4YM6D

Crystal structure of the human nucleosome containing 6-4pp (outside)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
96
structure length
96
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural basis of pyrimidine-pyrimidone (6-4) photoproduct recognition by UV-DDB in the nucleosome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 96
sequence length 96
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ym6D00
2F8NG 5CP6B 1AOIC 3VH6W 1TAFB 4ZUXD 4H9RB 1F66C 5AV6B 5B0YD 1H3OB 4ZUXC 3REKA 4H9QA 3LZ1A 2YFWB 1Q9CA 5B0YC 5CPIA 5FUGB 4AWLC 3AV1D 3MGPD 4R8PD 3REKB 3A6ND 3AV1C 3AZJA 3REID 3RELA 1P34B 5B1MD 3MGPC 4R8PC 4H9SC 5BO0A 3A6NC 3LJAA 4G92C 3REIC 4J8UA 5B1MC 3AZID 4JJNA 4XUJD 4KUDA 3LELA 4UUZA 3AZIC 5G49A 4XUJC 3AZHB 4WU9D 3LZ1D 5B32B 5B1LB 3MGSB 4WU9C 5CPID 1BH9A 3LELB 4KUDB 3VH5T 3LZ1C 5JRGB 5B31B 3V9RA 2NZDB 5CPIC 1EQZB 3AZJD 1P3AB 2RVQD 4J8VB 5B40A 5BNVB 3RELD 4LD9D 4NE5A 3LJAD 4J8WD 3AZJC 2NQBD 2RVQC 3V9RB 4J8UD 3RELC 5AV8B 3C1BA 3TU4A 3VH6T 5B24B 2PYOB 2LY8A 4JJND 5GSUA 3LJAC 2NQBC 4J8UC 3W98A 5B40B 4JJNC 5BNXA 2BYMA 5B2IA 3X1VA 3REHB 3WKJA 3AFAA 5AY8D 5GSUB 5GT3B 3W98B 2YFVB 5AY8C 4Z5TA 3X1SB 3B6FA 3WA9D 5GXQB 3WTPA 3AFAB 4KGCA 1P3BA 5E5AA 3WA9C 2HUEB 3X1UB 1KX3A 1M18B 3LZ0A 3AZGB 1P3KA 1P3BB 3AZLB 3C1CA 2CWEA 5B2ID 4NE6A 3REJA 3X1VD 1KX3B 3WKJD 1P3PA 1KX4B 3KWQA 4WU8A 1KU5A 5B33A 3X1VC 5B2IC 3O62B 3WKJC 3R45B 3C1CB 4H9OB 3AV2B 4Z5TD 3B6FD 4H9PB 3WTPD 5DNNA 3AZFA 1P3PB 5AVCA 4Z5TC 3B6FC 4KGCD 5E5AD 1P3LA 4DRBA 3WTPC 5B0ZA 4DRAA 4KGCC 5E5AC 3X1TA 1AOIB 5B32G 1P3KD 1F66B 3LZ0C 1A7WA 4ZUXB 1P3KC 3REJD 1ZLAA 5KDMA 2FJ7A 5B0YB 3KWQD 4WU8D 1P3GD 3NQUA 3REJC 1F1EA 4AWLB 4EO5C 3KWQC 4WU8C 5B2JB 1P3GC 4CAYB 3AV1B 5KDMB 5DNND 3AZFD 5AVCD 3MGPB 1P3LD 4R8PB 3NQUB 4XUJA 3A6NB 4G92B 5B0ZD 3REIB 5DNNC 4G91C 3AZFC 5AVCC 5B1MB 5GT0A 1P3LC 3VH6A 3X1TD 5B0ZC 4WU9A 4E45A 1P3MA 3AZIB 3X1TC 5AV9D 4XUJB 1ZLAD 1HQ3D 1P3FA 5AV9C 4KHAA 2FJ7D 3UT9A 4WU9B 1ZLAC 4H9QB 1HQ3C 3LZ1B 2FJ7C 4LD9A 5CPIB 1JFIA 4J8WA 2NQBA 3MVDA 4WNNA 4X23A 3AZJB 5CPJA 3RELB 2HIOD 5GT0D 5BO0B 1JFIB 5C3IC 3LJAB 4QLCA 2HIOC 3KUYA 4J8UB 1P3MD 5AY8A 5GT0C 5AVBD 2JSSA 4JJNB 4XZQA 3AZND 1P3IA 3B0CW 1P3MC 4UUZB 1P3FD 1WWIA 5AVBC 5DNMA 5G49B 3UT9D 3WA9A 3AZNC 2CV5A 4YM6D 5AY8B 1P3FC 3UT9C 4CSRA 1BH9B 4YM6C 3MVDD 4LD9C 1U35A 4X23D 3MGQA 5F99A 4J8WC 4Z66A 5AV5A 5CPJD 3MVDC 4X23C 3AZKA 5CPJC 4NFTA 4QLCD 3KUYD 3C1BB 3TU4B 1KX5A 4XZQD 3B6GA 1P3ID 4QLCC 3KUYC 1ID3A 5BS7A 2F8NA 3AZMD 5DNMD 4XZQC 1P3OA 1HTAA 5BNXB 2BYMB 5B2IB 3X1VB 1P3IC 2CV5D 3WKJB 2AROA 3AZMC 5DNMC 5B32D 2CV5C 4Z5TB 3B6FB 1U35D 5B32C 3WTPB 3MGQD 5F99D 4Z2MH 4J8XA 4Z66D 5AV5D 4KGCB 3KXBA 5E5AB 1U35C 1P3AD 3NQJA 3MGQC 5F99C 3AZKD 4Z66C 5AV5C 1P3AC 3LZ0B 3B0CT 3AZKC 1KX5D 1P3GA 3B6GD 1P3KB 1ID3D 2F8ND 5CPKA 1KX5C 1P3OD 3B6GC 3REJB 1ID3C 1S32D 4EO5B 5BS7C 3KWQB 2AROD 4WU8B 1P3OC 5B33B 4H9NA 1S32C 2AROC 3UTBA 3B0BA 5DNNB 4G91B 3AZFB 4J8XD 5JA4A 5AVCB 3KXBD 5AV9A 1P3LB 5B31G 5B0ZB 4H9NB 3MGRA 4J8XC 1HQ3A 3KXBC 3X1TB 1M18D 1M19A 4HGAC 3WTPE 2BYKA 3UTAA 3MNNA 3W99A 2HUEC 5AV9B 3W97A 3AYWA 5CPKD 1ZLAB 3AN2A 1N1JA 1BH8A 2FJ7B 2BYKB 3W96A 5CPKC 4YS3A 2HIOA 3WAAD 3B0DC 1TZYA 3AZEA 3UTBD 4ZBJC 3WAAC 4M6BA 2IO5C 5AVBA 3UTBC 5C3IB 3AZNA 3MGRD 2HIOB 1TAFA 5GT0B 1M19D 3UTAD 5AV6A 3MNND 3MGRC 3W99D 4YM6A 1P3MB 1H3OA 3W97D 2YFWA 1M19C 3UTAC 3AYWD 3MNNC 3AZNB 3W99C 1M1AD 3AN2D 1P3FB 5FUGA 1B6WA 4KHAB 3UT9B 3W97C 3AYWC 3W96D 1M1AC 4YM6B 3AN2C 4YS3D 4LD9B 1TZYD 3W96C 3AZED 1P34A 5B2JD 4J8WB 2NQBB 4YS3C 3MVDB 1TZYC 4WNNB 3AZEC 4X23B 1WWSA 5B2JC 5BT1D 5CP6D 5CPJB 2F8NH 3AZMA 5BT1C 5CP6C 5AV6D 4QLCB 3AZHA 3KUYB 4XZQB 5AV6C 5B32A 1P3IB 5B1LA 3MGSA 3AZMB 5JRGA 5DNMB 5B31A 3WA9B 2NZDA 2CV5B 1EQZA 3REKD 1P3AA 4J8VA 4CSRB 5BNVA 1P34D 3REKC 4Z2MG 1U35B 5AV8A 1P34C 3MGQB 5F99B 5B24A 2PYOA 4Z66B 5AV5B 3KSYA 3AZKB 3AZHD 1S32A 3REHA 1R4VA 1KX5B 3B6GB 3AZHC 5B1LD 3MGSD 4KUDD 1ID3B 5GT3A 3LELD 2YFVA 2F8NB 4WV4B 5JRGD 5B31D 1P3OB 2NZDD 3X1SA 5B1LC 3MGSC 4KUDC 1S32B 3LELC 5GXQA 1EQZD 2AROB 5JRGC 5B31C 2NZDC 4J8VD 1BFMA 1ULYA 3X1UA 1EQZC 1M18A 4J8VC 5AV8D 3AZGA 5B24D 2PYOD 4J8XB 3KXBB 3AZLA 4HGAB 5B40D 5AV8C 3NQJB 5B24C 2PYOC 3REHD 4NE3A 4E44A 3C1BD 5B40C 1KX4A 3TU4D 1P3GB 5GSUD 5GT3D 3O62A 3R45A 3REHC 3C1BC 3W98D 4H9OA 5CPKB 3WAAA 3TU4C 3AV2A 3X1SD 4H9PA 5GSUC 2F8NK 5GT3C 3W98C 5GXQD 3B0DB 3AFAD 3X1SC 4ZBJB 5GXQC 3WAAB 3X1UD 3AFAC 2IO5B 3UTBB 1AOIA 3AZGD 3X1UC 5JA4B 1M18C 1P3BD 3AZLD 1F66A 3AZGC 4WZSB 3MGRB 1M1AA 1HQ3B 4ZUXA 1KX3D 1P3BC 3AZLC 1M19B 3UTAB 1KX4D 5B0YA 3MNNB 3LZ0D 3W99B 5CHLB 1KX3C 3O62D 3W97B 3C1CD 3AYWB 1KX4C 3AV2D 1M1AB 5B2JA 3AN2B 1N1JB 1BH8B 4CAYA 3O62C 3AV1A 3C1CC 1P3PD 3W96B 3VH5W 3AV2C 3MGPA 4R8PA 4H9SA 5CP6A 4YS3B 5B33D 2L5AA 3VH5A 3A6NA 3REIA 1TZYB 1P3PC 1B67A 3AZEB 4H9RA 5B1MA 1AOID 5B33C 5AVBB 3AZIA 1F66D
chains in the Genus database with same CATH superfamily
2F8NG 5CP6B 1AOIC 2W8SA 3VH6W 3F6TA 1TAFB 4ZUXD 4H9RB 1F66C 5AV6B 5B0YD 3H0RC 1H3OB 4ZUXC 3REKA 4H9QA 3LZ1A 2YFWB 1Q9CA 5B0YC 5CPIA 5FUGB 4AWLC 3AV1D 3MGPD 4R8PD 3REKB 3A6ND 3AV1C 3AZJA 3REID 3RELA 1P34B 5B1MD 3MGPC 4R8PC 4H9SC 5BO0A 3A6NC 3LJAA 4G92C 3REIC 4J8UA 5B1MC 3AZID 4JJNA 4XUJD 4KUDA 3LELA 4UUZA 3AZIC 5G49A 4XUJC 3AZHB 4WU9D 3EPLA 3LZ1D 5B32B 5B1LB 3MGSB 4WU9C 5CPID 1BH9A 3LELB 4KUDB 3VH5T 3LZ1C 5JRGB 5B31B 3V9RA 2NZDB 5CPIC 1EQZB 3AZJD 1P3AB 2RVQD 4J8VB 5B40A 1W2EA 5BNVB 3RELD 4LD9D 4NE5A 3LJAD 4J8WD 3AZJC 2NQBD 2RVQC 3V9RB 4J8UD 3RELC 5AV8B 3C1BA 2JCHA 3TU4A 3VH6T 5B24B 2PYOB 2LY8A 4JJND 5GSUA 3LJAC 2NQBC 4J8UC 3W98A 5B40B 4JJNC 5B2IA 5BNXA 2BYMA 3X1VA 3REHB 3WKJA 3AFAA 5AY8D 2G5IC 5GSUB 5GT3B 3W98B 2YFVB 5AY8C 4Z5TA 3X1SB 3B6FA 3WA9D 5GXQB 3WTPA 3AFAB 4KGCA 1P3BA 5E5AA 3WA9C 2ZY2A 2HUEB 3X1UB 1KX3A 2Y2KA 1M18B 3LZ0A 3AL0C 3AZGB 1P3KA 1P3BB 3AZLB 4WJ3C 3C1CA 2CWEA 3IP4C 5B2ID 4NE6A 3REJA 3X1VD 1KX3B 3WKJD 1P3PA 1KX4B 3KWQA 2G5HC 4WU8A 1KU5A 5B33A 5B2IC 3X1VC 3O62B 3WKJC 3R45B 3C1CB 4H9OB 3AV2B 4Z5TD 3B6FD 4H9PB 3WTPD 5DNNA 3AZFA 1P3PB 5AVCA 4Z5TC 3B6FC 4KGCD 5E5AD 1P3LA 4DRBA 3WTPC 5B0ZA 4DRAA 2ZM5A 4KGCC 5E5AC 3X1TA 1AOIB 2Y2NA 5B32G 1P3KD 1F66B 3LZ0C 1A7WA 2UWXA 4ZUXB 3REJD 1P3KC 1ZLAA 5KDMA 2FJ7A 5B0YB 3KWQD 4WU8D 1P3GD 3NQUA 3REJC 1F1EA 4AWLB 4EO5C 3KWQC 4WU8C 5B2JB 1T3UA 2XD5A 1P3GC 3KFUG 4CAYB 3AV1B 5KDMB 5DNND 3AZFD 5AVCD 3MGPB 1P3LD 4R8PB 3NQUB 4XUJA 3A6NB 4G92B 5B0ZD 3REIB 5DNNC 4G91C 2BG1A 3AZFC 5AVCC 5B1MB 5GT0A 1P3LC 3VH6A 3X1TD 2F2AC 5B0ZC 4WU9A 4E45A 1P3MA 2Y2MA 3AZIB 3X1TC 5AV9D 4XUJB 1ZLAD 1HQ3D 1P3FA 5AV9C 4KHAA 2FJ7D 3UT9A 4WU9B 1ZLAC 4H9QB 1HQ3C 3LZ1B 2FJ7C 4LD9A 5CPIB 1JFIA 4J8WA 2NQBA 3MVDA 4WNNA 4X23A 2Y2GA 3AZJB 5CPJA 3RELB 2HIOD 5GT0D 5BO0B 1JFIB 5C3IC 3LJAB 4QLCA 2HIOC 3KUYA 4J8UB 1P3MD 5AY8A 5GT0C 1PZRA 2Y2IA 3EPJA 5AVBD 2JSSA 4JJNB 4XZQA 3AZND 1P3IA 3B0CW 1P3MC 4UUZB 1P3FD 1Z2CB 1WWIA 5AVBC 5DNMA 5G49B 3UT9D 3WA9A 3AZNC 2CV5A 4YM6D 5AY8B 1P3FC 2Y2QA 3UT9C 3FDDA 4CSRA 1BH9B 4YM6C 3P5JB 3MVDD 4LD9C 2Y2PA 1U35A 4X23D 3MGQA 5F99A 4J8WC 4Z66A 5AV5A 5CPJD 3MVDC 4X23C 3AZKA 5CPJC 4NFTA 4QLCD 3KUYD 3C1BB 3TU4B 1KX5A 4XZQD 3B6GA 1P3ID 4QLCC 3KUYC 1ID3A 5BS7A 2F8NA 3AZMD 2DF4C 5DNMD 4XZQC 1P3OA 1HTAA 5BNXB 2BYMB 5B2IB 3X1VB 1P3IC 2CV5D 3WKJB 2AROA 3AZMC 3A1IA 5DNMC 5B32D 2CV5C 4Z5TB 3B6FB 1U35D 5B32C 3WTPB 3MGQD 5F99D 4Z2MH 4J8XA 4Z66D 5AV5D 4KGCB 3KXBA 5E5AB 1U35C 1P3AD 3NQJA 3MGQC 5F99C 3AZKD 4Z66C 5AV5C 1P3AC 3LZ0B 3B0CT 3AZKC 1KX5D 1P3GA 3B6GD 1P3KB 1ID3D 2F8ND 5CPKA 1KX5C 1P3OD 3B6GC 3REJB 2Y2JA 1ID3C 1S32D 4EO5B 3EG5B 5BS7C 3KWQB 2AROD 4WU8B 1P3OC 5B33B 4H9NA 1S32C 2AROC 3UTBA 3B0BA 5DNNB 4G91B 3AZFB 4J8XD 5JA4A 5AVCB 3KXBD 5AV9A 1P3LB 5B31G 5B0ZB 4H9NB 3MGRA 4J8XC 1HQ3A 3KXBC 3X1TB 1M18D 1M19A 4HGAC 3WTPE 2BYKA 3UTAA 3MNNA 3W99A 2HUEC 5AV9B 3W97A 3AYWA 5CPKD 1ZLAB 3AN2A 1N1JA 1BH8A 2FJ7B 2BYKB 3W96A 5CPKC 2FFFB 4YS3A 2HIOA 3WAAD 3B0DC 1TZYA 3AZEA 3UTBD 4ZBJC 2Y2OA 3WAAC 4M6BA 2IO5C 5AVBA 3UTBC 5C3IB 3AZNA 3MGRD 2HIOB 1TAFA 5GT0B 1M19D 3UTAD 2J8PA 5AV6A 3MNND 3MGRC 3W99D 2RIQA 4YM6A 1H3OA 1P3MB 3W97D 2YFWA 1M19C 3UTAC 3AYWD 3MNNC 3AZNB 3W99C 1M1AD 3AN2D 1P3FB 5FUGA 1B6WA 4KHAB 3UT9B 3W97C 3AYWC 3W96D 4UPKA 1M1AC 4YM6B 3AN2C 4YS3D 4LD9B 1TZYD 3W96C 3AZED 1P34A 5B2JD 4J8WB 2NQBB 4YS3C 3MVDB 1TZYC 4WNNB 3AZEC 4X23B 1WWSA 5B2JC 5BT1D 5CP6D 5CPJB 2F8NH 3AZMA 2JE5A 5BT1C 3A1KA 5CP6C 5AV6D 4QLCB 3AZHA 3KUYB 2Y2HA 4DQYB 4XZQB 5AV6C 5B32A 1P3IB 5B1LA 3MGSA 3AZMB 5JRGA 2DQNC 5B31A 5DNMB 3WA9B 2NZDA 2CV5B 1EQZA 3REKD 1P3AA 4J8VA 4CSRB 5BNVA 1P34D 3REKC 4Z2MG 1U35B 5AV8A 1P34C 3MGQB 5F99B 5B24A 2PYOA 3H0MC 4Z66B 5AV5B 3KSYA 3AZKB 2ZY5A 3AZHD 1S32A 3REHA 1R4VA 1KX5B 3B6GB 3AZHC 5B1LD 3MGSD 4KUDD 1ID3B 5GT3A 3LELD 2YFVA 2F8NB 4WV4B 5JRGD 5B31D 1P3OB 2NZDD 3X1SA 5B1LC 3MGSC 4KUDC 1S32B 3LELC 5GXQA 1EQZD 2AROB 5JRGC 5B31C 2NZDC 4J8VD 1BFMA 1ULYA 3X1UA 1EQZC 1M18A 4J8VC 5AV8D 3AZGA 5B24D 2PYOD 4J8XB 3KXBB 3AZLA 3H0LC 4HGAB 5B40D 5AV8C 3NQJB 5B24C 3EPKA 2PYOC 3REHD 4NE3A 4E44A 3C1BD 5B40C 1KX4A 3TU4D 1P3GB 5GSUD 2VQRA 5GT3D 3O62A 3R45A 3REHC 3C1BC 3W98D 4H9OA 5CPKB 3WAAA 3TU4C 3AV2A 3X1SD 4H9PA 2ZY3A 5GSUC 2F8NK 3EPHA 5GT3C 3W98C 5GXQD 3B0DB 3AFAD 3X1SC 4ZBJB 5GXQC 3WAAB 3X1UD 3AFAC 2IO5B 3UTBB 1AOIA 3AZGD 3X1UC 5JA4B 1M18C 1P3BD 3AZLD 1F66A 3AZGC 4WZSB 3MGRB 1M1AA 1HQ3B 4ZUXA 1KX3D 1P3BC 3AZLC 1M19B 3UTAB 1KX4D 5B0YA 3MNNB 3LZ0D 3W99B 2XD1A 5CHLB 1KX3C 3O62D 3W97B 3C1CD 3AYWB 2ZY4A 1KX4C 3AV2D 1M1AB 5B2JA 2Y2LA 3AN2B 1N1JB 1BH8B 4CAYA 3O62C 3AV1A 3C1CC 1P3PD 3W96B 3VH5W 3AV2C 3MGPA 4R8PA 4H9SA 5CP6A 4YS3B 5B33D 2L5AA 3VH5A 3A6NA 3REIA 1TZYB 1P3PC 1B67A 3AZEB 4H9RA 5B1MA 1AOID 5B33C 5AVBB 3AZIA 1F66D
chains in the Genus database with same CATH topology
2F8NG 5CP6B 1AOIC 2W8SA 3VH6W 3F6TA 1TAFB 4ZUXD 4H9RB 1F66C 5AV6B 5B0YD 3H0RC 1H3OB 4ZUXC 3REKA 4H9QA 3LZ1A 2YFWB 1Q9CA 5B0YC 5CPIA 5FUGB 4AWLC 3AV1D 3MGPD 4R8PD 3REKB 3A6ND 3AV1C 3AZJA 3REID 3RELA 1P34B 5B1MD 3MGPC 4R8PC 4H9SC 5BO0A 3A6NC 3LJAA 4G92C 3REIC 4J8UA 5B1MC 3AZID 4JJNA 4XUJD 4KUDA 3LELA 4UUZA 3AZIC 5G49A 4XUJC 3AZHB 4WU9D 3EPLA 3LZ1D 5B32B 5B1LB 3MGSB 4WU9C 5CPID 1BH9A 3LELB 4KUDB 3VH5T 3LZ1C 5JRGB 5B31B 3V9RA 2NZDB 5CPIC 1EQZB 3AZJD 1P3AB 2RVQD 4J8VB 5B40A 1W2EA 5BNVB 3RELD 4LD9D 4NE5A 3LJAD 4J8WD 3AZJC 2NQBD 2RVQC 3V9RB 4J8UD 3RELC 5AV8B 3C1BA 2JCHA 3TU4A 3VH6T 5B24B 2PYOB 2LY8A 4JJND 5GSUA 3LJAC 2NQBC 4J8UC 3W98A 5B40B 4JJNC 5B2IA 5BNXA 2BYMA 3X1VA 3REHB 3WKJA 3AFAA 5AY8D 2G5IC 5GSUB 5GT3B 3W98B 2YFVB 5AY8C 4Z5TA 3X1SB 3B6FA 3WA9D 5GXQB 3WTPA 3AFAB 4KGCA 1P3BA 5E5AA 3WA9C 2ZY2A 2HUEB 3X1UB 1KX3A 2Y2KA 1M18B 3LZ0A 3AL0C 3AZGB 1P3KA 1P3BB 3AZLB 4WJ3C 3C1CA 2CWEA 3IP4C 5B2ID 4NE6A 3REJA 3X1VD 1KX3B 3WKJD 1P3PA 1KX4B 3KWQA 2G5HC 4WU8A 1KU5A 5B33A 5B2IC 3X1VC 3O62B 3WKJC 3R45B 3C1CB 4H9OB 3AV2B 4Z5TD 3B6FD 4H9PB 3WTPD 5DNNA 3AZFA 1P3PB 5AVCA 4Z5TC 3B6FC 4KGCD 5E5AD 1P3LA 4DRBA 3WTPC 5B0ZA 4DRAA 2ZM5A 4KGCC 5E5AC 3X1TA 1AOIB 2Y2NA 5B32G 1P3KD 1F66B 3LZ0C 1A7WA 2UWXA 4ZUXB 3REJD 1P3KC 1ZLAA 5KDMA 2FJ7A 5B0YB 3KWQD 4WU8D 1P3GD 3NQUA 3REJC 1F1EA 4AWLB 4EO5C 3KWQC 4WU8C 5B2JB 1T3UA 2XD5A 1P3GC 3KFUG 4CAYB 3AV1B 5KDMB 5DNND 3AZFD 5AVCD 3MGPB 1P3LD 4R8PB 3NQUB 4XUJA 3A6NB 4G92B 5B0ZD 3REIB 5DNNC 4G91C 2BG1A 3AZFC 5AVCC 5B1MB 5GT0A 1P3LC 3VH6A 3X1TD 2F2AC 5B0ZC 4WU9A 4E45A 1P3MA 2Y2MA 3AZIB 3X1TC 5AV9D 4XUJB 1ZLAD 1HQ3D 1P3FA 5AV9C 4KHAA 2FJ7D 3UT9A 4WU9B 1ZLAC 4H9QB 1HQ3C 3LZ1B 2FJ7C 4LD9A 5CPIB 1JFIA 4J8WA 2NQBA 3MVDA 4WNNA 4X23A 2Y2GA 3AZJB 5CPJA 3RELB 2HIOD 5GT0D 5BO0B 1JFIB 5C3IC 3LJAB 4QLCA 2HIOC 3KUYA 4J8UB 1P3MD 5AY8A 5GT0C 1PZRA 2Y2IA 3EPJA 5AVBD 2JSSA 4JJNB 4XZQA 3AZND 1P3IA 3B0CW 1P3MC 4UUZB 1P3FD 1Z2CB 1WWIA 5AVBC 5DNMA 5G49B 3UT9D 3WA9A 3AZNC 2CV5A 4YM6D 5AY8B 1P3FC 2Y2QA 3UT9C 3FDDA 4CSRA 1BH9B 4YM6C 3P5JB 3MVDD 4LD9C 2Y2PA 1U35A 4X23D 3MGQA 5F99A 4J8WC 4Z66A 5AV5A 5CPJD 3MVDC 4X23C 3AZKA 5CPJC 4NFTA 4QLCD 3KUYD 3C1BB 3TU4B 1KX5A 4XZQD 3B6GA 1P3ID 4QLCC 3KUYC 1ID3A 5BS7A 2F8NA 3AZMD 2DF4C 5DNMD 4XZQC 1P3OA 1HTAA 5BNXB 2BYMB 5B2IB 3X1VB 1P3IC 2CV5D 3WKJB 2AROA 3AZMC 3A1IA 5DNMC 5B32D 2CV5C 4Z5TB 3B6FB 1U35D 5B32C 3WTPB 3MGQD 5F99D 4Z2MH 4J8XA 4Z66D 5AV5D 4KGCB 3KXBA 5E5AB 1U35C 1P3AD 3NQJA 3MGQC 5F99C 3AZKD 4Z66C 5AV5C 1P3AC 3LZ0B 3B0CT 3AZKC 1KX5D 1P3GA 3B6GD 1P3KB 1ID3D 2F8ND 5CPKA 1KX5C 1P3OD 3B6GC 3REJB 2Y2JA 1ID3C 1S32D 4EO5B 3EG5B 5BS7C 3KWQB 2AROD 4WU8B 1P3OC 5B33B 4H9NA 1S32C 2AROC 3UTBA 3B0BA 5DNNB 4G91B 3AZFB 4J8XD 5JA4A 5AVCB 3KXBD 5AV9A 1P3LB 5B31G 5B0ZB 4H9NB 3MGRA 4J8XC 1HQ3A 3KXBC 3X1TB 1M18D 1M19A 4HGAC 3WTPE 2BYKA 3UTAA 3MNNA 3W99A 2HUEC 5AV9B 3W97A 3AYWA 5CPKD 1ZLAB 3AN2A 1N1JA 1BH8A 2FJ7B 2BYKB 3W96A 5CPKC 2FFFB 4YS3A 2HIOA 3WAAD 3B0DC 1TZYA 3AZEA 3UTBD 4ZBJC 2Y2OA 3WAAC 4M6BA 2IO5C 5AVBA 3UTBC 5C3IB 3AZNA 3MGRD 2HIOB 1TAFA 5GT0B 1M19D 3UTAD 2J8PA 5AV6A 3MNND 3MGRC 3W99D 2RIQA 4YM6A 1H3OA 1P3MB 3W97D 2YFWA 1M19C 3UTAC 3AYWD 3MNNC 3AZNB 3W99C 1M1AD 3AN2D 1P3FB 5FUGA 1B6WA 4KHAB 3UT9B 3W97C 3AYWC 3W96D 4UPKA 1M1AC 4YM6B 3AN2C 4YS3D 4LD9B 1TZYD 3W96C 3AZED 1P34A 5B2JD 4J8WB 2NQBB 4YS3C 3MVDB 1TZYC 4WNNB 3AZEC 4X23B 1WWSA 5B2JC 5BT1D 5CP6D 5CPJB 2F8NH 3AZMA 2JE5A 5BT1C 3A1KA 5CP6C 5AV6D 4QLCB 3AZHA 3KUYB 2Y2HA 4DQYB 4XZQB 5AV6C 5B32A 1P3IB 5B1LA 3MGSA 3AZMB 5JRGA 2DQNC 5B31A 5DNMB 3WA9B 2NZDA 2CV5B 1EQZA 3REKD 1P3AA 4J8VA 4CSRB 5BNVA 1P34D 3REKC 4Z2MG 1U35B 5AV8A 1P34C 3MGQB 5F99B 5B24A 2PYOA 3H0MC 4Z66B 5AV5B 3KSYA 3AZKB 2ZY5A 3AZHD 1S32A 3REHA 1R4VA 1KX5B 3B6GB 3AZHC 5B1LD 3MGSD 4KUDD 1ID3B 5GT3A 3LELD 2YFVA 2F8NB 4WV4B 5JRGD 5B31D 1P3OB 2NZDD 3X1SA 5B1LC 3MGSC 4KUDC 1S32B 3LELC 5GXQA 1EQZD 2AROB 5JRGC 5B31C 2NZDC 4J8VD 1BFMA 1ULYA 3X1UA 1EQZC 1M18A 4J8VC 5AV8D 3AZGA 5B24D 2PYOD 4J8XB 3KXBB 3AZLA 3H0LC 4HGAB 5B40D 5AV8C 3NQJB 5B24C 3EPKA 2PYOC 3REHD 4NE3A 4E44A 3C1BD 5B40C 1KX4A 3TU4D 1P3GB 5GSUD 2VQRA 5GT3D 3O62A 3R45A 3REHC 3C1BC 3W98D 4H9OA 5CPKB 3WAAA 3TU4C 3AV2A 3X1SD 4H9PA 2ZY3A 5GSUC 2F8NK 3EPHA 5GT3C 3W98C 5GXQD 3B0DB 3AFAD 3X1SC 4ZBJB 5GXQC 3WAAB 3X1UD 3AFAC 2IO5B 3UTBB 1AOIA 3AZGD 3X1UC 5JA4B 1M18C 1P3BD 3AZLD 1F66A 3AZGC 4WZSB 3MGRB 1M1AA 1HQ3B 4ZUXA 1KX3D 1P3BC 3AZLC 1M19B 3UTAB 1KX4D 5B0YA 3MNNB 3LZ0D 3W99B 2XD1A 5CHLB 1KX3C 3O62D 3W97B 3C1CD 3AYWB 2ZY4A 1KX4C 3AV2D 1M1AB 5B2JA 2Y2LA 3AN2B 1N1JB 1BH8B 4CAYA 3O62C 3AV1A 3C1CC 1P3PD 3W96B 3VH5W 3AV2C 3MGPA 4R8PA 4H9SA 5CP6A 4YS3B 5B33D 2L5AA 3VH5A 3A6NA 3REIA 1TZYB 1P3PC 1B67A 3AZEB 4H9RA 5B1MA 1AOID 5B33C 5AVBB 3AZIA 1F66D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8N G;  5CP6 B;  1AOI C;  3VH6 W;  1TAF B;  4ZUX D;  4H9R B;  1F66 C;  5AV6 B;  5B0Y D;  1H3O B;  4ZUX C;  3REK A;  4H9Q A;  3LZ1 A;  2YFW B;  1Q9C A;  5B0Y C;  5CPI A;  5FUG B;  4AWL C;  3AV1 D;  3MGP D;  4R8P D;  3REK B;  3A6N D;  3AV1 C;  3AZJ A;  3REI D;  3REL A;  1P34 B;  5B1M D;  3MGP C;  4R8P C;  4H9S C;  5BO0 A;  3A6N C;  3LJA A;  4G92 C;  3REI C;  4J8U A;  5B1M C;  3AZI D;  4JJN A;  4XUJ D;  4KUD A;  3LEL A;  4UUZ A;  3AZI C;  5G49 A;  4XUJ C;  3AZH B;  4WU9 D;  3LZ1 D;  5B32 B;  5B1L B;  3MGS B;  4WU9 C;  5CPI D;  1BH9 A;  3LEL B;  4KUD B;  3VH5 T;  3LZ1 C;  5JRG B;  5B31 B;  3V9R A;  2NZD B;  5CPI C;  1EQZ B;  3AZJ D;  1P3A B;  2RVQ D;  4J8V B;  5B40 A;  5BNV B;  3REL D;  4LD9 D;  4NE5 A;  3LJA D;  4J8W D;  3AZJ C;  2NQB D;  2RVQ C;  3V9R B;  4J8U D;  3REL C;  5AV8 B;  3C1B A;  3TU4 A;  3VH6 T;  5B24 B;  2PYO B;  2LY8 A;  4JJN D;  5GSU A;  3LJA C;  2NQB C;  4J8U C;  3W98 A;  5B40 B;  4JJN C;  5BNX A;  2BYM A;  5B2I A;  3X1V A;  3REH B;  3WKJ A;  3AFA A;  5AY8 D;  5GSU B;  5GT3 B;  3W98 B;  2YFV B;  5AY8 C;  4Z5T A;  3X1S B;  3B6F A;  3WA9 D;  5GXQ B;  3WTP A;  3AFA B;  4KGC A;  1P3B A;  5E5A A;  3WA9 C;  2HUE B;  3X1U B;  1KX3 A;  1M18 B;  3LZ0 A;  3AZG B;  1P3K A;  1P3B B;  3AZL B;  3C1C A;  2CWE A;  5B2I D;  4NE6 A;  3REJ A;  3X1V D;  1KX3 B;  3WKJ D;  1P3P A;  1KX4 B;  3KWQ A;  4WU8 A;  1KU5 A;  5B33 A;  3X1V C;  5B2I C;  3O62 B;  3WKJ C;  3R45 B;  3C1C B;  4H9O B;  3AV2 B;  4Z5T D;  3B6F D;  4H9P B;  3WTP D;  5DNN A;  3AZF A;  1P3P B;  5AVC A;  4Z5T C;  3B6F C;  4KGC D;  5E5A D;  1P3L A;  4DRB A;  3WTP C;  5B0Z A;  4DRA A;  4KGC C;  5E5A C;  3X1T A;  1AOI B;  5B32 G;  1P3K D;  1F66 B;  3LZ0 C;  1A7W A;  4ZUX B;  1P3K C;  3REJ D;  1ZLA A;  5KDM A;  2FJ7 A;  5B0Y B;  3KWQ D;  4WU8 D;  1P3G D;  3NQU A;  3REJ C;  1F1E A;  4AWL B;  4EO5 C;  3KWQ C;  4WU8 C;  5B2J B;  1P3G C;  4CAY B;  3AV1 B;  5KDM B;  5DNN D;  3AZF D;  5AVC D;  3MGP B;  1P3L D;  4R8P B;  3NQU B;  4XUJ A;  3A6N B;  4G92 B;  5B0Z D;  3REI B;  5DNN C;  4G91 C;  3AZF C;  5AVC C;  5B1M B;  5GT0 A;  1P3L C;  3VH6 A;  3X1T D;  5B0Z C;  4WU9 A;  4E45 A;  1P3M A;  3AZI B;  3X1T C;  5AV9 D;  4XUJ B;  1ZLA D;  1HQ3 D;  1P3F A;  5AV9 C;  4KHA A;  2FJ7 D;  3UT9 A;  4WU9 B;  1ZLA C;  4H9Q B;  1HQ3 C;  3LZ1 B;  2FJ7 C;  4LD9 A;  5CPI B;  1JFI A;  4J8W A;  2NQB A;  3MVD A;  4WNN A;  4X23 A;  3AZJ B;  5CPJ A;  3REL B;  2HIO D;  5GT0 D;  5BO0 B;  1JFI B;  5C3I C;  3LJA B;  4QLC A;  2HIO C;  3KUY A;  4J8U B;  1P3M D;  5AY8 A;  5GT0 C;  5AVB D;  2JSS A;  4JJN B;  4XZQ A;  3AZN D;  1P3I A;  3B0C W;  1P3M C;  4UUZ B;  1P3F D;  1WWI A;  5AVB C;  5DNM A;  5G49 B;  3UT9 D;  3WA9 A;  3AZN C;  2CV5 A;  4YM6 D;  5AY8 B;  1P3F C;  3UT9 C;  4CSR A;  1BH9 B;  4YM6 C;  3MVD D;  4LD9 C;  1U35 A;  4X23 D;  3MGQ A;  5F99 A;  4J8W C;  4Z66 A;  5AV5 A;  5CPJ D;  3MVD C;  4X23 C;  3AZK A;  5CPJ C;  4NFT A;  4QLC D;  3KUY D;  3C1B B;  3TU4 B;  1KX5 A;  4XZQ D;  3B6G A;  1P3I D;  4QLC C;  3KUY C;  1ID3 A;  5BS7 A;  2F8N A;  3AZM D;  5DNM D;  4XZQ C;  1P3O A;  1HTA A;  5BNX B;  2BYM B;  5B2I B;  3X1V B;  1P3I C;  2CV5 D;  3WKJ B;  2ARO A;  3AZM C;  5DNM C;  5B32 D;  2CV5 C;  4Z5T B;  3B6F B;  1U35 D;  5B32 C;  3WTP B;  3MGQ D;  5F99 D;  4Z2M H;  4J8X A;  4Z66 D;  5AV5 D;  4KGC B;  3KXB A;  5E5A B;  1U35 C;  1P3A D;  3NQJ A;  3MGQ C;  5F99 C;  3AZK D;  4Z66 C;  5AV5 C;  1P3A C;  3LZ0 B;  3B0C T;  3AZK C;  1KX5 D;  1P3G A;  3B6G D;  1P3K B;  1ID3 D;  2F8N D;  5CPK A;  1KX5 C;  1P3O D;  3B6G C;  3REJ B;  1ID3 C;  1S32 D;  4EO5 B;  5BS7 C;  3KWQ B;  2ARO D;  4WU8 B;  1P3O C;  5B33 B;  4H9N A;  1S32 C;  2ARO C;  3UTB A;  3B0B A;  5DNN B;  4G91 B;  3AZF B;  4J8X D;  5JA4 A;  5AVC B;  3KXB D;  5AV9 A;  1P3L B;  5B31 G;  5B0Z B;  4H9N B;  3MGR A;  4J8X C;  1HQ3 A;  3KXB C;  3X1T B;  1M18 D;  1M19 A;  4HGA C;  3WTP E;  2BYK A;  3UTA A;  3MNN A;  3W99 A;  2HUE C;  5AV9 B;  3W97 A;  3AYW A;  5CPK D;  1ZLA B;  3AN2 A;  1N1J A;  1BH8 A;  2FJ7 B;  2BYK B;  3W96 A;  5CPK C;  4YS3 A;  2HIO A;  3WAA D;  3B0D C;  1TZY A;  3AZE A;  3UTB D;  4ZBJ C;  3WAA C;  4M6B A;  2IO5 C;  5AVB A;  3UTB C;  5C3I B;  3AZN A;  3MGR D;  2HIO B;  1TAF A;  5GT0 B;  1M19 D;  3UTA D;  5AV6 A;  3MNN D;  3MGR C;  3W99 D;  4YM6 A;  1P3M B;  1H3O A;  3W97 D;  2YFW A;  1M19 C;  3UTA C;  3AYW D;  3MNN C;  3AZN B;  3W99 C;  1M1A D;  3AN2 D;  1P3F B;  5FUG A;  1B6W A;  4KHA B;  3UT9 B;  3W97 C;  3AYW C;  3W96 D;  1M1A C;  4YM6 B;  3AN2 C;  4YS3 D;  4LD9 B;  1TZY D;  3W96 C;  3AZE D;  1P34 A;  5B2J D;  4J8W B;  2NQB B;  4YS3 C;  3MVD B;  1TZY C;  4WNN B;  3AZE C;  4X23 B;  1WWS A;  5B2J C;  5BT1 D;  5CP6 D;  5CPJ B;  2F8N H;  3AZM A;  5BT1 C;  5CP6 C;  5AV6 D;  4QLC B;  3AZH A;  3KUY B;  4XZQ B;  5AV6 C;  5B32 A;  1P3I B;  5B1L A;  3MGS A;  3AZM B;  5JRG A;  5DNM B;  5B31 A;  3WA9 B;  2NZD A;  2CV5 B;  1EQZ A;  3REK D;  1P3A A;  4J8V A;  4CSR B;  5BNV A;  1P34 D;  3REK C;  4Z2M G;  1U35 B;  5AV8 A;  1P34 C;  3MGQ B;  5F99 B;  5B24 A;  2PYO A;  4Z66 B;  5AV5 B;  3KSY A;  3AZK B;  3AZH D;  1S32 A;  3REH A;  1R4V A;  1KX5 B;  3B6G B;  3AZH C;  5B1L D;  3MGS D;  4KUD D;  1ID3 B;  5GT3 A;  3LEL D;  2YFV A;  2F8N B;  4WV4 B;  5JRG D;  5B31 D;  1P3O B;  2NZD D;  3X1S A;  5B1L C;  3MGS C;  4KUD C;  1S32 B;  3LEL C;  5GXQ A;  1EQZ D;  2ARO B;  5JRG C;  5B31 C;  2NZD C;  4J8V D;  1BFM A;  1ULY A;  3X1U A;  1EQZ C;  1M18 A;  4J8V C;  5AV8 D;  3AZG A;  5B24 D;  2PYO D;  4J8X B;  3KXB B;  3AZL A;  4HGA B;  5B40 D;  5AV8 C;  3NQJ B;  5B24 C;  2PYO C;  3REH D;  4NE3 A;  4E44 A;  3C1B D;  5B40 C;  1KX4 A;  3TU4 D;  1P3G B;  5GSU D;  5GT3 D;  3O62 A;  3R45 A;  3REH C;  3C1B C;  3W98 D;  4H9O A;  5CPK B;  3WAA A;  3TU4 C;  3AV2 A;  3X1S D;  4H9P A;  5GSU C;  2F8N K;  5GT3 C;  3W98 C;  5GXQ D;  3B0D B;  3AFA D;  3X1S C;  4ZBJ B;  5GXQ C;  3WAA B;  3X1U D;  3AFA C;  2IO5 B;  3UTB B;  1AOI A;  3AZG D;  3X1U C;  5JA4 B;  1M18 C;  1P3B D;  3AZL D;  1F66 A;  3AZG C;  4WZS B;  3MGR B;  1M1A A;  1HQ3 B;  4ZUX A;  1KX3 D;  1P3B C;  3AZL C;  1M19 B;  3UTA B;  1KX4 D;  5B0Y A;  3MNN B;  3LZ0 D;  3W99 B;  5CHL B;  1KX3 C;  3O62 D;  3W97 B;  3C1C D;  3AYW B;  1KX4 C;  3AV2 D;  1M1A B;  5B2J A;  3AN2 B;  1N1J B;  1BH8 B;  4CAY A;  3O62 C;  3AV1 A;  3C1C C;  1P3P D;  3W96 B;  3VH5 W;  3AV2 C;  3MGP A;  4R8P A;  4H9S A;  5CP6 A;  4YS3 B;  5B33 D;  2L5A A;  3VH5 A;  3A6N A;  3REI A;  1TZY B;  1P3P C;  1B67 A;  3AZE B;  4H9R A;  5B1M A;  1AOI D;  5B33 C;  5AVB B;  3AZI A;  1F66 D; 
#chains in the Genus database with same CATH topology
 2F8N G;  5CP6 B;  1AOI C;  2W8S A;  3VH6 W;  3F6T A;  1TAF B;  4ZUX D;  4H9R B;  1F66 C;  5AV6 B;  5B0Y D;  3H0R C;  1H3O B;  4ZUX C;  3REK A;  4H9Q A;  3LZ1 A;  2YFW B;  1Q9C A;  5B0Y C;  5CPI A;  5FUG B;  4AWL C;  3AV1 D;  3MGP D;  4R8P D;  3REK B;  3A6N D;  3AV1 C;  3AZJ A;  3REI D;  3REL A;  1P34 B;  5B1M D;  3MGP C;  4R8P C;  4H9S C;  5BO0 A;  3A6N C;  3LJA A;  4G92 C;  3REI C;  4J8U A;  5B1M C;  3AZI D;  4JJN A;  4XUJ D;  4KUD A;  3LEL A;  4UUZ A;  3AZI C;  5G49 A;  4XUJ C;  3AZH B;  4WU9 D;  3EPL A;  3LZ1 D;  5B32 B;  5B1L B;  3MGS B;  4WU9 C;  5CPI D;  1BH9 A;  3LEL B;  4KUD B;  3VH5 T;  3LZ1 C;  5JRG B;  5B31 B;  3V9R A;  2NZD B;  5CPI C;  1EQZ B;  3AZJ D;  1P3A B;  2RVQ D;  4J8V B;  5B40 A;  1W2E A;  5BNV B;  3REL D;  4LD9 D;  4NE5 A;  3LJA D;  4J8W D;  3AZJ C;  2NQB D;  2RVQ C;  3V9R B;  4J8U D;  3REL C;  5AV8 B;  3C1B A;  2JCH A;  3TU4 A;  3VH6 T;  5B24 B;  2PYO B;  2LY8 A;  4JJN D;  5GSU A;  3LJA C;  2NQB C;  4J8U C;  3W98 A;  5B40 B;  4JJN C;  5B2I A;  5BNX A;  2BYM A;  3X1V A;  3REH B;  3WKJ A;  3AFA A;  5AY8 D;  2G5I C;  5GSU B;  5GT3 B;  3W98 B;  2YFV B;  5AY8 C;  4Z5T A;  3X1S B;  3B6F A;  3WA9 D;  5GXQ B;  3WTP A;  3AFA B;  4KGC A;  1P3B A;  5E5A A;  3WA9 C;  2ZY2 A;  2HUE B;  3X1U B;  1KX3 A;  2Y2K A;  1M18 B;  3LZ0 A;  3AL0 C;  3AZG B;  1P3K A;  1P3B B;  3AZL B;  4WJ3 C;  3C1C A;  2CWE A;  3IP4 C;  5B2I D;  4NE6 A;  3REJ A;  3X1V D;  1KX3 B;  3WKJ D;  1P3P A;  1KX4 B;  3KWQ A;  2G5H C;  4WU8 A;  1KU5 A;  5B33 A;  5B2I C;  3X1V C;  3O62 B;  3WKJ C;  3R45 B;  3C1C B;  4H9O B;  3AV2 B;  4Z5T D;  3B6F D;  4H9P B;  3WTP D;  5DNN A;  3AZF A;  1P3P B;  5AVC A;  4Z5T C;  3B6F C;  4KGC D;  5E5A D;  1P3L A;  4DRB A;  3WTP C;  5B0Z A;  4DRA A;  2ZM5 A;  4KGC C;  5E5A C;  3X1T A;  1AOI B;  2Y2N A;  5B32 G;  1P3K D;  1F66 B;  3LZ0 C;  1A7W A;  2UWX A;  4ZUX B;  3REJ D;  1P3K C;  1ZLA A;  5KDM A;  2FJ7 A;  5B0Y B;  3KWQ D;  4WU8 D;  1P3G D;  3NQU A;  3REJ C;  1F1E A;  4AWL B;  4EO5 C;  3KWQ C;  4WU8 C;  5B2J B;  1T3U A;  2XD5 A;  1P3G C;  3KFU G;  4CAY B;  3AV1 B;  5KDM B;  5DNN D;  3AZF D;  5AVC D;  3MGP B;  1P3L D;  4R8P B;  3NQU B;  4XUJ A;  3A6N B;  4G92 B;  5B0Z D;  3REI B;  5DNN C;  4G91 C;  2BG1 A;  3AZF C;  5AVC C;  5B1M B;  5GT0 A;  1P3L C;  3VH6 A;  3X1T D;  2F2A C;  5B0Z C;  4WU9 A;  4E45 A;  1P3M A;  2Y2M A;  3AZI B;  3X1T C;  5AV9 D;  4XUJ B;  1ZLA D;  1HQ3 D;  1P3F A;  5AV9 C;  4KHA A;  2FJ7 D;  3UT9 A;  4WU9 B;  1ZLA C;  4H9Q B;  1HQ3 C;  3LZ1 B;  2FJ7 C;  4LD9 A;  5CPI B;  1JFI A;  4J8W A;  2NQB A;  3MVD A;  4WNN A;  4X23 A;  2Y2G A;  3AZJ B;  5CPJ A;  3REL B;  2HIO D;  5GT0 D;  5BO0 B;  1JFI B;  5C3I C;  3LJA B;  4QLC A;  2HIO C;  3KUY A;  4J8U B;  1P3M D;  5AY8 A;  5GT0 C;  1PZR A;  2Y2I A;  3EPJ A;  5AVB D;  2JSS A;  4JJN B;  4XZQ A;  3AZN D;  1P3I A;  3B0C W;  1P3M C;  4UUZ B;  1P3F D;  1Z2C B;  1WWI A;  5AVB C;  5DNM A;  5G49 B;  3UT9 D;  3WA9 A;  3AZN C;  2CV5 A;  4YM6 D;  5AY8 B;  1P3F C;  2Y2Q A;  3UT9 C;  3FDD A;  4CSR A;  1BH9 B;  4YM6 C;  3P5J B;  3MVD D;  4LD9 C;  2Y2P A;  1U35 A;  4X23 D;  3MGQ A;  5F99 A;  4J8W C;  4Z66 A;  5AV5 A;  5CPJ D;  3MVD C;  4X23 C;  3AZK A;  5CPJ C;  4NFT A;  4QLC D;  3KUY D;  3C1B B;  3TU4 B;  1KX5 A;  4XZQ D;  3B6G A;  1P3I D;  4QLC C;  3KUY C;  1ID3 A;  5BS7 A;  2F8N A;  3AZM D;  2DF4 C;  5DNM D;  4XZQ C;  1P3O A;  1HTA A;  5BNX B;  2BYM B;  5B2I B;  3X1V B;  1P3I C;  2CV5 D;  3WKJ B;  2ARO A;  3AZM C;  3A1I A;  5DNM C;  5B32 D;  2CV5 C;  4Z5T B;  3B6F B;  1U35 D;  5B32 C;  3WTP B;  3MGQ D;  5F99 D;  4Z2M H;  4J8X A;  4Z66 D;  5AV5 D;  4KGC B;  3KXB A;  5E5A B;  1U35 C;  1P3A D;  3NQJ A;  3MGQ C;  5F99 C;  3AZK D;  4Z66 C;  5AV5 C;  1P3A C;  3LZ0 B;  3B0C T;  3AZK C;  1KX5 D;  1P3G A;  3B6G D;  1P3K B;  1ID3 D;  2F8N D;  5CPK A;  1KX5 C;  1P3O D;  3B6G C;  3REJ B;  2Y2J A;  1ID3 C;  1S32 D;  4EO5 B;  3EG5 B;  5BS7 C;  3KWQ B;  2ARO D;  4WU8 B;  1P3O C;  5B33 B;  4H9N A;  1S32 C;  2ARO C;  3UTB A;  3B0B A;  5DNN B;  4G91 B;  3AZF B;  4J8X D;  5JA4 A;  5AVC B;  3KXB D;  5AV9 A;  1P3L B;  5B31 G;  5B0Z B;  4H9N B;  3MGR A;  4J8X C;  1HQ3 A;  3KXB C;  3X1T B;  1M18 D;  1M19 A;  4HGA C;  3WTP E;  2BYK A;  3UTA A;  3MNN A;  3W99 A;  2HUE C;  5AV9 B;  3W97 A;  3AYW A;  5CPK D;  1ZLA B;  3AN2 A;  1N1J A;  1BH8 A;  2FJ7 B;  2BYK B;  3W96 A;  5CPK C;  2FFF B;  4YS3 A;  2HIO A;  3WAA D;  3B0D C;  1TZY A;  3AZE A;  3UTB D;  4ZBJ C;  2Y2O A;  3WAA C;  4M6B A;  2IO5 C;  5AVB A;  3UTB C;  5C3I B;  3AZN A;  3MGR D;  2HIO B;  1TAF A;  5GT0 B;  1M19 D;  3UTA D;  2J8P A;  5AV6 A;  3MNN D;  3MGR C;  3W99 D;  2RIQ A;  4YM6 A;  1H3O A;  1P3M B;  3W97 D;  2YFW A;  1M19 C;  3UTA C;  3AYW D;  3MNN C;  3AZN B;  3W99 C;  1M1A D;  3AN2 D;  1P3F B;  5FUG A;  1B6W A;  4KHA B;  3UT9 B;  3W97 C;  3AYW C;  3W96 D;  4UPK A;  1M1A C;  4YM6 B;  3AN2 C;  4YS3 D;  4LD9 B;  1TZY D;  3W96 C;  3AZE D;  1P34 A;  5B2J D;  4J8W B;  2NQB B;  4YS3 C;  3MVD B;  1TZY C;  4WNN B;  3AZE C;  4X23 B;  1WWS A;  5B2J C;  5BT1 D;  5CP6 D;  5CPJ B;  2F8N H;  3AZM A;  2JE5 A;  5BT1 C;  3A1K A;  5CP6 C;  5AV6 D;  4QLC B;  3AZH A;  3KUY B;  2Y2H A;  4DQY B;  4XZQ B;  5AV6 C;  5B32 A;  1P3I B;  5B1L A;  3MGS A;  3AZM B;  5JRG A;  2DQN C;  5B31 A;  5DNM B;  3WA9 B;  2NZD A;  2CV5 B;  1EQZ A;  3REK D;  1P3A A;  4J8V A;  4CSR B;  5BNV A;  1P34 D;  3REK C;  4Z2M G;  1U35 B;  5AV8 A;  1P34 C;  3MGQ B;  5F99 B;  5B24 A;  2PYO A;  3H0M C;  4Z66 B;  5AV5 B;  3KSY A;  3AZK B;  2ZY5 A;  3AZH D;  1S32 A;  3REH A;  1R4V A;  1KX5 B;  3B6G B;  3AZH C;  5B1L D;  3MGS D;  4KUD D;  1ID3 B;  5GT3 A;  3LEL D;  2YFV A;  2F8N B;  4WV4 B;  5JRG D;  5B31 D;  1P3O B;  2NZD D;  3X1S A;  5B1L C;  3MGS C;  4KUD C;  1S32 B;  3LEL C;  5GXQ A;  1EQZ D;  2ARO B;  5JRG C;  5B31 C;  2NZD C;  4J8V D;  1BFM A;  1ULY A;  3X1U A;  1EQZ C;  1M18 A;  4J8V C;  5AV8 D;  3AZG A;  5B24 D;  2PYO D;  4J8X B;  3KXB B;  3AZL A;  3H0L C;  4HGA B;  5B40 D;  5AV8 C;  3NQJ B;  5B24 C;  3EPK A;  2PYO C;  3REH D;  4NE3 A;  4E44 A;  3C1B D;  5B40 C;  1KX4 A;  3TU4 D;  1P3G B;  5GSU D;  2VQR A;  5GT3 D;  3O62 A;  3R45 A;  3REH C;  3C1B C;  3W98 D;  4H9O A;  5CPK B;  3WAA A;  3TU4 C;  3AV2 A;  3X1S D;  4H9P A;  2ZY3 A;  5GSU C;  2F8N K;  3EPH A;  5GT3 C;  3W98 C;  5GXQ D;  3B0D B;  3AFA D;  3X1S C;  4ZBJ B;  5GXQ C;  3WAA B;  3X1U D;  3AFA C;  2IO5 B;  3UTB B;  1AOI A;  3AZG D;  3X1U C;  5JA4 B;  1M18 C;  1P3B D;  3AZL D;  1F66 A;  3AZG C;  4WZS B;  3MGR B;  1M1A A;  1HQ3 B;  4ZUX A;  1KX3 D;  1P3B C;  3AZL C;  1M19 B;  3UTA B;  1KX4 D;  5B0Y A;  3MNN B;  3LZ0 D;  3W99 B;  2XD1 A;  5CHL B;  1KX3 C;  3O62 D;  3W97 B;  3C1C D;  3AYW B;  2ZY4 A;  1KX4 C;  3AV2 D;  1M1A B;  5B2J A;  2Y2L A;  3AN2 B;  1N1J B;  1BH8 B;  4CAY A;  3O62 C;  3AV1 A;  3C1C C;  1P3P D;  3W96 B;  3VH5 W;  3AV2 C;  3MGP A;  4R8P A;  4H9S A;  5CP6 A;  4YS3 B;  5B33 D;  2L5A A;  3VH5 A;  3A6N A;  3REI A;  1TZY B;  1P3P C;  1B67 A;  3AZE B;  4H9R A;  5B1M A;  1AOI D;  5B33 C;  5AVB B;  3AZI A;  1F66 D; 
#chains in the Genus database with same CATH homology
 2F8N G;  5CP6 B;  1AOI C;  2W8S A;  3VH6 W;  3F6T A;  1TAF B;  4ZUX D;  4H9R B;  1F66 C;  5AV6 B;  5B0Y D;  3H0R C;  1H3O B;  4ZUX C;  3REK A;  4H9Q A;  3LZ1 A;  2YFW B;  1Q9C A;  5B0Y C;  5CPI A;  5FUG B;  4AWL C;  3AV1 D;  3MGP D;  4R8P D;  3REK B;  3A6N D;  3AV1 C;  3AZJ A;  3REI D;  3REL A;  1P34 B;  5B1M D;  3MGP C;  4R8P C;  4H9S C;  5BO0 A;  3A6N C;  3LJA A;  4G92 C;  3REI C;  4J8U A;  5B1M C;  3AZI D;  4JJN A;  4XUJ D;  4KUD A;  3LEL A;  4UUZ A;  3AZI C;  5G49 A;  4XUJ C;  3AZH B;  4WU9 D;  3EPL A;  3LZ1 D;  5B32 B;  5B1L B;  3MGS B;  4WU9 C;  5CPI D;  1BH9 A;  3LEL B;  4KUD B;  3VH5 T;  3LZ1 C;  5JRG B;  5B31 B;  3V9R A;  2NZD B;  5CPI C;  1EQZ B;  3AZJ D;  1P3A B;  2RVQ D;  4J8V B;  5B40 A;  1W2E A;  5BNV B;  3REL D;  4LD9 D;  4NE5 A;  3LJA D;  4J8W D;  3AZJ C;  2NQB D;  2RVQ C;  3V9R B;  4J8U D;  3REL C;  5AV8 B;  3C1B A;  2JCH A;  3TU4 A;  3VH6 T;  5B24 B;  2PYO B;  2LY8 A;  4JJN D;  5GSU A;  3LJA C;  2NQB C;  4J8U C;  3W98 A;  5B40 B;  4JJN C;  5B2I A;  5BNX A;  2BYM A;  3X1V A;  3REH B;  3WKJ A;  3AFA A;  5AY8 D;  2G5I C;  5GSU B;  5GT3 B;  3W98 B;  2YFV B;  5AY8 C;  4Z5T A;  3X1S B;  3B6F A;  3WA9 D;  5GXQ B;  3WTP A;  3AFA B;  4KGC A;  1P3B A;  5E5A A;  3WA9 C;  2ZY2 A;  2HUE B;  3X1U B;  1KX3 A;  2Y2K A;  1M18 B;  3LZ0 A;  3AL0 C;  3AZG B;  1P3K A;  1P3B B;  3AZL B;  4WJ3 C;  3C1C A;  2CWE A;  3IP4 C;  5B2I D;  4NE6 A;  3REJ A;  3X1V D;  1KX3 B;  3WKJ D;  1P3P A;  1KX4 B;  3KWQ A;  2G5H C;  4WU8 A;  1KU5 A;  5B33 A;  5B2I C;  3X1V C;  3O62 B;  3WKJ C;  3R45 B;  3C1C B;  4H9O B;  3AV2 B;  4Z5T D;  3B6F D;  4H9P B;  3WTP D;  5DNN A;  3AZF A;  1P3P B;  5AVC A;  4Z5T C;  3B6F C;  4KGC D;  5E5A D;  1P3L A;  4DRB A;  3WTP C;  5B0Z A;  4DRA A;  2ZM5 A;  4KGC C;  5E5A C;  3X1T A;  1AOI B;  2Y2N A;  5B32 G;  1P3K D;  1F66 B;  3LZ0 C;  1A7W A;  2UWX A;  4ZUX B;  3REJ D;  1P3K C;  1ZLA A;  5KDM A;  2FJ7 A;  5B0Y B;  3KWQ D;  4WU8 D;  1P3G D;  3NQU A;  3REJ C;  1F1E A;  4AWL B;  4EO5 C;  3KWQ C;  4WU8 C;  5B2J B;  1T3U A;  2XD5 A;  1P3G C;  3KFU G;  4CAY B;  3AV1 B;  5KDM B;  5DNN D;  3AZF D;  5AVC D;  3MGP B;  1P3L D;  4R8P B;  3NQU B;  4XUJ A;  3A6N B;  4G92 B;  5B0Z D;  3REI B;  5DNN C;  4G91 C;  2BG1 A;  3AZF C;  5AVC C;  5B1M B;  5GT0 A;  1P3L C;  3VH6 A;  3X1T D;  2F2A C;  5B0Z C;  4WU9 A;  4E45 A;  1P3M A;  2Y2M A;  3AZI B;  3X1T C;  5AV9 D;  4XUJ B;  1ZLA D;  1HQ3 D;  1P3F A;  5AV9 C;  4KHA A;  2FJ7 D;  3UT9 A;  4WU9 B;  1ZLA C;  4H9Q B;  1HQ3 C;  3LZ1 B;  2FJ7 C;  4LD9 A;  5CPI B;  1JFI A;  4J8W A;  2NQB A;  3MVD A;  4WNN A;  4X23 A;  2Y2G A;  3AZJ B;  5CPJ A;  3REL B;  2HIO D;  5GT0 D;  5BO0 B;  1JFI B;  5C3I C;  3LJA B;  4QLC A;  2HIO C;  3KUY A;  4J8U B;  1P3M D;  5AY8 A;  5GT0 C;  1PZR A;  2Y2I A;  3EPJ A;  5AVB D;  2JSS A;  4JJN B;  4XZQ A;  3AZN D;  1P3I A;  3B0C W;  1P3M C;  4UUZ B;  1P3F D;  1Z2C B;  1WWI A;  5AVB C;  5DNM A;  5G49 B;  3UT9 D;  3WA9 A;  3AZN C;  2CV5 A;  4YM6 D;  5AY8 B;  1P3F C;  2Y2Q A;  3UT9 C;  3FDD A;  4CSR A;  1BH9 B;  4YM6 C;  3P5J B;  3MVD D;  4LD9 C;  2Y2P A;  1U35 A;  4X23 D;  3MGQ A;  5F99 A;  4J8W C;  4Z66 A;  5AV5 A;  5CPJ D;  3MVD C;  4X23 C;  3AZK A;  5CPJ C;  4NFT A;  4QLC D;  3KUY D;  3C1B B;  3TU4 B;  1KX5 A;  4XZQ D;  3B6G A;  1P3I D;  4QLC C;  3KUY C;  1ID3 A;  5BS7 A;  2F8N A;  3AZM D;  2DF4 C;  5DNM D;  4XZQ C;  1P3O A;  1HTA A;  5BNX B;  2BYM B;  5B2I B;  3X1V B;  1P3I C;  2CV5 D;  3WKJ B;  2ARO A;  3AZM C;  3A1I A;  5DNM C;  5B32 D;  2CV5 C;  4Z5T B;  3B6F B;  1U35 D;  5B32 C;  3WTP B;  3MGQ D;  5F99 D;  4Z2M H;  4J8X A;  4Z66 D;  5AV5 D;  4KGC B;  3KXB A;  5E5A B;  1U35 C;  1P3A D;  3NQJ A;  3MGQ C;  5F99 C;  3AZK D;  4Z66 C;  5AV5 C;  1P3A C;  3LZ0 B;  3B0C T;  3AZK C;  1KX5 D;  1P3G A;  3B6G D;  1P3K B;  1ID3 D;  2F8N D;  5CPK A;  1KX5 C;  1P3O D;  3B6G C;  3REJ B;  2Y2J A;  1ID3 C;  1S32 D;  4EO5 B;  3EG5 B;  5BS7 C;  3KWQ B;  2ARO D;  4WU8 B;  1P3O C;  5B33 B;  4H9N A;  1S32 C;  2ARO C;  3UTB A;  3B0B A;  5DNN B;  4G91 B;  3AZF B;  4J8X D;  5JA4 A;  5AVC B;  3KXB D;  5AV9 A;  1P3L B;  5B31 G;  5B0Z B;  4H9N B;  3MGR A;  4J8X C;  1HQ3 A;  3KXB C;  3X1T B;  1M18 D;  1M19 A;  4HGA C;  3WTP E;  2BYK A;  3UTA A;  3MNN A;  3W99 A;  2HUE C;  5AV9 B;  3W97 A;  3AYW A;  5CPK D;  1ZLA B;  3AN2 A;  1N1J A;  1BH8 A;  2FJ7 B;  2BYK B;  3W96 A;  5CPK C;  2FFF B;  4YS3 A;  2HIO A;  3WAA D;  3B0D C;  1TZY A;  3AZE A;  3UTB D;  4ZBJ C;  2Y2O A;  3WAA C;  4M6B A;  2IO5 C;  5AVB A;  3UTB C;  5C3I B;  3AZN A;  3MGR D;  2HIO B;  1TAF A;  5GT0 B;  1M19 D;  3UTA D;  2J8P A;  5AV6 A;  3MNN D;  3MGR C;  3W99 D;  2RIQ A;  4YM6 A;  1H3O A;  1P3M B;  3W97 D;  2YFW A;  1M19 C;  3UTA C;  3AYW D;  3MNN C;  3AZN B;  3W99 C;  1M1A D;  3AN2 D;  1P3F B;  5FUG A;  1B6W A;  4KHA B;  3UT9 B;  3W97 C;  3AYW C;  3W96 D;  4UPK A;  1M1A C;  4YM6 B;  3AN2 C;  4YS3 D;  4LD9 B;  1TZY D;  3W96 C;  3AZE D;  1P34 A;  5B2J D;  4J8W B;  2NQB B;  4YS3 C;  3MVD B;  1TZY C;  4WNN B;  3AZE C;  4X23 B;  1WWS A;  5B2J C;  5BT1 D;  5CP6 D;  5CPJ B;  2F8N H;  3AZM A;  2JE5 A;  5BT1 C;  3A1K A;  5CP6 C;  5AV6 D;  4QLC B;  3AZH A;  3KUY B;  2Y2H A;  4DQY B;  4XZQ B;  5AV6 C;  5B32 A;  1P3I B;  5B1L A;  3MGS A;  3AZM B;  5JRG A;  2DQN C;  5B31 A;  5DNM B;  3WA9 B;  2NZD A;  2CV5 B;  1EQZ A;  3REK D;  1P3A A;  4J8V A;  4CSR B;  5BNV A;  1P34 D;  3REK C;  4Z2M G;  1U35 B;  5AV8 A;  1P34 C;  3MGQ B;  5F99 B;  5B24 A;  2PYO A;  3H0M C;  4Z66 B;  5AV5 B;  3KSY A;  3AZK B;  2ZY5 A;  3AZH D;  1S32 A;  3REH A;  1R4V A;  1KX5 B;  3B6G B;  3AZH C;  5B1L D;  3MGS D;  4KUD D;  1ID3 B;  5GT3 A;  3LEL D;  2YFV A;  2F8N B;  4WV4 B;  5JRG D;  5B31 D;  1P3O B;  2NZD D;  3X1S A;  5B1L C;  3MGS C;  4KUD C;  1S32 B;  3LEL C;  5GXQ A;  1EQZ D;  2ARO B;  5JRG C;  5B31 C;  2NZD C;  4J8V D;  1BFM A;  1ULY A;  3X1U A;  1EQZ C;  1M18 A;  4J8V C;  5AV8 D;  3AZG A;  5B24 D;  2PYO D;  4J8X B;  3KXB B;  3AZL A;  3H0L C;  4HGA B;  5B40 D;  5AV8 C;  3NQJ B;  5B24 C;  3EPK A;  2PYO C;  3REH D;  4NE3 A;  4E44 A;  3C1B D;  5B40 C;  1KX4 A;  3TU4 D;  1P3G B;  5GSU D;  2VQR A;  5GT3 D;  3O62 A;  3R45 A;  3REH C;  3C1B C;  3W98 D;  4H9O A;  5CPK B;  3WAA A;  3TU4 C;  3AV2 A;  3X1S D;  4H9P A;  2ZY3 A;  5GSU C;  2F8N K;  3EPH A;  5GT3 C;  3W98 C;  5GXQ D;  3B0D B;  3AFA D;  3X1S C;  4ZBJ B;  5GXQ C;  3WAA B;  3X1U D;  3AFA C;  2IO5 B;  3UTB B;  1AOI A;  3AZG D;  3X1U C;  5JA4 B;  1M18 C;  1P3B D;  3AZL D;  1F66 A;  3AZG C;  4WZS B;  3MGR B;  1M1A A;  1HQ3 B;  4ZUX A;  1KX3 D;  1P3B C;  3AZL C;  1M19 B;  3UTA B;  1KX4 D;  5B0Y A;  3MNN B;  3LZ0 D;  3W99 B;  2XD1 A;  5CHL B;  1KX3 C;  3O62 D;  3W97 B;  3C1C D;  3AYW B;  2ZY4 A;  1KX4 C;  3AV2 D;  1M1A B;  5B2J A;  2Y2L A;  3AN2 B;  1N1J B;  1BH8 B;  4CAY A;  3O62 C;  3AV1 A;  3C1C C;  1P3P D;  3W96 B;  3VH5 W;  3AV2 C;  3MGP A;  4R8P A;  4H9S A;  5CP6 A;  4YS3 B;  5B33 D;  2L5A A;  3VH5 A;  3A6N A;  3REI A;  1TZY B;  1P3P C;  1B67 A;  3AZE B;  4H9R A;  5B1M A;  1AOI D;  5B33 C;  5AVB B;  3AZI A;  1F66 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...