4YM6D

Crystal structure of the human nucleosome containing 6-4pp (outside)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
96
structure length
96
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural basis of pyrimidine-pyrimidone (6-4) photoproduct recognition by UV-DDB in the nucleosome
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 96
sequence length 96
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ym6D00
3X1TA 4H9PB 1S32A 4NE6A 3B0CW 3LJAB 3TU4B 4WU8B 3A6NC 4QLCA 3MVDB 5GT0B 3MVDD 3REIA 5GT0D 1EQZB 1EQZD 2PYOA 3AZLA 5B0YA 4J8VC 3AZEB 4X23C 1P3AB 1P3AD 5AV8B 5G49B 5JRGC 5AV8D 4J8XA 4Z66C 2HUEB 5B31B 1KU5A 5B31D 3UT9C 1M18B 1M18D 5DNMB 3WKJA 2IO5B 5GSUA 3MGSB 1F66A 1M1AA 1HQ3D 5B0ZC 1U35C 5B2JD 5BO0B 5CPIA 3AZNC 3X1SD 2YFVB 4XUJC 1P3PA 5B31G 3MGRA 5C3IC 3AZGD 1P3BB 2F8NB 3MGQD 3UTBC 1ZLAA 1H3OA 4H9SC 4YS3A 3O62C 3AZFB 4Z5TA 3AZMC 3RELA 4ZBJB 4AWLC 3AYWB 5E5AC 3AYWD 3C1BB 3C1BD 2F8NG 1P3GC 5B24C 1AOIC 3B6FA 1S32B 3W98A 1S32D 3AN2C 3AZJC 3AZHD 3WTPD 4QLCB 3KUYD 2PYOB 2PYOD 5B1MD 1P3IC 3AZLB 5B0YB 4LD9A 4EO5B 3VH5W 4KUDA 1P34A 1P3KC 4J8XB 4J8XD 1ULYA 3WAAC 1KX4C 5AV5C 3WKJB 3WKJD 1B67A 1P3OC 1HTAA 1M1AB 3VH6A 3C1CD 4DRBA 3W99B 3W99D 3WTPE 4YM6C 1P3PB 3UTAA 5AY8C 5CPKB 5GXQC 5CPKD 3MGRB 3REHB 3AV1A 3MGRD 3REHD 3WA9A 3REKA 2IO5C 3MGSC 5GT3D 4KGCD 3MVDA 4WU9C 1H3OB 2LY8A 1ZLAB 4YS3B 4WV4B 5B2ID 4YS3D 3MNNC 5B33C 2FJ7B 4NE5A 2FJ7D 4ZUXC 5AVCC 3RELB 3RELD 1ID3C 3A6ND 4WZSB 5AV8A 3KWQD 5B31A 1KX5C 2NZDC 3B6FB 3B6FD 3AZID 1HQ3A 4G92B 5B2JA 5BO0A 4R8PC 5F99A 3X1SA 1P3MC 4LD9B 2AROC 5B0ZD 4CAYA 3KXBC 4KUDB 2RVQC 1P34B 4KUDD 4J8UC 1P3FC 3AZGA 5BS7C 3X1TC 3MGQA 3AZKC 5CPJC 4KHAA 3REIC 5JA4A 4H9RA 3REJA 3UTAB 2BYMA 5DNNC 3O62D 3WA9B 3WA9D 3REKB 1KX3B 5E5AD 1KX3D 5GSUC 5B40B 5BNVA 5B40D 1F66C 3AZHA 3WTPA 3KUYA 5B1MA 5CPIC 3X1UB 3X1UD 3AN2D 1P3PC 1N1JA 4HGAB 1M19A 3R45A 5BT1C 4G91C 1HQ3B 3C1CA 3WAAD 4XZQC 5B2JB 5AV5D 5F99B 3X1SB 3LZ1B 5F99D 1TZYC 3B0DB 3LZ1D 4Z5TC 3LZ0B 4CSRA 3LZ0D 3W99A 5B1LC 3X1VC 4CAYB 2CV5A 1JFIB 5CPKA 1WWSA 4NFTA 3REHA 3VH5T 5B32C 4H9NA 4YM6D 4H9OA 3AZGB 1B6WA 3MGPC 3MGQB 3W98C 5GT3A 4KGCA 4KHAB 5B2IA 3W96C 5JA4B 3W97B 3AV2B 2FJ7A 3W97D 3AV2D 4H9RB 3REJB 3REJD 4LD9C 3A6NA 4WU9D 1A7WA 3KWQA 1BH9B 2BYMB 5B33D 4JJNC 4WNNA 2NQBC 5JRGA 4M6BA 3AZIA 5AV6C 5BNXB 3UT9A 1P3LC 5BNVB 3AZHB 3WTPB 3KUYB 5B1MB 1BH8A 3LELB 3LELD 5B0ZA 2HIOB 1N1JB 2HIOD 1M19B 3R45B 1M19D 4R8PD 4NE3A 3AV1C 5FUGA 5CP6C 4J8WD 4J8UD 3AFAB 1P3FD 3AFAD 3LJAC 3C1CB 3TU4C 4WU8C 3MVDC 5GT0C 1EQZC 3AZKD 4CSRB 3AZEC 1P3AC 5AV9B 5AV9D 4H9SA 5AV8C 2CV5B 3O62A 2CV5D 2HUEC 5B31C 1M18C 4H9NB 5E5AA 4H9OB 5DNMC 1KX3A 3B6GB 5B40A 5GT3B 3B6GD 4KGCB 1P3GA 5B2JC 5AVBD 1AOIA 5B2IB 3V9RA 3X1SC 1WWIA 4UUZA 3B0DC 3X1UA 3AN2A 2BYKA 3AZJA 3A6NB 3KWQB 4X23B 4J8VD 4WNNB 4X23D 5JRGB 1P3BC 5JRGD 4Z66B 3AZIB 4Z66D 3UT9B 3UT9D 3WAAA 5AV5A 3LZ1A 1BH8B 1P3OA 3AZFC 3LZ0A 4ZBJC 5B0ZB 1U35B 3AYWC 4XZQD 1U35D 1JFIA 3C1BC 3AZND 1TZYD 4XUJD 5B1LD 4YM6A 3X1VD 5FUGB 5AY8A 5GXQA 1S32C 5C3IB 5B32D 4QLCC 2PYOC 3W97A 3AV2A 3MGPD 3UTBB 3AZLC 3UTBD 5B0YC 4WU9A 4EO5C 1Q9CA 1BH9A 3MNNA 5B33A 3O62B 4J8XC 5AVCA 3AZMD 1ID3A 4AWLB 5E5AB 3WKJC 5BNXA 1KX5A 2YFWB 3C1CC 1P3GB 1P3GD 1M1AC 5B24D 2NQBD 2NZDA 1AOIB 3LELA 1AOID 3V9RB 4UUZB 3AN2B 3W99C 2BYKB 3AZJB 2HIOA 3AZJD 4R8PA 1P3MA 5CPKC 1P3ID 3MGRC 3REHC 2AROA 3KXBA 4J8WA 1P3KB 1P3KD 4J8UA 3B0BA 1P3FA 3AFAA 4KGCC 3WAAB 3NQUB 1KX4D 5BS7A 1ZLAC 5AV5B 4YS3C 5CP6D 3AZKA 5CPJA 1P3OB 2FJ7C 1P3OD 3RELC 5AV9A 3LJAD 3TU4D 4WU8D 3VH5A 3KWQC 3AZED 4YM6B 4Z2MH 5AY8B 3B6FC 5GXQB 5AY8D 5DNNA 5GXQD 3AZIC 3B6GA 4G92C 5AVBA 2CWEA 2JSSA 5DNMD 3MGSD 4WU9B 1F1EA 4KUDC 1P34C 3MNNB 5B33B 3MNND 4ZUXB 4J8VA 5AVCB 4DRAA 4ZUXD 5AVCD 4X23A 1ID3B 1ID3D 3NQJA 4Z66A 1KX5B 1KX5D 2NZDB 2NZDD 1P3BD 2F8ND 1U35A 4XZQA 4R8PB 3AZNA 3UTAC 1P3MB 1TZYA 1P3MD 3AZFD 4XUJA 1R4VA 5B1LA 3WA9C 3X1VA 2AROB 2AROD 3REKC 3KXBB 4J8WB 1KX3C 3KXBD 2RVQD 1TAFA 4J8UB 5B40C 1P3FB 5B32A 3MGPA 3X1TB 3AZKB 3X1TD 3X1UC 3UTBA 5CPJB 5CPJD 4HGAC 3REIB 3REID 3W96A 4QLCD 3AZMA 3AZLD 5B0YD 5DNNB 5DNND 4JJNA 1HQ3C 2YFWA 2NQBA 5B24A 5AVBB 1BFMA 5F99C 3LZ1C 5AV6A 5GSUB 3LZ0C 1P3LA 5GSUD 4E44A 5KDMA 1F66B 1F66D 1M1AD 5CPIB 5CPID 1P3IA 3VH6T 4H9QA 4J8VB 3AZGC 1P3PD 1P3KA 3MGQC 3NQJB 5BT1D 4G91B 1KX4A 3NQUA 5CP6A 4H9PA 2F8NK 3AV2C 3W97C 2F8NH 3REJC 3LJAA 3TU4A 4WU8A 4XZQB 5GT0A 1EQZA 1ZLAD 3AZNB 1TZYB 4Z5TB 4Z5TD 4XUJB 3AZEA 5B1LB 1P3AA 3X1VB 5G49A 1TAFB 1M18A 3AZHC 5B32B 3WTPC 5DNMA 3KUYC 5B1MC 3LELC 3MGPB 3W98B 3W98D 3MGSA 3VH6W 2HIOC 1M19C 5CP6B 3B0CT 3W96B 4Z2MG 3W96D 2YFVA 4ZUXA 3AZMB 2L5AA 4LD9D 5B32G 4J8WC 1P34D 4JJNB 3AFAC 4JJND 2NQBB 5B24B 1P3BA 2F8NA 5AV6B 5AV6D 1P3LB 5CHLB 1P3LD 5KDMB 3KSYA 5AV9C 2CV5C 1P3IB 3AZFA 4E45A 4H9QB 3AYWA 3C1BA 3UTAD 3B6GC 5GT3C 3AV1B 3AV1D 1KX4B 5AVBC 5B2IC 3REKD
chains in the Genus database with same CATH superfamily
3X1TA 4H9PB 1S32A 4NE6A 3B0CW 3H0RC 3LJAB 3TU4B 4WU8B 3A6NC 4QLCA 3MVDB 5GT0B 3MVDD 3REIA 5GT0D 1EQZB 1EQZD 2PYOA 3AZLA 2Y2GA 5B0YA 4J8VC 3AZEB 4X23C 1P3AB 1P3AD 5AV8B 5G49B 3P5JB 5JRGC 5AV8D 4J8XA 4Z66C 2HUEB 5B31B 1KU5A 5B31D 3UT9C 1M18B 1M18D 5DNMB 3WKJA 2IO5B 3AL0C 5GSUA 3MGSB 2DF4C 1F66A 1M1AA 1HQ3D 5B0ZC 1U35C 5B2JD 5BO0B 5CPIA 3AZNC 3EPHA 3X1SD 2YFVB 4XUJC 1P3PA 5B31G 1W2EA 3MGRA 5C3IC 3AZGD 1P3BB 2F8NB 3MGQD 3UTBC 2UWXA 1ZLAA 1H3OA 4H9SC 4YS3A 3O62C 3AZFB 4Z5TA 3AZMC 3RELA 4ZBJB 4AWLC 3AYWB 5E5AC 3AYWD 3C1BB 2Y2MA 3C1BD 2Y2NA 2F8NG 1P3GC 5B24C 1AOIC 3B6FA 1S32B 3W98A 1S32D 3AN2C 3AZJC 3AZHD 3WTPD 4QLCB 3KUYD 2PYOB 2PYOD 5B1MD 1P3IC 3AZLB 5B0YB 4LD9A 4EO5B 3VH5W 4KUDA 1P34A 1P3KC 4J8XB 4J8XD 1ULYA 3WAAC 1KX4C 3EPLA 5AV5C 3WKJB 3WKJD 1B67A 3F6TA 1HTAA 1P3OC 1M1AB 3VH6A 3C1CD 2VQRA 4DRBA 3W99B 3W99D 3WTPE 4YM6C 1Z2CB 1P3PB 3UTAA 5AY8C 5CPKB 5GXQC 5CPKD 3MGRB 3REHB 3AV1A 3MGRD 3REHD 3WA9A 3REKA 2ZY2A 2IO5C 3MGSC 5GT3D 2RIQA 4KGCD 3MVDA 4WU9C 1H3OB 2LY8A 1ZLAB 4YS3B 4WV4B 5B2ID 4YS3D 3MNNC 5B33C 2FJ7B 4NE5A 2FJ7D 4ZUXC 5AVCC 3RELB 3RELD 2Y2PA 1ID3C 3A6ND 4WZSB 5AV8A 3KWQD 5B31A 1KX5C 3A1IA 2NZDC 3B6FB 3B6FD 3AZID 1HQ3A 4G92B 5B2JA 5BO0A 4R8PC 5F99A 3X1SA 1P3MC 4LD9B 2AROC 5B0ZD 4CAYA 3KXBC 4KUDB 2RVQC 1P34B 4KUDD 4J8UC 1P3FC 3AZGA 5BS7C 3X1TC 3MGQA 3AZKC 5CPJC 2JCHA 3EG5B 4KHAA 3REIC 5JA4A 4H9RA 3REJA 2ZY3A 2FFFB 3UTAB 2BYMA 5DNNC 3O62D 3WA9B 3WA9D 3REKB 1KX3B 5E5AD 1KX3D 5GSUC 5B40B 5BNVA 5B40D 1F66C 3AZHA 3WTPA 3KUYA 5B1MA 5CPIC 3X1UB 3X1UD 3AN2D 1P3PC 1N1JA 4HGAB 1M19A 3R45A 5BT1C 4G91C 4DQYB 3LZ1D 1HQ3B 3C1CA 2Y2QA 3WAAD 4XZQC 5B2JB 5AV5D 5F99B 3X1SB 3LZ1B 4UPKA 1TZYC 2Y2KA 3A1KA 3B0DB 4Z5TC 5F99D 4CSRA 3LZ0B 3LZ0D 5B1LC 3W99A 3X1VC 4CAYB 2CV5A 1JFIB 5CPKA 1WWSA 4NFTA 3REHA 3VH5T 5B32C 4H9NA 4YM6D 4H9OA 3AZGB 1B6WA 3MGPC 3MGQB 3W98C 5GT3A 4KGCA 4KHAB 5B2IA 3W96C 5JA4B 3W97B 3AV2B 2FJ7A 3W97D 3AV2D 2Y2LA 4H9RB 3REJB 3REJD 4LD9C 3A6NA 4WU9D 1A7WA 3KWQA 1BH9B 2BYMB 5B33D 2ZY4A 2XD1A 4JJNC 4WNNA 2NQBC 5JRGA 4M6BA 3AZIA 5AV6C 5BNXB 3UT9A 1P3LC 5BNVB 3AZHB 3WTPB 3KUYB 5B1MB 1BH8A 3LELB 3LELD 5B0ZA 2HIOB 1N1JB 2HIOD 1M19B 3R45B 1M19D 4R8PD 4NE3A 3AV1C 5FUGA 5CP6C 4J8WD 2W8SA 3H0MC 4J8UD 3AFAB 1P3FD 3AFAD 3LJAC 3C1CB 3TU4C 4WU8C 3MVDC 5GT0C 1EQZC 3AZKD 4CSRB 3AZEC 1P3AC 5AV9B 4H9SA 5AV9D 5AV8C 2CV5B 3O62A 2CV5D 2HUEC 3FDDA 5B31C 2Y2OA 1M18C 4H9NB 5E5AA 4H9OB 5DNMC 1KX3A 2G5IC 3B6GB 5B40A 5GT3B 3B6GD 4KGCB 1P3GA 5B2JC 5AVBD 1AOIA 5B2IB 3V9RA 3X1SC 1WWIA 4UUZA 3B0DC 3X1UA 3AN2A 2BYKA 3AZJA 3A6NB 3KWQB 4X23B 4J8VD 2JE5A 4WNNB 4X23D 5JRGB 1P3BC 5JRGD 2G5HC 4Z66B 3AZIB 4Z66D 3UT9B 3UT9D 3WAAA 5AV5A 3LZ1A 1BH8B 1P3OA 3AZFC 3LZ0A 4ZBJC 5B0ZB 1U35B 3AYWC 4XZQD 1U35D 1JFIA 3C1BC 3AZND 1TZYD 4XUJD 5B1LD 4YM6A 2BG1A 3X1VD 5FUGB 5AY8A 5GXQA 1S32C 5C3IB 3KFUG 2Y2JA 5B32D 4QLCC 2PYOC 3W97A 3AV2A 3MGPD 3UTBB 3AZLC 3UTBD 5B0YC 4WU9A 4EO5C 1Q9CA 1BH9A 3MNNA 5B33A 3O62B 4J8XC 5AVCA 3AZMD 1ID3A 4AWLB 5E5AB 3WKJC 3EPJA 5BNXA 1KX5A 2YFWB 3C1CC 1P3GB 1P3GD 1M1AC 5B24D 2NQBD 2NZDA 1AOIB 3LELA 1AOID 2XD5A 3V9RB 4UUZB 2F2AC 3AN2B 3W99C 2BYKB 3AZJB 2HIOA 3AZJD 4R8PA 1P3MA 5CPKC 1P3ID 3MGRC 3REHC 2AROA 3IP4C 3KXBA 4J8WA 1P3KB 1P3KD 4J8UA 3B0BA 1P3FA 3AFAA 4KGCC 3WAAB 3NQUB 1KX4D 5BS7A 1ZLAC 5AV5B 4YS3C 5CP6D 3AZKA 5CPJA 1P3OB 2FJ7C 1P3OD 3RELC 5AV9A 3LJAD 3TU4D 4WU8D 3VH5A 3KWQC 2ZY5A 3AZED 4YM6B 4Z2MH 5AY8B 3B6FC 5GXQB 5AY8D 5DNNA 5GXQD 1PZRA 3AZIC 3B6GA 4G92C 5AVBA 2CWEA 2JSSA 5DNMD 3MGSD 4WU9B 1F1EA 4KUDC 1P34C 3MNNB 5B33B 3MNND 4ZUXB 4J8VA 5AVCB 4DRAA 4ZUXD 5AVCD 4X23A 1ID3B 1ID3D 3EPKA 3NQJA 4Z66A 1KX5B 1KX5D 2NZDB 2NZDD 1P3BD 2F8ND 1U35A 4XZQA 4R8PB 3AZNA 3UTAC 1P3MB 1TZYA 1P3MD 3AZFD 2J8PA 4XUJA 1R4VA 5B1LA 3WA9C 3X1VA 2AROB 2AROD 3REKC 2Y2IA 3KXBB 4J8WB 3KXBD 1KX3C 2RVQD 1TAFA 4J8UB 5B40C 1P3FB 5B32A 1T3UA 3MGPA 3X1TB 3AZKB 3X1TD 3X1UC 3UTBA 5CPJB 5CPJD 4HGAC 3REIB 3REID 3W96A 4QLCD 3AZMA 3AZLD 5B0YD 2DQNC 5DNNB 5DNND 4JJNA 1HQ3C 2YFWA 2NQBA 5B24A 5AVBB 1BFMA 5F99C 3LZ1C 5AV6A 5GSUB 3LZ0C 1P3LA 5GSUD 4E44A 5KDMA 1F66B 1F66D 1M1AD 5CPIB 5CPID 1P3IA 3VH6T 4H9QA 4J8VB 3AZGC 1P3PD 1P3KA 3MGQC 3NQJB 5BT1D 4G91B 1KX4A 3NQUA 5CP6A 4H9PA 2F8NK 3AV2C 3W97C 2F8NH 3REJC 3LJAA 3TU4A 4WU8A 4XZQB 5GT0A 1EQZA 1ZLAD 3AZNB 1TZYB 4Z5TB 4Z5TD 4XUJB 3AZEA 5B1LB 1P3AA 3X1VB 5G49A 1TAFB 1M18A 3AZHC 5B32B 3WTPC 5DNMA 3KUYC 5B1MC 3LELC 3MGPB 3W98B 3W98D 3MGSA 3VH6W 2HIOC 1M19C 5CP6B 3B0CT 3W96B 4Z2MG 3W96D 2YFVA 4ZUXA 3AZMB 4WJ3C 2L5AA 4LD9D 5B32G 4J8WC 1P34D 4JJNB 3AFAC 4JJND 2NQBB 5B24B 1P3BA 2ZM5A 2F8NA 5AV6B 5AV6D 1P3LB 5CHLB 1P3LD 5KDMB 3KSYA 2Y2HA 5AV9C 2CV5C 1P3IB 3AZFA 4E45A 4H9QB 3AYWA 3H0LC 3C1BA 3UTAD 3B6GC 5GT3C 3AV1B 3AV1D 1KX4B 5AVBC 5B2IC 3REKD
chains in the Genus database with same CATH topology
3X1TA 4H9PB 1S32A 4NE6A 3B0CW 3H0RC 3LJAB 3TU4B 4WU8B 3A6NC 4QLCA 3MVDB 5GT0B 3MVDD 3REIA 5GT0D 1EQZB 1EQZD 2PYOA 3AZLA 2Y2GA 5B0YA 4J8VC 3AZEB 4X23C 1P3AB 1P3AD 5AV8B 5G49B 3P5JB 5JRGC 5AV8D 4J8XA 4Z66C 2HUEB 5B31B 1KU5A 5B31D 3UT9C 1M18B 1M18D 5DNMB 3WKJA 2IO5B 3AL0C 5GSUA 3MGSB 2DF4C 1F66A 1M1AA 1HQ3D 5B0ZC 1U35C 5B2JD 5BO0B 5CPIA 3AZNC 3EPHA 3X1SD 2YFVB 4XUJC 1P3PA 5B31G 1W2EA 3MGRA 5C3IC 3AZGD 1P3BB 2F8NB 3MGQD 3UTBC 2UWXA 1ZLAA 1H3OA 4H9SC 4YS3A 3O62C 3AZFB 4Z5TA 3AZMC 3RELA 4ZBJB 4AWLC 3AYWB 5E5AC 3AYWD 3C1BB 2Y2MA 3C1BD 2Y2NA 2F8NG 1P3GC 5B24C 1AOIC 3B6FA 1S32B 3W98A 1S32D 3AN2C 3AZJC 3AZHD 3WTPD 4QLCB 3KUYD 2PYOB 2PYOD 5B1MD 1P3IC 3AZLB 5B0YB 4LD9A 4EO5B 3VH5W 4KUDA 1P34A 1P3KC 4J8XB 4J8XD 1ULYA 3WAAC 1KX4C 3EPLA 5AV5C 3WKJB 3WKJD 1B67A 3F6TA 1HTAA 1P3OC 1M1AB 3VH6A 3C1CD 2VQRA 4DRBA 3W99B 3W99D 3WTPE 4YM6C 1Z2CB 1P3PB 3UTAA 5AY8C 5CPKB 5GXQC 5CPKD 3MGRB 3REHB 3AV1A 3MGRD 3REHD 3WA9A 3REKA 2ZY2A 2IO5C 3MGSC 5GT3D 2RIQA 4KGCD 3MVDA 4WU9C 1H3OB 2LY8A 1ZLAB 4YS3B 4WV4B 5B2ID 4YS3D 3MNNC 5B33C 2FJ7B 4NE5A 2FJ7D 4ZUXC 5AVCC 3RELB 3RELD 2Y2PA 1ID3C 3A6ND 4WZSB 5AV8A 3KWQD 5B31A 1KX5C 3A1IA 2NZDC 3B6FB 3B6FD 3AZID 1HQ3A 4G92B 5B2JA 5BO0A 4R8PC 5F99A 3X1SA 1P3MC 4LD9B 2AROC 5B0ZD 4CAYA 3KXBC 4KUDB 2RVQC 1P34B 4KUDD 4J8UC 1P3FC 3AZGA 5BS7C 3X1TC 3MGQA 3AZKC 5CPJC 2JCHA 3EG5B 4KHAA 3REIC 5JA4A 4H9RA 3REJA 2ZY3A 2FFFB 3UTAB 2BYMA 5DNNC 3O62D 3WA9B 3WA9D 3REKB 1KX3B 5E5AD 1KX3D 5GSUC 5B40B 5BNVA 5B40D 1F66C 3AZHA 3WTPA 3KUYA 5B1MA 5CPIC 3X1UB 3X1UD 3AN2D 1P3PC 1N1JA 4HGAB 1M19A 3R45A 5BT1C 4G91C 4DQYB 3LZ1D 1HQ3B 3C1CA 2Y2QA 3WAAD 4XZQC 5B2JB 5AV5D 5F99B 3X1SB 3LZ1B 4UPKA 1TZYC 2Y2KA 3A1KA 3B0DB 4Z5TC 5F99D 4CSRA 3LZ0B 3LZ0D 5B1LC 3W99A 3X1VC 4CAYB 2CV5A 1JFIB 5CPKA 1WWSA 4NFTA 3REHA 3VH5T 5B32C 4H9NA 4YM6D 4H9OA 3AZGB 1B6WA 3MGPC 3MGQB 3W98C 5GT3A 4KGCA 4KHAB 5B2IA 3W96C 5JA4B 3W97B 3AV2B 2FJ7A 3W97D 3AV2D 2Y2LA 4H9RB 3REJB 3REJD 4LD9C 3A6NA 4WU9D 1A7WA 3KWQA 1BH9B 2BYMB 5B33D 2ZY4A 2XD1A 4JJNC 4WNNA 2NQBC 5JRGA 4M6BA 3AZIA 5AV6C 5BNXB 3UT9A 1P3LC 5BNVB 3AZHB 3WTPB 3KUYB 5B1MB 1BH8A 3LELB 3LELD 5B0ZA 2HIOB 1N1JB 2HIOD 1M19B 3R45B 1M19D 4R8PD 4NE3A 3AV1C 5FUGA 5CP6C 4J8WD 2W8SA 3H0MC 4J8UD 3AFAB 1P3FD 3AFAD 3LJAC 3C1CB 3TU4C 4WU8C 3MVDC 5GT0C 1EQZC 3AZKD 4CSRB 3AZEC 1P3AC 5AV9B 4H9SA 5AV9D 5AV8C 2CV5B 3O62A 2CV5D 2HUEC 3FDDA 5B31C 2Y2OA 1M18C 4H9NB 5E5AA 4H9OB 5DNMC 1KX3A 2G5IC 3B6GB 5B40A 5GT3B 3B6GD 4KGCB 1P3GA 5B2JC 5AVBD 1AOIA 5B2IB 3V9RA 3X1SC 1WWIA 4UUZA 3B0DC 3X1UA 3AN2A 2BYKA 3AZJA 3A6NB 3KWQB 4X23B 4J8VD 2JE5A 4WNNB 4X23D 5JRGB 1P3BC 5JRGD 2G5HC 4Z66B 3AZIB 4Z66D 3UT9B 3UT9D 3WAAA 5AV5A 3LZ1A 1BH8B 1P3OA 3AZFC 3LZ0A 4ZBJC 5B0ZB 1U35B 3AYWC 4XZQD 1U35D 1JFIA 3C1BC 3AZND 1TZYD 4XUJD 5B1LD 4YM6A 2BG1A 3X1VD 5FUGB 5AY8A 5GXQA 1S32C 5C3IB 3KFUG 2Y2JA 5B32D 4QLCC 2PYOC 3W97A 3AV2A 3MGPD 3UTBB 3AZLC 3UTBD 5B0YC 4WU9A 4EO5C 1Q9CA 1BH9A 3MNNA 5B33A 3O62B 4J8XC 5AVCA 3AZMD 1ID3A 4AWLB 5E5AB 3WKJC 3EPJA 5BNXA 1KX5A 2YFWB 3C1CC 1P3GB 1P3GD 1M1AC 5B24D 2NQBD 2NZDA 1AOIB 3LELA 1AOID 2XD5A 3V9RB 4UUZB 2F2AC 3AN2B 3W99C 2BYKB 3AZJB 2HIOA 3AZJD 4R8PA 1P3MA 5CPKC 1P3ID 3MGRC 3REHC 2AROA 3IP4C 3KXBA 4J8WA 1P3KB 1P3KD 4J8UA 3B0BA 1P3FA 3AFAA 4KGCC 3WAAB 3NQUB 1KX4D 5BS7A 1ZLAC 5AV5B 4YS3C 5CP6D 3AZKA 5CPJA 1P3OB 2FJ7C 1P3OD 3RELC 5AV9A 3LJAD 3TU4D 4WU8D 3VH5A 3KWQC 2ZY5A 3AZED 4YM6B 4Z2MH 5AY8B 3B6FC 5GXQB 5AY8D 5DNNA 5GXQD 1PZRA 3AZIC 3B6GA 4G92C 5AVBA 2CWEA 2JSSA 5DNMD 3MGSD 4WU9B 1F1EA 4KUDC 1P34C 3MNNB 5B33B 3MNND 4ZUXB 4J8VA 5AVCB 4DRAA 4ZUXD 5AVCD 4X23A 1ID3B 1ID3D 3EPKA 3NQJA 4Z66A 1KX5B 1KX5D 2NZDB 2NZDD 1P3BD 2F8ND 1U35A 4XZQA 4R8PB 3AZNA 3UTAC 1P3MB 1TZYA 1P3MD 3AZFD 2J8PA 4XUJA 1R4VA 5B1LA 3WA9C 3X1VA 2AROB 2AROD 3REKC 2Y2IA 3KXBB 4J8WB 3KXBD 1KX3C 2RVQD 1TAFA 4J8UB 5B40C 1P3FB 5B32A 1T3UA 3MGPA 3X1TB 3AZKB 3X1TD 3X1UC 3UTBA 5CPJB 5CPJD 4HGAC 3REIB 3REID 3W96A 4QLCD 3AZMA 3AZLD 5B0YD 2DQNC 5DNNB 5DNND 4JJNA 1HQ3C 2YFWA 2NQBA 5B24A 5AVBB 1BFMA 5F99C 3LZ1C 5AV6A 5GSUB 3LZ0C 1P3LA 5GSUD 4E44A 5KDMA 1F66B 1F66D 1M1AD 5CPIB 5CPID 1P3IA 3VH6T 4H9QA 4J8VB 3AZGC 1P3PD 1P3KA 3MGQC 3NQJB 5BT1D 4G91B 1KX4A 3NQUA 5CP6A 4H9PA 2F8NK 3AV2C 3W97C 2F8NH 3REJC 3LJAA 3TU4A 4WU8A 4XZQB 5GT0A 1EQZA 1ZLAD 3AZNB 1TZYB 4Z5TB 4Z5TD 4XUJB 3AZEA 5B1LB 1P3AA 3X1VB 5G49A 1TAFB 1M18A 3AZHC 5B32B 3WTPC 5DNMA 3KUYC 5B1MC 3LELC 3MGPB 3W98B 3W98D 3MGSA 3VH6W 2HIOC 1M19C 5CP6B 3B0CT 3W96B 4Z2MG 3W96D 2YFVA 4ZUXA 3AZMB 4WJ3C 2L5AA 4LD9D 5B32G 4J8WC 1P34D 4JJNB 3AFAC 4JJND 2NQBB 5B24B 1P3BA 2ZM5A 2F8NA 5AV6B 5AV6D 1P3LB 5CHLB 1P3LD 5KDMB 3KSYA 2Y2HA 5AV9C 2CV5C 1P3IB 3AZFA 4E45A 4H9QB 3AYWA 3H0LC 3C1BA 3UTAD 3B6GC 5GT3C 3AV1B 3AV1D 1KX4B 5AVBC 5B2IC 3REKD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1T A;  4H9P B;  1S32 A;  4NE6 A;  3B0C W;  3LJA B;  3TU4 B;  4WU8 B;  3A6N C;  4QLC A;  3MVD B;  5GT0 B;  3MVD D;  3REI A;  5GT0 D;  1EQZ B;  1EQZ D;  2PYO A;  3AZL A;  5B0Y A;  4J8V C;  3AZE B;  4X23 C;  1P3A B;  1P3A D;  5AV8 B;  5G49 B;  5JRG C;  5AV8 D;  4J8X A;  4Z66 C;  2HUE B;  5B31 B;  1KU5 A;  5B31 D;  3UT9 C;  1M18 B;  1M18 D;  5DNM B;  3WKJ A;  2IO5 B;  5GSU A;  3MGS B;  1F66 A;  1M1A A;  1HQ3 D;  5B0Z C;  1U35 C;  5B2J D;  5BO0 B;  5CPI A;  3AZN C;  3X1S D;  2YFV B;  4XUJ C;  1P3P A;  5B31 G;  3MGR A;  5C3I C;  3AZG D;  1P3B B;  2F8N B;  3MGQ D;  3UTB C;  1ZLA A;  1H3O A;  4H9S C;  4YS3 A;  3O62 C;  3AZF B;  4Z5T A;  3AZM C;  3REL A;  4ZBJ B;  4AWL C;  3AYW B;  5E5A C;  3AYW D;  3C1B B;  3C1B D;  2F8N G;  1P3G C;  5B24 C;  1AOI C;  3B6F A;  1S32 B;  3W98 A;  1S32 D;  3AN2 C;  3AZJ C;  3AZH D;  3WTP D;  4QLC B;  3KUY D;  2PYO B;  2PYO D;  5B1M D;  1P3I C;  3AZL B;  5B0Y B;  4LD9 A;  4EO5 B;  3VH5 W;  4KUD A;  1P34 A;  1P3K C;  4J8X B;  4J8X D;  1ULY A;  3WAA C;  1KX4 C;  5AV5 C;  3WKJ B;  3WKJ D;  1B67 A;  1P3O C;  1HTA A;  1M1A B;  3VH6 A;  3C1C D;  4DRB A;  3W99 B;  3W99 D;  3WTP E;  4YM6 C;  1P3P B;  3UTA A;  5AY8 C;  5CPK B;  5GXQ C;  5CPK D;  3MGR B;  3REH B;  3AV1 A;  3MGR D;  3REH D;  3WA9 A;  3REK A;  2IO5 C;  3MGS C;  5GT3 D;  4KGC D;  3MVD A;  4WU9 C;  1H3O B;  2LY8 A;  1ZLA B;  4YS3 B;  4WV4 B;  5B2I D;  4YS3 D;  3MNN C;  5B33 C;  2FJ7 B;  4NE5 A;  2FJ7 D;  4ZUX C;  5AVC C;  3REL B;  3REL D;  1ID3 C;  3A6N D;  4WZS B;  5AV8 A;  3KWQ D;  5B31 A;  1KX5 C;  2NZD C;  3B6F B;  3B6F D;  3AZI D;  1HQ3 A;  4G92 B;  5B2J A;  5BO0 A;  4R8P C;  5F99 A;  3X1S A;  1P3M C;  4LD9 B;  2ARO C;  5B0Z D;  4CAY A;  3KXB C;  4KUD B;  2RVQ C;  1P34 B;  4KUD D;  4J8U C;  1P3F C;  3AZG A;  5BS7 C;  3X1T C;  3MGQ A;  3AZK C;  5CPJ C;  4KHA A;  3REI C;  5JA4 A;  4H9R A;  3REJ A;  3UTA B;  2BYM A;  5DNN C;  3O62 D;  3WA9 B;  3WA9 D;  3REK B;  1KX3 B;  5E5A D;  1KX3 D;  5GSU C;  5B40 B;  5BNV A;  5B40 D;  1F66 C;  3AZH A;  3WTP A;  3KUY A;  5B1M A;  5CPI C;  3X1U B;  3X1U D;  3AN2 D;  1P3P C;  1N1J A;  4HGA B;  1M19 A;  3R45 A;  5BT1 C;  4G91 C;  1HQ3 B;  3C1C A;  3WAA D;  4XZQ C;  5B2J B;  5AV5 D;  5F99 B;  3X1S B;  3LZ1 B;  5F99 D;  1TZY C;  3B0D B;  3LZ1 D;  4Z5T C;  3LZ0 B;  4CSR A;  3LZ0 D;  3W99 A;  5B1L C;  3X1V C;  4CAY B;  2CV5 A;  1JFI B;  5CPK A;  1WWS A;  4NFT A;  3REH A;  3VH5 T;  5B32 C;  4H9N A;  4YM6 D;  4H9O A;  3AZG B;  1B6W A;  3MGP C;  3MGQ B;  3W98 C;  5GT3 A;  4KGC A;  4KHA B;  5B2I A;  3W96 C;  5JA4 B;  3W97 B;  3AV2 B;  2FJ7 A;  3W97 D;  3AV2 D;  4H9R B;  3REJ B;  3REJ D;  4LD9 C;  3A6N A;  4WU9 D;  1A7W A;  3KWQ A;  1BH9 B;  2BYM B;  5B33 D;  4JJN C;  4WNN A;  2NQB C;  5JRG A;  4M6B A;  3AZI A;  5AV6 C;  5BNX B;  3UT9 A;  1P3L C;  5BNV B;  3AZH B;  3WTP B;  3KUY B;  5B1M B;  1BH8 A;  3LEL B;  3LEL D;  5B0Z A;  2HIO B;  1N1J B;  2HIO D;  1M19 B;  3R45 B;  1M19 D;  4R8P D;  4NE3 A;  3AV1 C;  5FUG A;  5CP6 C;  4J8W D;  4J8U D;  3AFA B;  1P3F D;  3AFA D;  3LJA C;  3C1C B;  3TU4 C;  4WU8 C;  3MVD C;  5GT0 C;  1EQZ C;  3AZK D;  4CSR B;  3AZE C;  1P3A C;  5AV9 B;  5AV9 D;  4H9S A;  5AV8 C;  2CV5 B;  3O62 A;  2CV5 D;  2HUE C;  5B31 C;  1M18 C;  4H9N B;  5E5A A;  4H9O B;  5DNM C;  1KX3 A;  3B6G B;  5B40 A;  5GT3 B;  3B6G D;  4KGC B;  1P3G A;  5B2J C;  5AVB D;  1AOI A;  5B2I B;  3V9R A;  3X1S C;  1WWI A;  4UUZ A;  3B0D C;  3X1U A;  3AN2 A;  2BYK A;  3AZJ A;  3A6N B;  3KWQ B;  4X23 B;  4J8V D;  4WNN B;  4X23 D;  5JRG B;  1P3B C;  5JRG D;  4Z66 B;  3AZI B;  4Z66 D;  3UT9 B;  3UT9 D;  3WAA A;  5AV5 A;  3LZ1 A;  1BH8 B;  1P3O A;  3AZF C;  3LZ0 A;  4ZBJ C;  5B0Z B;  1U35 B;  3AYW C;  4XZQ D;  1U35 D;  1JFI A;  3C1B C;  3AZN D;  1TZY D;  4XUJ D;  5B1L D;  4YM6 A;  3X1V D;  5FUG B;  5AY8 A;  5GXQ A;  1S32 C;  5C3I B;  5B32 D;  4QLC C;  2PYO C;  3W97 A;  3AV2 A;  3MGP D;  3UTB B;  3AZL C;  3UTB D;  5B0Y C;  4WU9 A;  4EO5 C;  1Q9C A;  1BH9 A;  3MNN A;  5B33 A;  3O62 B;  4J8X C;  5AVC A;  3AZM D;  1ID3 A;  4AWL B;  5E5A B;  3WKJ C;  5BNX A;  1KX5 A;  2YFW B;  3C1C C;  1P3G B;  1P3G D;  1M1A C;  5B24 D;  2NQB D;  2NZD A;  1AOI B;  3LEL A;  1AOI D;  3V9R B;  4UUZ B;  3AN2 B;  3W99 C;  2BYK B;  3AZJ B;  2HIO A;  3AZJ D;  4R8P A;  1P3M A;  5CPK C;  1P3I D;  3MGR C;  3REH C;  2ARO A;  3KXB A;  4J8W A;  1P3K B;  1P3K D;  4J8U A;  3B0B A;  1P3F A;  3AFA A;  4KGC C;  3WAA B;  3NQU B;  1KX4 D;  5BS7 A;  1ZLA C;  5AV5 B;  4YS3 C;  5CP6 D;  3AZK A;  5CPJ A;  1P3O B;  2FJ7 C;  1P3O D;  3REL C;  5AV9 A;  3LJA D;  3TU4 D;  4WU8 D;  3VH5 A;  3KWQ C;  3AZE D;  4YM6 B;  4Z2M H;  5AY8 B;  3B6F C;  5GXQ B;  5AY8 D;  5DNN A;  5GXQ D;  3AZI C;  3B6G A;  4G92 C;  5AVB A;  2CWE A;  2JSS A;  5DNM D;  3MGS D;  4WU9 B;  1F1E A;  4KUD C;  1P34 C;  3MNN B;  5B33 B;  3MNN D;  4ZUX B;  4J8V A;  5AVC B;  4DRA A;  4ZUX D;  5AVC D;  4X23 A;  1ID3 B;  1ID3 D;  3NQJ A;  4Z66 A;  1KX5 B;  1KX5 D;  2NZD B;  2NZD D;  1P3B D;  2F8N D;  1U35 A;  4XZQ A;  4R8P B;  3AZN A;  3UTA C;  1P3M B;  1TZY A;  1P3M D;  3AZF D;  4XUJ A;  1R4V A;  5B1L A;  3WA9 C;  3X1V A;  2ARO B;  2ARO D;  3REK C;  3KXB B;  4J8W B;  1KX3 C;  3KXB D;  2RVQ D;  1TAF A;  4J8U B;  5B40 C;  1P3F B;  5B32 A;  3MGP A;  3X1T B;  3AZK B;  3X1T D;  3X1U C;  3UTB A;  5CPJ B;  5CPJ D;  4HGA C;  3REI B;  3REI D;  3W96 A;  4QLC D;  3AZM A;  3AZL D;  5B0Y D;  5DNN B;  5DNN D;  4JJN A;  1HQ3 C;  2YFW A;  2NQB A;  5B24 A;  5AVB B;  1BFM A;  5F99 C;  3LZ1 C;  5AV6 A;  5GSU B;  3LZ0 C;  1P3L A;  5GSU D;  4E44 A;  5KDM A;  1F66 B;  1F66 D;  1M1A D;  5CPI B;  5CPI D;  1P3I A;  3VH6 T;  4H9Q A;  4J8V B;  3AZG C;  1P3P D;  1P3K A;  3MGQ C;  3NQJ B;  5BT1 D;  4G91 B;  1KX4 A;  3NQU A;  5CP6 A;  4H9P A;  2F8N K;  3AV2 C;  3W97 C;  2F8N H;  3REJ C;  3LJA A;  3TU4 A;  4WU8 A;  4XZQ B;  5GT0 A;  1EQZ A;  1ZLA D;  3AZN B;  1TZY B;  4Z5T B;  4Z5T D;  4XUJ B;  3AZE A;  5B1L B;  1P3A A;  3X1V B;  5G49 A;  1TAF B;  1M18 A;  3AZH C;  5B32 B;  3WTP C;  5DNM A;  3KUY C;  5B1M C;  3LEL C;  3MGP B;  3W98 B;  3W98 D;  3MGS A;  3VH6 W;  2HIO C;  1M19 C;  5CP6 B;  3B0C T;  3W96 B;  4Z2M G;  3W96 D;  2YFV A;  4ZUX A;  3AZM B;  2L5A A;  4LD9 D;  5B32 G;  4J8W C;  1P34 D;  4JJN B;  3AFA C;  4JJN D;  2NQB B;  5B24 B;  1P3B A;  2F8N A;  5AV6 B;  5AV6 D;  1P3L B;  5CHL B;  1P3L D;  5KDM B;  3KSY A;  5AV9 C;  2CV5 C;  1P3I B;  3AZF A;  4E45 A;  4H9Q B;  3AYW A;  3C1B A;  3UTA D;  3B6G C;  5GT3 C;  3AV1 B;  3AV1 D;  1KX4 B;  5AVB C;  5B2I C;  3REK D; 
#chains in the Genus database with same CATH topology
 3X1T A;  4H9P B;  1S32 A;  4NE6 A;  3B0C W;  3H0R C;  3LJA B;  3TU4 B;  4WU8 B;  3A6N C;  4QLC A;  3MVD B;  5GT0 B;  3MVD D;  3REI A;  5GT0 D;  1EQZ B;  1EQZ D;  2PYO A;  3AZL A;  2Y2G A;  5B0Y A;  4J8V C;  3AZE B;  4X23 C;  1P3A B;  1P3A D;  5AV8 B;  5G49 B;  3P5J B;  5JRG C;  5AV8 D;  4J8X A;  4Z66 C;  2HUE B;  5B31 B;  1KU5 A;  5B31 D;  3UT9 C;  1M18 B;  1M18 D;  5DNM B;  3WKJ A;  2IO5 B;  3AL0 C;  5GSU A;  3MGS B;  2DF4 C;  1F66 A;  1M1A A;  1HQ3 D;  5B0Z C;  1U35 C;  5B2J D;  5BO0 B;  5CPI A;  3AZN C;  3EPH A;  3X1S D;  2YFV B;  4XUJ C;  1P3P A;  5B31 G;  1W2E A;  3MGR A;  5C3I C;  3AZG D;  1P3B B;  2F8N B;  3MGQ D;  3UTB C;  2UWX A;  1ZLA A;  1H3O A;  4H9S C;  4YS3 A;  3O62 C;  3AZF B;  4Z5T A;  3AZM C;  3REL A;  4ZBJ B;  4AWL C;  3AYW B;  5E5A C;  3AYW D;  3C1B B;  2Y2M A;  3C1B D;  2Y2N A;  2F8N G;  1P3G C;  5B24 C;  1AOI C;  3B6F A;  1S32 B;  3W98 A;  1S32 D;  3AN2 C;  3AZJ C;  3AZH D;  3WTP D;  4QLC B;  3KUY D;  2PYO B;  2PYO D;  5B1M D;  1P3I C;  3AZL B;  5B0Y B;  4LD9 A;  4EO5 B;  3VH5 W;  4KUD A;  1P34 A;  1P3K C;  4J8X B;  4J8X D;  1ULY A;  3WAA C;  1KX4 C;  3EPL A;  5AV5 C;  3WKJ B;  3WKJ D;  1B67 A;  3F6T A;  1HTA A;  1P3O C;  1M1A B;  3VH6 A;  3C1C D;  2VQR A;  4DRB A;  3W99 B;  3W99 D;  3WTP E;  4YM6 C;  1Z2C B;  1P3P B;  3UTA A;  5AY8 C;  5CPK B;  5GXQ C;  5CPK D;  3MGR B;  3REH B;  3AV1 A;  3MGR D;  3REH D;  3WA9 A;  3REK A;  2ZY2 A;  2IO5 C;  3MGS C;  5GT3 D;  2RIQ A;  4KGC D;  3MVD A;  4WU9 C;  1H3O B;  2LY8 A;  1ZLA B;  4YS3 B;  4WV4 B;  5B2I D;  4YS3 D;  3MNN C;  5B33 C;  2FJ7 B;  4NE5 A;  2FJ7 D;  4ZUX C;  5AVC C;  3REL B;  3REL D;  2Y2P A;  1ID3 C;  3A6N D;  4WZS B;  5AV8 A;  3KWQ D;  5B31 A;  1KX5 C;  3A1I A;  2NZD C;  3B6F B;  3B6F D;  3AZI D;  1HQ3 A;  4G92 B;  5B2J A;  5BO0 A;  4R8P C;  5F99 A;  3X1S A;  1P3M C;  4LD9 B;  2ARO C;  5B0Z D;  4CAY A;  3KXB C;  4KUD B;  2RVQ C;  1P34 B;  4KUD D;  4J8U C;  1P3F C;  3AZG A;  5BS7 C;  3X1T C;  3MGQ A;  3AZK C;  5CPJ C;  2JCH A;  3EG5 B;  4KHA A;  3REI C;  5JA4 A;  4H9R A;  3REJ A;  2ZY3 A;  2FFF B;  3UTA B;  2BYM A;  5DNN C;  3O62 D;  3WA9 B;  3WA9 D;  3REK B;  1KX3 B;  5E5A D;  1KX3 D;  5GSU C;  5B40 B;  5BNV A;  5B40 D;  1F66 C;  3AZH A;  3WTP A;  3KUY A;  5B1M A;  5CPI C;  3X1U B;  3X1U D;  3AN2 D;  1P3P C;  1N1J A;  4HGA B;  1M19 A;  3R45 A;  5BT1 C;  4G91 C;  4DQY B;  3LZ1 D;  1HQ3 B;  3C1C A;  2Y2Q A;  3WAA D;  4XZQ C;  5B2J B;  5AV5 D;  5F99 B;  3X1S B;  3LZ1 B;  4UPK A;  1TZY C;  2Y2K A;  3A1K A;  3B0D B;  4Z5T C;  5F99 D;  4CSR A;  3LZ0 B;  3LZ0 D;  5B1L C;  3W99 A;  3X1V C;  4CAY B;  2CV5 A;  1JFI B;  5CPK A;  1WWS A;  4NFT A;  3REH A;  3VH5 T;  5B32 C;  4H9N A;  4YM6 D;  4H9O A;  3AZG B;  1B6W A;  3MGP C;  3MGQ B;  3W98 C;  5GT3 A;  4KGC A;  4KHA B;  5B2I A;  3W96 C;  5JA4 B;  3W97 B;  3AV2 B;  2FJ7 A;  3W97 D;  3AV2 D;  2Y2L A;  4H9R B;  3REJ B;  3REJ D;  4LD9 C;  3A6N A;  4WU9 D;  1A7W A;  3KWQ A;  1BH9 B;  2BYM B;  5B33 D;  2ZY4 A;  2XD1 A;  4JJN C;  4WNN A;  2NQB C;  5JRG A;  4M6B A;  3AZI A;  5AV6 C;  5BNX B;  3UT9 A;  1P3L C;  5BNV B;  3AZH B;  3WTP B;  3KUY B;  5B1M B;  1BH8 A;  3LEL B;  3LEL D;  5B0Z A;  2HIO B;  1N1J B;  2HIO D;  1M19 B;  3R45 B;  1M19 D;  4R8P D;  4NE3 A;  3AV1 C;  5FUG A;  5CP6 C;  4J8W D;  2W8S A;  3H0M C;  4J8U D;  3AFA B;  1P3F D;  3AFA D;  3LJA C;  3C1C B;  3TU4 C;  4WU8 C;  3MVD C;  5GT0 C;  1EQZ C;  3AZK D;  4CSR B;  3AZE C;  1P3A C;  5AV9 B;  4H9S A;  5AV9 D;  5AV8 C;  2CV5 B;  3O62 A;  2CV5 D;  2HUE C;  3FDD A;  5B31 C;  2Y2O A;  1M18 C;  4H9N B;  5E5A A;  4H9O B;  5DNM C;  1KX3 A;  2G5I C;  3B6G B;  5B40 A;  5GT3 B;  3B6G D;  4KGC B;  1P3G A;  5B2J C;  5AVB D;  1AOI A;  5B2I B;  3V9R A;  3X1S C;  1WWI A;  4UUZ A;  3B0D C;  3X1U A;  3AN2 A;  2BYK A;  3AZJ A;  3A6N B;  3KWQ B;  4X23 B;  4J8V D;  2JE5 A;  4WNN B;  4X23 D;  5JRG B;  1P3B C;  5JRG D;  2G5H C;  4Z66 B;  3AZI B;  4Z66 D;  3UT9 B;  3UT9 D;  3WAA A;  5AV5 A;  3LZ1 A;  1BH8 B;  1P3O A;  3AZF C;  3LZ0 A;  4ZBJ C;  5B0Z B;  1U35 B;  3AYW C;  4XZQ D;  1U35 D;  1JFI A;  3C1B C;  3AZN D;  1TZY D;  4XUJ D;  5B1L D;  4YM6 A;  2BG1 A;  3X1V D;  5FUG B;  5AY8 A;  5GXQ A;  1S32 C;  5C3I B;  3KFU G;  2Y2J A;  5B32 D;  4QLC C;  2PYO C;  3W97 A;  3AV2 A;  3MGP D;  3UTB B;  3AZL C;  3UTB D;  5B0Y C;  4WU9 A;  4EO5 C;  1Q9C A;  1BH9 A;  3MNN A;  5B33 A;  3O62 B;  4J8X C;  5AVC A;  3AZM D;  1ID3 A;  4AWL B;  5E5A B;  3WKJ C;  3EPJ A;  5BNX A;  1KX5 A;  2YFW B;  3C1C C;  1P3G B;  1P3G D;  1M1A C;  5B24 D;  2NQB D;  2NZD A;  1AOI B;  3LEL A;  1AOI D;  2XD5 A;  3V9R B;  4UUZ B;  2F2A C;  3AN2 B;  3W99 C;  2BYK B;  3AZJ B;  2HIO A;  3AZJ D;  4R8P A;  1P3M A;  5CPK C;  1P3I D;  3MGR C;  3REH C;  2ARO A;  3IP4 C;  3KXB A;  4J8W A;  1P3K B;  1P3K D;  4J8U A;  3B0B A;  1P3F A;  3AFA A;  4KGC C;  3WAA B;  3NQU B;  1KX4 D;  5BS7 A;  1ZLA C;  5AV5 B;  4YS3 C;  5CP6 D;  3AZK A;  5CPJ A;  1P3O B;  2FJ7 C;  1P3O D;  3REL C;  5AV9 A;  3LJA D;  3TU4 D;  4WU8 D;  3VH5 A;  3KWQ C;  2ZY5 A;  3AZE D;  4YM6 B;  4Z2M H;  5AY8 B;  3B6F C;  5GXQ B;  5AY8 D;  5DNN A;  5GXQ D;  1PZR A;  3AZI C;  3B6G A;  4G92 C;  5AVB A;  2CWE A;  2JSS A;  5DNM D;  3MGS D;  4WU9 B;  1F1E A;  4KUD C;  1P34 C;  3MNN B;  5B33 B;  3MNN D;  4ZUX B;  4J8V A;  5AVC B;  4DRA A;  4ZUX D;  5AVC D;  4X23 A;  1ID3 B;  1ID3 D;  3EPK A;  3NQJ A;  4Z66 A;  1KX5 B;  1KX5 D;  2NZD B;  2NZD D;  1P3B D;  2F8N D;  1U35 A;  4XZQ A;  4R8P B;  3AZN A;  3UTA C;  1P3M B;  1TZY A;  1P3M D;  3AZF D;  2J8P A;  4XUJ A;  1R4V A;  5B1L A;  3WA9 C;  3X1V A;  2ARO B;  2ARO D;  3REK C;  2Y2I A;  3KXB B;  4J8W B;  3KXB D;  1KX3 C;  2RVQ D;  1TAF A;  4J8U B;  5B40 C;  1P3F B;  5B32 A;  1T3U A;  3MGP A;  3X1T B;  3AZK B;  3X1T D;  3X1U C;  3UTB A;  5CPJ B;  5CPJ D;  4HGA C;  3REI B;  3REI D;  3W96 A;  4QLC D;  3AZM A;  3AZL D;  5B0Y D;  2DQN C;  5DNN B;  5DNN D;  4JJN A;  1HQ3 C;  2YFW A;  2NQB A;  5B24 A;  5AVB B;  1BFM A;  5F99 C;  3LZ1 C;  5AV6 A;  5GSU B;  3LZ0 C;  1P3L A;  5GSU D;  4E44 A;  5KDM A;  1F66 B;  1F66 D;  1M1A D;  5CPI B;  5CPI D;  1P3I A;  3VH6 T;  4H9Q A;  4J8V B;  3AZG C;  1P3P D;  1P3K A;  3MGQ C;  3NQJ B;  5BT1 D;  4G91 B;  1KX4 A;  3NQU A;  5CP6 A;  4H9P A;  2F8N K;  3AV2 C;  3W97 C;  2F8N H;  3REJ C;  3LJA A;  3TU4 A;  4WU8 A;  4XZQ B;  5GT0 A;  1EQZ A;  1ZLA D;  3AZN B;  1TZY B;  4Z5T B;  4Z5T D;  4XUJ B;  3AZE A;  5B1L B;  1P3A A;  3X1V B;  5G49 A;  1TAF B;  1M18 A;  3AZH C;  5B32 B;  3WTP C;  5DNM A;  3KUY C;  5B1M C;  3LEL C;  3MGP B;  3W98 B;  3W98 D;  3MGS A;  3VH6 W;  2HIO C;  1M19 C;  5CP6 B;  3B0C T;  3W96 B;  4Z2M G;  3W96 D;  2YFV A;  4ZUX A;  3AZM B;  4WJ3 C;  2L5A A;  4LD9 D;  5B32 G;  4J8W C;  1P34 D;  4JJN B;  3AFA C;  4JJN D;  2NQB B;  5B24 B;  1P3B A;  2ZM5 A;  2F8N A;  5AV6 B;  5AV6 D;  1P3L B;  5CHL B;  1P3L D;  5KDM B;  3KSY A;  2Y2H A;  5AV9 C;  2CV5 C;  1P3I B;  3AZF A;  4E45 A;  4H9Q B;  3AYW A;  3H0L C;  3C1B A;  3UTA D;  3B6G C;  5GT3 C;  3AV1 B;  3AV1 D;  1KX4 B;  5AVB C;  5B2I C;  3REK D; 
#chains in the Genus database with same CATH homology
 3X1T A;  4H9P B;  1S32 A;  4NE6 A;  3B0C W;  3H0R C;  3LJA B;  3TU4 B;  4WU8 B;  3A6N C;  4QLC A;  3MVD B;  5GT0 B;  3MVD D;  3REI A;  5GT0 D;  1EQZ B;  1EQZ D;  2PYO A;  3AZL A;  2Y2G A;  5B0Y A;  4J8V C;  3AZE B;  4X23 C;  1P3A B;  1P3A D;  5AV8 B;  5G49 B;  3P5J B;  5JRG C;  5AV8 D;  4J8X A;  4Z66 C;  2HUE B;  5B31 B;  1KU5 A;  5B31 D;  3UT9 C;  1M18 B;  1M18 D;  5DNM B;  3WKJ A;  2IO5 B;  3AL0 C;  5GSU A;  3MGS B;  2DF4 C;  1F66 A;  1M1A A;  1HQ3 D;  5B0Z C;  1U35 C;  5B2J D;  5BO0 B;  5CPI A;  3AZN C;  3EPH A;  3X1S D;  2YFV B;  4XUJ C;  1P3P A;  5B31 G;  1W2E A;  3MGR A;  5C3I C;  3AZG D;  1P3B B;  2F8N B;  3MGQ D;  3UTB C;  2UWX A;  1ZLA A;  1H3O A;  4H9S C;  4YS3 A;  3O62 C;  3AZF B;  4Z5T A;  3AZM C;  3REL A;  4ZBJ B;  4AWL C;  3AYW B;  5E5A C;  3AYW D;  3C1B B;  2Y2M A;  3C1B D;  2Y2N A;  2F8N G;  1P3G C;  5B24 C;  1AOI C;  3B6F A;  1S32 B;  3W98 A;  1S32 D;  3AN2 C;  3AZJ C;  3AZH D;  3WTP D;  4QLC B;  3KUY D;  2PYO B;  2PYO D;  5B1M D;  1P3I C;  3AZL B;  5B0Y B;  4LD9 A;  4EO5 B;  3VH5 W;  4KUD A;  1P34 A;  1P3K C;  4J8X B;  4J8X D;  1ULY A;  3WAA C;  1KX4 C;  3EPL A;  5AV5 C;  3WKJ B;  3WKJ D;  1B67 A;  3F6T A;  1HTA A;  1P3O C;  1M1A B;  3VH6 A;  3C1C D;  2VQR A;  4DRB A;  3W99 B;  3W99 D;  3WTP E;  4YM6 C;  1Z2C B;  1P3P B;  3UTA A;  5AY8 C;  5CPK B;  5GXQ C;  5CPK D;  3MGR B;  3REH B;  3AV1 A;  3MGR D;  3REH D;  3WA9 A;  3REK A;  2ZY2 A;  2IO5 C;  3MGS C;  5GT3 D;  2RIQ A;  4KGC D;  3MVD A;  4WU9 C;  1H3O B;  2LY8 A;  1ZLA B;  4YS3 B;  4WV4 B;  5B2I D;  4YS3 D;  3MNN C;  5B33 C;  2FJ7 B;  4NE5 A;  2FJ7 D;  4ZUX C;  5AVC C;  3REL B;  3REL D;  2Y2P A;  1ID3 C;  3A6N D;  4WZS B;  5AV8 A;  3KWQ D;  5B31 A;  1KX5 C;  3A1I A;  2NZD C;  3B6F B;  3B6F D;  3AZI D;  1HQ3 A;  4G92 B;  5B2J A;  5BO0 A;  4R8P C;  5F99 A;  3X1S A;  1P3M C;  4LD9 B;  2ARO C;  5B0Z D;  4CAY A;  3KXB C;  4KUD B;  2RVQ C;  1P34 B;  4KUD D;  4J8U C;  1P3F C;  3AZG A;  5BS7 C;  3X1T C;  3MGQ A;  3AZK C;  5CPJ C;  2JCH A;  3EG5 B;  4KHA A;  3REI C;  5JA4 A;  4H9R A;  3REJ A;  2ZY3 A;  2FFF B;  3UTA B;  2BYM A;  5DNN C;  3O62 D;  3WA9 B;  3WA9 D;  3REK B;  1KX3 B;  5E5A D;  1KX3 D;  5GSU C;  5B40 B;  5BNV A;  5B40 D;  1F66 C;  3AZH A;  3WTP A;  3KUY A;  5B1M A;  5CPI C;  3X1U B;  3X1U D;  3AN2 D;  1P3P C;  1N1J A;  4HGA B;  1M19 A;  3R45 A;  5BT1 C;  4G91 C;  4DQY B;  3LZ1 D;  1HQ3 B;  3C1C A;  2Y2Q A;  3WAA D;  4XZQ C;  5B2J B;  5AV5 D;  5F99 B;  3X1S B;  3LZ1 B;  4UPK A;  1TZY C;  2Y2K A;  3A1K A;  3B0D B;  4Z5T C;  5F99 D;  4CSR A;  3LZ0 B;  3LZ0 D;  5B1L C;  3W99 A;  3X1V C;  4CAY B;  2CV5 A;  1JFI B;  5CPK A;  1WWS A;  4NFT A;  3REH A;  3VH5 T;  5B32 C;  4H9N A;  4YM6 D;  4H9O A;  3AZG B;  1B6W A;  3MGP C;  3MGQ B;  3W98 C;  5GT3 A;  4KGC A;  4KHA B;  5B2I A;  3W96 C;  5JA4 B;  3W97 B;  3AV2 B;  2FJ7 A;  3W97 D;  3AV2 D;  2Y2L A;  4H9R B;  3REJ B;  3REJ D;  4LD9 C;  3A6N A;  4WU9 D;  1A7W A;  3KWQ A;  1BH9 B;  2BYM B;  5B33 D;  2ZY4 A;  2XD1 A;  4JJN C;  4WNN A;  2NQB C;  5JRG A;  4M6B A;  3AZI A;  5AV6 C;  5BNX B;  3UT9 A;  1P3L C;  5BNV B;  3AZH B;  3WTP B;  3KUY B;  5B1M B;  1BH8 A;  3LEL B;  3LEL D;  5B0Z A;  2HIO B;  1N1J B;  2HIO D;  1M19 B;  3R45 B;  1M19 D;  4R8P D;  4NE3 A;  3AV1 C;  5FUG A;  5CP6 C;  4J8W D;  2W8S A;  3H0M C;  4J8U D;  3AFA B;  1P3F D;  3AFA D;  3LJA C;  3C1C B;  3TU4 C;  4WU8 C;  3MVD C;  5GT0 C;  1EQZ C;  3AZK D;  4CSR B;  3AZE C;  1P3A C;  5AV9 B;  4H9S A;  5AV9 D;  5AV8 C;  2CV5 B;  3O62 A;  2CV5 D;  2HUE C;  3FDD A;  5B31 C;  2Y2O A;  1M18 C;  4H9N B;  5E5A A;  4H9O B;  5DNM C;  1KX3 A;  2G5I C;  3B6G B;  5B40 A;  5GT3 B;  3B6G D;  4KGC B;  1P3G A;  5B2J C;  5AVB D;  1AOI A;  5B2I B;  3V9R A;  3X1S C;  1WWI A;  4UUZ A;  3B0D C;  3X1U A;  3AN2 A;  2BYK A;  3AZJ A;  3A6N B;  3KWQ B;  4X23 B;  4J8V D;  2JE5 A;  4WNN B;  4X23 D;  5JRG B;  1P3B C;  5JRG D;  2G5H C;  4Z66 B;  3AZI B;  4Z66 D;  3UT9 B;  3UT9 D;  3WAA A;  5AV5 A;  3LZ1 A;  1BH8 B;  1P3O A;  3AZF C;  3LZ0 A;  4ZBJ C;  5B0Z B;  1U35 B;  3AYW C;  4XZQ D;  1U35 D;  1JFI A;  3C1B C;  3AZN D;  1TZY D;  4XUJ D;  5B1L D;  4YM6 A;  2BG1 A;  3X1V D;  5FUG B;  5AY8 A;  5GXQ A;  1S32 C;  5C3I B;  3KFU G;  2Y2J A;  5B32 D;  4QLC C;  2PYO C;  3W97 A;  3AV2 A;  3MGP D;  3UTB B;  3AZL C;  3UTB D;  5B0Y C;  4WU9 A;  4EO5 C;  1Q9C A;  1BH9 A;  3MNN A;  5B33 A;  3O62 B;  4J8X C;  5AVC A;  3AZM D;  1ID3 A;  4AWL B;  5E5A B;  3WKJ C;  3EPJ A;  5BNX A;  1KX5 A;  2YFW B;  3C1C C;  1P3G B;  1P3G D;  1M1A C;  5B24 D;  2NQB D;  2NZD A;  1AOI B;  3LEL A;  1AOI D;  2XD5 A;  3V9R B;  4UUZ B;  2F2A C;  3AN2 B;  3W99 C;  2BYK B;  3AZJ B;  2HIO A;  3AZJ D;  4R8P A;  1P3M A;  5CPK C;  1P3I D;  3MGR C;  3REH C;  2ARO A;  3IP4 C;  3KXB A;  4J8W A;  1P3K B;  1P3K D;  4J8U A;  3B0B A;  1P3F A;  3AFA A;  4KGC C;  3WAA B;  3NQU B;  1KX4 D;  5BS7 A;  1ZLA C;  5AV5 B;  4YS3 C;  5CP6 D;  3AZK A;  5CPJ A;  1P3O B;  2FJ7 C;  1P3O D;  3REL C;  5AV9 A;  3LJA D;  3TU4 D;  4WU8 D;  3VH5 A;  3KWQ C;  2ZY5 A;  3AZE D;  4YM6 B;  4Z2M H;  5AY8 B;  3B6F C;  5GXQ B;  5AY8 D;  5DNN A;  5GXQ D;  1PZR A;  3AZI C;  3B6G A;  4G92 C;  5AVB A;  2CWE A;  2JSS A;  5DNM D;  3MGS D;  4WU9 B;  1F1E A;  4KUD C;  1P34 C;  3MNN B;  5B33 B;  3MNN D;  4ZUX B;  4J8V A;  5AVC B;  4DRA A;  4ZUX D;  5AVC D;  4X23 A;  1ID3 B;  1ID3 D;  3EPK A;  3NQJ A;  4Z66 A;  1KX5 B;  1KX5 D;  2NZD B;  2NZD D;  1P3B D;  2F8N D;  1U35 A;  4XZQ A;  4R8P B;  3AZN A;  3UTA C;  1P3M B;  1TZY A;  1P3M D;  3AZF D;  2J8P A;  4XUJ A;  1R4V A;  5B1L A;  3WA9 C;  3X1V A;  2ARO B;  2ARO D;  3REK C;  2Y2I A;  3KXB B;  4J8W B;  3KXB D;  1KX3 C;  2RVQ D;  1TAF A;  4J8U B;  5B40 C;  1P3F B;  5B32 A;  1T3U A;  3MGP A;  3X1T B;  3AZK B;  3X1T D;  3X1U C;  3UTB A;  5CPJ B;  5CPJ D;  4HGA C;  3REI B;  3REI D;  3W96 A;  4QLC D;  3AZM A;  3AZL D;  5B0Y D;  2DQN C;  5DNN B;  5DNN D;  4JJN A;  1HQ3 C;  2YFW A;  2NQB A;  5B24 A;  5AVB B;  1BFM A;  5F99 C;  3LZ1 C;  5AV6 A;  5GSU B;  3LZ0 C;  1P3L A;  5GSU D;  4E44 A;  5KDM A;  1F66 B;  1F66 D;  1M1A D;  5CPI B;  5CPI D;  1P3I A;  3VH6 T;  4H9Q A;  4J8V B;  3AZG C;  1P3P D;  1P3K A;  3MGQ C;  3NQJ B;  5BT1 D;  4G91 B;  1KX4 A;  3NQU A;  5CP6 A;  4H9P A;  2F8N K;  3AV2 C;  3W97 C;  2F8N H;  3REJ C;  3LJA A;  3TU4 A;  4WU8 A;  4XZQ B;  5GT0 A;  1EQZ A;  1ZLA D;  3AZN B;  1TZY B;  4Z5T B;  4Z5T D;  4XUJ B;  3AZE A;  5B1L B;  1P3A A;  3X1V B;  5G49 A;  1TAF B;  1M18 A;  3AZH C;  5B32 B;  3WTP C;  5DNM A;  3KUY C;  5B1M C;  3LEL C;  3MGP B;  3W98 B;  3W98 D;  3MGS A;  3VH6 W;  2HIO C;  1M19 C;  5CP6 B;  3B0C T;  3W96 B;  4Z2M G;  3W96 D;  2YFV A;  4ZUX A;  3AZM B;  4WJ3 C;  2L5A A;  4LD9 D;  5B32 G;  4J8W C;  1P34 D;  4JJN B;  3AFA C;  4JJN D;  2NQB B;  5B24 B;  1P3B A;  2ZM5 A;  2F8N A;  5AV6 B;  5AV6 D;  1P3L B;  5CHL B;  1P3L D;  5KDM B;  3KSY A;  2Y2H A;  5AV9 C;  2CV5 C;  1P3I B;  3AZF A;  4E45 A;  4H9Q B;  3AYW A;  3H0L C;  3C1B A;  3UTA D;  3B6G C;  5GT3 C;  3AV1 B;  3AV1 D;  1KX4 B;  5AVB C;  5B2I C;  3REK D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...