;  4J8U C;  5BNV A;  5AY8 D;  5B24 B;  1ZLA B;  3LEL B;  5CPK C;  3UT9 D;  5GSU B;  1P3A D;  4ZUX A;  4R8P D;  1TZY A;  2CV5 D;  3MGR A;  3AZN B;  5B40 C;  1P3I D;  3REJ A;  1BFM A;  5BO0 B;  1N1J A;  4G91 B;  3C1B A;  1KX3 A;  3AZL B;  3W97 B;  4Z66 B;  5JA4 A;  4LD9 A;  3AZF B;  4WNN A;  3MVD B;  4J8W B;  1P3K B;  3UTB D;  5JRG C;  5B1L D;  4WU8 D;  3AZF D;  3X1S B;  3MGS D;  1M19 D;  4JJN A;  4NE3 A;  2BYM A;  5AVC D;  3VH5 W;  4G92 C;  1M18 C;  2IO5 C;  5F99 B;  1P3K D;  4H9R B;  3TU4 C;  3AZK B;  5CPJ B;  5CP6 D;  1P3L D;  1AOI B;  1KX5 C;  3O62 A;  4J8V C;  3VH6 W;  4XZQ A;  3B6F A;  1HQ3 D;  4CSR B;  3WA9 D;  3WTP E;  3KXB B;  5CPJ D;  3WKJ D;  3REK A;  3REH D;  3AZJ C;  3AYW B;  4XUJ C;  3LZ1 B;  4E44 A;  3C1C A;  1M1A A;  5AY8 A;  1P3P B;  5FUG B;  3AYW D;  2ARO C;  5B2J B;  4M6B A;  3X1T D;  1P3A A;  5GT0 B;  4R8P A;  2CWE A;  4DRA A;  4H9P B;  4Z5T B;  2CV5 A;  1P3I A;  5AV6 D;  1EQZ C;  4QLC B;  4H9Q B;  5DNN D;  3REL C;  1H3O B;  3VH5 A;  2FJ7 B;  3W99 A;  5DNM A;  5B33 A;  5B0Y D;  3KSY A;  3B6G A;  3WTP D;  1KX4 A;  5AV5 C;  3UTB A;  3VH6 A;  5B1L A;  4WU8 A;  3AN2 C;  3MGS A;  5E5A C;  3KUY B;  2NQB B;  3KWQ B;  5B31 D;  3X1V D;  2PYO C;  3W96 A;  2JSS A;  1U35 D;  5CP6 A;  5BT1 C;  1P3L A;  1TZY B;  3KWQ D;  3MGR B;  1HQ3 A;  1KU5 A;  3REJ B;  3WA9 A;  4EO5 B;  3C1B B;  3A6N C;  2NZD B;  5JA4 B;  5B2I D;  4LD9 B;  3WKJ A;  4ZUX D;  3REH A;  4WNN B;  5B40 A;  3AZM D;  4J8X C;  3B0C T;  5AV8 C;  3AZE A;  5B32 D;  3C1B D;  1KX3 D;  1P3F C;  4LD9 D;  4JJN B;  5AV9 C;  2BYM B;  1P3B C;  3X1T A;  3REI B;  4HGA B;  1A7W A;  4KUD C;  5AV6 A;  3MNN D;  3O62 B;  4WV4 B;  5GT3 D;  5DNN A;  5AVB C;  4JJN D;  3B6F B;  3MGP C;  2BYK A;  3W98 C;  4YM6 C;  5B0Z C;  5B0Y A;  3REK B;  2HIO D;  3WTP A;  5BNX A;  4KGC A;  4XZQ D;  3AV2 D;  3C1C B;  3B6F D;  1F66 C;  5B1M C;  2F8N A;  1M1A B;  3MGQ D;  5B31 A;  1P3M D;  5AY8 B;  3X1V A;  5CPI D;  3UT9 C;  1U35 A;  4AWL C;  1P3A B;  1P3G D;  4R8P B;  5B24 C;  1P34 A;  2CV5 B;  1ZLA C;  3LEL C;  3NQJ A;  1P3I B;  3AFA D;  3UTA D;  4X23 D;  3LZ0 D;  5GSU C;  3AV1 A;  5B2I A;  3W99 B;  5B32 G;  5DNM B;  5B33 B;  3LJA A;  4WZS B;  3AZN C;  3AZM A;  3B6G B;  4G91 C;  1KX4 B;  3UTB B;  3AZL C;  3W97 C;  4Z66 C;  4YS3 A;  5B1L B;  5B32 A;  4WU8 B;  3AZF C;  2YFV A;  1S32 D;  2RVQ C;  3W99 D;  1ID3 A;  3MGS B;  5DNM D;  3MVD C;  5KDM A;  5B33 D;  1M19 B;  4J8W C;  5GXQ D;  5AVC B;  3B6G D;  3R45 A;  1P3K C;  1P3O D;  3W96 B;  1KX4 D;  3V9R A;  3WAA A;  3X1S C;  5CP6 B;  3X1U D;  1P3L B;  1JFI A;  3MNN A;  5GT3 A;  1WWS A;  5F99 C;  1HQ3 B;  3AZK C;  3W96 D;  3WA9 B;  5CPJ C;  3WKJ B;  1AOI C;  2HIO A;  3REH B;  1B67 A;  1HTA A;  4H9N A;  3AZI A;  3AV2 A;  4Z2M G;  3AZE B;  3KXB C;  5CPK D;  3MGQ A;  4NFT A;  3AZH A;  1P3M A;  3AYW C;  5CPI A;  2L5A A;  3LZ1 C;  5B40 D;  4E45 A;  3X1T B;  1P3G A;  3AZE D;  1TAF A;  4WU9 A;  1P3P C;  4Z2M H;  5AV6 B;  3AFA A;  3UTA A;  5B2J C;  5DNN B;  4X23 A;  3LZ0 A;  2BYK B;  5GT0 C;  4Z5T C;  5B0Y B;  4QLC C;  3WTP B;  5BNX B;  4KGC B;  1M18 D; 
#chains in the Genus database with same CATH topology
 1S32 A;  3TU4 D;  2F8N B;  2Y2O A;  5G49 A;  3VH5 T;  5B31 B;  3X1V B;  2HUE B;  5GXQ A;  1KX5 D;  1P3O A;  4J8V D;  3NQU B;  1U35 B;  1R4V A;  4KGC D;  3X1U A;  3VH6 T;  3KUY C;  2F8N D;  2NQB C;  3KWQ C;  1P34 B;  2ZY2 A;  3NQJ B;  5BNV B;  3AZJ D;  4KHA A;  3AZG A;  1WWI A;  3AV1 B;  5B2I B;  2F2A C;  4ZUX B;  1TZY C;  4ZBJ B;  4J8U A;  3LJA B;  3MGR C;  3AZM B;  3REJ C;  1P34 D;  2ZY3 A;  5BS7 C;  5GSU A;  4EO5 C;  3C1B C;  2ARO D;  2NZD C;  5CPK A;  1N1J B;  4YS3 B;  2G5I C;  4LD9 C;  5B32 B;  3IP4 C;  1KX3 B;  2YFV B;  3AV1 D;  1ID3 B;  5KDM B;  3LJA D;  3R45 B;  3V9R B;  3WAA B;  4YS3 D;  3MVD A;  1ID3 D;  1JFI B;  3MNN B;  4JJN C;  5GT3 B;  4H9O A;  3REI C;  5AV5 D;  5JRG A;  4H9S C;  4HGA C;  3WAA D;  3AN2 D;  5E5A D;  1F1E A;  2HIO B;  3O62 C;  4H9N B;  3B6F C;  3AZI B;  2UWX A;  1M18 A;  5C3I B;  4XZQ B;  3AV2 B;  2PYO D;  3TU4 A;  2Y2H A;  3REK C;  3MGQ B;  1BH9 A;  3AZH B;  2F8N G;  1P3M B;  5CPI B;  1KX5 A;  4J8V A;  5B31 G;  1W2E A;  3FDD A;  3C1C C;  3AZI D;  2VQR A;  1P3G B;  2YFW A;  3A6N D;  3B0D B;  1M1A C;  1TAF B;  4WU9 B;  5AY8 C;  3AZH D;  2LY8 A;  3AZJ A;  4DRB A;  4XUJ A;  3AFA B;  3UTA B;  4X23 B;  3LZ0 B;  4J8X D;  1P3A C;  2F8N H;  5AV8 D;  4R8P C;  2CV5 C;  4WU9 D;  1P3I C;  2ARO A;  1P3B D;  3W99 C;  5DNM C;  1S32 B;  2Y2N A;  5B33 C;  3B6G C;  5G49 B;  1Q9C A;  1EQZ A;  5GXQ B;  1KX4 C;  1P3O B;  3UTB C;  5B1L C;  5AVB D;  3REL A;  4WU8 C;  3MGP D;  4YM6 D;  3MGS C;  5B0Z D;  3X1U B;  1M19 C;  5AVC C;  3W96 C;  5AV5 A;  3AZG B;  3AN2 A;  5CP6 C;  1P3L C;  5B1M D;  5E5A A;  4J8U B;  1HQ3 C;  1BH8 A;  2PYO A;  3WA9 C;  5CPK B;  3AZG D;  3WKJ C;  3REH C;  2F8N K;  5B24 D;  3B0B A;  1ZLA D;  3LEL D;  4J8U D;  5B40 B;  5BS7 A;  3AZE C;  2NZD A;  5GSU D;  4NE6 A;  3A6N A;  3KFU G;  2FJ7 C;  3AZN D;  4J8X A;  4H9O B;  3X1T C;  5AV8 A;  3W97 D;  3EPL A;  3AZL D;  4Z66 D;  5JRG B;  1P3F A;  2RVQ D;  5AV6 C;  1B6W A;  3MVD D;  5DNN C;  3A1I A;  4J8W D;  3REI A;  5AV9 A;  4G92 B;  1P3B A;  1M18 B;  2IO5 B;  4H9S A;  3TU4 B;  5JRG D;  3X1S D;  5B0Y C;  4KUD A;  1BH9 B;  3WTP C;  1KX5 B;  4J8V B;  4KGC C;  5AVB A;  5F99 D;  3MGP A;  3W98 A;  3AZK D;  4YM6 A;  5B0Z A;  2YFW B;  5B31 C;  3X1V C;  2HUE C;  1AOI D;  3AZJ B;  4XUJ B;  1U35 C;  4CAY A;  1Z2C B;  1F66 A;  5B1M A;  3KXB D;  1P34 C;  4UPK A;  3LZ1 D;  3UT9 A;  4XUJ D;  3F6T A;  2ARO B;  3AV1 C;  5B2I C;  3B0C W;  4ZUX C;  4UUZ A;  4ZBJ C;  3LJA C;  1P3P D;  5B24 A;  3AZM C;  1ZLA A;  3LEL A;  1EQZ B;  5B2J D;  2Y2K A;  4YS3 C;  3REL B;  5B32 C;  1KX3 C;  5GT0 D;  1ID3 C;  4Z5T D;  3AZN A;  4QLC D;  5BO0 A;  1EQZ D;  5AV5 B;  3WAA C;  3W97 A;  3AZL A;  4Z66 A;  2FJ7 D;  3REL D;  3AZF A;  1ULY A;  3AN2 B;  5E5A B;  1M19 A;  4NE5 A;  3MNN C;  5AVC A;  5GT3 C;  4J8W A;  1P3K A;  1BH8 B;  2PYO B;  3X1S A;  3H0R C;  2HIO C;  3KUY D;  2NQB D;  4WJ3 C;  3AZI C;  5C3I C;  5F99 A;  4XZQ C;  3AV2 C;  4H9R A;  3AZK A;  2JE5 A;  5CPJ A;  3A6N B;  3MGQ C;  3AZH C;  1P3M C;  1AOI A;  5CPI C;  1TZY D;  5BT1 D;  3MGR D;  3REJ D;  4CSR A;  4J8X B;  1P3G C;  5AV8 B;  2NZD D;  3B0D C;  3KXB A;  4WU9 C;  1P3F B;  3P5J B;  3AYW A;  3AFA C;  3UTA C;  3LZ1 A;  4X23 C;  3LZ0 C;  5AV9 B;  1P3B B;  1P3P A;  4KUD B;  1P3F D;  5FUG A;  5B2J A;  5AVB B;  3REI D;  5AV9 D;  5CHL B;  3MGP B;  1S32 C;  3W98 B;  5GT0 A;  4YM6 B;  5B0Z B;  4H9P A;  4Z5T A;  5GXQ C;  4QLC A;  4H9Q A;  3O62 D;  1P3O C;  4KUD D;  1H3O A;  4CAY B;  2FJ7 A;  3X1U C;  1F66 B;  3W98 D;  5B1M B;  3REK D;  3NQU A;  3UT9 B;  3AZG C;  4AWL B;  3C1C D;  4KHA B;  1M1A D;  3KUY A;  1F66 D;  2NQB A;  4UUZ B;  3KWQ A;  4J8U C;  5BNV A;  5AY8 D;  5B24 B;  1ZLA B;  3LEL B;  2DF4 C;  5CPK C;  2Y2M A;  2Y2J A;  5GSU B;  3UT9 D;  1P3A D;  4ZUX A;  4R8P D;  1TZY A;  2CV5 D;  3MGR A;  3AZN B;  5B40 C;  1P3I D;  3REJ A;  1BFM A;  5BO0 B;  1N1J A;  4G91 B;  3C1B A;  1KX3 A;  3AZL B;  3W97 B;  2DQN C;  2J8P A;  2ZY4 A;  4Z66 B;  5JA4 A;  3AZF B;  4LD9 A;  4WNN A;  3MVD B;  4J8W B;  1P3K B;  3UTB D;  2JCH A;  5B1L D;  5JRG C;  4WU8 D;  3AZF D;  3X1S B;  3MGS D;  1M19 D;  4JJN A;  4NE3 A;  2BYM A;  5AVC D;  3VH5 W;  4G92 C;  1M18 C;  2IO5 C;  5F99 B;  1P3K D;  4H9R B;  3TU4 C;  3AZK B;  5CPJ B;  5CP6 D;  1P3L D;  1AOI B;  1KX5 C;  3O62 A;  4J8V C;  3VH6 W;  4XZQ A;  3B6F A;  1HQ3 D;  4CSR B;  1PZR A;  3WA9 D;  3WTP E;  3KXB B;  2Y2I A;  5CPJ D;  2ZM5 A;  3WKJ D;  3REK A;  3REH D;  3AZJ C;  3AYW B;  4XUJ C;  3LZ1 B;  4E44 A;  3C1C A;  1M1A A;  2RIQ A;  5AY8 A;  1P3P B;  5FUG B;  3AYW D;  2ARO C;  5B2J B;  4M6B A;  3X1T D;  1P3A A;  5GT0 B;  4R8P A;  2CWE A;  4DRA A;  4H9P B;  4Z5T B;  2CV5 A;  4DQY B;  1P3I A;  5AV6 D;  1EQZ C;  4QLC B;  4H9Q B;  5DNN D;  3REL C;  1H3O B;  3VH5 A;  2FJ7 B;  3W99 A;  2Y2Q A;  5DNM A;  5B33 A;  5B0Y D;  3KSY A;  3B6G A;  3WTP D;  1KX4 A;  5AV5 C;  3UTB A;  3VH6 A;  2Y2G A;  5B1L A;  4WU8 A;  3AN2 C;  3MGS A;  5E5A C;  3KUY B;  2NQB B;  3KWQ B;  5B31 D;  3X1V D;  2PYO C;  3W96 A;  2JSS A;  1U35 D;  5CP6 A;  5BT1 C;  1P3L A;  1TZY B;  3KWQ D;  3MGR B;  1HQ3 A;  1KU5 A;  3REJ B;  3H0L C;  3WA9 A;  4EO5 B;  3C1B B;  3A6N C;  2NZD B;  5JA4 B;  5B2I D;  4LD9 B;  3WKJ A;  4ZUX D;  3REH A;  4WNN B;  5B40 A;  3AL0 C;  3AZM D;  4J8X C;  3B0C T;  5AV8 C;  3AZE A;  2Y2P A;  5B32 D;  3C1B D;  1KX3 D;  1P3F C;  4LD9 D;  2FFF B;  4JJN B;  5AV9 C;  2BYM B;  1T3U A;  1P3B C;  3X1T A;  3REI B;  4HGA B;  1A7W A;  4KUD C;  5AV6 A;  3MNN D;  3O62 B;  4WV4 B;  5GT3 D;  5DNN A;  5AVB C;  4JJN D;  3B6F B;  3MGP C;  2BYK A;  3W98 C;  4YM6 C;  5B0Z C;  5B0Y A;  3REK B;  2HIO D;  3WTP A;  5BNX A;  4KGC A;  4XZQ D;  3AV2 D;  3C1C B;  3B6F D;  1F66 C;  5B1M C;  2F8N A;  1M1A B;  3MGQ D;  5B31 A;  1P3M D;  5AY8 B;  3X1V A;  5CPI D;  3EG5 B;  3UT9 C;  1U35 A;  4AWL C;  1P3A B;  1P3G D;  4R8P B;  5B24 C;  1P34 A;  2CV5 B;  1ZLA C;  3LEL C;  3NQJ A;  1P3I B;  3AFA D;  3UTA D;  4X23 D;  3LZ0 D;  5GSU C;  3AV1 A;  5B2I A;  3W99 B;  5B32 G;  5DNM B;  5B33 B;  3LJA A;  4WZS B;  3AZN C;  3AZM A;  2XD1 A;  3B6G B;  4G91 C;  3EPK A;  1KX4 B;  3UTB B;  3AZL C;  3W97 C;  4Z66 C;  4YS3 A;  5B1L B;  5B32 A;  4WU8 B;  3AZF C;  2YFV A;  3A1K A;  1S32 D;  2RVQ C;  3W99 D;  1ID3 A;  3MGS B;  5DNM D;  2W8S A;  3MVD C;  5KDM A;  5B33 D;  1M19 B;  4J8W C;  5GXQ D;  5AVC B;  3B6G D;  3R45 A;  1P3K C;  1P3O D;  3W96 B;  1KX4 D;  3V9R A;  3WAA A;  3X1S C;  5CP6 B;  2BG1 A;  3X1U D;  1P3L B;  1JFI A;  3MNN A;  5GT3 A;  1WWS A;  5F99 C;  1HQ3 B;  3AZK C;  3W96 D;  3WA9 B;  5CPJ C;  2XD5 A;  3EPJ A;  3WKJ B;  1AOI C;  2HIO A;  3REH B;  1B67 A;  1HTA A;  4H9N A;  3AZI A;  3AV2 A;  4Z2M G;  3AZE B;  3KXB C;  5CPK D;  3MGQ A;  4NFT A;  3AZH A;  1P3M A;  3AYW C;  5CPI A;  2L5A A;  3LZ1 C;  3EPH A;  5B40 D;  4E45 A;  3X1T B;  1P3G A;  2G5H C;  3AZE D;  1TAF A;  4WU9 A;  1P3P C;  3H0M C;  4Z2M H;  5AV6 B;  3AFA A;  3UTA A;  5B2J C;  5DNN B;  4X23 A;  3LZ0 A;  2BYK B;  5GT0 C;  2Y2L A;  4Z5T C;  5B0Y B;  4QLC C;  3WTP B;  2ZY5 A;  5BNX B;  4KGC B;  1M18 D; 
#chains in the Genus database with same CATH homology
 1S32 A;  3TU4 D;  2F8N B;  2Y2O A;  5G49 A;  3VH5 T;  5B31 B;  3X1V B;  2HUE B;  5GXQ A;  1KX5 D;  1P3O A;  4J8V D;  3NQU B;  1U35 B;  1R4V A;  4KGC D;  3X1U A;  3VH6 T;  3KUY C;  2F8N D;  2NQB C;  3KWQ C;  1P34 B;  2ZY2 A;  3NQJ B;  5BNV B;  3AZJ D;  4KHA A;  3AZG A;  1WWI A;  3AV1 B;  5B2I B;  2F2A C;  4ZUX B;  1TZY C;  4ZBJ B;  4J8U A;  3LJA B;  3MGR C;  3AZM B;  3REJ C;  1P34 D;  2ZY3 A;  5BS7 C;  5GSU A;  4EO5 C;  3C1B C;  2ARO D;  2NZD C;  5CPK A;  1N1J B;  4YS3 B;  2G5I C;  4LD9 C;  5B32 B;  3IP4 C;  1KX3 B;  2YFV B;  3AV1 D;  1ID3 B;  5KDM B;  3LJA D;  3R45 B;  3V9R B;  3WAA B;  4YS3 D;  3MVD A;  1ID3 D;  1JFI B;  3MNN B;  4JJN C;  5GT3 B;  4H9O A;  3REI C;  5AV5 D;  5JRG A;  4H9S C;  4HGA C;  3WAA D;  3AN2 D;  5E5A D;  1F1E A;  2HIO B;  3O62 C;  4H9N B;  3B6F C;  3AZI B;  2UWX A;  1M18 A;  5C3I B;  4XZQ B;  3AV2 B;  2PYO D;  3TU4 A;  2Y2H A;  3REK C;  3MGQ B;  1BH9 A;  3AZH B;  2F8N G;  1P3M B;  5CPI B;  1KX5 A;  4J8V A;  5B31 G;  1W2E A;  3FDD A;  3C1C C;  3AZI D;  2VQR A;  1P3G B;  2YFW A;  3A6N D;  3B0D B;  1M1A C;  1TAF B;  4WU9 B;  5AY8 C;  3AZH D;  2LY8 A;  3AZJ A;  4DRB A;  4XUJ A;  3AFA B;  3UTA B;  4X23 B;  3LZ0 B;  4J8X D;  1P3A C;  2F8N H;  5AV8 D;  4R8P C;  2CV5 C;  4WU9 D;  1P3I C;  2ARO A;  1P3B D;  3W99 C;  5DNM C;  1S32 B;  2Y2N A;  5B33 C;  3B6G C;  5G49 B;  1Q9C A;  1EQZ A;  5GXQ B;  1KX4 C;  1P3O B;  3UTB C;  5B1L C;  5AVB D;  3REL A;  4WU8 C;  3MGP D;  4YM6 D;  3MGS C;  5B0Z D;  3X1U B;  1M19 C;  5AVC C;  3W96 C;  5AV5 A;  3AZG B;  3AN2 A;  5CP6 C;  1P3L C;  5B1M D;  5E5A A;  4J8U B;  1HQ3 C;  1BH8 A;  2PYO A;  3WA9 C;  5CPK B;  3AZG D;  3WKJ C;  3REH C;  2F8N K;  5B24 D;  3B0B A;  1ZLA D;  3LEL D;  4J8U D;  5B40 B;  5BS7 A;  3AZE C;  2NZD A;  5GSU D;  4NE6 A;  3A6N A;  3KFU G;  2FJ7 C;  3AZN D;  4J8X A;  4H9O B;  3X1T C;  5AV8 A;  3W97 D;  3EPL A;  3AZL D;  4Z66 D;  5JRG B;  1P3F A;  2RVQ D;  5AV6 C;  1B6W A;  3MVD D;  5DNN C;  3A1I A;  4J8W D;  3REI A;  5AV9 A;  4G92 B;  1P3B A;  1M18 B;  2IO5 B;  4H9S A;  3TU4 B;  5JRG D;  3X1S D;  5B0Y C;  4KUD A;  1BH9 B;  3WTP C;  1KX5 B;  4J8V B;  4KGC C;  5AVB A;  5F99 D;  3MGP A;  3W98 A;  3AZK D;  4YM6 A;  5B0Z A;  2YFW B;  5B31 C;  3X1V C;  2HUE C;  1AOI D;  3AZJ B;  4XUJ B;  1U35 C;  4CAY A;  1Z2C B;  1F66 A;  5B1M A;  3KXB D;  1P34 C;  4UPK A;  3LZ1 D;  3UT9 A;  4XUJ D;  3F6T A;  2ARO B;  3AV1 C;  5B2I C;  3B0C W;  4ZUX C;  4UUZ A;  4ZBJ C;  3LJA C;  1P3P D;  5B24 A;  3AZM C;  1ZLA A;  3LEL A;  1EQZ B;  5B2J D;  2Y2K A;  4YS3 C;  3REL B;  5B32 C;  1KX3 C;  5GT0 D;  1ID3 C;  4Z5T D;  3AZN A;  4QLC D;  5BO0 A;  1EQZ D;  5AV5 B;  3WAA C;  3W97 A;  3AZL A;  4Z66 A;  2FJ7 D;  3REL D;  3AZF A;  1ULY A;  3AN2 B;  5E5A B;  1M19 A;  4NE5 A;  3MNN C;  5AVC A;  5GT3 C;  4J8W A;  1P3K A;  1BH8 B;  2PYO B;  3X1S A;  3H0R C;  2HIO C;  3KUY D;  2NQB D;  4WJ3 C;  3AZI C;  5C3I C;  5F99 A;  4XZQ C;  3AV2 C;  4H9R A;  3AZK A;  2JE5 A;  5CPJ A;  3A6N B;  3MGQ C;  3AZH C;  1P3M C;  1AOI A;  5CPI C;  1TZY D;  5BT1 D;  3MGR D;  3REJ D;  4CSR A;  4J8X B;  1P3G C;  5AV8 B;  2NZD D;  3B0D C;  3KXB A;  4WU9 C;  1P3F B;  3P5J B;  3AYW A;  3AFA C;  3UTA C;  3LZ1 A;  4X23 C;  3LZ0 C;  5AV9 B;  1P3B B;  1P3P A;  4KUD B;  1P3F D;  5FUG A;  5B2J A;  5AVB B;  3REI D;  5AV9 D;  5CHL B;  3MGP B;  1S32 C;  3W98 B;  5GT0 A;  4YM6 B;  5B0Z B;  4H9P A;  4Z5T A;  5GXQ C;  4QLC A;  4H9Q A;  3O62 D;  1P3O C;  4KUD D;  1H3O A;  4CAY B;  2FJ7 A;  3X1U C;  1F66 B;  3W98 D;  5B1M B;  3REK D;  3NQU A;  3UT9 B;  3AZG C;  4AWL B;  3C1C D;  4KHA B;  1M1A D;  3KUY A;  1F66 D;  2NQB A;  4UUZ B;  3KWQ A;  4J8U C;  5BNV A;  5AY8 D;  5B24 B;  1ZLA B;  3LEL B;  2DF4 C;  5CPK C;  2Y2M A;  2Y2J A;  5GSU B;  3UT9 D;  1P3A D;  4ZUX A;  4R8P D;  1TZY A;  2CV5 D;  3MGR A;  3AZN B;  5B40 C;  1P3I D;  3REJ A;  1BFM A;  5BO0 B;  1N1J A;  4G91 B;  3C1B A;  1KX3 A;  3AZL B;  3W97 B;  2DQN C;  2J8P A;  2ZY4 A;  4Z66 B;  5JA4 A;  3AZF B;  4LD9 A;  4WNN A;  3MVD B;  4J8W B;  1P3K B;  3UTB D;  2JCH A;  5B1L D;  5JRG C;  4WU8 D;  3AZF D;  3X1S B;  3MGS D;  1M19 D;  4JJN A;  4NE3 A;  2BYM A;  5AVC D;  3VH5 W;  4G92 C;  1M18 C;  2IO5 C;  5F99 B;  1P3K D;  4H9R B;  3TU4 C;  3AZK B;  5CPJ B;  5CP6 D;  1P3L D;  1AOI B;  1KX5 C;  3O62 A;  4J8V C;  3VH6 W;  4XZQ A;  3B6F A;  1HQ3 D;  4CSR B;  1PZR A;  3WA9 D;  3WTP E;  3KXB B;  2Y2I A;  5CPJ D;  2ZM5 A;  3WKJ D;  3REK A;  3REH D;  3AZJ C;  3AYW B;  4XUJ C;  3LZ1 B;  4E44 A;  3C1C A;  1M1A A;  2RIQ A;  5AY8 A;  1P3P B;  5FUG B;  3AYW D;  2ARO C;  5B2J B;  4M6B A;  3X1T D;  1P3A A;  5GT0 B;  4R8P A;  2CWE A;  4DRA A;  4H9P B;  4Z5T B;  2CV5 A;  4DQY B;  1P3I A;  5AV6 D;  1EQZ C;  4QLC B;  4H9Q B;  5DNN D;  3REL C;  1H3O B;  3VH5 A;  2FJ7 B;  3W99 A;  2Y2Q A;  5DNM A;  5B33 A;  5B0Y D;  3KSY A;  3B6G A;  3WTP D;  1KX4 A;  5AV5 C;  3UTB A;  3VH6 A;  2Y2G A;  5B1L A;  4WU8 A;  3AN2 C;  3MGS A;  5E5A C;  3KUY B;  2NQB B;  3KWQ B;  5B31 D;  3X1V D;  2PYO C;  3W96 A;  2JSS A;  1U35 D;  5CP6 A;  5BT1 C;  1P3L A;  1TZY B;  3KWQ D;  3MGR B;  1HQ3 A;  1KU5 A;  3REJ B;  3H0L C;  3WA9 A;  4EO5 B;  3C1B B;  3A6N C;  2NZD B;  5JA4 B;  5B2I D;  4LD9 B;  3WKJ A;  4ZUX D;  3REH A;  4WNN B;  5B40 A;  3AL0 C;  3AZM D;  4J8X C;  3B0C T;  5AV8 C;  3AZE A;  2Y2P A;  5B32 D;  3C1B D;  1KX3 D;  1P3F C;  4LD9 D;  2FFF B;  4JJN B;  5AV9 C;  2BYM B;  1T3U A;  1P3B C;  3X1T A;  3REI B;  4HGA B;  1A7W A;  4KUD C;  5AV6 A;  3MNN D;  3O62 B;  4WV4 B;  5GT3 D;  5DNN A;  5AVB C;  4JJN D;  3B6F B;  3MGP C;  2BYK A;  3W98 C;  4YM6 C;  5B0Z C;  5B0Y A;  3REK B;  2HIO D;  3WTP A;  5BNX A;  4KGC A;  4XZQ D;  3AV2 D;  3C1C B;  3B6F D;  1F66 C;  5B1M C;  2F8N A;  1M1A B;  3MGQ D;  5B31 A;  1P3M D;  5AY8 B;  3X1V A;  5CPI D;  3EG5 B;  3UT9 C;  1U35 A;  4AWL C;  1P3A B;  1P3G D;  4R8P B;  5B24 C;  1P34 A;  2CV5 B;  1ZLA C;  3LEL C;  3NQJ A;  1P3I B;  3AFA D;  3UTA D;  4X23 D;  3LZ0 D;  5GSU C;  3AV1 A;  5B2I A;  3W99 B;  5B32 G;  5DNM B;  5B33 B;  3LJA A;  4WZS B;  3AZN C;  3AZM A;  2XD1 A;  3B6G B;  4G91 C;  3EPK A;  1KX4 B;  3UTB B;  3AZL C;  3W97 C;  4Z66 C;  4YS3 A;  5B1L B;  5B32 A;  4WU8 B;  3AZF C;  2YFV A;  3A1K A;  1S32 D;  2RVQ C;  3W99 D;  1ID3 A;  3MGS B;  5DNM D;  2W8S A;  3MVD C;  5KDM A;  5B33 D;  1M19 B;  4J8W C;  5GXQ D;  5AVC B;  3B6G D;  3R45 A;  1P3K C;  1P3O D;  3W96 B;  1KX4 D;  3V9R A;  3WAA A;  3X1S C;  5CP6 B;  2BG1 A;  3X1U D;  1P3L B;  1JFI A;  3MNN A;  5GT3 A;  1WWS A;  5F99 C;  1HQ3 B;  3AZK C;  3W96 D;  3WA9 B;  5CPJ C;  2XD5 A;  3EPJ A;  3WKJ B;  1AOI C;  2HIO A;  3REH B;  1B67 A;  1HTA A;  4H9N A;  3AZI A;  3AV2 A;  4Z2M G;  3AZE B;  3KXB C;  5CPK D;  3MGQ A;  4NFT A;  3AZH A;  1P3M A;  3AYW C;  5CPI A;  2L5A A;  3LZ1 C;  3EPH A;  5B40 D;  4E45 A;  3X1T B;  1P3G A;  2G5H C;  3AZE D;  1TAF A;  4WU9 A;  1P3P C;  3H0M C;  4Z2M H;  5AV6 B;  3AFA A;  3UTA A;  5B2J C;  5DNN B;  4X23 A;  3LZ0 A;  2BYK B;  5GT0 C;  2Y2L A;  4Z5T C;  5B0Y B;  4QLC C;  3WTP B;  2ZY5 A;  5BNX B;  4KGC B;  1M18 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...