4YM6D

Crystal structure of the human nucleosome containing 6-4pp (outside)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
96
structure length
96
Chain Sequence
b'KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural basis of pyrimidine-pyrimidone (6-4) photoproduct recognition by UV-DDB in the nucleosome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 96
sequence length 96
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ym6D00
4KGCA 3MGQC 3AZMD 3A6NB 5GXQB 2BYMA 3MNND 3LELC 3RELD 5B31A 4UUZB 3KUYB 1P3LD 4X23C 4J8UA 3X1VA 1AOIA 3W98A 2HIOA 3NQJB 5CP6A 5GT3D 3WAAC 4LD9D 5B2IA 1P3ID 1HQ3C 3AYWA 1P3OD 1P3BC 4J8XD 3AZHA 1TAFB 1P3AB 2AROD 4R8PA 5AVCC 3X1UB 4Z2MG 2YFVB 4E45A 4Z5TA 1M18B 5B32C 1KX4B 4KUDC 3C1BD 3O62B 1TZYB 3B6GD 5CPJC 4NE5A 2CV5C 3AV1D 5GT0D 4QLCB 5G49B 3AN2D 2F8NB 4XZQB 5GSUC 5B0ZB 1N1JB 2YFVA 4H9PA 3VH6A 3REHC 3UT9B 5GXQD 3AZNA 1KX4A 1M19A 3LELA 2PYOC 3KUYD 4G91C 3AN2B 3MGRB 1P3MC 2NQBB 1KX5B 3MVDB 4WU8B 2HUEB 3C1CB 4AWLC 4KHAB 1N1JA 3UT9A 1P3GD 1ZLAB 1P3BA 1P3AD 5AV9B 1M1AA 3AZEA 3AV2A 4H9OB 1U35A 2RVQD 4J8VB 3AZGC 3X1UD 3KXBC 3REKB 4E44A 1P34D 1M18D 1H3OA 3MGSA 3REJA 1F66C 3O62D 1TZYD 5AV5B 4KHAA 5AV8B 5B24C 2IO5B 5CPJA 2CV5A 1S32C 3X1SC 4H9OA 3W99C 5B33C 4JJNB 5E5AB 5B0ZD 4H9RB 4WNNA 3REHA 3AZFA 3AZLA 4J8WC 3W97B 5CHLB 2PYOA 3MGRD 5CPIC 2NQBD 3LZ1C 3MVDD 3MGPA 3WKJB 5AY8D 3UTBC 2NZDB 5JRGC 3C1CD 1EQZC 5C3IB 3AZKB 4Z2MH 1ZLAD 5AV9D 4YS3C 5CPKD 3MNNC 4YM6B 4J8VD 1P3FC 3AZGA 4DRBA 1P3LC 5AV6B 3LJAD 3REKD 3X1TD 2LY8A 3LZ0B 1F66A 4ZBJB 5GT3C 2NZDA 4LD9C 3KSYA 5AV5D 1P3IC 3R45B 1BFMA 5DNNA 5AV8D 3AZJB 3TU4B 1P3OC 5AVBB 4ZUXB 3AZIA 5B2JA 5F99B 3KWQD 1S32A 2FJ7B 2AROC 3REIA 5B33A 4WU9B 5E5AD 1P3PA 4KGCB 3C1BC 3B6GC 5BNVA 2BYMB 3W97D 3AZJA 5B31B 3WTPD 3AV1C 5GT0C 5CPIA 2FJ7A 3WKJD 3X1VB 3AN2C 1AOIB 3W98B 4NE6A 5JRGA 3AZKD 1EQZA 5BT1D 2F8NH 5B2IB 1ID3D 3AYWB 4YS3A 3AZHB 4YM6D 1KX3D 3KUYC 1P3FA 3AFAD 5AV6D 4R8PB 3LZ0D 4Z5TB 3W96A 3TU4D 1P3GC 1P3OA 3B6FD 5F99D 2RVQC 4WU9D 3VH5A 4Z66D 4KGCD 1P34C 1M18C 1P3KC 4H9PB 5B40A 1TZYC 5B1LA 4NFTA 5B1MA 3AZNB 1M19B 3LELB 2L5AA 4HGAB 5B0YC 4H9NA 5GT0A 3WA9A 4J8UD 5DNMD 4X23B 4XUJA 5B0ZC 3V9RA 1AOID 3W98D 2HIOD 5CP6D 5B2ID 3MGQA 3AYWD 1HQ3B 3A6ND 3AZHD 1P3BB 1M1AB 3AZEB 3AV2B 3B0DB 1U35B 3MGRC 4R8PD 2NQBC 3MVDC 5AY8C 4X23A 1KU5A 4Z5TD 1H3OB 3MGSB 3C1CC 5B32B 4G92B 1R4VA 3REJB 5BO0A 1ZLAC 1P3GA 3WAAA 1HQ3A 5CPJB 5CPKC 4J8VC 2CV5B 3B0CT 4H9SC 3LJAC 3REKC 2F8NG 3X1TC 1P34A 1P3KA 5AVCA 4WNNB 3REHB 3AZND 5B32A 5AV5C 3AZFB 1M19D 1KX4D 3AZLB 4KUDA 5AV8C 2IO5C 1WWIA 3UTAC 5B0YA 2PYOB 3KWQC 4G91B 1P3MB 3MGPB 5E5AC 4QLCD 2F8ND 1BH9A 1Q9CA 4XZQD 5GSUA 4AWLB 4CSRA 4H9QA 3UT9D 1BH8A 3WTPE 3W97C 1M1AD 3AZED 3AV2D 1U35D 3AZGB 3WTPC 3WKJC 1P3MA 1KX5D 4WU8D 3MGSD 3REJD 1F66B 3NQUA 5C3IC 3VH5T 5BT1C 2F8NK 1ID3C 3AZMC 5DNNB 5B24B 5CPKA 4YM6C 3AZIB 5B2JB 4EO5B 1F1EA 1KX3C 1S32B 3REIB 3AFAC 3RELC 5B33B 4H9SA 1P3PB 3KXBA 4NE3A 3AZFD 3AZLD 3TU4C 5BS7C 5BNVB 4J8WB 3UTAA 3B6FC 5F99C 5B24A 4J8XC 2PYOD 3VH6T 3KWQA 3MGPD 5CPIB 4Z66C 4WU9C 3X1SA 3W99A 4KGCC 4JJND 5JRGB 5KDMB 1EQZB 4YS3B 3B0BA 5BNXB 4J8WA 1P3FB 3WTPA 4J8UC 5DNMC 1P3LB 3LZ1A 1AOIC 1JFIA 2HIOC 1F66D 5CP6C 2NZDD 3UTBA 5GT3B 5B2IC 5KDMA 3AYWC 3AZMA 5DNND 3A6NC 1ID3A 3W96B 1P3OB 5GXQC 3AZID 5B2JD 3MNNA 1KX3A 5BNXA 3REID 2BYKB 4R8PC 3RELA 1P3LA 2CWEA 1P3PD 4Z5TC 5JA4B 5B40B 3VH6W 5B1MB 5B1LB 5GT3A 3B6GB 4LD9A 1P3IA 3AZJD 2YFWA 5AVBD 4J8XA 1P3AC 4ZUXD 5B31G 4H9NB 5GT0B 4WZSB 3AV1B 2FJ7D 3WA9B 2AROA 2BYKA 4XUJB 3V9RB 3X1UC 5JRGD 1EQZD 3AZNC 3MGQB 5JA4A 1M19C 1KX4C 4YS3D 3O62C 3C1BA 3B6GA 4HGAC 1P3FD 5B31D 5DNMA 3AV1A 4QLCC 3X1VD 5FUGA 3AN2A 4XZQC 5BO0B 3UT9C 3A6NA 3W96D 3WAAB 1P3GB 5GXQA 1M1AC 3AZEC 3AV2C 3B0DC 1U35C 4UUZA 3KUYA 1KX5C 1P34B 4WU8C 3MGSC 5AVCB 4G92C 5B40D 3REJC 1P3KB 3NQJA 2HUEC 5B1MD 5B1LD 4KUDB 5AV9C 1TAFA 5B0YB 1P3AA 3WA9D 4XUJD 3X1UA 1BH9B 5GSUB 1M18A 3MGQD 4CSRB 2JSSA 3AZFC 4H9QB 3AZLC 1BH8B 3O62A 1TZYA 3LELD 3MGPC 4QLCA 4X23D 5AY8B 5G49A 1A7WA 4JJNC 1ULYA 2F8NA 4XZQA 5B0ZA 3NQUB 5B32G 3WAAD 1HQ3D 5CPKB 1P3BD 3MGRA 3LJAB 2NQBA 1KX5A 3X1TB 3MVDA 1P3KD 5AVCD 4WU8A 5AY8A 3KXBB 2NZDC 5B32D 3C1CA 4KUDD 3AZKC 5DNNC 3B0CW 4WV4B 1ZLAA 3UTAB 3AZIC 5CPJD 5B2JC 4EO5C 5B0YD 5AV9A 3KWQB 3REIC 2CV5D 4J8VA 3X1SB 3W99B 5AV6C 1P3PC 3LJAA 3REKA 3X1TA 5GSUD 3LZ0C 4ZBJC 3REHD 5AV5A 3AZJC 5AV8A 5AVBC 4ZUXC 3WTPB 2FJ7C 1P3MD 3LZ1B 1JFIB 4JJNA 5E5AA 3UTBB 4H9RA 1ID3B 3AZMB 4CAYB 3W97A 3MNNB 1KX3B 5B31C 3AFAB 3RELB 3AZGD 3VH5W 1B67A 3X1VC 3WKJA 3KXBD 4DRAA 3W98C 3AZKA 3W96C 1WWSA 4LD9B 3UTAD 1P3IB 3B6FB 5B24D 2YFWB 4CAYA 3AZHC 4M6BA 4J8XB 4YM6A 1S32D 3X1SD 4Z66B 3W99D 2AROB 3AFAA 5B33D 5AV6A 5B40C 3LZ0A 5B1MC 5B1LC 3R45A 3C1BB 4J8WD 3TU4A 5BS7A 5AVBA 1HTAA 4ZUXA 3B6FA 1B6WA 5F99A 3WA9C 4J8UB 4XUJC 5DNMB 5CPID 3LZ1D 4Z66A 4WU9A 5FUGB 2HIOB 5CP6B 3UTBD
chains in the Genus database with same CATH superfamily
4KGCA 3MGQC 3AZMD 2FFFB 3A6NB 5GXQB 2BYMA 3MNND 3LELC 3RELD 5B31A 4UUZB 3KUYB 1P3LD 4X23C 4J8UA 3X1VA 1AOIA 3W98A 2HIOA 3NQJB 5CP6A 5GT3D 3WAAC 4LD9D 5B2IA 1P3ID 1HQ3C 3AYWA 1P3OD 1P3BC 4J8XD 3AZHA 1TAFB 1P3AB 2AROD 4R8PA 5AVCC 3X1UB 4Z2MG 2YFVB 4E45A 4Z5TA 1M18B 5B32C 1KX4B 4KUDC 3C1BD 3O62B 1TZYB 3B6GD 5CPJC 4NE5A 2VQRA 2CV5C 3AV1D 5GT0D 4QLCB 5G49B 3AN2D 2F8NB 4XZQB 5GSUC 5B0ZB 1N1JB 2YFVA 4H9PA 3VH6A 3REHC 3UT9B 5GXQD 3AZNA 1KX4A 1M19A 3LELA 2PYOC 3KUYD 4G91C 3AN2B 3MGRB 1P3MC 2NQBB 1KX5B 3MVDB 4WU8B 2BG1A 2HUEB 3C1CB 4AWLC 4KHAB 1N1JA 3UT9A 1P3GD 1ZLAB 1P3BA 1P3AD 5AV9B 1M1AA 3A1KA 3AZEA 4H9OB 3AV2A 1U35A 2RVQD 4J8VB 3AZGC 3X1UD 3KXBC 3REKB 4E44A 1P34D 1M18D 1H3OA 3MGSA 3REJA 1F66C 3O62D 1TZYD 5AV5B 2Y2NA 4KHAA 5AV8B 5B24C 2IO5B 5CPJA 2CV5A 1S32C 3X1SC 4H9OA 3W99C 5B33C 4DQYB 4JJNB 5E5AB 5B0ZD 4H9RB 4WNNA 3REHA 3AZFA 3IP4C 3AZLA 4J8WC 3W97B 5CHLB 2PYOA 3MGRD 5CPIC 2NQBD 3LZ1C 3MVDD 3MGPA 3WKJB 5AY8D 3UTBC 2NZDB 5JRGC 3C1CD 1EQZC 5C3IB 3AZKB 4Z2MH 1ZLAD 5AV9D 4YS3C 5CPKD 3MNNC 4YM6B 4J8VD 1P3FC 3AZGA 4DRBA 1P3LC 5AV6B 3LJAD 3REKD 3X1TD 2LY8A 3LZ0B 1F66A 4ZBJB 5GT3C 2NZDA 4LD9C 3KSYA 5AV5D 1P3IC 3R45B 1BFMA 5DNNA 5AV8D 3AZJB 2DF4C 3TU4B 1P3OC 5AVBB 4ZUXB 3AZIA 5B2JA 5F99B 3KWQD 1S32A 2FJ7B 2AROC 3REIA 5B33A 4WU9B 5E5AD 1P3PA 4KGCB 3C1BC 3B6GC 5BNVA 2BYMB 3W97D 3AZJA 3P5JB 5B31B 3WTPD 3AV1C 5GT0C 5CPIA 2FJ7A 3WKJD 3X1VB 3AN2C 1AOIB 3W98B 4NE6A 5JRGA 3AZKD 1EQZA 5BT1D 2F8NH 5B2IB 1ID3D 3AYWB 1Z2CB 4YS3A 3AZHB 4YM6D 1KX3D 3KUYC 1P3FA 3AFAD 5AV6D 4R8PB 2DQNC 3LZ0D 4Z5TB 3W96A 3TU4D 1P3GC 1P3OA 3B6FD 5F99D 2Y2MA 2RVQC 3FDDA 4WU9D 3VH5A 4Z66D 4KGCD 1P34C 1M18C 1P3KC 4H9PB 5B40A 4WJ3C 3H0LC 1TZYC 5B1LA 4NFTA 5B1MA 3AZNB 1M19B 3LELB 2L5AA 4HGAB 5B0YC 4H9NA 5GT0A 3WA9A 4J8UD 5DNMD 4X23B 4XUJA 5B0ZC 3V9RA 1AOID 3W98D 2HIOD 5CP6D 5B2ID 3MGQA 3AYWD 1HQ3B 3A6ND 3AZHD 1P3BB 1M1AB 3AZEB 3AV2B 3B0DB 1U35B 3MGRC 4R8PD 2NQBC 3MVDC 5AY8C 4X23A 1KU5A 4Z5TD 1H3OB 3MGSB 3C1CC 2ZY2A 5B32B 1R4VA 4G92B 5BO0A 3H0MC 3REJB 2Y2PA 1ZLAC 1P3GA 3WAAA 1HQ3A 5CPJB 5CPKC 4J8VC 2CV5B 3B0CT 4H9SC 3LJAC 3REKC 2UWXA 3X1TC 2F8NG 1P34A 1P3KA 5AVCA 4WNNB 3REHB 3AZND 5B32A 5AV5C 3AZFB 1M19D 1KX4D 3AZLB 4KUDA 5AV8C 2IO5C 1WWIA 2XD5A 1PZRA 3UTAC 5B0YA 2PYOB 3KWQC 2ZM5A 4G91B 1P3MB 3F6TA 3MGPB 5E5AC 4QLCD 2F8ND 1BH9A 1Q9CA 4XZQD 5GSUA 4AWLB 3EPHA 4CSRA 4H9QA 3UT9D 2Y2IA 1BH8A 3WTPE 3W97C 1M1AD 3AZED 3AV2D 1U35D 3AZGB 3WTPC 3KFUG 2Y2QA 3WKJC 1P3MA 1KX5D 4WU8D 2J8PA 3MGSD 3REJD 1F66B 3NQUA 5C3IC 3VH5T 5BT1C 2F8NK 1ID3C 3AZMC 5DNNB 5B24B 5CPKA 4YM6C 3AZIB 5B2JB 4EO5B 1F1EA 1KX3C 1S32B 3REIB 3AFAC 3RELC 5B33B 4H9SA 1P3PB 3KXBA 4NE3A 3AZFD 3AZLD 3TU4C 5BS7C 5BNVB 4J8WB 3EPJA 3UTAA 3B6FC 5F99C 5B24A 4J8XC 2PYOD 3VH6T 3KWQA 3MGPD 5CPIB 4Z66C 4WU9C 3X1SA 3W99A 4KGCC 4JJND 5JRGB 5KDMB 1EQZB 2Y2JA 4YS3B 3B0BA 5BNXB 4J8WA 1P3FB 2JE5A 3WTPA 4J8UC 5DNMC 1P3LB 3A1IA 3LZ1A 1AOIC 1JFIA 2ZY3A 2HIOC 1F66D 5CP6C 2NZDD 3UTBA 5GT3B 5B2IC 5KDMA 3AYWC 3AZMA 5DNND 3A6NC 1ID3A 3W96B 1P3OB 5GXQC 3AZID 5B2JD 3MNNA 1KX3A 5BNXA 3REID 2BYKB 4R8PC 3RELA 1P3LA 2CWEA 1P3PD 2ZY4A 4Z5TC 5JA4B 5B40B 3VH6W 5B1MB 5B1LB 5GT3A 3B6GB 4LD9A 1P3IA 3AZJD 2YFWA 5AVBD 4J8XA 1P3AC 4ZUXD 3AL0C 5B31G 2RIQA 4H9NB 5GT0B 4WZSB 3AV1B 2FJ7D 3WA9B 2AROA 2BYKA 4XUJB 3V9RB 3X1UC 5JRGD 1EQZD 3AZNC 3MGQB 5JA4A 1M19C 1KX4C 4YS3D 3O62C 3C1BA 3B6GA 4HGAC 1P3FD 5B31D 5DNMA 3AV1A 4QLCC 3X1VD 5FUGA 3AN2A 4XZQC 2Y2LA 5BO0B 3UT9C 3A6NA 3W96D 3WAAB 1P3GB 5GXQA 1M1AC 3AZEC 3AV2C 3B0DC 1U35C 2Y2KA 4UUZA 3KUYA 2Y2HA 1KX5C 1P34B 4WU8C 3MGSC 5AVCB 4G92C 5B40D 3REJC 1P3KB 3NQJA 2HUEC 5B1MD 5B1LD 4KUDB 5AV9C 1TAFA 5B0YB 1T3UA 1P3AA 3WA9D 2F2AC 4XUJD 3X1UA 1BH9B 5GSUB 1M18A 3MGQD 4CSRB 2JSSA 3AZFC 4H9QB 3AZLC 1BH8B 3O62A 1TZYA 3LELD 3MGPC 4QLCA 4X23D 5AY8B 5G49A 1A7WA 4JJNC 1ULYA 2F8NA 4XZQA 5B0ZA 3NQUB 5B32G 3WAAD 1HQ3D 5CPKB 3H0RC 1P3BD 3MGRA 3LJAB 2NQBA 1KX5A 3X1TB 3MVDA 1P3KD 5AVCD 4WU8A 5AY8A 3KXBB 2NZDC 5B32D 3C1CA 4KUDD 3AZKC 5DNNC 3B0CW 4WV4B 1ZLAA 3UTAB 3AZIC 5CPJD 5B2JC 4EO5C 5B0YD 5AV9A 3KWQB 3REIC 2CV5D 4J8VA 3X1SB 3W99B 5AV6C 1P3PC 3LJAA 3REKA 3X1TA 5GSUD 3LZ0C 4ZBJC 2JCHA 3REHD 5AV5A 3AZJC 5AV8A 5AVBC 4ZUXC 3EPKA 2ZY5A 3WTPB 2FJ7C 1P3MD 1W2EA 4UPKA 3LZ1B 1JFIB 4JJNA 5E5AA 3UTBB 4H9RA 1ID3B 3AZMB 4CAYB 2XD1A 3W97A 2W8SA 3MNNB 1KX3B 5B31C 3AFAB 3RELB 3AZGD 3VH5W 1B67A 3X1VC 3WKJA 3KXBD 4DRAA 3W98C 3AZKA 3W96C 1WWSA 4LD9B 3UTAD 1P3IB 3B6FB 5B24D 2YFWB 4CAYA 3AZHC 4M6BA 4J8XB 4YM6A 2G5HC 1S32D 3X1SD 4Z66B 3W99D 2AROB 3AFAA 5B33D 5AV6A 3EPLA 2Y2OA 5B40C 3LZ0A 5B1MC 5B1LC 3R45A 3C1BB 4J8WD 3TU4A 5BS7A 5AVBA 2Y2GA 1HTAA 3EG5B 4ZUXA 3B6FA 1B6WA 5F99A 3WA9C 4J8UB 4XUJC 5DNMB 5CPID 3LZ1D 2G5IC 4Z66A 4WU9A 5FUGB 2HIOB 5CP6B 3UTBD
chains in the Genus database with same CATH topology
4KGCA 3MGQC 3AZMD 2FFFB 3A6NB 5GXQB 2BYMA 3MNND 3LELC 3RELD 5B31A 4UUZB 3KUYB 1P3LD 4X23C 4J8UA 3X1VA 1AOIA 3W98A 2HIOA 3NQJB 5CP6A 5GT3D 3WAAC 4LD9D 5B2IA 1P3ID 1HQ3C 3AYWA 1P3OD 1P3BC 4J8XD 3AZHA 1TAFB 1P3AB 2AROD 4R8PA 5AVCC 3X1UB 4Z2MG 2YFVB 4E45A 4Z5TA 1M18B 5B32C 1KX4B 4KUDC 3C1BD 3O62B 1TZYB 3B6GD 5CPJC 4NE5A 2VQRA 2CV5C 3AV1D 5GT0D 4QLCB 5G49B 3AN2D 2F8NB 4XZQB 5GSUC 5B0ZB 1N1JB 2YFVA 4H9PA 3VH6A 3REHC 3UT9B 5GXQD 3AZNA 1KX4A 1M19A 3LELA 2PYOC 3KUYD 4G91C 3AN2B 3MGRB 1P3MC 2NQBB 1KX5B 3MVDB 4WU8B 2BG1A 2HUEB 3C1CB 4AWLC 4KHAB 1N1JA 3UT9A 1P3GD 1ZLAB 1P3BA 1P3AD 5AV9B 1M1AA 3A1KA 3AZEA 4H9OB 3AV2A 1U35A 2RVQD 4J8VB 3AZGC 3X1UD 3KXBC 3REKB 4E44A 1P34D 1M18D 1H3OA 3MGSA 3REJA 1F66C 3O62D 1TZYD 5AV5B 2Y2NA 4KHAA 5AV8B 5B24C 2IO5B 5CPJA 2CV5A 1S32C 3X1SC 4H9OA 3W99C 5B33C 4DQYB 4JJNB 5E5AB 5B0ZD 4H9RB 4WNNA 3REHA 3AZFA 3IP4C 3AZLA 4J8WC 3W97B 5CHLB 2PYOA 3MGRD 5CPIC 2NQBD 3LZ1C 3MVDD 3MGPA 3WKJB 5AY8D 3UTBC 2NZDB 5JRGC 3C1CD 1EQZC 5C3IB 3AZKB 4Z2MH 1ZLAD 5AV9D 4YS3C 5CPKD 3MNNC 4YM6B 4J8VD 1P3FC 3AZGA 4DRBA 1P3LC 5AV6B 3LJAD 3REKD 3X1TD 2LY8A 3LZ0B 1F66A 4ZBJB 5GT3C 2NZDA 4LD9C 3KSYA 5AV5D 1P3IC 3R45B 1BFMA 5DNNA 5AV8D 3AZJB 2DF4C 3TU4B 1P3OC 5AVBB 4ZUXB 3AZIA 5B2JA 5F99B 3KWQD 1S32A 2FJ7B 2AROC 3REIA 5B33A 4WU9B 5E5AD 1P3PA 4KGCB 3C1BC 3B6GC 5BNVA 2BYMB 3W97D 3AZJA 3P5JB 5B31B 3WTPD 3AV1C 5GT0C 5CPIA 2FJ7A 3WKJD 3X1VB 3AN2C 1AOIB 3W98B 4NE6A 5JRGA 3AZKD 1EQZA 5BT1D 2F8NH 5B2IB 1ID3D 3AYWB 1Z2CB 4YS3A 3AZHB 4YM6D 1KX3D 3KUYC 1P3FA 3AFAD 5AV6D 4R8PB 2DQNC 3LZ0D 4Z5TB 3W96A 3TU4D 1P3GC 1P3OA 3B6FD 5F99D 2Y2MA 2RVQC 3FDDA 4WU9D 3VH5A 4Z66D 4KGCD 1P34C 1M18C 1P3KC 4H9PB 5B40A 4WJ3C 3H0LC 1TZYC 5B1LA 4NFTA 5B1MA 3AZNB 1M19B 3LELB 2L5AA 4HGAB 5B0YC 4H9NA 5GT0A 3WA9A 4J8UD 5DNMD 4X23B 4XUJA 5B0ZC 3V9RA 1AOID 3W98D 2HIOD 5CP6D 5B2ID 3MGQA 3AYWD 1HQ3B 3A6ND 3AZHD 1P3BB 1M1AB 3AZEB 3AV2B 3B0DB 1U35B 3MGRC 4R8PD 2NQBC 3MVDC 5AY8C 4X23A 1KU5A 4Z5TD 1H3OB 3MGSB 3C1CC 2ZY2A 5B32B 1R4VA 4G92B 5BO0A 3H0MC 3REJB 2Y2PA 1ZLAC 1P3GA 3WAAA 1HQ3A 5CPJB 5CPKC 4J8VC 2CV5B 3B0CT 4H9SC 3LJAC 3REKC 2UWXA 3X1TC 2F8NG 1P34A 1P3KA 5AVCA 4WNNB 3REHB 3AZND 5B32A 5AV5C 3AZFB 1M19D 1KX4D 3AZLB 4KUDA 5AV8C 2IO5C 1WWIA 2XD5A 1PZRA 3UTAC 5B0YA 2PYOB 3KWQC 2ZM5A 4G91B 1P3MB 3F6TA 3MGPB 5E5AC 4QLCD 2F8ND 1BH9A 1Q9CA 4XZQD 5GSUA 4AWLB 3EPHA 4CSRA 4H9QA 3UT9D 2Y2IA 1BH8A 3WTPE 3W97C 1M1AD 3AZED 3AV2D 1U35D 3AZGB 3WTPC 3KFUG 2Y2QA 3WKJC 1P3MA 1KX5D 4WU8D 2J8PA 3MGSD 3REJD 1F66B 3NQUA 5C3IC 3VH5T 5BT1C 2F8NK 1ID3C 3AZMC 5DNNB 5B24B 5CPKA 4YM6C 3AZIB 5B2JB 4EO5B 1F1EA 1KX3C 1S32B 3REIB 3AFAC 3RELC 5B33B 4H9SA 1P3PB 3KXBA 4NE3A 3AZFD 3AZLD 3TU4C 5BS7C 5BNVB 4J8WB 3EPJA 3UTAA 3B6FC 5F99C 5B24A 4J8XC 2PYOD 3VH6T 3KWQA 3MGPD 5CPIB 4Z66C 4WU9C 3X1SA 3W99A 4KGCC 4JJND 5JRGB 5KDMB 1EQZB 2Y2JA 4YS3B 3B0BA 5BNXB 4J8WA 1P3FB 2JE5A 3WTPA 4J8UC 5DNMC 1P3LB 3A1IA 3LZ1A 1AOIC 1JFIA 2ZY3A 2HIOC 1F66D 5CP6C 2NZDD 3UTBA 5GT3B 5B2IC 5KDMA 3AYWC 3AZMA 5DNND 3A6NC 1ID3A 3W96B 1P3OB 5GXQC 3AZID 5B2JD 3MNNA 1KX3A 5BNXA 3REID 2BYKB 4R8PC 3RELA 1P3LA 2CWEA 1P3PD 2ZY4A 4Z5TC 5JA4B 5B40B 3VH6W 5B1MB 5B1LB 5GT3A 3B6GB 4LD9A 1P3IA 3AZJD 2YFWA 5AVBD 4J8XA 1P3AC 4ZUXD 3AL0C 5B31G 2RIQA 4H9NB 5GT0B 4WZSB 3AV1B 2FJ7D 3WA9B 2AROA 2BYKA 4XUJB 3V9RB 3X1UC 5JRGD 1EQZD 3AZNC 3MGQB 5JA4A 1M19C 1KX4C 4YS3D 3O62C 3C1BA 3B6GA 4HGAC 1P3FD 5B31D 5DNMA 3AV1A 4QLCC 3X1VD 5FUGA 3AN2A 4XZQC 2Y2LA 5BO0B 3UT9C 3A6NA 3W96D 3WAAB 1P3GB 5GXQA 1M1AC 3AZEC 3AV2C 3B0DC 1U35C 2Y2KA 4UUZA 3KUYA 2Y2HA 1KX5C 1P34B 4WU8C 3MGSC 5AVCB 4G92C 5B40D 3REJC 1P3KB 3NQJA 2HUEC 5B1MD 5B1LD 4KUDB 5AV9C 1TAFA 5B0YB 1T3UA 1P3AA 3WA9D 2F2AC 4XUJD 3X1UA 1BH9B 5GSUB 1M18A 3MGQD 4CSRB 2JSSA 3AZFC 4H9QB 3AZLC 1BH8B 3O62A 1TZYA 3LELD 3MGPC 4QLCA 4X23D 5AY8B 5G49A 1A7WA 4JJNC 1ULYA 2F8NA 4XZQA 5B0ZA 3NQUB 5B32G 3WAAD 1HQ3D 5CPKB 3H0RC 1P3BD 3MGRA 3LJAB 2NQBA 1KX5A 3X1TB 3MVDA 1P3KD 5AVCD 4WU8A 5AY8A 3KXBB 2NZDC 5B32D 3C1CA 4KUDD 3AZKC 5DNNC 3B0CW 4WV4B 1ZLAA 3UTAB 3AZIC 5CPJD 5B2JC 4EO5C 5B0YD 5AV9A 3KWQB 3REIC 2CV5D 4J8VA 3X1SB 3W99B 5AV6C 1P3PC 3LJAA 3REKA 3X1TA 5GSUD 3LZ0C 4ZBJC 2JCHA 3REHD 5AV5A 3AZJC 5AV8A 5AVBC 4ZUXC 3EPKA 2ZY5A 3WTPB 2FJ7C 1P3MD 1W2EA 4UPKA 3LZ1B 1JFIB 4JJNA 5E5AA 3UTBB 4H9RA 1ID3B 3AZMB 4CAYB 2XD1A 3W97A 2W8SA 3MNNB 1KX3B 5B31C 3AFAB 3RELB 3AZGD 3VH5W 1B67A 3X1VC 3WKJA 3KXBD 4DRAA 3W98C 3AZKA 3W96C 1WWSA 4LD9B 3UTAD 1P3IB 3B6FB 5B24D 2YFWB 4CAYA 3AZHC 4M6BA 4J8XB 4YM6A 2G5HC 1S32D 3X1SD 4Z66B 3W99D 2AROB 3AFAA 5B33D 5AV6A 3EPLA 2Y2OA 5B40C 3LZ0A 5B1MC 5B1LC 3R45A 3C1BB 4J8WD 3TU4A 5BS7A 5AVBA 2Y2GA 1HTAA 3EG5B 4ZUXA 3B6FA 1B6WA 5F99A 3WA9C 4J8UB 4XUJC 5DNMB 5CPID 3LZ1D 2G5IC 4Z66A 4WU9A 5FUGB 2HIOB 5CP6B 3UTBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KGC A;  3MGQ C;  3AZM D;  3A6N B;  5GXQ B;  2BYM A;  3MNN D;  3LEL C;  3REL D;  5B31 A;  4UUZ B;  3KUY B;  1P3L D;  4X23 C;  4J8U A;  3X1V A;  1AOI A;  3W98 A;  2HIO A;  3NQJ B;  5CP6 A;  5GT3 D;  3WAA C;  4LD9 D;  5B2I A;  1P3I D;  1HQ3 C;  3AYW A;  1P3O D;  1P3B C;  4J8X D;  3AZH A;  1TAF B;  1P3A B;  2ARO D;  4R8P A;  5AVC C;  3X1U B;  4Z2M G;  2YFV B;  4E45 A;  4Z5T A;  1M18 B;  5B32 C;  1KX4 B;  4KUD C;  3C1B D;  3O62 B;  1TZY B;  3B6G D;  5CPJ C;  4NE5 A;  2CV5 C;  3AV1 D;  5GT0 D;  4QLC B;  5G49 B;  3AN2 D;  2F8N B;  4XZQ B;  5GSU C;  5B0Z B;  1N1J B;  2YFV A;  4H9P A;  3VH6 A;  3REH C;  3UT9 B;  5GXQ D;  3AZN A;  1KX4 A;  1M19 A;  3LEL A;  2PYO C;  3KUY D;  4G91 C;  3AN2 B;  3MGR B;  1P3M C;  2NQB B;  1KX5 B;  3MVD B;  4WU8 B;  2HUE B;  3C1C B;  4AWL C;  4KHA B;  1N1J A;  3UT9 A;  1P3G D;  1ZLA B;  1P3B A;  1P3A D;  5AV9 B;  1M1A A;  3AZE A;  3AV2 A;  4H9O B;  1U35 A;  2RVQ D;  4J8V B;  3AZG C;  3X1U D;  3KXB C;  3REK B;  4E44 A;  1P34 D;  1M18 D;  1H3O A;  3MGS A;  3REJ A;  1F66 C;  3O62 D;  1TZY D;  5AV5 B;  4KHA A;  5AV8 B;  5B24 C;  2IO5 B;  5CPJ A;  2CV5 A;  1S32 C;  3X1S C;  4H9O A;  3W99 C;  5B33 C;  4JJN B;  5E5A B;  5B0Z D;  4H9R B;  4WNN A;  3REH A;  3AZF A;  3AZL A;  4J8W C;  3W97 B;  5CHL B;  2PYO A;  3MGR D;  5CPI C;  2NQB D;  3LZ1 C;  3MVD D;  3MGP A;  3WKJ B;  5AY8 D;  3UTB C;  2NZD B;  5JRG C;  3C1C D;  1EQZ C;  5C3I B;  3AZK B;  4Z2M H;  1ZLA D;  5AV9 D;  4YS3 C;  5CPK D;  3MNN C;  4YM6 B;  4J8V D;  1P3F C;  3AZG A;  4DRB A;  1P3L C;  5AV6 B;  3LJA D;  3REK D;  3X1T D;  2LY8 A;  3LZ0 B;  1F66 A;  4ZBJ B;  5GT3 C;  2NZD A;  4LD9 C;  3KSY A;  5AV5 D;  1P3I C;  3R45 B;  1BFM A;  5DNN A;  5AV8 D;  3AZJ B;  3TU4 B;  1P3O C;  5AVB B;  4ZUX B;  3AZI A;  5B2J A;  5F99 B;  3KWQ D;  1S32 A;  2FJ7 B;  2ARO C;  3REI A;  5B33 A;  4WU9 B;  5E5A D;  1P3P A;  4KGC B;  3C1B C;  3B6G C;  5BNV A;  2BYM B;  3W97 D;  3AZJ A;  5B31 B;  3WTP D;  3AV1 C;  5GT0 C;  5CPI A;  2FJ7 A;  3WKJ D;  3X1V B;  3AN2 C;  1AOI B;  3W98 B;  4NE6 A;  5JRG A;  3AZK D;  1EQZ A;  5BT1 D;  2F8N H;  5B2I B;  1ID3 D;  3AYW B;  4YS3 A;  3AZH B;  4YM6 D;  1KX3 D;  3KUY C;  1P3F A;  3AFA D;  5AV6 D;  4R8P B;  3LZ0 D;  4Z5T B;  3W96 A;  3TU4 D;  1P3G C;  1P3O A;  3B6F D;  5F99 D;  2RVQ C;  4WU9 D;  3VH5 A;  4Z66 D;  4KGC D;  1P34 C;  1M18 C;  1P3K C;  4H9P B;  5B40 A;  1TZY C;  5B1L A;  4NFT A;  5B1M A;  3AZN B;  1M19 B;  3LEL B;  2L5A A;  4HGA B;  5B0Y C;  4H9N A;  5GT0 A;  3WA9 A;  4J8U D;  5DNM D;  4X23 B;  4XUJ A;  5B0Z C;  3V9R A;  1AOI D;  3W98 D;  2HIO D;  5CP6 D;  5B2I D;  3MGQ A;  3AYW D;  1HQ3 B;  3A6N D;  3AZH D;  1P3B B;  1M1A B;  3AZE B;  3AV2 B;  3B0D B;  1U35 B;  3MGR C;  4R8P D;  2NQB C;  3MVD C;  5AY8 C;  4X23 A;  1KU5 A;  4Z5T D;  1H3O B;  3MGS B;  3C1C C;  5B32 B;  4G92 B;  1R4V A;  3REJ B;  5BO0 A;  1ZLA C;  1P3G A;  3WAA A;  1HQ3 A;  5CPJ B;  5CPK C;  4J8V C;  2CV5 B;  3B0C T;  4H9S C;  3LJA C;  3REK C;  2F8N G;  3X1T C;  1P34 A;  1P3K A;  5AVC A;  4WNN B;  3REH B;  3AZN D;  5B32 A;  5AV5 C;  3AZF B;  1M19 D;  1KX4 D;  3AZL B;  4KUD A;  5AV8 C;  2IO5 C;  1WWI A;  3UTA C;  5B0Y A;  2PYO B;  3KWQ C;  4G91 B;  1P3M B;  3MGP B;  5E5A C;  4QLC D;  2F8N D;  1BH9 A;  1Q9C A;  4XZQ D;  5GSU A;  4AWL B;  4CSR A;  4H9Q A;  3UT9 D;  1BH8 A;  3WTP E;  3W97 C;  1M1A D;  3AZE D;  3AV2 D;  1U35 D;  3AZG B;  3WTP C;  3WKJ C;  1P3M A;  1KX5 D;  4WU8 D;  3MGS D;  3REJ D;  1F66 B;  3NQU A;  5C3I C;  3VH5 T;  5BT1 C;  2F8N K;  1ID3 C;  3AZM C;  5DNN B;  5B24 B;  5CPK A;  4YM6 C;  3AZI B;  5B2J B;  4EO5 B;  1F1E A;  1KX3 C;  1S32 B;  3REI B;  3AFA C;  3REL C;  5B33 B;  4H9S A;  1P3P B;  3KXB A;  4NE3 A;  3AZF D;  3AZL D;  3TU4 C;  5BS7 C;  5BNV B;  4J8W B;  3UTA A;  3B6F C;  5F99 C;  5B24 A;  4J8X C;  2PYO D;  3VH6 T;  3KWQ A;  3MGP D;  5CPI B;  4Z66 C;  4WU9 C;  3X1S A;  3W99 A;  4KGC C;  4JJN D;  5JRG B;  5KDM B;  1EQZ B;  4YS3 B;  3B0B A;  5BNX B;  4J8W A;  1P3F B;  3WTP A;  4J8U C;  5DNM C;  1P3L B;  3LZ1 A;  1AOI C;  1JFI A;  2HIO C;  1F66 D;  5CP6 C;  2NZD D;  3UTB A;  5GT3 B;  5B2I C;  5KDM A;  3AYW C;  3AZM A;  5DNN D;  3A6N C;  1ID3 A;  3W96 B;  1P3O B;  5GXQ C;  3AZI D;  5B2J D;  3MNN A;  1KX3 A;  5BNX A;  3REI D;  2BYK B;  4R8P C;  3REL A;  1P3L A;  2CWE A;  1P3P D;  4Z5T C;  5JA4 B;  5B40 B;  3VH6 W;  5B1M B;  5B1L B;  5GT3 A;  3B6G B;  4LD9 A;  1P3I A;  3AZJ D;  2YFW A;  5AVB D;  4J8X A;  1P3A C;  4ZUX D;  5B31 G;  4H9N B;  5GT0 B;  4WZS B;  3AV1 B;  2FJ7 D;  3WA9 B;  2ARO A;  2BYK A;  4XUJ B;  3V9R B;  3X1U C;  5JRG D;  1EQZ D;  3AZN C;  3MGQ B;  5JA4 A;  1M19 C;  1KX4 C;  4YS3 D;  3O62 C;  3C1B A;  3B6G A;  4HGA C;  1P3F D;  5B31 D;  5DNM A;  3AV1 A;  4QLC C;  3X1V D;  5FUG A;  3AN2 A;  4XZQ C;  5BO0 B;  3UT9 C;  3A6N A;  3W96 D;  3WAA B;  1P3G B;  5GXQ A;  1M1A C;  3AZE C;  3AV2 C;  3B0D C;  1U35 C;  4UUZ A;  3KUY A;  1KX5 C;  1P34 B;  4WU8 C;  3MGS C;  5AVC B;  4G92 C;  5B40 D;  3REJ C;  1P3K B;  3NQJ A;  2HUE C;  5B1M D;  5B1L D;  4KUD B;  5AV9 C;  1TAF A;  5B0Y B;  1P3A A;  3WA9 D;  4XUJ D;  3X1U A;  1BH9 B;  5GSU B;  1M18 A;  3MGQ D;  4CSR B;  2JSS A;  3AZF C;  4H9Q B;  3AZL C;  1BH8 B;  3O62 A;  1TZY A;  3LEL D;  3MGP C;  4QLC A;  4X23 D;  5AY8 B;  5G49 A;  1A7W A;  4JJN C;  1ULY A;  2F8N A;  4XZQ A;  5B0Z A;  3NQU B;  5B32 G;  3WAA D;  1HQ3 D;  5CPK B;  1P3B D;  3MGR A;  3LJA B;  2NQB A;  1KX5 A;  3X1T B;  3MVD A;  1P3K D;  5AVC D;  4WU8 A;  5AY8 A;  3KXB B;  2NZD C;  5B32 D;  3C1C A;  4KUD D;  3AZK C;  5DNN C;  3B0C W;  4WV4 B;  1ZLA A;  3UTA B;  3AZI C;  5CPJ D;  5B2J C;  4EO5 C;  5B0Y D;  5AV9 A;  3KWQ B;  3REI C;  2CV5 D;  4J8V A;  3X1S B;  3W99 B;  5AV6 C;  1P3P C;  3LJA A;  3REK A;  3X1T A;  5GSU D;  3LZ0 C;  4ZBJ C;  3REH D;  5AV5 A;  3AZJ C;  5AV8 A;  5AVB C;  4ZUX C;  3WTP B;  2FJ7 C;  1P3M D;  3LZ1 B;  1JFI B;  4JJN A;  5E5A A;  3UTB B;  4H9R A;  1ID3 B;  3AZM B;  4CAY B;  3W97 A;  3MNN B;  1KX3 B;  5B31 C;  3AFA B;  3REL B;  3AZG D;  3VH5 W;  1B67 A;  3X1V C;  3WKJ A;  3KXB D;  4DRA A;  3W98 C;  3AZK A;  3W96 C;  1WWS A;  4LD9 B;  3UTA D;  1P3I B;  3B6F B;  5B24 D;  2YFW B;  4CAY A;  3AZH C;  4M6B A;  4J8X B;  4YM6 A;  1S32 D;  3X1S D;  4Z66 B;  3W99 D;  2ARO B;  3AFA A;  5B33 D;  5AV6 A;  5B40 C;  3LZ0 A;  5B1M C;  5B1L C;  3R45 A;  3C1B B;  4J8W D;  3TU4 A;  5BS7 A;  5AVB A;  1HTA A;  4ZUX A;  3B6F A;  1B6W A;  5F99 A;  3WA9 C;  4J8U B;  4XUJ C;  5DNM B;  5CPI D;  3LZ1 D;  4Z66 A;  4WU9 A;  5FUG B;  2HIO B;  5CP6 B;  3UTB D; 
#chains in the Genus database with same CATH topology
 4KGC A;  3MGQ C;  3AZM D;  2FFF B;  3A6N B;  5GXQ B;  2BYM A;  3MNN D;  3LEL C;  3REL D;  5B31 A;  4UUZ B;  3KUY B;  1P3L D;  4X23 C;  4J8U A;  3X1V A;  1AOI A;  3W98 A;  2HIO A;  3NQJ B;  5CP6 A;  5GT3 D;  3WAA C;  4LD9 D;  5B2I A;  1P3I D;  1HQ3 C;  3AYW A;  1P3O D;  1P3B C;  4J8X D;  3AZH A;  1TAF B;  1P3A B;  2ARO D;  4R8P A;  5AVC C;  3X1U B;  4Z2M G;  2YFV B;  4E45 A;  4Z5T A;  1M18 B;  5B32 C;  1KX4 B;  4KUD C;  3C1B D;  3O62 B;  1TZY B;  3B6G D;  5CPJ C;  4NE5 A;  2VQR A;  2CV5 C;  3AV1 D;  5GT0 D;  4QLC B;  5G49 B;  3AN2 D;  2F8N B;  4XZQ B;  5GSU C;  5B0Z B;  1N1J B;  2YFV A;  4H9P A;  3VH6 A;  3REH C;  3UT9 B;  5GXQ D;  3AZN A;  1KX4 A;  1M19 A;  3LEL A;  2PYO C;  3KUY D;  4G91 C;  3AN2 B;  3MGR B;  1P3M C;  2NQB B;  1KX5 B;  3MVD B;  4WU8 B;  2BG1 A;  2HUE B;  3C1C B;  4AWL C;  4KHA B;  1N1J A;  3UT9 A;  1P3G D;  1ZLA B;  1P3B A;  1P3A D;  5AV9 B;  1M1A A;  3A1K A;  3AZE A;  4H9O B;  3AV2 A;  1U35 A;  2RVQ D;  4J8V B;  3AZG C;  3X1U D;  3KXB C;  3REK B;  4E44 A;  1P34 D;  1M18 D;  1H3O A;  3MGS A;  3REJ A;  1F66 C;  3O62 D;  1TZY D;  5AV5 B;  2Y2N A;  4KHA A;  5AV8 B;  5B24 C;  2IO5 B;  5CPJ A;  2CV5 A;  1S32 C;  3X1S C;  4H9O A;  3W99 C;  5B33 C;  4DQY B;  4JJN B;  5E5A B;  5B0Z D;  4H9R B;  4WNN A;  3REH A;  3AZF A;  3IP4 C;  3AZL A;  4J8W C;  3W97 B;  5CHL B;  2PYO A;  3MGR D;  5CPI C;  2NQB D;  3LZ1 C;  3MVD D;  3MGP A;  3WKJ B;  5AY8 D;  3UTB C;  2NZD B;  5JRG C;  3C1C D;  1EQZ C;  5C3I B;  3AZK B;  4Z2M H;  1ZLA D;  5AV9 D;  4YS3 C;  5CPK D;  3MNN C;  4YM6 B;  4J8V D;  1P3F C;  3AZG A;  4DRB A;  1P3L C;  5AV6 B;  3LJA D;  3REK D;  3X1T D;  2LY8 A;  3LZ0 B;  1F66 A;  4ZBJ B;  5GT3 C;  2NZD A;  4LD9 C;  3KSY A;  5AV5 D;  1P3I C;  3R45 B;  1BFM A;  5DNN A;  5AV8 D;  3AZJ B;  2DF4 C;  3TU4 B;  1P3O C;  5AVB B;  4ZUX B;  3AZI A;  5B2J A;  5F99 B;  3KWQ D;  1S32 A;  2FJ7 B;  2ARO C;  3REI A;  5B33 A;  4WU9 B;  5E5A D;  1P3P A;  4KGC B;  3C1B C;  3B6G C;  5BNV A;  2BYM B;  3W97 D;  3AZJ A;  3P5J B;  5B31 B;  3WTP D;  3AV1 C;  5GT0 C;  5CPI A;  2FJ7 A;  3WKJ D;  3X1V B;  3AN2 C;  1AOI B;  3W98 B;  4NE6 A;  5JRG A;  3AZK D;  1EQZ A;  5BT1 D;  2F8N H;  5B2I B;  1ID3 D;  3AYW B;  1Z2C B;  4YS3 A;  3AZH B;  4YM6 D;  1KX3 D;  3KUY C;  1P3F A;  3AFA D;  5AV6 D;  4R8P B;  2DQN C;  3LZ0 D;  4Z5T B;  3W96 A;  3TU4 D;  1P3G C;  1P3O A;  3B6F D;  5F99 D;  2Y2M A;  2RVQ C;  3FDD A;  4WU9 D;  3VH5 A;  4Z66 D;  4KGC D;  1P34 C;  1M18 C;  1P3K C;  4H9P B;  5B40 A;  4WJ3 C;  3H0L C;  1TZY C;  5B1L A;  4NFT A;  5B1M A;  3AZN B;  1M19 B;  3LEL B;  2L5A A;  4HGA B;  5B0Y C;  4H9N A;  5GT0 A;  3WA9 A;  4J8U D;  5DNM D;  4X23 B;  4XUJ A;  5B0Z C;  3V9R A;  1AOI D;  3W98 D;  2HIO D;  5CP6 D;  5B2I D;  3MGQ A;  3AYW D;  1HQ3 B;  3A6N D;  3AZH D;  1P3B B;  1M1A B;  3AZE B;  3AV2 B;  3B0D B;  1U35 B;  3MGR C;  4R8P D;  2NQB C;  3MVD C;  5AY8 C;  4X23 A;  1KU5 A;  4Z5T D;  1H3O B;  3MGS B;  3C1C C;  2ZY2 A;  5B32 B;  1R4V A;  4G92 B;  5BO0 A;  3H0M C;  3REJ B;  2Y2P A;  1ZLA C;  1P3G A;  3WAA A;  1HQ3 A;  5CPJ B;  5CPK C;  4J8V C;  2CV5 B;  3B0C T;  4H9S C;  3LJA C;  3REK C;  2UWX A;  3X1T C;  2F8N G;  1P34 A;  1P3K A;  5AVC A;  4WNN B;  3REH B;  3AZN D;  5B32 A;  5AV5 C;  3AZF B;  1M19 D;  1KX4 D;  3AZL B;  4KUD A;  5AV8 C;  2IO5 C;  1WWI A;  2XD5 A;  1PZR A;  3UTA C;  5B0Y A;  2PYO B;  3KWQ C;  2ZM5 A;  4G91 B;  1P3M B;  3F6T A;  3MGP B;  5E5A C;  4QLC D;  2F8N D;  1BH9 A;  1Q9C A;  4XZQ D;  5GSU A;  4AWL B;  3EPH A;  4CSR A;  4H9Q A;  3UT9 D;  2Y2I A;  1BH8 A;  3WTP E;  3W97 C;  1M1A D;  3AZE D;  3AV2 D;  1U35 D;  3AZG B;  3WTP C;  3KFU G;  2Y2Q A;  3WKJ C;  1P3M A;  1KX5 D;  4WU8 D;  2J8P A;  3MGS D;  3REJ D;  1F66 B;  3NQU A;  5C3I C;  3VH5 T;  5BT1 C;  2F8N K;  1ID3 C;  3AZM C;  5DNN B;  5B24 B;  5CPK A;  4YM6 C;  3AZI B;  5B2J B;  4EO5 B;  1F1E A;  1KX3 C;  1S32 B;  3REI B;  3AFA C;  3REL C;  5B33 B;  4H9S A;  1P3P B;  3KXB A;  4NE3 A;  3AZF D;  3AZL D;  3TU4 C;  5BS7 C;  5BNV B;  4J8W B;  3EPJ A;  3UTA A;  3B6F C;  5F99 C;  5B24 A;  4J8X C;  2PYO D;  3VH6 T;  3KWQ A;  3MGP D;  5CPI B;  4Z66 C;  4WU9 C;  3X1S A;  3W99 A;  4KGC C;  4JJN D;  5JRG B;  5KDM B;  1EQZ B;  2Y2J A;  4YS3 B;  3B0B A;  5BNX B;  4J8W A;  1P3F B;  2JE5 A;  3WTP A;  4J8U C;  5DNM C;  1P3L B;  3A1I A;  3LZ1 A;  1AOI C;  1JFI A;  2ZY3 A;  2HIO C;  1F66 D;  5CP6 C;  2NZD D;  3UTB A;  5GT3 B;  5B2I C;  5KDM A;  3AYW C;  3AZM A;  5DNN D;  3A6N C;  1ID3 A;  3W96 B;  1P3O B;  5GXQ C;  3AZI D;  5B2J D;  3MNN A;  1KX3 A;  5BNX A;  3REI D;  2BYK B;  4R8P C;  3REL A;  1P3L A;  2CWE A;  1P3P D;  2ZY4 A;  4Z5T C;  5JA4 B;  5B40 B;  3VH6 W;  5B1M B;  5B1L B;  5GT3 A;  3B6G B;  4LD9 A;  1P3I A;  3AZJ D;  2YFW A;  5AVB D;  4J8X A;  1P3A C;  4ZUX D;  3AL0 C;  5B31 G;  2RIQ A;  4H9N B;  5GT0 B;  4WZS B;  3AV1 B;  2FJ7 D;  3WA9 B;  2ARO A;  2BYK A;  4XUJ B;  3V9R B;  3X1U C;  5JRG D;  1EQZ D;  3AZN C;  3MGQ B;  5JA4 A;  1M19 C;  1KX4 C;  4YS3 D;  3O62 C;  3C1B A;  3B6G A;  4HGA C;  1P3F D;  5B31 D;  5DNM A;  3AV1 A;  4QLC C;  3X1V D;  5FUG A;  3AN2 A;  4XZQ C;  2Y2L A;  5BO0 B;  3UT9 C;  3A6N A;  3W96 D;  3WAA B;  1P3G B;  5GXQ A;  1M1A C;  3AZE C;  3AV2 C;  3B0D C;  1U35 C;  2Y2K A;  4UUZ A;  3KUY A;  2Y2H A;  1KX5 C;  1P34 B;  4WU8 C;  3MGS C;  5AVC B;  4G92 C;  5B40 D;  3REJ C;  1P3K B;  3NQJ A;  2HUE C;  5B1M D;  5B1L D;  4KUD B;  5AV9 C;  1TAF A;  5B0Y B;  1T3U A;  1P3A A;  3WA9 D;  2F2A C;  4XUJ D;  3X1U A;  1BH9 B;  5GSU B;  1M18 A;  3MGQ D;  4CSR B;  2JSS A;  3AZF C;  4H9Q B;  3AZL C;  1BH8 B;  3O62 A;  1TZY A;  3LEL D;  3MGP C;  4QLC A;  4X23 D;  5AY8 B;  5G49 A;  1A7W A;  4JJN C;  1ULY A;  2F8N A;  4XZQ A;  5B0Z A;  3NQU B;  5B32 G;  3WAA D;  1HQ3 D;  5CPK B;  3H0R C;  1P3B D;  3MGR A;  3LJA B;  2NQB A;  1KX5 A;  3X1T B;  3MVD A;  1P3K D;  5AVC D;  4WU8 A;  5AY8 A;  3KXB B;  2NZD C;  5B32 D;  3C1C A;  4KUD D;  3AZK C;  5DNN C;  3B0C W;  4WV4 B;  1ZLA A;  3UTA B;  3AZI C;  5CPJ D;  5B2J C;  4EO5 C;  5B0Y D;  5AV9 A;  3KWQ B;  3REI C;  2CV5 D;  4J8V A;  3X1S B;  3W99 B;  5AV6 C;  1P3P C;  3LJA A;  3REK A;  3X1T A;  5GSU D;  3LZ0 C;  4ZBJ C;  2JCH A;  3REH D;  5AV5 A;  3AZJ C;  5AV8 A;  5AVB C;  4ZUX C;  3EPK A;  2ZY5 A;  3WTP B;  2FJ7 C;  1P3M D;  1W2E A;  4UPK A;  3LZ1 B;  1JFI B;  4JJN A;  5E5A A;  3UTB B;  4H9R A;  1ID3 B;  3AZM B;  4CAY B;  2XD1 A;  3W97 A;  2W8S A;  3MNN B;  1KX3 B;  5B31 C;  3AFA B;  3REL B;  3AZG D;  3VH5 W;  1B67 A;  3X1V C;  3WKJ A;  3KXB D;  4DRA A;  3W98 C;  3AZK A;  3W96 C;  1WWS A;  4LD9 B;  3UTA D;  1P3I B;  3B6F B;  5B24 D;  2YFW B;  4CAY A;  3AZH C;  4M6B A;  4J8X B;  4YM6 A;  2G5H C;  1S32 D;  3X1S D;  4Z66 B;  3W99 D;  2ARO B;  3AFA A;  5B33 D;  5AV6 A;  3EPL A;  2Y2O A;  5B40 C;  3LZ0 A;  5B1M C;  5B1L C;  3R45 A;  3C1B B;  4J8W D;  3TU4 A;  5BS7 A;  5AVB A;  2Y2G A;  1HTA A;  3EG5 B;  4ZUX A;  3B6F A;  1B6W A;  5F99 A;  3WA9 C;  4J8U B;  4XUJ C;  5DNM B;  5CPI D;  3LZ1 D;  2G5I C;  4Z66 A;  4WU9 A;  5FUG B;  2HIO B;  5CP6 B;  3UTB D; 
#chains in the Genus database with same CATH homology
 4KGC A;  3MGQ C;  3AZM D;  2FFF B;  3A6N B;  5GXQ B;  2BYM A;  3MNN D;  3LEL C;  3REL D;  5B31 A;  4UUZ B;  3KUY B;  1P3L D;  4X23 C;  4J8U A;  3X1V A;  1AOI A;  3W98 A;  2HIO A;  3NQJ B;  5CP6 A;  5GT3 D;  3WAA C;  4LD9 D;  5B2I A;  1P3I D;  1HQ3 C;  3AYW A;  1P3O D;  1P3B C;  4J8X D;  3AZH A;  1TAF B;  1P3A B;  2ARO D;  4R8P A;  5AVC C;  3X1U B;  4Z2M G;  2YFV B;  4E45 A;  4Z5T A;  1M18 B;  5B32 C;  1KX4 B;  4KUD C;  3C1B D;  3O62 B;  1TZY B;  3B6G D;  5CPJ C;  4NE5 A;  2VQR A;  2CV5 C;  3AV1 D;  5GT0 D;  4QLC B;  5G49 B;  3AN2 D;  2F8N B;  4XZQ B;  5GSU C;  5B0Z B;  1N1J B;  2YFV A;  4H9P A;  3VH6 A;  3REH C;  3UT9 B;  5GXQ D;  3AZN A;  1KX4 A;  1M19 A;  3LEL A;  2PYO C;  3KUY D;  4G91 C;  3AN2 B;  3MGR B;  1P3M C;  2NQB B;  1KX5 B;  3MVD B;  4WU8 B;  2BG1 A;  2HUE B;  3C1C B;  4AWL C;  4KHA B;  1N1J A;  3UT9 A;  1P3G D;  1ZLA B;  1P3B A;  1P3A D;  5AV9 B;  1M1A A;  3A1K A;  3AZE A;  4H9O B;  3AV2 A;  1U35 A;  2RVQ D;  4J8V B;  3AZG C;  3X1U D;  3KXB C;  3REK B;  4E44 A;  1P34 D;  1M18 D;  1H3O A;  3MGS A;  3REJ A;  1F66 C;  3O62 D;  1TZY D;  5AV5 B;  2Y2N A;  4KHA A;  5AV8 B;  5B24 C;  2IO5 B;  5CPJ A;  2CV5 A;  1S32 C;  3X1S C;  4H9O A;  3W99 C;  5B33 C;  4DQY B;  4JJN B;  5E5A B;  5B0Z D;  4H9R B;  4WNN A;  3REH A;  3AZF A;  3IP4 C;  3AZL A;  4J8W C;  3W97 B;  5CHL B;  2PYO A;  3MGR D;  5CPI C;  2NQB D;  3LZ1 C;  3MVD D;  3MGP A;  3WKJ B;  5AY8 D;  3UTB C;  2NZD B;  5JRG C;  3C1C D;  1EQZ C;  5C3I B;  3AZK B;  4Z2M H;  1ZLA D;  5AV9 D;  4YS3 C;  5CPK D;  3MNN C;  4YM6 B;  4J8V D;  1P3F C;  3AZG A;  4DRB A;  1P3L C;  5AV6 B;  3LJA D;  3REK D;  3X1T D;  2LY8 A;  3LZ0 B;  1F66 A;  4ZBJ B;  5GT3 C;  2NZD A;  4LD9 C;  3KSY A;  5AV5 D;  1P3I C;  3R45 B;  1BFM A;  5DNN A;  5AV8 D;  3AZJ B;  2DF4 C;  3TU4 B;  1P3O C;  5AVB B;  4ZUX B;  3AZI A;  5B2J A;  5F99 B;  3KWQ D;  1S32 A;  2FJ7 B;  2ARO C;  3REI A;  5B33 A;  4WU9 B;  5E5A D;  1P3P A;  4KGC B;  3C1B C;  3B6G C;  5BNV A;  2BYM B;  3W97 D;  3AZJ A;  3P5J B;  5B31 B;  3WTP D;  3AV1 C;  5GT0 C;  5CPI A;  2FJ7 A;  3WKJ D;  3X1V B;  3AN2 C;  1AOI B;  3W98 B;  4NE6 A;  5JRG A;  3AZK D;  1EQZ A;  5BT1 D;  2F8N H;  5B2I B;  1ID3 D;  3AYW B;  1Z2C B;  4YS3 A;  3AZH B;  4YM6 D;  1KX3 D;  3KUY C;  1P3F A;  3AFA D;  5AV6 D;  4R8P B;  2DQN C;  3LZ0 D;  4Z5T B;  3W96 A;  3TU4 D;  1P3G C;  1P3O A;  3B6F D;  5F99 D;  2Y2M A;  2RVQ C;  3FDD A;  4WU9 D;  3VH5 A;  4Z66 D;  4KGC D;  1P34 C;  1M18 C;  1P3K C;  4H9P B;  5B40 A;  4WJ3 C;  3H0L C;  1TZY C;  5B1L A;  4NFT A;  5B1M A;  3AZN B;  1M19 B;  3LEL B;  2L5A A;  4HGA B;  5B0Y C;  4H9N A;  5GT0 A;  3WA9 A;  4J8U D;  5DNM D;  4X23 B;  4XUJ A;  5B0Z C;  3V9R A;  1AOI D;  3W98 D;  2HIO D;  5CP6 D;  5B2I D;  3MGQ A;  3AYW D;  1HQ3 B;  3A6N D;  3AZH D;  1P3B B;  1M1A B;  3AZE B;  3AV2 B;  3B0D B;  1U35 B;  3MGR C;  4R8P D;  2NQB C;  3MVD C;  5AY8 C;  4X23 A;  1KU5 A;  4Z5T D;  1H3O B;  3MGS B;  3C1C C;  2ZY2 A;  5B32 B;  1R4V A;  4G92 B;  5BO0 A;  3H0M C;  3REJ B;  2Y2P A;  1ZLA C;  1P3G A;  3WAA A;  1HQ3 A;  5CPJ B;  5CPK C;  4J8V C;  2CV5 B;  3B0C T;  4H9S C;  3LJA C;  3REK C;  2UWX A;  3X1T C;  2F8N G;  1P34 A;  1P3K A;  5AVC A;  4WNN B;  3REH B;  3AZN D;  5B32 A;  5AV5 C;  3AZF B;  1M19 D;  1KX4 D;  3AZL B;  4KUD A;  5AV8 C;  2IO5 C;  1WWI A;  2XD5 A;  1PZR A;  3UTA C;  5B0Y A;  2PYO B;  3KWQ C;  2ZM5 A;  4G91 B;  1P3M B;  3F6T A;  3MGP B;  5E5A C;  4QLC D;  2F8N D;  1BH9 A;  1Q9C A;  4XZQ D;  5GSU A;  4AWL B;  3EPH A;  4CSR A;  4H9Q A;  3UT9 D;  2Y2I A;  1BH8 A;  3WTP E;  3W97 C;  1M1A D;  3AZE D;  3AV2 D;  1U35 D;  3AZG B;  3WTP C;  3KFU G;  2Y2Q A;  3WKJ C;  1P3M A;  1KX5 D;  4WU8 D;  2J8P A;  3MGS D;  3REJ D;  1F66 B;  3NQU A;  5C3I C;  3VH5 T;  5BT1 C;  2F8N K;  1ID3 C;  3AZM C;  5DNN B;  5B24 B;  5CPK A;  4YM6 C;  3AZI B;  5B2J B;  4EO5 B;  1F1E A;  1KX3 C;  1S32 B;  3REI B;  3AFA C;  3REL C;  5B33 B;  4H9S A;  1P3P B;  3KXB A;  4NE3 A;  3AZF D;  3AZL D;  3TU4 C;  5BS7 C;  5BNV B;  4J8W B;  3EPJ A;  3UTA A;  3B6F C;  5F99 C;  5B24 A;  4J8X C;  2PYO D;  3VH6 T;  3KWQ A;  3MGP D;  5CPI B;  4Z66 C;  4WU9 C;  3X1S A;  3W99 A;  4KGC C;  4JJN D;  5JRG B;  5KDM B;  1EQZ B;  2Y2J A;  4YS3 B;  3B0B A;  5BNX B;  4J8W A;  1P3F B;  2JE5 A;  3WTP A;  4J8U C;  5DNM C;  1P3L B;  3A1I A;  3LZ1 A;  1AOI C;  1JFI A;  2ZY3 A;  2HIO C;  1F66 D;  5CP6 C;  2NZD D;  3UTB A;  5GT3 B;  5B2I C;  5KDM A;  3AYW C;  3AZM A;  5DNN D;  3A6N C;  1ID3 A;  3W96 B;  1P3O B;  5GXQ C;  3AZI D;  5B2J D;  3MNN A;  1KX3 A;  5BNX A;  3REI D;  2BYK B;  4R8P C;  3REL A;  1P3L A;  2CWE A;  1P3P D;  2ZY4 A;  4Z5T C;  5JA4 B;  5B40 B;  3VH6 W;  5B1M B;  5B1L B;  5GT3 A;  3B6G B;  4LD9 A;  1P3I A;  3AZJ D;  2YFW A;  5AVB D;  4J8X A;  1P3A C;  4ZUX D;  3AL0 C;  5B31 G;  2RIQ A;  4H9N B;  5GT0 B;  4WZS B;  3AV1 B;  2FJ7 D;  3WA9 B;  2ARO A;  2BYK A;  4XUJ B;  3V9R B;  3X1U C;  5JRG D;  1EQZ D;  3AZN C;  3MGQ B;  5JA4 A;  1M19 C;  1KX4 C;  4YS3 D;  3O62 C;  3C1B A;  3B6G A;  4HGA C;  1P3F D;  5B31 D;  5DNM A;  3AV1 A;  4QLC C;  3X1V D;  5FUG A;  3AN2 A;  4XZQ C;  2Y2L A;  5BO0 B;  3UT9 C;  3A6N A;  3W96 D;  3WAA B;  1P3G B;  5GXQ A;  1M1A C;  3AZE C;  3AV2 C;  3B0D C;  1U35 C;  2Y2K A;  4UUZ A;  3KUY A;  2Y2H A;  1KX5 C;  1P34 B;  4WU8 C;  3MGS C;  5AVC B;  4G92 C;  5B40 D;  3REJ C;  1P3K B;  3NQJ A;  2HUE C;  5B1M D;  5B1L D;  4KUD B;  5AV9 C;  1TAF A;  5B0Y B;  1T3U A;  1P3A A;  3WA9 D;  2F2A C;  4XUJ D;  3X1U A;  1BH9 B;  5GSU B;  1M18 A;  3MGQ D;  4CSR B;  2JSS A;  3AZF C;  4H9Q B;  3AZL C;  1BH8 B;  3O62 A;  1TZY A;  3LEL D;  3MGP C;  4QLC A;  4X23 D;  5AY8 B;  5G49 A;  1A7W A;  4JJN C;  1ULY A;  2F8N A;  4XZQ A;  5B0Z A;  3NQU B;  5B32 G;  3WAA D;  1HQ3 D;  5CPK B;  3H0R C;  1P3B D;  3MGR A;  3LJA B;  2NQB A;  1KX5 A;  3X1T B;  3MVD A;  1P3K D;  5AVC D;  4WU8 A;  5AY8 A;  3KXB B;  2NZD C;  5B32 D;  3C1C A;  4KUD D;  3AZK C;  5DNN C;  3B0C W;  4WV4 B;  1ZLA A;  3UTA B;  3AZI C;  5CPJ D;  5B2J C;  4EO5 C;  5B0Y D;  5AV9 A;  3KWQ B;  3REI C;  2CV5 D;  4J8V A;  3X1S B;  3W99 B;  5AV6 C;  1P3P C;  3LJA A;  3REK A;  3X1T A;  5GSU D;  3LZ0 C;  4ZBJ C;  2JCH A;  3REH D;  5AV5 A;  3AZJ C;  5AV8 A;  5AVB C;  4ZUX C;  3EPK A;  2ZY5 A;  3WTP B;  2FJ7 C;  1P3M D;  1W2E A;  4UPK A;  3LZ1 B;  1JFI B;  4JJN A;  5E5A A;  3UTB B;  4H9R A;  1ID3 B;  3AZM B;  4CAY B;  2XD1 A;  3W97 A;  2W8S A;  3MNN B;  1KX3 B;  5B31 C;  3AFA B;  3REL B;  3AZG D;  3VH5 W;  1B67 A;  3X1V C;  3WKJ A;  3KXB D;  4DRA A;  3W98 C;  3AZK A;  3W96 C;  1WWS A;  4LD9 B;  3UTA D;  1P3I B;  3B6F B;  5B24 D;  2YFW B;  4CAY A;  3AZH C;  4M6B A;  4J8X B;  4YM6 A;  2G5H C;  1S32 D;  3X1S D;  4Z66 B;  3W99 D;  2ARO B;  3AFA A;  5B33 D;  5AV6 A;  3EPL A;  2Y2O A;  5B40 C;  3LZ0 A;  5B1M C;  5B1L C;  3R45 A;  3C1B B;  4J8W D;  3TU4 A;  5BS7 A;  5AVB A;  2Y2G A;  1HTA A;  3EG5 B;  4ZUX A;  3B6F A;  1B6W A;  5F99 A;  3WA9 C;  4J8U B;  4XUJ C;  5DNM B;  5CPI D;  3LZ1 D;  2G5I C;  4Z66 A;  4WU9 A;  5FUG B;  2HIO B;  5CP6 B;  3UTB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...