4YM6D

Crystal structure of the human nucleosome containing 6-4pp (outside)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
96
structure length
96
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Structural basis of pyrimidine-pyrimidone (6-4) photoproduct recognition by UV-DDB in the nucleosome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 96
sequence length 96
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ym6D00
3NQUB 5GXQC 3AV2B 3R45A 4G92B 1P3AD 5B33B 4KUDB 3MGSB 3LZ0A 4DRBA 4LD9B 3AZFA 5B32A 1BH9B 3VH5T 5BT1D 5B2JD 5B31B 3AFAD 5CPIA 3W97B 3REHA 1TZYC 1U35D 2YFWB 1P3OD 1P3GB 1KX5C 4XZQD 5B0ZD 5DNNA 5CP6C 5AV6B 1AOIB 3O62C 5JRGA 5BS7A 1KX3D 1P3MB 2PYOA 3B6FA 4J8XB 1P34C 3UTAA 3WKJA 4Z66C 4ZUXA 4H9NB 3REJD 3V9RA 2JSSA 5AV5A 4UUZB 5GT3D 3MVDA 3AV1C 3WA9D 4QLCB 4G91B 3AFAB 3TU4C 5JA4B 5B31G 3LJAD 3AZMD 3B0BA 3AZLC 1S32C 4R8PB 1F1EA 1KX4C 3C1BD 2RVQD 5B2IA 3UTBC 5B1MA 1EQZB 5B24D 4Z2MH 3REKC 4J8VA 4HGAC 3AZGC 3RELB 5BNVA 5AVBC 3KUYC 2LY8A 4WV4B 3B0CW 5BNXB 1ID3B 4WU8C 4YM6C 5B0YD 1N1JA 3WTPC 5G49B 3X1TC 5GT0A 3UT9C 1KU5A 4WU9D 3KSYA 3WAAA 4X23D 3R45B 3A6NA 5B33C 4J8UA 2F8NK 5GXQD 1P3BA 1P3IC 1Q9CA 4LD9C 3LZ0B 3AZFB 5B32B 5B40A 5B31C 5CPIB 3AYWD 3W97C 3X1UA 3REHB 4JJNA 1P3GC 1BH8A 1P3PB 5CPKC 5DNNB 4H9RA 5AV6C 5JRGB 5E5AA 3AZNA 1P3MC 3C1CD 2PYOB 4ZBJB 3B6FB 4M6BA 3UTAB 3AZIC 3WKJB 4ZUXB 1P3FA 1F66C 3V9RB 5B1LA 4EO5B 4Z2MG 5AV5B 3LZ1C 1HQ3D 5B32G 3MVDB 4QLCC 1M18D 1P3AA 5FUGA 3VH5A 2CV5D 5BO0A 2BYKA 3LELC 5B2IB 2NQBD 1EQZC 1WWSA 5B1MB 3W96D 1S32D 3A6ND 1U35A 1P3OA 4J8VB 3MGQC 3UTBD 3RELC 1M1AD 4Z5TC 4XZQA 5B0ZA 3X1UD 2NZDC 5AV8C 5AVBD 3W98C 1KX3A 4WZSB 1N1JB 3REJA 3X1VC 3AZJA 2AROA 5GT0B 5GT3A 3WTPD 3AN2D 3X1TD 3WAAB 3UT9D 3REID 3LJAA 4J8UB 3AZMA 4XUJA 1P3BB 5B32C 4E45A 3C1BA 5C3IB 5F99C 2L5AA 5CPIC 5B40B 4KGCD 1B67A 5KDMA 4CSRA 1P3ID 5B24A 3MGPC 4JJNB 1P3LC 5CPJC 1P3PC 2FJ7D 5AV9C 4H9RB 3X1SC 5E5AB 3AZNB 2HIOD 3AZHC 5B0YA 4ZBJC 2F8ND 3UTAC 3WKJC 3W99C 4ZUXC 1P3FB 3MNNB 3MGRD 1TAFA 5B1LB 5AV5C 2HUEB 3AZID 4WU9A 1F66D 4X23A 4H9SC 1P3AB 3LZ1D 3AZJD 2AROD 5AY8D 5BO0B 5GXQA 4H9OA 4E44A 4AWLB 2BYKB 1M19C 4J8WC 5B2JB 3AYWA 5B1MC 3B0DC 1U35B 1P3KC 4XUJD 1P3OB 3LELD 3KWQC 4XZQB 1TZYA 3KXBC 5B0ZB 3WTPE 3MGQD 4WNNA 1KX3B 3C1CA 1ZLAC 5CP6A 2NZDD 5AV8D 1A7WA 3REJB 3AZJB 3AZKC 4DRAA 3AZED 5GT3B 3B6GC 3X1VD 1HQ3A 3WA9B 4YS3C 1M18A 5DNMD 2CV5A 3LJAB 3AZMB 3AV1A 4NFTA 3AV2C 5AVCD 3C1BB 4G92C 2NQBA 5B40C 3W96A 5KDMB 1S32A 4CSRB 5GSUD 5B24B 4KUDC 3MGSC 1KX4A 3UTBA 1M1AA 4NE6A 1P3LD 3MGPD 5CPJD 5AVBA 5E5AC 5B0YB 5AV9D 3X1SD 1TZYD 1AOIC 1KX5D 3MNNC 3VH6W 1TAFB 3WTPA 5CP6D 3AN2A 3W99D 4J8XC 4WU9B 3O62D 3X1TA 4X23B 3UT9A 3REIA 5GXQB 1P34D 4Z66D 4AWLC 5B33A 4G91C 3AFAC 5B2JC 4KGCA 3AYWB 1P3IA 1U35C 3AV1D 1M19D 4R8PC 3W97A 3TU4D 4XZQC 1TZYB 1P3KD 2FJ7A 3AZLD 3KWQD 1KX4D 4H9PA 2HIOA 3KXBD 4WNNB 5CPKA 5BNVB 3C1CB 5CP6B 5AV6A 2F8NA 3REKD 3AZGD 1ZLAD 3MGRA 1ID3C 3KUYD 3AZIA 1JFIA 1F66A 1HQ3B 3WA9C 3AZKD 1M18B 3LZ1A 4WU8D 4YM6D 2CV5B 5AY8A 3LJAC 3B6GD 4YS3D 2RVQC 2NQBB 3W96B 1S32B 3A6NB 3AV2D 1KX4B 3LELA 3LZ0C 3UTBB 1M1AB 3AZFC 5B33D 4KUDD 3MGSD 3X1UB 3REHC 3MGQA 4LD9D 3RELA 4Z5TA 5AVBB 1BH8B 3W97D 5B31D 2NZDA 5AV8A 5DNNC 1P3GD 3W98A 5JRGC 2CWEA 5BS7C 5CPKD 3AZEA 2PYOC 3WTPB 5AV6D 3AN2B 1AOID 3X1VA 3VH5W 3B6FC 2F8NH 3X1TB 5CHLB 3UT9B 5DNMA 3REIB 1P3MD 1H3OA 4EO5C 4J8XD 3MVDC 5AVCA 4KGCB 5FUGB 3AYWC 1P3IB 5GSUA 4QLCD 5F99A 5B2IC 1P3LA 3MGPA 2FJ7B 5CPJA 4KHAA 4R8PD 1HTAA 2IO5B 4J8VC 1P3PA 4H9PB 2HIOB 5CPKB 3C1CC 1EQZD 5AV9A 3X1SA 2F8NB 1KX5A 3RELD 4Z5TD 3AZHA 3MGRB 3W99A 3NQJA 3AZIB 3O62A 1HQ3C 1JFIB 1F66B 1M18C 1ID3D 3W98D 3LZ1B 2CV5C 2AROB 5GT0C 5AY8B 3VH6A 1P34A 4Z66A 4H9QA 4H9SA 3WAAC 2NQBC 3W96C 1BFMA 3A6NC 4J8UC 4XUJB 1P3BC 1M19A 4J8WA 3LELB 1M1AC 4CAYA 3TU4A 5C3IC 3B0CT 1P3KA 2F8NG 3AZLA 3X1UC 3LZ0D 3KWQA 2YFVA 3MGQB 4Z5TB 5B32D 2BYMA 4JJNC 3AZFD 3KXBA 5F99D 5CPID 3REHD 2NZDB 5AV8B 3REKA 3AZGA 3W98B 1ZLAA 1P3PD 3AZNC 3KUYA 3AZEB 5DNND 3AN2C 3X1VB 3AZKA 5JRGD 3REIC 1P3FC 5DNMB 3AZHD 4WU8A 4YM6A 2PYOD 3B6GA 5B1LC 1H3OB 3B6FD 2HUEC 3UTAD 3WKJD 4ZUXD 4YS3A 5AVCB 1P3AC 5AV5D 4KGCC 1B6WA 3NQUA 5GSUB 3AV2A 4H9OB 3MVDD 5F99B 5BT1C 1P3LB 3MGPB 3VH6T 3MGSA 2FJ7C 5CPJB 4KUDA 4LD9A 1P3OC 4KHAB 2IO5C 1BH9A 4J8WD 5B2ID 2HIOC 5B31A 5B1MD 5AV9B 3X1SB 2YFWA 5B0ZC 4J8VD 1P3GA 1KX5B 3AZHB 3MGRC 1KX3C 1AOIA 3NQJB 3W99B 3O62B 3MNNA 4NE3A 3REJC 3AZJC 1P3MA 2AROC 5AY8C 4J8XA 5GT3C 1P34B 4H9NA 4Z66B 4H9QB 5GT0D 4UUZA 4NE5A 3AZMC 4XUJC 3AV1B 1M19B 3WAAD 4QLCA 4J8WB 1WWIA 3AFAA 5B2JA 4CAYB 5JA4A 3C1BC 3TU4B 4J8UD 3B0DB 1P3KB 1P3BD 3AZLB 5B24C 2YFVB 4R8PA 3KWQB 2BYMB 3KXBB 5B40D 1EQZA 4JJND 3REKB 4HGAB 3AZGB 1ZLAB 3KUYB 3AZEC 5B0YC 5BNXA 3AZKB 1ID3A 5E5AD 3AZND 5DNMC 4WU8B 4YM6B 3B6GB 1R4VA 5G49A 3WA9A 4YS3B 4WU9C 1P3FD 5AVCC 4X23C 3MNND 5B1LD 1ULYA 5GSUC
chains in the Genus database with same CATH superfamily
3NQUB 5GXQC 3AV2B 3R45A 4G92B 1P3AD 3EG5B 3H0RC 5B33B 4KUDB 3MGSB 3LZ0A 4DRBA 4LD9B 3AZFA 5B32A 1BH9B 3VH5T 5BT1D 5B2JD 5B31B 3AFAD 5CPIA 3W97B 3REHA 1TZYC 1U35D 2YFWB 1P3OD 2ZY2A 1P3GB 1KX5C 4XZQD 5B0ZD 5DNNA 5CP6C 5AV6B 1AOIB 3O62C 3IP4C 5JRGA 5BS7A 1KX3D 1P3MB 2PYOA 3B6FA 4J8XB 1P34C 3UTAA 3WKJA 4Z66C 4ZUXA 4H9NB 3REJD 2ZY5A 3V9RA 2JSSA 5AV5A 4UUZB 5GT3D 3MVDA 3AV1C 3WA9D 4QLCB 4G91B 3AFAB 3TU4C 5JA4B 5B31G 3EPHA 3LJAD 3AZMD 3B0BA 3AZLC 1S32C 4R8PB 1F1EA 1KX4C 3C1BD 2RVQD 5B2IA 3UTBC 5B1MA 1EQZB 5B24D 4Z2MH 3REKC 4J8VA 4HGAC 3AZGC 3RELB 5BNVA 5AVBC 3KUYC 2LY8A 2F2AC 4WV4B 3B0CW 5BNXB 1ID3B 4WU8C 4YM6C 5B0YD 1N1JA 3WTPC 3F6TA 5G49B 3X1TC 5GT0A 3UT9C 1KU5A 1Z2CB 4WU9D 3KSYA 3WAAA 4X23D 3R45B 3A6NA 5B33C 4J8UA 2F8NK 5GXQD 1P3BA 1P3IC 1Q9CA 4LD9C 3LZ0B 3AZFB 5B32B 5B40A 5B31C 5CPIB 3AYWD 3W97C 3X1UA 3REHB 4JJNA 1P3GC 1BH8A 3FDDA 2Y2PA 1P3PB 5CPKC 3H0LC 5DNNB 4H9RA 5AV6C 2Y2HA 5JRGB 5E5AA 3AZNA 1P3MC 2JCHA 3C1CD 2PYOB 4ZBJB 3B6FB 4M6BA 3UTAB 3AZIC 3WKJB 4ZUXB 1P3FA 1F66C 3V9RB 5B1LA 4EO5B 4Z2MG 5AV5B 3LZ1C 1HQ3D 5B32G 3MVDB 4QLCC 1M18D 1P3AA 5FUGA 2Y2MA 3VH5A 2CV5D 5BO0A 2Y2JA 2BYKA 3LELC 5B2IB 2Y2QA 2NQBD 1EQZC 1WWSA 5B1MB 3W96D 1S32D 3A6ND 1U35A 1P3OA 4J8VB 2G5HC 3MGQC 3UTBD 3RELC 1M1AD 4Z5TC 4XZQA 5B0ZA 1PZRA 3X1UD 2NZDC 5AV8C 5AVBD 3W98C 1KX3A 4WZSB 1N1JB 3REJA 3X1VC 3AZJA 2AROA 5GT0B 5GT3A 3WTPD 3AN2D 3X1TD 3WAAB 3UT9D 2UWXA 3REID 3LJAA 4J8UB 3AZMA 4XUJA 1P3BB 5B32C 4E45A 3C1BA 5C3IB 5F99C 2L5AA 5CPIC 5B40B 4KGCD 1B67A 5KDMA 4CSRA 1P3ID 5B24A 3MGPC 4JJNB 1P3LC 5CPJC 1P3PC 2FJ7D 5AV9C 4H9RB 3X1SC 5E5AB 3AZNB 2HIOD 3AZHC 5B0YA 4ZBJC 2F8ND 3UTAC 3WKJC 3W99C 4ZUXC 3AL0C 1P3FB 3MNNB 3MGRD 5B1LB 1TAFA 5AV5C 2HUEB 3AZID 4WU9A 1F66D 4X23A 4H9SC 1P3AB 2BG1A 3LZ1D 3AZJD 2AROD 5AY8D 5BO0B 5GXQA 4H9OA 4E44A 4AWLB 2BYKB 1M19C 4J8WC 5B2JB 3AYWA 5B1MC 2XD1A 3B0DC 1U35B 1P3KC 4XUJD 1P3OB 3LELD 3KWQC 4XZQB 1TZYA 3KXBC 5B0ZB 3WTPE 3MGQD 4WNNA 1KX3B 3C1CA 1ZLAC 5CP6A 2NZDD 5AV8D 1A7WA 3REJB 3AZJB 3AZKC 4DRAA 3AZED 5GT3B 3B6GC 3X1VD 1HQ3A 3WA9B 4YS3C 1M18A 5DNMD 2RIQA 2CV5A 3LJAB 3AZMB 3AV1A 4NFTA 3P5JB 3AV2C 5AVCD 3C1BB 4G92C 2NQBA 5B40C 3W96A 5KDMB 1S32A 4CSRB 5GSUD 5B24B 4KUDC 3A1IA 4UPKA 3MGSC 1KX4A 3UTBA 1M1AA 4NE6A 1P3LD 3MGPD 5CPJD 5AVBA 3EPJA 5E5AC 5B0YB 5AV9D 3X1SD 1TZYD 1AOIC 1KX5D 3MNNC 3VH6W 2ZY3A 1TAFB 3WTPA 5CP6D 3AN2A 3W99D 4J8XC 4WU9B 3O62D 3X1TA 4X23B 3UT9A 3REIA 5GXQB 1P34D 4Z66D 4AWLC 5B33A 2Y2KA 4G91C 3AFAC 2DF4C 5B2JC 4KGCA 3AYWB 1P3IA 1U35C 3AV1D 1M19D 4R8PC 3W97A 3TU4D 4XZQC 1TZYB 1P3KD 2FJ7A 3AZLD 3KWQD 1KX4D 4H9PA 2HIOA 3KXBD 4WNNB 5CPKA 5BNVB 3C1CB 5CP6B 5AV6A 2F8NA 2JE5A 3REKD 3AZGD 1ZLAD 3MGRA 1ID3C 3KUYD 3AZIA 1JFIA 1F66A 1HQ3B 3WA9C 3AZKD 1M18B 2Y2OA 3LZ1A 3EPKA 4WU8D 4YM6D 2CV5B 5AY8A 3LJAC 3B6GD 4YS3D 2RVQC 2NQBB 3W96B 1S32B 3A6NB 3AV2D 3EPLA 1KX4B 3LELA 3LZ0C 3UTBB 1M1AB 3AZFC 5B33D 4KUDD 3MGSD 3X1UB 3REHC 3MGQA 4LD9D 3RELA 4Z5TA 5AVBB 1BH8B 3W97D 5B31D 2NZDA 5AV8A 5DNNC 1P3GD 3W98A 5JRGC 2CWEA 2Y2GA 5BS7C 5CPKD 3AZEA 2PYOC 3WTPB 5AV6D 3AN2B 1AOID 3X1VA 3VH5W 3B6FC 2F8NH 3X1TB 5CHLB 3UT9B 5DNMA 3REIB 1P3MD 2ZM5A 1H3OA 4EO5C 4J8XD 2FFFB 3MVDC 5AVCA 4KGCB 5FUGB 3AYWC 1P3IB 5GSUA 1T3UA 4QLCD 5F99A 3KFUG 2VQRA 5B2IC 1P3LA 3MGPA 2FJ7B 5CPJA 4KHAA 4R8PD 1HTAA 2IO5B 4J8VC 1P3PA 4H9PB 2HIOB 5CPKB 3C1CC 1EQZD 5AV9A 4DQYB 3X1SA 2F8NB 1KX5A 3RELD 4Z5TD 3AZHA 3MGRB 3W99A 3NQJA 3AZIB 3O62A 1HQ3C 1JFIB 1F66B 1M18C 1ID3D 3W98D 3LZ1B 2CV5C 2AROB 5GT0C 5AY8B 3VH6A 1P34A 4Z66A 4H9QA 4H9SA 3WAAC 2Y2IA 2NQBC 3W96C 1BFMA 2XD5A 3A6NC 4J8UC 4XUJB 1P3BC 1M19A 4J8WA 3LELB 1M1AC 4CAYA 3TU4A 5C3IC 3B0CT 1P3KA 2F8NG 3AZLA 3X1UC 3LZ0D 3KWQA 2YFVA 2W8SA 4Z5TB 5B32D 2BYMA 3MGQB 4JJNC 3AZFD 3KXBA 5F99D 5CPID 3A1KA 3REHD 2NZDB 5AV8B 3REKA 3AZGA 3W98B 4WJ3C 1ZLAA 1P3PD 3AZNC 3KUYA 3AZEB 5DNND 3AN2C 3X1VB 3AZKA 5JRGD 3REIC 1P3FC 5DNMB 3AZHD 4WU8A 4YM6A 2PYOD 3H0MC 3B6GA 5B1LC 1H3OB 3B6FD 2HUEC 3UTAD 3WKJD 4ZUXD 4YS3A 5AVCB 1P3AC 5AV5D 4KGCC 1B6WA 2ZY4A 3NQUA 5GSUB 3AV2A 4H9OB 3MVDD 5F99B 5BT1C 1P3LB 3MGPB 3VH6T 3MGSA 2FJ7C 5CPJB 4KUDA 4LD9A 1P3OC 4KHAB 2IO5C 1BH9A 4J8WD 5B2ID 2HIOC 5B31A 5B1MD 5AV9B 3X1SB 2YFWA 5B0ZC 4J8VD 1P3GA 1KX5B 3AZHB 3MGRC 1KX3C 2DQNC 1AOIA 3NQJB 3W99B 3O62B 3MNNA 4NE3A 3REJC 3AZJC 1P3MA 2AROC 5AY8C 4J8XA 5GT3C 2J8PA 1P34B 4H9NA 4Z66B 4H9QB 1W2EA 2Y2LA 5GT0D 4UUZA 4NE5A 3AZMC 4XUJC 3AV1B 1M19B 3WAAD 4QLCA 4J8WB 1WWIA 3AFAA 5B2JA 4CAYB 5JA4A 3C1BC 3TU4B 4J8UD 3B0DB 1P3KB 1P3BD 3AZLB 5B24C 2YFVB 4R8PA 3KWQB 2BYMB 3KXBB 5B40D 1EQZA 4JJND 3REKB 4HGAB 2G5IC 3AZGB 1ZLAB 3KUYB 3AZEC 5B0YC 2Y2NA 5BNXA 3AZKB 1ID3A 5E5AD 3AZND 5DNMC 4WU8B 4YM6B 3B6GB 1R4VA 5G49A 3WA9A 4YS3B 4WU9C 1P3FD 5AVCC 4X23C 3MNND 5B1LD 1ULYA 5GSUC
chains in the Genus database with same CATH topology
3NQUB 5GXQC 3AV2B 3R45A 4G92B 1P3AD 3EG5B 3H0RC 5B33B 4KUDB 3MGSB 3LZ0A 4DRBA 4LD9B 3AZFA 5B32A 1BH9B 3VH5T 5BT1D 5B2JD 5B31B 3AFAD 5CPIA 3W97B 3REHA 1TZYC 1U35D 2YFWB 1P3OD 2ZY2A 1P3GB 1KX5C 4XZQD 5B0ZD 5DNNA 5CP6C 5AV6B 1AOIB 3O62C 3IP4C 5JRGA 5BS7A 1KX3D 1P3MB 2PYOA 3B6FA 4J8XB 1P34C 3UTAA 3WKJA 4Z66C 4ZUXA 4H9NB 3REJD 2ZY5A 3V9RA 2JSSA 5AV5A 4UUZB 5GT3D 3MVDA 3AV1C 3WA9D 4QLCB 4G91B 3AFAB 3TU4C 5JA4B 5B31G 3EPHA 3LJAD 3AZMD 3B0BA 3AZLC 1S32C 4R8PB 1F1EA 1KX4C 3C1BD 2RVQD 5B2IA 3UTBC 5B1MA 1EQZB 5B24D 4Z2MH 3REKC 4J8VA 4HGAC 3AZGC 3RELB 5BNVA 5AVBC 3KUYC 2LY8A 2F2AC 4WV4B 3B0CW 5BNXB 1ID3B 4WU8C 4YM6C 5B0YD 1N1JA 3WTPC 3F6TA 5G49B 3X1TC 5GT0A 3UT9C 1KU5A 1Z2CB 4WU9D 3KSYA 3WAAA 4X23D 3R45B 3A6NA 5B33C 4J8UA 2F8NK 5GXQD 1P3BA 1P3IC 1Q9CA 4LD9C 3LZ0B 3AZFB 5B32B 5B40A 5B31C 5CPIB 3AYWD 3W97C 3X1UA 3REHB 4JJNA 1P3GC 1BH8A 3FDDA 2Y2PA 1P3PB 5CPKC 3H0LC 5DNNB 4H9RA 5AV6C 2Y2HA 5JRGB 5E5AA 3AZNA 1P3MC 2JCHA 3C1CD 2PYOB 4ZBJB 3B6FB 4M6BA 3UTAB 3AZIC 3WKJB 4ZUXB 1P3FA 1F66C 3V9RB 5B1LA 4EO5B 4Z2MG 5AV5B 3LZ1C 1HQ3D 5B32G 3MVDB 4QLCC 1M18D 1P3AA 5FUGA 2Y2MA 3VH5A 2CV5D 5BO0A 2Y2JA 2BYKA 3LELC 5B2IB 2Y2QA 2NQBD 1EQZC 1WWSA 5B1MB 3W96D 1S32D 3A6ND 1U35A 1P3OA 4J8VB 2G5HC 3MGQC 3UTBD 3RELC 1M1AD 4Z5TC 4XZQA 5B0ZA 1PZRA 3X1UD 2NZDC 5AV8C 5AVBD 3W98C 1KX3A 4WZSB 1N1JB 3REJA 3X1VC 3AZJA 2AROA 5GT0B 5GT3A 3WTPD 3AN2D 3X1TD 3WAAB 3UT9D 2UWXA 3REID 3LJAA 4J8UB 3AZMA 4XUJA 1P3BB 5B32C 4E45A 3C1BA 5C3IB 5F99C 2L5AA 5CPIC 5B40B 4KGCD 1B67A 5KDMA 4CSRA 1P3ID 5B24A 3MGPC 4JJNB 1P3LC 5CPJC 1P3PC 2FJ7D 5AV9C 4H9RB 3X1SC 5E5AB 3AZNB 2HIOD 3AZHC 5B0YA 4ZBJC 2F8ND 3UTAC 3WKJC 3W99C 4ZUXC 3AL0C 1P3FB 3MNNB 3MGRD 5B1LB 1TAFA 5AV5C 2HUEB 3AZID 4WU9A 1F66D 4X23A 4H9SC 1P3AB 2BG1A 3LZ1D 3AZJD 2AROD 5AY8D 5BO0B 5GXQA 4H9OA 4E44A 4AWLB 2BYKB 1M19C 4J8WC 5B2JB 3AYWA 5B1MC 2XD1A 3B0DC 1U35B 1P3KC 4XUJD 1P3OB 3LELD 3KWQC 4XZQB 1TZYA 3KXBC 5B0ZB 3WTPE 3MGQD 4WNNA 1KX3B 3C1CA 1ZLAC 5CP6A 2NZDD 5AV8D 1A7WA 3REJB 3AZJB 3AZKC 4DRAA 3AZED 5GT3B 3B6GC 3X1VD 1HQ3A 3WA9B 4YS3C 1M18A 5DNMD 2RIQA 2CV5A 3LJAB 3AZMB 3AV1A 4NFTA 3P5JB 3AV2C 5AVCD 3C1BB 4G92C 2NQBA 5B40C 3W96A 5KDMB 1S32A 4CSRB 5GSUD 5B24B 4KUDC 3A1IA 4UPKA 3MGSC 1KX4A 3UTBA 1M1AA 4NE6A 1P3LD 3MGPD 5CPJD 5AVBA 3EPJA 5E5AC 5B0YB 5AV9D 3X1SD 1TZYD 1AOIC 1KX5D 3MNNC 3VH6W 2ZY3A 1TAFB 3WTPA 5CP6D 3AN2A 3W99D 4J8XC 4WU9B 3O62D 3X1TA 4X23B 3UT9A 3REIA 5GXQB 1P34D 4Z66D 4AWLC 5B33A 2Y2KA 4G91C 3AFAC 2DF4C 5B2JC 4KGCA 3AYWB 1P3IA 1U35C 3AV1D 1M19D 4R8PC 3W97A 3TU4D 4XZQC 1TZYB 1P3KD 2FJ7A 3AZLD 3KWQD 1KX4D 4H9PA 2HIOA 3KXBD 4WNNB 5CPKA 5BNVB 3C1CB 5CP6B 5AV6A 2F8NA 2JE5A 3REKD 3AZGD 1ZLAD 3MGRA 1ID3C 3KUYD 3AZIA 1JFIA 1F66A 1HQ3B 3WA9C 3AZKD 1M18B 2Y2OA 3LZ1A 3EPKA 4WU8D 4YM6D 2CV5B 5AY8A 3LJAC 3B6GD 4YS3D 2RVQC 2NQBB 3W96B 1S32B 3A6NB 3AV2D 3EPLA 1KX4B 3LELA 3LZ0C 3UTBB 1M1AB 3AZFC 5B33D 4KUDD 3MGSD 3X1UB 3REHC 3MGQA 4LD9D 3RELA 4Z5TA 5AVBB 1BH8B 3W97D 5B31D 2NZDA 5AV8A 5DNNC 1P3GD 3W98A 5JRGC 2CWEA 2Y2GA 5BS7C 5CPKD 3AZEA 2PYOC 3WTPB 5AV6D 3AN2B 1AOID 3X1VA 3VH5W 3B6FC 2F8NH 3X1TB 5CHLB 3UT9B 5DNMA 3REIB 1P3MD 2ZM5A 1H3OA 4EO5C 4J8XD 2FFFB 3MVDC 5AVCA 4KGCB 5FUGB 3AYWC 1P3IB 5GSUA 1T3UA 4QLCD 5F99A 3KFUG 2VQRA 5B2IC 1P3LA 3MGPA 2FJ7B 5CPJA 4KHAA 4R8PD 1HTAA 2IO5B 4J8VC 1P3PA 4H9PB 2HIOB 5CPKB 3C1CC 1EQZD 5AV9A 4DQYB 3X1SA 2F8NB 1KX5A 3RELD 4Z5TD 3AZHA 3MGRB 3W99A 3NQJA 3AZIB 3O62A 1HQ3C 1JFIB 1F66B 1M18C 1ID3D 3W98D 3LZ1B 2CV5C 2AROB 5GT0C 5AY8B 3VH6A 1P34A 4Z66A 4H9QA 4H9SA 3WAAC 2Y2IA 2NQBC 3W96C 1BFMA 2XD5A 3A6NC 4J8UC 4XUJB 1P3BC 1M19A 4J8WA 3LELB 1M1AC 4CAYA 3TU4A 5C3IC 3B0CT 1P3KA 2F8NG 3AZLA 3X1UC 3LZ0D 3KWQA 2YFVA 2W8SA 4Z5TB 5B32D 2BYMA 3MGQB 4JJNC 3AZFD 3KXBA 5F99D 5CPID 3A1KA 3REHD 2NZDB 5AV8B 3REKA 3AZGA 3W98B 4WJ3C 1ZLAA 1P3PD 3AZNC 3KUYA 3AZEB 5DNND 3AN2C 3X1VB 3AZKA 5JRGD 3REIC 1P3FC 5DNMB 3AZHD 4WU8A 4YM6A 2PYOD 3H0MC 3B6GA 5B1LC 1H3OB 3B6FD 2HUEC 3UTAD 3WKJD 4ZUXD 4YS3A 5AVCB 1P3AC 5AV5D 4KGCC 1B6WA 2ZY4A 3NQUA 5GSUB 3AV2A 4H9OB 3MVDD 5F99B 5BT1C 1P3LB 3MGPB 3VH6T 3MGSA 2FJ7C 5CPJB 4KUDA 4LD9A 1P3OC 4KHAB 2IO5C 1BH9A 4J8WD 5B2ID 2HIOC 5B31A 5B1MD 5AV9B 3X1SB 2YFWA 5B0ZC 4J8VD 1P3GA 1KX5B 3AZHB 3MGRC 1KX3C 2DQNC 1AOIA 3NQJB 3W99B 3O62B 3MNNA 4NE3A 3REJC 3AZJC 1P3MA 2AROC 5AY8C 4J8XA 5GT3C 2J8PA 1P34B 4H9NA 4Z66B 4H9QB 1W2EA 2Y2LA 5GT0D 4UUZA 4NE5A 3AZMC 4XUJC 3AV1B 1M19B 3WAAD 4QLCA 4J8WB 1WWIA 3AFAA 5B2JA 4CAYB 5JA4A 3C1BC 3TU4B 4J8UD 3B0DB 1P3KB 1P3BD 3AZLB 5B24C 2YFVB 4R8PA 3KWQB 2BYMB 3KXBB 5B40D 1EQZA 4JJND 3REKB 4HGAB 2G5IC 3AZGB 1ZLAB 3KUYB 3AZEC 5B0YC 2Y2NA 5BNXA 3AZKB 1ID3A 5E5AD 3AZND 5DNMC 4WU8B 4YM6B 3B6GB 1R4VA 5G49A 3WA9A 4YS3B 4WU9C 1P3FD 5AVCC 4X23C 3MNND 5B1LD 1ULYA 5GSUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NQU B;  5GXQ C;  3AV2 B;  3R45 A;  4G92 B;  1P3A D;  5B33 B;  4KUD B;  3MGS B;  3LZ0 A;  4DRB A;  4LD9 B;  3AZF A;  5B32 A;  1BH9 B;  3VH5 T;  5BT1 D;  5B2J D;  5B31 B;  3AFA D;  5CPI A;  3W97 B;  3REH A;  1TZY C;  1U35 D;  2YFW B;  1P3O D;  1P3G B;  1KX5 C;  4XZQ D;  5B0Z D;  5DNN A;  5CP6 C;  5AV6 B;  1AOI B;  3O62 C;  5JRG A;  5BS7 A;  1KX3 D;  1P3M B;  2PYO A;  3B6F A;  4J8X B;  1P34 C;  3UTA A;  3WKJ A;  4Z66 C;  4ZUX A;  4H9N B;  3REJ D;  3V9R A;  2JSS A;  5AV5 A;  4UUZ B;  5GT3 D;  3MVD A;  3AV1 C;  3WA9 D;  4QLC B;  4G91 B;  3AFA B;  3TU4 C;  5JA4 B;  5B31 G;  3LJA D;  3AZM D;  3B0B A;  3AZL C;  1S32 C;  4R8P B;  1F1E A;  1KX4 C;  3C1B D;  2RVQ D;  5B2I A;  3UTB C;  5B1M A;  1EQZ B;  5B24 D;  4Z2M H;  3REK C;  4J8V A;  4HGA C;  3AZG C;  3REL B;  5BNV A;  5AVB C;  3KUY C;  2LY8 A;  4WV4 B;  3B0C W;  5BNX B;  1ID3 B;  4WU8 C;  4YM6 C;  5B0Y D;  1N1J A;  3WTP C;  5G49 B;  3X1T C;  5GT0 A;  3UT9 C;  1KU5 A;  4WU9 D;  3KSY A;  3WAA A;  4X23 D;  3R45 B;  3A6N A;  5B33 C;  4J8U A;  2F8N K;  5GXQ D;  1P3B A;  1P3I C;  1Q9C A;  4LD9 C;  3LZ0 B;  3AZF B;  5B32 B;  5B40 A;  5B31 C;  5CPI B;  3AYW D;  3W97 C;  3X1U A;  3REH B;  4JJN A;  1P3G C;  1BH8 A;  1P3P B;  5CPK C;  5DNN B;  4H9R A;  5AV6 C;  5JRG B;  5E5A A;  3AZN A;  1P3M C;  3C1C D;  2PYO B;  4ZBJ B;  3B6F B;  4M6B A;  3UTA B;  3AZI C;  3WKJ B;  4ZUX B;  1P3F A;  1F66 C;  3V9R B;  5B1L A;  4EO5 B;  4Z2M G;  5AV5 B;  3LZ1 C;  1HQ3 D;  5B32 G;  3MVD B;  4QLC C;  1M18 D;  1P3A A;  5FUG A;  3VH5 A;  2CV5 D;  5BO0 A;  2BYK A;  3LEL C;  5B2I B;  2NQB D;  1EQZ C;  1WWS A;  5B1M B;  3W96 D;  1S32 D;  3A6N D;  1U35 A;  1P3O A;  4J8V B;  3MGQ C;  3UTB D;  3REL C;  1M1A D;  4Z5T C;  4XZQ A;  5B0Z A;  3X1U D;  2NZD C;  5AV8 C;  5AVB D;  3W98 C;  1KX3 A;  4WZS B;  1N1J B;  3REJ A;  3X1V C;  3AZJ A;  2ARO A;  5GT0 B;  5GT3 A;  3WTP D;  3AN2 D;  3X1T D;  3WAA B;  3UT9 D;  3REI D;  3LJA A;  4J8U B;  3AZM A;  4XUJ A;  1P3B B;  5B32 C;  4E45 A;  3C1B A;  5C3I B;  5F99 C;  2L5A A;  5CPI C;  5B40 B;  4KGC D;  1B67 A;  5KDM A;  4CSR A;  1P3I D;  5B24 A;  3MGP C;  4JJN B;  1P3L C;  5CPJ C;  1P3P C;  2FJ7 D;  5AV9 C;  4H9R B;  3X1S C;  5E5A B;  3AZN B;  2HIO D;  3AZH C;  5B0Y A;  4ZBJ C;  2F8N D;  3UTA C;  3WKJ C;  3W99 C;  4ZUX C;  1P3F B;  3MNN B;  3MGR D;  1TAF A;  5B1L B;  5AV5 C;  2HUE B;  3AZI D;  4WU9 A;  1F66 D;  4X23 A;  4H9S C;  1P3A B;  3LZ1 D;  3AZJ D;  2ARO D;  5AY8 D;  5BO0 B;  5GXQ A;  4H9O A;  4E44 A;  4AWL B;  2BYK B;  1M19 C;  4J8W C;  5B2J B;  3AYW A;  5B1M C;  3B0D C;  1U35 B;  1P3K C;  4XUJ D;  1P3O B;  3LEL D;  3KWQ C;  4XZQ B;  1TZY A;  3KXB C;  5B0Z B;  3WTP E;  3MGQ D;  4WNN A;  1KX3 B;  3C1C A;  1ZLA C;  5CP6 A;  2NZD D;  5AV8 D;  1A7W A;  3REJ B;  3AZJ B;  3AZK C;  4DRA A;  3AZE D;  5GT3 B;  3B6G C;  3X1V D;  1HQ3 A;  3WA9 B;  4YS3 C;  1M18 A;  5DNM D;  2CV5 A;  3LJA B;  3AZM B;  3AV1 A;  4NFT A;  3AV2 C;  5AVC D;  3C1B B;  4G92 C;  2NQB A;  5B40 C;  3W96 A;  5KDM B;  1S32 A;  4CSR B;  5GSU D;  5B24 B;  4KUD C;  3MGS C;  1KX4 A;  3UTB A;  1M1A A;  4NE6 A;  1P3L D;  3MGP D;  5CPJ D;  5AVB A;  5E5A C;  5B0Y B;  5AV9 D;  3X1S D;  1TZY D;  1AOI C;  1KX5 D;  3MNN C;  3VH6 W;  1TAF B;  3WTP A;  5CP6 D;  3AN2 A;  3W99 D;  4J8X C;  4WU9 B;  3O62 D;  3X1T A;  4X23 B;  3UT9 A;  3REI A;  5GXQ B;  1P34 D;  4Z66 D;  4AWL C;  5B33 A;  4G91 C;  3AFA C;  5B2J C;  4KGC A;  3AYW B;  1P3I A;  1U35 C;  3AV1 D;  1M19 D;  4R8P C;  3W97 A;  3TU4 D;  4XZQ C;  1TZY B;  1P3K D;  2FJ7 A;  3AZL D;  3KWQ D;  1KX4 D;  4H9P A;  2HIO A;  3KXB D;  4WNN B;  5CPK A;  5BNV B;  3C1C B;  5CP6 B;  5AV6 A;  2F8N A;  3REK D;  3AZG D;  1ZLA D;  3MGR A;  1ID3 C;  3KUY D;  3AZI A;  1JFI A;  1F66 A;  1HQ3 B;  3WA9 C;  3AZK D;  1M18 B;  3LZ1 A;  4WU8 D;  4YM6 D;  2CV5 B;  5AY8 A;  3LJA C;  3B6G D;  4YS3 D;  2RVQ C;  2NQB B;  3W96 B;  1S32 B;  3A6N B;  3AV2 D;  1KX4 B;  3LEL A;  3LZ0 C;  3UTB B;  1M1A B;  3AZF C;  5B33 D;  4KUD D;  3MGS D;  3X1U B;  3REH C;  3MGQ A;  4LD9 D;  3REL A;  4Z5T A;  5AVB B;  1BH8 B;  3W97 D;  5B31 D;  2NZD A;  5AV8 A;  5DNN C;  1P3G D;  3W98 A;  5JRG C;  2CWE A;  5BS7 C;  5CPK D;  3AZE A;  2PYO C;  3WTP B;  5AV6 D;  3AN2 B;  1AOI D;  3X1V A;  3VH5 W;  3B6F C;  2F8N H;  3X1T B;  5CHL B;  3UT9 B;  5DNM A;  3REI B;  1P3M D;  1H3O A;  4EO5 C;  4J8X D;  3MVD C;  5AVC A;  4KGC B;  5FUG B;  3AYW C;  1P3I B;  5GSU A;  4QLC D;  5F99 A;  5B2I C;  1P3L A;  3MGP A;  2FJ7 B;  5CPJ A;  4KHA A;  4R8P D;  1HTA A;  2IO5 B;  4J8V C;  1P3P A;  4H9P B;  2HIO B;  5CPK B;  3C1C C;  1EQZ D;  5AV9 A;  3X1S A;  2F8N B;  1KX5 A;  3REL D;  4Z5T D;  3AZH A;  3MGR B;  3W99 A;  3NQJ A;  3AZI B;  3O62 A;  1HQ3 C;  1JFI B;  1F66 B;  1M18 C;  1ID3 D;  3W98 D;  3LZ1 B;  2CV5 C;  2ARO B;  5GT0 C;  5AY8 B;  3VH6 A;  1P34 A;  4Z66 A;  4H9Q A;  4H9S A;  3WAA C;  2NQB C;  3W96 C;  1BFM A;  3A6N C;  4J8U C;  4XUJ B;  1P3B C;  1M19 A;  4J8W A;  3LEL B;  1M1A C;  4CAY A;  3TU4 A;  5C3I C;  3B0C T;  1P3K A;  2F8N G;  3AZL A;  3X1U C;  3LZ0 D;  3KWQ A;  2YFV A;  3MGQ B;  4Z5T B;  5B32 D;  2BYM A;  4JJN C;  3AZF D;  3KXB A;  5F99 D;  5CPI D;  3REH D;  2NZD B;  5AV8 B;  3REK A;  3AZG A;  3W98 B;  1ZLA A;  1P3P D;  3AZN C;  3KUY A;  3AZE B;  5DNN D;  3AN2 C;  3X1V B;  3AZK A;  5JRG D;  3REI C;  1P3F C;  5DNM B;  3AZH D;  4WU8 A;  4YM6 A;  2PYO D;  3B6G A;  5B1L C;  1H3O B;  3B6F D;  2HUE C;  3UTA D;  3WKJ D;  4ZUX D;  4YS3 A;  5AVC B;  1P3A C;  5AV5 D;  4KGC C;  1B6W A;  3NQU A;  5GSU B;  3AV2 A;  4H9O B;  3MVD D;  5F99 B;  5BT1 C;  1P3L B;  3MGP B;  3VH6 T;  3MGS A;  2FJ7 C;  5CPJ B;  4KUD A;  4LD9 A;  1P3O C;  4KHA B;  2IO5 C;  1BH9 A;  4J8W D;  5B2I D;  2HIO C;  5B31 A;  5B1M D;  5AV9 B;  3X1S B;  2YFW A;  5B0Z C;  4J8V D;  1P3G A;  1KX5 B;  3AZH B;  3MGR C;  1KX3 C;  1AOI A;  3NQJ B;  3W99 B;  3O62 B;  3MNN A;  4NE3 A;  3REJ C;  3AZJ C;  1P3M A;  2ARO C;  5AY8 C;  4J8X A;  5GT3 C;  1P34 B;  4H9N A;  4Z66 B;  4H9Q B;  5GT0 D;  4UUZ A;  4NE5 A;  3AZM C;  4XUJ C;  3AV1 B;  1M19 B;  3WAA D;  4QLC A;  4J8W B;  1WWI A;  3AFA A;  5B2J A;  4CAY B;  5JA4 A;  3C1B C;  3TU4 B;  4J8U D;  3B0D B;  1P3K B;  1P3B D;  3AZL B;  5B24 C;  2YFV B;  4R8P A;  3KWQ B;  2BYM B;  3KXB B;  5B40 D;  1EQZ A;  4JJN D;  3REK B;  4HGA B;  3AZG B;  1ZLA B;  3KUY B;  3AZE C;  5B0Y C;  5BNX A;  3AZK B;  1ID3 A;  5E5A D;  3AZN D;  5DNM C;  4WU8 B;  4YM6 B;  3B6G B;  1R4V A;  5G49 A;  3WA9 A;  4YS3 B;  4WU9 C;  1P3F D;  5AVC C;  4X23 C;  3MNN D;  5B1L D;  1ULY A;  5GSU C; 
#chains in the Genus database with same CATH topology
 3NQU B;  5GXQ C;  3AV2 B;  3R45 A;  4G92 B;  1P3A D;  3EG5 B;  3H0R C;  5B33 B;  4KUD B;  3MGS B;  3LZ0 A;  4DRB A;  4LD9 B;  3AZF A;  5B32 A;  1BH9 B;  3VH5 T;  5BT1 D;  5B2J D;  5B31 B;  3AFA D;  5CPI A;  3W97 B;  3REH A;  1TZY C;  1U35 D;  2YFW B;  1P3O D;  2ZY2 A;  1P3G B;  1KX5 C;  4XZQ D;  5B0Z D;  5DNN A;  5CP6 C;  5AV6 B;  1AOI B;  3O62 C;  3IP4 C;  5JRG A;  5BS7 A;  1KX3 D;  1P3M B;  2PYO A;  3B6F A;  4J8X B;  1P34 C;  3UTA A;  3WKJ A;  4Z66 C;  4ZUX A;  4H9N B;  3REJ D;  2ZY5 A;  3V9R A;  2JSS A;  5AV5 A;  4UUZ B;  5GT3 D;  3MVD A;  3AV1 C;  3WA9 D;  4QLC B;  4G91 B;  3AFA B;  3TU4 C;  5JA4 B;  5B31 G;  3EPH A;  3LJA D;  3AZM D;  3B0B A;  3AZL C;  1S32 C;  4R8P B;  1F1E A;  1KX4 C;  3C1B D;  2RVQ D;  5B2I A;  3UTB C;  5B1M A;  1EQZ B;  5B24 D;  4Z2M H;  3REK C;  4J8V A;  4HGA C;  3AZG C;  3REL B;  5BNV A;  5AVB C;  3KUY C;  2LY8 A;  2F2A C;  4WV4 B;  3B0C W;  5BNX B;  1ID3 B;  4WU8 C;  4YM6 C;  5B0Y D;  1N1J A;  3WTP C;  3F6T A;  5G49 B;  3X1T C;  5GT0 A;  3UT9 C;  1KU5 A;  1Z2C B;  4WU9 D;  3KSY A;  3WAA A;  4X23 D;  3R45 B;  3A6N A;  5B33 C;  4J8U A;  2F8N K;  5GXQ D;  1P3B A;  1P3I C;  1Q9C A;  4LD9 C;  3LZ0 B;  3AZF B;  5B32 B;  5B40 A;  5B31 C;  5CPI B;  3AYW D;  3W97 C;  3X1U A;  3REH B;  4JJN A;  1P3G C;  1BH8 A;  3FDD A;  2Y2P A;  1P3P B;  5CPK C;  3H0L C;  5DNN B;  4H9R A;  5AV6 C;  2Y2H A;  5JRG B;  5E5A A;  3AZN A;  1P3M C;  2JCH A;  3C1C D;  2PYO B;  4ZBJ B;  3B6F B;  4M6B A;  3UTA B;  3AZI C;  3WKJ B;  4ZUX B;  1P3F A;  1F66 C;  3V9R B;  5B1L A;  4EO5 B;  4Z2M G;  5AV5 B;  3LZ1 C;  1HQ3 D;  5B32 G;  3MVD B;  4QLC C;  1M18 D;  1P3A A;  5FUG A;  2Y2M A;  3VH5 A;  2CV5 D;  5BO0 A;  2Y2J A;  2BYK A;  3LEL C;  5B2I B;  2Y2Q A;  2NQB D;  1EQZ C;  1WWS A;  5B1M B;  3W96 D;  1S32 D;  3A6N D;  1U35 A;  1P3O A;  4J8V B;  2G5H C;  3MGQ C;  3UTB D;  3REL C;  1M1A D;  4Z5T C;  4XZQ A;  5B0Z A;  1PZR A;  3X1U D;  2NZD C;  5AV8 C;  5AVB D;  3W98 C;  1KX3 A;  4WZS B;  1N1J B;  3REJ A;  3X1V C;  3AZJ A;  2ARO A;  5GT0 B;  5GT3 A;  3WTP D;  3AN2 D;  3X1T D;  3WAA B;  3UT9 D;  2UWX A;  3REI D;  3LJA A;  4J8U B;  3AZM A;  4XUJ A;  1P3B B;  5B32 C;  4E45 A;  3C1B A;  5C3I B;  5F99 C;  2L5A A;  5CPI C;  5B40 B;  4KGC D;  1B67 A;  5KDM A;  4CSR A;  1P3I D;  5B24 A;  3MGP C;  4JJN B;  1P3L C;  5CPJ C;  1P3P C;  2FJ7 D;  5AV9 C;  4H9R B;  3X1S C;  5E5A B;  3AZN B;  2HIO D;  3AZH C;  5B0Y A;  4ZBJ C;  2F8N D;  3UTA C;  3WKJ C;  3W99 C;  4ZUX C;  3AL0 C;  1P3F B;  3MNN B;  3MGR D;  5B1L B;  1TAF A;  5AV5 C;  2HUE B;  3AZI D;  4WU9 A;  1F66 D;  4X23 A;  4H9S C;  1P3A B;  2BG1 A;  3LZ1 D;  3AZJ D;  2ARO D;  5AY8 D;  5BO0 B;  5GXQ A;  4H9O A;  4E44 A;  4AWL B;  2BYK B;  1M19 C;  4J8W C;  5B2J B;  3AYW A;  5B1M C;  2XD1 A;  3B0D C;  1U35 B;  1P3K C;  4XUJ D;  1P3O B;  3LEL D;  3KWQ C;  4XZQ B;  1TZY A;  3KXB C;  5B0Z B;  3WTP E;  3MGQ D;  4WNN A;  1KX3 B;  3C1C A;  1ZLA C;  5CP6 A;  2NZD D;  5AV8 D;  1A7W A;  3REJ B;  3AZJ B;  3AZK C;  4DRA A;  3AZE D;  5GT3 B;  3B6G C;  3X1V D;  1HQ3 A;  3WA9 B;  4YS3 C;  1M18 A;  5DNM D;  2RIQ A;  2CV5 A;  3LJA B;  3AZM B;  3AV1 A;  4NFT A;  3P5J B;  3AV2 C;  5AVC D;  3C1B B;  4G92 C;  2NQB A;  5B40 C;  3W96 A;  5KDM B;  1S32 A;  4CSR B;  5GSU D;  5B24 B;  4KUD C;  3A1I A;  4UPK A;  3MGS C;  1KX4 A;  3UTB A;  1M1A A;  4NE6 A;  1P3L D;  3MGP D;  5CPJ D;  5AVB A;  3EPJ A;  5E5A C;  5B0Y B;  5AV9 D;  3X1S D;  1TZY D;  1AOI C;  1KX5 D;  3MNN C;  3VH6 W;  2ZY3 A;  1TAF B;  3WTP A;  5CP6 D;  3AN2 A;  3W99 D;  4J8X C;  4WU9 B;  3O62 D;  3X1T A;  4X23 B;  3UT9 A;  3REI A;  5GXQ B;  1P34 D;  4Z66 D;  4AWL C;  5B33 A;  2Y2K A;  4G91 C;  3AFA C;  2DF4 C;  5B2J C;  4KGC A;  3AYW B;  1P3I A;  1U35 C;  3AV1 D;  1M19 D;  4R8P C;  3W97 A;  3TU4 D;  4XZQ C;  1TZY B;  1P3K D;  2FJ7 A;  3AZL D;  3KWQ D;  1KX4 D;  4H9P A;  2HIO A;  3KXB D;  4WNN B;  5CPK A;  5BNV B;  3C1C B;  5CP6 B;  5AV6 A;  2F8N A;  2JE5 A;  3REK D;  3AZG D;  1ZLA D;  3MGR A;  1ID3 C;  3KUY D;  3AZI A;  1JFI A;  1F66 A;  1HQ3 B;  3WA9 C;  3AZK D;  1M18 B;  2Y2O A;  3LZ1 A;  3EPK A;  4WU8 D;  4YM6 D;  2CV5 B;  5AY8 A;  3LJA C;  3B6G D;  4YS3 D;  2RVQ C;  2NQB B;  3W96 B;  1S32 B;  3A6N B;  3AV2 D;  3EPL A;  1KX4 B;  3LEL A;  3LZ0 C;  3UTB B;  1M1A B;  3AZF C;  5B33 D;  4KUD D;  3MGS D;  3X1U B;  3REH C;  3MGQ A;  4LD9 D;  3REL A;  4Z5T A;  5AVB B;  1BH8 B;  3W97 D;  5B31 D;  2NZD A;  5AV8 A;  5DNN C;  1P3G D;  3W98 A;  5JRG C;  2CWE A;  2Y2G A;  5BS7 C;  5CPK D;  3AZE A;  2PYO C;  3WTP B;  5AV6 D;  3AN2 B;  1AOI D;  3X1V A;  3VH5 W;  3B6F C;  2F8N H;  3X1T B;  5CHL B;  3UT9 B;  5DNM A;  3REI B;  1P3M D;  2ZM5 A;  1H3O A;  4EO5 C;  4J8X D;  2FFF B;  3MVD C;  5AVC A;  4KGC B;  5FUG B;  3AYW C;  1P3I B;  5GSU A;  1T3U A;  4QLC D;  5F99 A;  3KFU G;  2VQR A;  5B2I C;  1P3L A;  3MGP A;  2FJ7 B;  5CPJ A;  4KHA A;  4R8P D;  1HTA A;  2IO5 B;  4J8V C;  1P3P A;  4H9P B;  2HIO B;  5CPK B;  3C1C C;  1EQZ D;  5AV9 A;  4DQY B;  3X1S A;  2F8N B;  1KX5 A;  3REL D;  4Z5T D;  3AZH A;  3MGR B;  3W99 A;  3NQJ A;  3AZI B;  3O62 A;  1HQ3 C;  1JFI B;  1F66 B;  1M18 C;  1ID3 D;  3W98 D;  3LZ1 B;  2CV5 C;  2ARO B;  5GT0 C;  5AY8 B;  3VH6 A;  1P34 A;  4Z66 A;  4H9Q A;  4H9S A;  3WAA C;  2Y2I A;  2NQB C;  3W96 C;  1BFM A;  2XD5 A;  3A6N C;  4J8U C;  4XUJ B;  1P3B C;  1M19 A;  4J8W A;  3LEL B;  1M1A C;  4CAY A;  3TU4 A;  5C3I C;  3B0C T;  1P3K A;  2F8N G;  3AZL A;  3X1U C;  3LZ0 D;  3KWQ A;  2YFV A;  2W8S A;  4Z5T B;  5B32 D;  2BYM A;  3MGQ B;  4JJN C;  3AZF D;  3KXB A;  5F99 D;  5CPI D;  3A1K A;  3REH D;  2NZD B;  5AV8 B;  3REK A;  3AZG A;  3W98 B;  4WJ3 C;  1ZLA A;  1P3P D;  3AZN C;  3KUY A;  3AZE B;  5DNN D;  3AN2 C;  3X1V B;  3AZK A;  5JRG D;  3REI C;  1P3F C;  5DNM B;  3AZH D;  4WU8 A;  4YM6 A;  2PYO D;  3H0M C;  3B6G A;  5B1L C;  1H3O B;  3B6F D;  2HUE C;  3UTA D;  3WKJ D;  4ZUX D;  4YS3 A;  5AVC B;  1P3A C;  5AV5 D;  4KGC C;  1B6W A;  2ZY4 A;  3NQU A;  5GSU B;  3AV2 A;  4H9O B;  3MVD D;  5F99 B;  5BT1 C;  1P3L B;  3MGP B;  3VH6 T;  3MGS A;  2FJ7 C;  5CPJ B;  4KUD A;  4LD9 A;  1P3O C;  4KHA B;  2IO5 C;  1BH9 A;  4J8W D;  5B2I D;  2HIO C;  5B31 A;  5B1M D;  5AV9 B;  3X1S B;  2YFW A;  5B0Z C;  4J8V D;  1P3G A;  1KX5 B;  3AZH B;  3MGR C;  1KX3 C;  2DQN C;  1AOI A;  3NQJ B;  3W99 B;  3O62 B;  3MNN A;  4NE3 A;  3REJ C;  3AZJ C;  1P3M A;  2ARO C;  5AY8 C;  4J8X A;  5GT3 C;  2J8P A;  1P34 B;  4H9N A;  4Z66 B;  4H9Q B;  1W2E A;  2Y2L A;  5GT0 D;  4UUZ A;  4NE5 A;  3AZM C;  4XUJ C;  3AV1 B;  1M19 B;  3WAA D;  4QLC A;  4J8W B;  1WWI A;  3AFA A;  5B2J A;  4CAY B;  5JA4 A;  3C1B C;  3TU4 B;  4J8U D;  3B0D B;  1P3K B;  1P3B D;  3AZL B;  5B24 C;  2YFV B;  4R8P A;  3KWQ B;  2BYM B;  3KXB B;  5B40 D;  1EQZ A;  4JJN D;  3REK B;  4HGA B;  2G5I C;  3AZG B;  1ZLA B;  3KUY B;  3AZE C;  5B0Y C;  2Y2N A;  5BNX A;  3AZK B;  1ID3 A;  5E5A D;  3AZN D;  5DNM C;  4WU8 B;  4YM6 B;  3B6G B;  1R4V A;  5G49 A;  3WA9 A;  4YS3 B;  4WU9 C;  1P3F D;  5AVC C;  4X23 C;  3MNN D;  5B1L D;  1ULY A;  5GSU C; 
#chains in the Genus database with same CATH homology
 3NQU B;  5GXQ C;  3AV2 B;  3R45 A;  4G92 B;  1P3A D;  3EG5 B;  3H0R C;  5B33 B;  4KUD B;  3MGS B;  3LZ0 A;  4DRB A;  4LD9 B;  3AZF A;  5B32 A;  1BH9 B;  3VH5 T;  5BT1 D;  5B2J D;  5B31 B;  3AFA D;  5CPI A;  3W97 B;  3REH A;  1TZY C;  1U35 D;  2YFW B;  1P3O D;  2ZY2 A;  1P3G B;  1KX5 C;  4XZQ D;  5B0Z D;  5DNN A;  5CP6 C;  5AV6 B;  1AOI B;  3O62 C;  3IP4 C;  5JRG A;  5BS7 A;  1KX3 D;  1P3M B;  2PYO A;  3B6F A;  4J8X B;  1P34 C;  3UTA A;  3WKJ A;  4Z66 C;  4ZUX A;  4H9N B;  3REJ D;  2ZY5 A;  3V9R A;  2JSS A;  5AV5 A;  4UUZ B;  5GT3 D;  3MVD A;  3AV1 C;  3WA9 D;  4QLC B;  4G91 B;  3AFA B;  3TU4 C;  5JA4 B;  5B31 G;  3EPH A;  3LJA D;  3AZM D;  3B0B A;  3AZL C;  1S32 C;  4R8P B;  1F1E A;  1KX4 C;  3C1B D;  2RVQ D;  5B2I A;  3UTB C;  5B1M A;  1EQZ B;  5B24 D;  4Z2M H;  3REK C;  4J8V A;  4HGA C;  3AZG C;  3REL B;  5BNV A;  5AVB C;  3KUY C;  2LY8 A;  2F2A C;  4WV4 B;  3B0C W;  5BNX B;  1ID3 B;  4WU8 C;  4YM6 C;  5B0Y D;  1N1J A;  3WTP C;  3F6T A;  5G49 B;  3X1T C;  5GT0 A;  3UT9 C;  1KU5 A;  1Z2C B;  4WU9 D;  3KSY A;  3WAA A;  4X23 D;  3R45 B;  3A6N A;  5B33 C;  4J8U A;  2F8N K;  5GXQ D;  1P3B A;  1P3I C;  1Q9C A;  4LD9 C;  3LZ0 B;  3AZF B;  5B32 B;  5B40 A;  5B31 C;  5CPI B;  3AYW D;  3W97 C;  3X1U A;  3REH B;  4JJN A;  1P3G C;  1BH8 A;  3FDD A;  2Y2P A;  1P3P B;  5CPK C;  3H0L C;  5DNN B;  4H9R A;  5AV6 C;  2Y2H A;  5JRG B;  5E5A A;  3AZN A;  1P3M C;  2JCH A;  3C1C D;  2PYO B;  4ZBJ B;  3B6F B;  4M6B A;  3UTA B;  3AZI C;  3WKJ B;  4ZUX B;  1P3F A;  1F66 C;  3V9R B;  5B1L A;  4EO5 B;  4Z2M G;  5AV5 B;  3LZ1 C;  1HQ3 D;  5B32 G;  3MVD B;  4QLC C;  1M18 D;  1P3A A;  5FUG A;  2Y2M A;  3VH5 A;  2CV5 D;  5BO0 A;  2Y2J A;  2BYK A;  3LEL C;  5B2I B;  2Y2Q A;  2NQB D;  1EQZ C;  1WWS A;  5B1M B;  3W96 D;  1S32 D;  3A6N D;  1U35 A;  1P3O A;  4J8V B;  2G5H C;  3MGQ C;  3UTB D;  3REL C;  1M1A D;  4Z5T C;  4XZQ A;  5B0Z A;  1PZR A;  3X1U D;  2NZD C;  5AV8 C;  5AVB D;  3W98 C;  1KX3 A;  4WZS B;  1N1J B;  3REJ A;  3X1V C;  3AZJ A;  2ARO A;  5GT0 B;  5GT3 A;  3WTP D;  3AN2 D;  3X1T D;  3WAA B;  3UT9 D;  2UWX A;  3REI D;  3LJA A;  4J8U B;  3AZM A;  4XUJ A;  1P3B B;  5B32 C;  4E45 A;  3C1B A;  5C3I B;  5F99 C;  2L5A A;  5CPI C;  5B40 B;  4KGC D;  1B67 A;  5KDM A;  4CSR A;  1P3I D;  5B24 A;  3MGP C;  4JJN B;  1P3L C;  5CPJ C;  1P3P C;  2FJ7 D;  5AV9 C;  4H9R B;  3X1S C;  5E5A B;  3AZN B;  2HIO D;  3AZH C;  5B0Y A;  4ZBJ C;  2F8N D;  3UTA C;  3WKJ C;  3W99 C;  4ZUX C;  3AL0 C;  1P3F B;  3MNN B;  3MGR D;  5B1L B;  1TAF A;  5AV5 C;  2HUE B;  3AZI D;  4WU9 A;  1F66 D;  4X23 A;  4H9S C;  1P3A B;  2BG1 A;  3LZ1 D;  3AZJ D;  2ARO D;  5AY8 D;  5BO0 B;  5GXQ A;  4H9O A;  4E44 A;  4AWL B;  2BYK B;  1M19 C;  4J8W C;  5B2J B;  3AYW A;  5B1M C;  2XD1 A;  3B0D C;  1U35 B;  1P3K C;  4XUJ D;  1P3O B;  3LEL D;  3KWQ C;  4XZQ B;  1TZY A;  3KXB C;  5B0Z B;  3WTP E;  3MGQ D;  4WNN A;  1KX3 B;  3C1C A;  1ZLA C;  5CP6 A;  2NZD D;  5AV8 D;  1A7W A;  3REJ B;  3AZJ B;  3AZK C;  4DRA A;  3AZE D;  5GT3 B;  3B6G C;  3X1V D;  1HQ3 A;  3WA9 B;  4YS3 C;  1M18 A;  5DNM D;  2RIQ A;  2CV5 A;  3LJA B;  3AZM B;  3AV1 A;  4NFT A;  3P5J B;  3AV2 C;  5AVC D;  3C1B B;  4G92 C;  2NQB A;  5B40 C;  3W96 A;  5KDM B;  1S32 A;  4CSR B;  5GSU D;  5B24 B;  4KUD C;  3A1I A;  4UPK A;  3MGS C;  1KX4 A;  3UTB A;  1M1A A;  4NE6 A;  1P3L D;  3MGP D;  5CPJ D;  5AVB A;  3EPJ A;  5E5A C;  5B0Y B;  5AV9 D;  3X1S D;  1TZY D;  1AOI C;  1KX5 D;  3MNN C;  3VH6 W;  2ZY3 A;  1TAF B;  3WTP A;  5CP6 D;  3AN2 A;  3W99 D;  4J8X C;  4WU9 B;  3O62 D;  3X1T A;  4X23 B;  3UT9 A;  3REI A;  5GXQ B;  1P34 D;  4Z66 D;  4AWL C;  5B33 A;  2Y2K A;  4G91 C;  3AFA C;  2DF4 C;  5B2J C;  4KGC A;  3AYW B;  1P3I A;  1U35 C;  3AV1 D;  1M19 D;  4R8P C;  3W97 A;  3TU4 D;  4XZQ C;  1TZY B;  1P3K D;  2FJ7 A;  3AZL D;  3KWQ D;  1KX4 D;  4H9P A;  2HIO A;  3KXB D;  4WNN B;  5CPK A;  5BNV B;  3C1C B;  5CP6 B;  5AV6 A;  2F8N A;  2JE5 A;  3REK D;  3AZG D;  1ZLA D;  3MGR A;  1ID3 C;  3KUY D;  3AZI A;  1JFI A;  1F66 A;  1HQ3 B;  3WA9 C;  3AZK D;  1M18 B;  2Y2O A;  3LZ1 A;  3EPK A;  4WU8 D;  4YM6 D;  2CV5 B;  5AY8 A;  3LJA C;  3B6G D;  4YS3 D;  2RVQ C;  2NQB B;  3W96 B;  1S32 B;  3A6N B;  3AV2 D;  3EPL A;  1KX4 B;  3LEL A;  3LZ0 C;  3UTB B;  1M1A B;  3AZF C;  5B33 D;  4KUD D;  3MGS D;  3X1U B;  3REH C;  3MGQ A;  4LD9 D;  3REL A;  4Z5T A;  5AVB B;  1BH8 B;  3W97 D;  5B31 D;  2NZD A;  5AV8 A;  5DNN C;  1P3G D;  3W98 A;  5JRG C;  2CWE A;  2Y2G A;  5BS7 C;  5CPK D;  3AZE A;  2PYO C;  3WTP B;  5AV6 D;  3AN2 B;  1AOI D;  3X1V A;  3VH5 W;  3B6F C;  2F8N H;  3X1T B;  5CHL B;  3UT9 B;  5DNM A;  3REI B;  1P3M D;  2ZM5 A;  1H3O A;  4EO5 C;  4J8X D;  2FFF B;  3MVD C;  5AVC A;  4KGC B;  5FUG B;  3AYW C;  1P3I B;  5GSU A;  1T3U A;  4QLC D;  5F99 A;  3KFU G;  2VQR A;  5B2I C;  1P3L A;  3MGP A;  2FJ7 B;  5CPJ A;  4KHA A;  4R8P D;  1HTA A;  2IO5 B;  4J8V C;  1P3P A;  4H9P B;  2HIO B;  5CPK B;  3C1C C;  1EQZ D;  5AV9 A;  4DQY B;  3X1S A;  2F8N B;  1KX5 A;  3REL D;  4Z5T D;  3AZH A;  3MGR B;  3W99 A;  3NQJ A;  3AZI B;  3O62 A;  1HQ3 C;  1JFI B;  1F66 B;  1M18 C;  1ID3 D;  3W98 D;  3LZ1 B;  2CV5 C;  2ARO B;  5GT0 C;  5AY8 B;  3VH6 A;  1P34 A;  4Z66 A;  4H9Q A;  4H9S A;  3WAA C;  2Y2I A;  2NQB C;  3W96 C;  1BFM A;  2XD5 A;  3A6N C;  4J8U C;  4XUJ B;  1P3B C;  1M19 A;  4J8W A;  3LEL B;  1M1A C;  4CAY A;  3TU4 A;  5C3I C;  3B0C T;  1P3K A;  2F8N G;  3AZL A;  3X1U C;  3LZ0 D;  3KWQ A;  2YFV A;  2W8S A;  4Z5T B;  5B32 D;  2BYM A;  3MGQ B;  4JJN C;  3AZF D;  3KXB A;  5F99 D;  5CPI D;  3A1K A;  3REH D;  2NZD B;  5AV8 B;  3REK A;  3AZG A;  3W98 B;  4WJ3 C;  1ZLA A;  1P3P D;  3AZN C;  3KUY A;  3AZE B;  5DNN D;  3AN2 C;  3X1V B;  3AZK A;  5JRG D;  3REI C;  1P3F C;  5DNM B;  3AZH D;  4WU8 A;  4YM6 A;  2PYO D;  3H0M C;  3B6G A;  5B1L C;  1H3O B;  3B6F D;  2HUE C;  3UTA D;  3WKJ D;  4ZUX D;  4YS3 A;  5AVC B;  1P3A C;  5AV5 D;  4KGC C;  1B6W A;  2ZY4 A;  3NQU A;  5GSU B;  3AV2 A;  4H9O B;  3MVD D;  5F99 B;  5BT1 C;  1P3L B;  3MGP B;  3VH6 T;  3MGS A;  2FJ7 C;  5CPJ B;  4KUD A;  4LD9 A;  1P3O C;  4KHA B;  2IO5 C;  1BH9 A;  4J8W D;  5B2I D;  2HIO C;  5B31 A;  5B1M D;  5AV9 B;  3X1S B;  2YFW A;  5B0Z C;  4J8V D;  1P3G A;  1KX5 B;  3AZH B;  3MGR C;  1KX3 C;  2DQN C;  1AOI A;  3NQJ B;  3W99 B;  3O62 B;  3MNN A;  4NE3 A;  3REJ C;  3AZJ C;  1P3M A;  2ARO C;  5AY8 C;  4J8X A;  5GT3 C;  2J8P A;  1P34 B;  4H9N A;  4Z66 B;  4H9Q B;  1W2E A;  2Y2L A;  5GT0 D;  4UUZ A;  4NE5 A;  3AZM C;  4XUJ C;  3AV1 B;  1M19 B;  3WAA D;  4QLC A;  4J8W B;  1WWI A;  3AFA A;  5B2J A;  4CAY B;  5JA4 A;  3C1B C;  3TU4 B;  4J8U D;  3B0D B;  1P3K B;  1P3B D;  3AZL B;  5B24 C;  2YFV B;  4R8P A;  3KWQ B;  2BYM B;  3KXB B;  5B40 D;  1EQZ A;  4JJN D;  3REK B;  4HGA B;  2G5I C;  3AZG B;  1ZLA B;  3KUY B;  3AZE C;  5B0Y C;  2Y2N A;  5BNX A;  3AZK B;  1ID3 A;  5E5A D;  3AZN D;  5DNM C;  4WU8 B;  4YM6 B;  3B6G B;  1R4V A;  5G49 A;  3WA9 A;  4YS3 B;  4WU9 C;  1P3F D;  5AVC C;  4X23 C;  3MNN D;  5B1L D;  1ULY A;  5GSU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...