3REIC

2.65 angstrom crystal structure of the nucleosome core particle assembled with a 145 bp alpha-satellite dna (ncp145) derivatized with triamminechloroplatinum(ii) chloride
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3reiC00
3TU4B 5BNXB 4G91B 4WU8D 1HTAA 1M19C 5GSUA 5BS7A 4ZBJB 3AZMD 5AV9A 3AZIC 1TAFB 1M1AA 5B33B 1S32C 1M18C 1BH9A 4XZQB 3LELC 1S32D 1M18D 3WA9B 3X1TA 5AY8A 1B67A 4J8UD 3LELD 4H9RA 3REHD 4H9PA 4AWLC 5B0YA 1AOIC 5B32D 3B6GB 3W99A 2NZDA 3AZHA 1WWSA 1P3IA 3W97D 4KUDD 3KUYA 1P3OD 1AOID 5E5AD 1KX5A 2F8NH 5F99A 2AROC 4XUJC 3REJB 3C1CC 3W96B 3KWQA 4YM6A 2F8NK 5JA4A 4KGCD 3B0DC 5KDMA 3UTBD 4LD9D 2IO5B 3MGQA 5B1MD 4WU9B 5JRGB 3V9RA 3VH6W 1HQ3C 5B2JB 2YFVA 5B31D 3NQJB 5AV8C 3MGRA 1P3AB 3UTAA 5AVCD 3AZLB 5B1LB 4Z2MH 4R8PA 3X1VA 4HGAB 1P34B 3C1BA 3B0BA 3WAAA 3O62C 1BH8B 5AVBC 3MGSD 5B32G 3AZKD 4YS3B 2HUEB 5C3IC 4H9OA 5B2IC 3VH5T 3AV1D 3AYWA 4KHAB 3RELB 1P3GD 1JFIB 3REKA 3W98D 1P3MA 1KX3C 1F66A 4J8VC 2HIOB 4H9SC 3AFAC 1P3KB 4J8WB 5GT0B 3TU4D 5DNNC 3AZNA 1EQZA 2BYKA 4ZUXA 1N1JA 3LZ1C 4Z66C 3UT9A 4J8XA 3VH6T 4Z66D 3NQUA 5GXQA 1M19B 5AV5C 5B33D 1ID3A 4NE6A 3AN2A 2PYOA 3AZIB 1P3FA 4XZQD 3X1TC 1S32B 5B0ZA 3REIC 1M18B 3WA9D 2L5AA 1H3OB 3X1UD 3R45B 3LELB 4Z5TC 5B0YC 1TZYC 3B6GD 4WU8A 3KUYC 4AWLB 1KX5C 1AOIB 5F99C 3AZMA 3REJD 4YM6C 3W96D 3B0CW 3AZGC 1KX4C 3X1SA 4XUJB 2AROB 2F8NB 3C1CB 4UUZA 5CPJC 3B0DB 4X23A 4WU9D 3A6NC 1Q9CA 5JRGD 3MNNA 5CPJD 1WWIA 3LJAC 5B2JD 3LZ0C 5B32A 3W97A 4WNNB 1HQ3B 4CAYA 1P3AD 3AZLD 5B1LD 1ULYA 1P34D 5AV8B 5BO0A 1P3PA 4KGCA 2NQBC 4YS3D 3UTBA 4NE5A 4LD9A 5B1MA 3O62B 2CV5C 5AVBB 3RELD 3WTPC 5DNMA 5C3IB 5B2IB 5AV6A 3WTPD 1P3LA 1F66C 2HIOD 1B6WA 5B40C 5B24C 1P3KD 4J8WD 5GT0D 3AZJC 3AZNC 1EQZC 1KX3B 5AVCA 4J8VB 3AZFC 3AFAB 4JJNC 5DNNB 3MGSA 3LZ1B 3AZKA 4Z66B 4H9NA 1M19D 3B6FC 1P3BA 3AV2C 5CPKC 1KU5A 5G49A 3AZID 1P3FC 5CPIC 5AV5B 5B0ZC 4WV4B 3X1UB 3TU4A 3X1TB 3REIB 2BYMA 5GT3C 5BNXA 4H9RB 3VH5W 4Z5TB 5B0YB 5BNVA 1TZYB 5GT3D 3KUYB 1TAFA 1KX5B 5B33A 5F99B 3X1SC 5CP6C 2AROD 4XUJD 3AZEC 2F8ND 3C1CD 4XZQA 4YM6B 3AZGB 4X23C 1KX4B 3MNNC 5CPJB 2YFWA 3A6NB 4QLCA 3B6GA 1ZLAC 3LJAB 1HQ3D 2YFVB 3LZ0B 1ZLAD 5AV8D 1P3PC 3MGPC 2FJ7A 3WKJC 1U35C 3O62D 5AVBD 5DNMC 2CWEA 4WU9A 4H9OB 2NQBB 5AV6C 5B2ID 2CV5B 4DRAA 3WTPB 3MVDA 2F8NG 3NQJA 1F66B 3KXBA 1KX3D 4J8VD 5B1LA 3AZLA 5B40B 1A7WA 5B24B 3AFAD 3AZJB 3AZNB 1EQZB 1BH8A 5DNND 5GSUC 3AZFB 3LZ1D 5BS7C 5B31G 4JJNB 5AV9C 1P3BC 3RELA 1M1AC 1JFIA 1M1AD 5AV5D 3B6FB 5BT1C 3AV2B 5CPKB 2HIOA 1P3FB 5AY8C 4Z2MG 1P3KA 4J8WA 5GT0A 5CPIB 1R4VA 5B0ZB 3X1TD 3REID 3W99C 2NZDC 4H9QB 3AZHC 1P3IC 4Z5TD 5B0YD 1TZYD 5GT3B 4EO5C 3KUYD 1M19A 1KX5D 3KWQC 5F99D 3AZIA 3MGQC 4YM6D 3AZGD 3X1SB 5CP6B 1S32A 1M18A 1KX4D 3AZEB 1H3OA 3R45A 4E45A 4J8UA 4CSRB 3LELA 5FUGB 4QLCC 3REHA 3A6ND 3MNNB 3LJAD 3MGRC 4KUDA 3LZ0D 1AOIA 1P3OA 3UTAC 5E5AA 4R8PC 3X1VC 3MGRD 1ZLAB 3C1BC 2FJ7C 3WAAC 1BFMA 4R8PD 5BO0B 2AROA 4XUJA 2IO5C 2F8NA 3C1CA 3AYWC 1P3PB 3MGPB 4NE3A 3WKJB 1U35B 2RVQC 2NQBD 3AYWD 2CV5D 3REKC 5DNMB 1P3MC 5AV6B 3MVDC 5B31A 4WNNA 1HQ3A 3KXBC 1F66D 4ZUXC 5B40D 5B24D 5AV8A 1F1EA 3AZJD 3AZND 3UT9C 4J8XC 1EQZD 3AZFD 5GXQC 4JJND 3AV1A 3O62A 5GSUB 1P3GA 1ID3C 3AN2C 5AV9B 2PYOC 1P3BB 1M1AB 3B6FD 3AV2D 3W98A 5CPKD 2PYOD 1P3FD 1BH9B 5CPID 5B0ZD 1KX3A 4J8VA 4H9SA 3VH5A 5AY8B 3AFAA 4WU8C 4H9PB 5DNNA 2BYMB 3LZ1A 3W99B 2NZDB 3AZMC 3AZHB 4Z66A 1P3IB 5BNVB 3WTPE 4EO5B 5AV5A 3KWQB 5JA4B 3X1SD 5CP6D 3WA9A 3AZED 5KDMB 4J8UC 3MGQB 3X1UA 4G92C 3VH6A 3REHC 4X23D 3REIA 5B32C 3MNND 2YFWB 3W97C 4Z5TA 3V9RB 4KUDC 4QLCB 1P3OC 1TZYA 5E5AC 3MGRB 3REJA 3W96A 3UTAB 4R8PB 3X1VB 4KGCC 3UTBC 4LD9C 3C1BB 2FJ7B 3WAAB 5B1MC 1P3PD 3MGPD 3AZGA 3WKJD 1U35D 1KX4A 5JRGA 3AYWB 5CPJA 1P3LC 5DNMD 3A6NA 5B2JA 5AV6D 5B31C 2LY8A 3LJAA 3REKB 1P3LD 3LZ0A 1P3MB 3MVDB 1P3AA 5AVCC 1P34A 3KXBB 3MGSC 2BYKB 4ZUXB 1N1JB 3AZKC 3AV1C 4YS3A 3UT9B 4J8XB 5GSUD 1P3GC 4KHAA 2NQBA 3NQUB 5GXQB 5AV9D 2CV5A 1P3BD 3W98C 1ID3B 3WTPA 3AN2B 2PYOB 5BT1D 3TU4C 5B40A 5AY8D 5B24A 4G91C 3AZJA 3AZFA 3W99D 4ZBJC 2NZDD 3AZHD 4WU8B 4JJNA 1P3ID 5B33C 4E44A 3AZMB 4XZQC 3B6FA 3KWQD 3AV2A 3WA9C 5CPKA 3X1UC 4UUZB 3MGQD 5CPIA 4M6BA 4X23B 3B6GC 4J8UB 4H9QA 4DRBA 4G92B 3REHB 4QLCD 5B32B 5GT3A 3REJC 3W97B 4KUDB 4CAYB 1P3OB 3W96C 5E5AB 3UTAD 3X1VD 3C1BD 2FJ7D 3WAAD 4WZSB 5CP6A 4KGCB 4WU9C 3AZEA 5CHLB 5JRGC 3UTBB 4LD9B 5B1MB 4CSRA 5FUGA 2RVQD 5B2JC 3REKD 1P3LB 2JSSA 1P3AC 1P3MD 3MVDD 5B31B 3AZLC 5B1LC 1ZLAA 1P34C 4HGAC 3KSYA 3KXBD 5AVCB 4ZUXD 4YS3C 2HUEC 3UT9D 4J8XD 3MGPA 3RELC 3WKJA 3MGSB 3AZKB 1U35A 5AVBA 3AV1B 5GXQD 4H9NB 5B2IA 1P3GB 1ID3D 3AN2D 2HIOC 5G49B 1P3KC 4J8WC 5GT0C 3W98B 3B0CT 4NFTA
chains in the Genus database with same CATH superfamily
3TU4B 1Z2CB 5BNXB 4G91B 4WU8D 1HTAA 1M19C 5GSUA 5BS7A 4ZBJB 3AZMD 5AV9A 3AZIC 1TAFB 1M1AA 5B33B 1S32C 1M18C 2ZY5A 1BH9A 4XZQB 3LELC 1S32D 1M18D 3WA9B 3X1TA 5AY8A 1B67A 4J8UD 3LELD 4H9RA 3REHD 4H9PA 4AWLC 5B0YA 1AOIC 5B32D 2UWXA 3B6GB 3W99A 2NZDA 3AZHA 1WWSA 1P3IA 3W97D 4KUDD 3F6TA 3KUYA 1P3OD 1AOID 5E5AD 1KX5A 2F8NH 3KFUG 5F99A 2AROC 4XUJC 3REJB 3C1CC 3W96B 3KWQA 4YM6A 2F8NK 5JA4A 4KGCD 3B0DC 5KDMA 3UTBD 4LD9D 2IO5B 3MGQA 5B1MD 4WU9B 5JRGB 3V9RA 3VH6W 5B2JB 1HQ3C 2XD1A 2YFVA 5B31D 3NQJB 5AV8C 3MGRA 1P3AB 3UTAA 5AVCD 3AZLB 5B1LB 4Z2MH 4R8PA 3X1VA 4HGAB 1P34B 3C1BA 3B0BA 3WAAA 2Y2JA 1BH8B 3O62C 5AVBC 3MGSD 5B32G 3AZKD 4YS3B 2J8PA 2HUEB 5C3IC 4H9OA 5B2IC 3VH5T 3AV1D 3AYWA 4KHAB 3RELB 1P3GD 1JFIB 3REKA 3W98D 1P3MA 1KX3C 1F66A 4J8VC 2HIOB 4H9SC 3AFAC 1P3KB 4J8WB 2W8SA 5GT0B 3H0RC 3TU4D 5DNNC 3AZNA 1EQZA 2XD5A 2BYKA 4ZUXA 1N1JA 3LZ1C 4Z66C 2ZY2A 3UT9A 4J8XA 3VH6T 4Z66D 3NQUA 5GXQA 1M19B 5AV5C 5B33D 1ID3A 4NE6A 3AN2A 2PYOA 3AZIB 1P3FA 4XZQD 3X1TC 1S32B 5B0ZA 3REIC 2JCHA 1M18B 2L5AA 3WA9D 1H3OB 3X1UD 3R45B 3LELB 4Z5TC 5B0YC 1TZYC 3B6GD 4WU8A 3KUYC 4AWLB 1KX5C 1AOIB 5F99C 3AZMA 3REJD 4YM6C 3W96D 3B0CW 3AZGC 1KX4C 3FDDA 3X1SA 4XUJB 2AROB 2F8NB 3C1CB 4UUZA 5CPJC 3B0DB 4X23A 4WU9D 3A6NC 1Q9CA 5JRGD 3MNNA 5CPJD 1WWIA 3LJAC 5B2JD 3LZ0C 5B32A 3W97A 4WNNB 1HQ3B 4CAYA 1P3AD 2Y2GA 3AZLD 5B1LD 1ULYA 1P34D 5AV8B 5BO0A 1P3PA 4KGCA 2ZM5A 4YS3D 2NQBC 3UTBA 4NE5A 4LD9A 5B1MA 3O62B 2CV5C 5AVBB 3RELD 3WTPC 5DNMA 5C3IB 5B2IB 5AV6A 3WTPD 1P3LA 1F66C 2VQRA 2HIOD 1B6WA 5B40C 5B24C 1P3KD 4J8WD 5GT0D 3AZJC 3AZNC 1EQZC 1KX3B 5AVCA 4J8VB 3AZFC 3AFAB 4JJNC 5DNNB 3MGSA 3LZ1B 3AZKA 4Z66B 3EPLA 4H9NA 1M19D 3B6FC 1P3BA 3AV2C 5CPKC 3H0LC 1KU5A 5G49A 3AZID 1P3FC 5CPIC 5AV5B 5B0ZC 4WV4B 3X1UB 3TU4A 3X1TB 3REIB 2BG1A 2BYMA 5GT3C 5BNXA 4H9RB 3VH5W 4Z5TB 5B0YB 5BNVA 1TZYB 5GT3D 3KUYB 1TAFA 1KX5B 5B33A 5F99B 3X1SC 5CP6C 2AROD 4XUJD 3AZEC 2F8ND 3C1CD 4XZQA 3A1IA 4YM6B 3AZGB 4X23C 1KX4B 4UPKA 3MNNC 5CPJB 2YFWA 3A6NB 4QLCA 3B6GA 1ZLAC 3A1KA 3LJAB 1HQ3D 2YFVB 3LZ0B 1ZLAD 5AV8D 1P3PC 3MGPC 2FJ7A 3WKJC 1U35C 3O62D 2DF4C 5AVBD 5DNMC 2CWEA 2DQNC 4H9OB 4WU9A 5AV6C 2NQBB 5B2ID 4WJ3C 2CV5B 4DRAA 3WTPB 3EPJA 3MVDA 2F8NG 3NQJA 1F66B 3KXBA 1KX3D 4J8VD 5B1LA 3AZLA 5B40B 1A7WA 5B24B 1W2EA 3AFAD 3AZJB 3AZNB 1EQZB 1BH8A 5DNND 5GSUC 3AZFB 3LZ1D 5BS7C 5B31G 4JJNB 5AV9C 1P3BC 3RELA 1M1AC 1JFIA 1M1AD 5AV5D 3B6FB 5BT1C 3AV2B 3IP4C 5CPKB 2HIOA 1P3FB 5AY8C 4Z2MG 1P3KA 4J8WA 5GT0A 5CPIB 1R4VA 5B0ZB 3X1TD 3REID 2Y2KA 3W99C 2Y2PA 2NZDC 4H9QB 3AZHC 1P3IC 4Z5TD 5B0YD 1TZYD 5GT3B 4EO5C 3KUYD 1M19A 1KX5D 3KWQC 5F99D 3AZIA 3MGQC 4YM6D 3AZGD 3X1SB 5CP6B 1S32A 1M18A 1KX4D 3AZEB 1H3OA 3R45A 4E45A 4J8UA 4CSRB 3LELA 1PZRA 3P5JB 5FUGB 4QLCC 3REHA 3A6ND 3MNNB 3LJAD 3MGRC 4KUDA 3LZ0D 1AOIA 2G5HC 1P3OA 3UTAC 5E5AA 4R8PC 3X1VC 3MGRD 1ZLAB 3C1BC 2FJ7C 3WAAC 1BFMA 4R8PD 5BO0B 2AROA 4XUJA 2IO5C 2F8NA 3C1CA 3AYWC 1P3PB 3MGPB 4NE3A 3WKJB 1U35B 2RVQC 2NQBD 3AYWD 2F2AC 2CV5D 3REKC 5DNMB 1P3MC 5AV6B 3MVDC 5B31A 4WNNA 1HQ3A 3KXBC 1F66D 4ZUXC 5B40D 5B24D 5AV8A 1F1EA 3AZJD 3AZND 3UT9C 4J8XC 1EQZD 3AZFD 5GXQC 4JJND 3AV1A 3O62A 5GSUB 1P3GA 1ID3C 3EPHA 3AN2C 5AV9B 2PYOC 1P3BB 1M1AB 3B6FD 3AV2D 3W98A 5CPKD 2PYOD 1P3FD 1BH9B 5CPID 5B0ZD 1KX3A 4J8VA 4H9SA 3VH5A 5AY8B 3AFAA 4WU8C 4H9PB 5DNNA 2BYMB 3LZ1A 3W99B 2NZDB 3AZMC 3AZHB 4Z66A 1P3IB 5BNVB 3WTPE 2Y2LA 2Y2OA 4EO5B 5AV5A 3KWQB 5JA4B 3X1SD 5CP6D 3WA9A 3AZED 5KDMB 4J8UC 3MGQB 3X1UA 4G92C 3VH6A 3REHC 4X23D 3REIA 5B32C 3MNND 2YFWB 3W97C 4Z5TA 3V9RB 4KUDC 4QLCB 1P3OC 4DQYB 1TZYA 5E5AC 3MGRB 3REJA 3W96A 3UTAB 4R8PB 3X1VB 4KGCC 3UTBC 4LD9C 3C1BB 2FJ7B 3WAAB 5B1MC 1P3PD 3MGPD 3AZGA 3WKJD 1U35D 1KX4A 5JRGA 3AYWB 5CPJA 1P3LC 5DNMD 3A6NA 5B2JA 5AV6D 5B31C 2LY8A 2Y2HA 3LJAA 3REKB 1P3LD 3LZ0A 1P3MB 3MVDB 1P3AA 5AVCC 2Y2NA 1P34A 3KXBB 3MGSC 2BYKB 4ZUXB 1N1JB 3AZKC 3AV1C 4YS3A 3UT9B 4J8XB 3EG5B 5GSUD 1P3GC 4KHAA 2NQBA 3EPKA 3NQUB 5GXQB 5AV9D 2CV5A 1P3BD 3W98C 1ID3B 3WTPA 3AN2B 2PYOB 5BT1D 3TU4C 2G5IC 5B40A 5AY8D 5B24A 4G91C 3AZJA 3AZFA 3W99D 2ZY3A 4ZBJC 3AL0C 3AZHD 2NZDD 4WU8B 4JJNA 1P3ID 5B33C 4E44A 3AZMB 3H0MC 4XZQC 3KWQD 3B6FA 3AV2A 3WA9C 5CPKA 2JE5A 3X1UC 4UUZB 3MGQD 5CPIA 4M6BA 4X23B 2Y2MA 3B6GC 4J8UB 4H9QA 4DRBA 4G92B 2RIQA 3REHB 4QLCD 5B32B 5GT3A 3REJC 3W97B 4KUDB 4CAYB 1P3OB 3W96C 5E5AB 3UTAD 3X1VD 3C1BD 2FJ7D 3WAAD 4WZSB 5CP6A 4KGCB 4WU9C 3AZEA 5CHLB 5JRGC 3UTBB 4LD9B 1T3UA 5B1MB 4CSRA 5FUGA 2RVQD 5B2JC 2ZY4A 3REKD 1P3LB 2JSSA 1P3AC 1P3MD 3MVDD 5B31B 3AZLC 5B1LC 1ZLAA 1P34C 4HGAC 3KSYA 3KXBD 5AVCB 2Y2IA 4ZUXD 4YS3C 2HUEC 3UT9D 4J8XD 3MGPA 3RELC 3WKJA 3MGSB 3AZKB 1U35A 5AVBA 2Y2QA 3AV1B 2FFFB 4H9NB 5GXQD 5B2IA 1P3GB 1ID3D 3AN2D 2HIOC 5G49B 1P3KC 4J8WC 5GT0C 3W98B 3B0CT 4NFTA
chains in the Genus database with same CATH topology
3TU4B 1Z2CB 5BNXB 4G91B 4WU8D 1HTAA 1M19C 5GSUA 5BS7A 4ZBJB 3AZMD 5AV9A 3AZIC 1TAFB 1M1AA 5B33B 1S32C 1M18C 2ZY5A 1BH9A 4XZQB 3LELC 1S32D 1M18D 3WA9B 3X1TA 5AY8A 1B67A 4J8UD 3LELD 4H9RA 3REHD 4H9PA 4AWLC 5B0YA 1AOIC 5B32D 2UWXA 3B6GB 3W99A 2NZDA 3AZHA 1WWSA 1P3IA 3W97D 4KUDD 3F6TA 3KUYA 1P3OD 1AOID 5E5AD 1KX5A 2F8NH 3KFUG 5F99A 2AROC 4XUJC 3REJB 3C1CC 3W96B 3KWQA 4YM6A 2F8NK 5JA4A 4KGCD 3B0DC 5KDMA 3UTBD 4LD9D 2IO5B 3MGQA 5B1MD 4WU9B 5JRGB 3V9RA 3VH6W 5B2JB 1HQ3C 2XD1A 2YFVA 5B31D 3NQJB 5AV8C 3MGRA 1P3AB 3UTAA 5AVCD 3AZLB 5B1LB 4Z2MH 4R8PA 3X1VA 4HGAB 1P34B 3C1BA 3B0BA 3WAAA 2Y2JA 1BH8B 3O62C 5AVBC 3MGSD 5B32G 3AZKD 4YS3B 2J8PA 2HUEB 5C3IC 4H9OA 5B2IC 3VH5T 3AV1D 3AYWA 4KHAB 3RELB 1P3GD 1JFIB 3REKA 3W98D 1P3MA 1KX3C 1F66A 4J8VC 2HIOB 4H9SC 3AFAC 1P3KB 4J8WB 2W8SA 5GT0B 3H0RC 3TU4D 5DNNC 3AZNA 1EQZA 2XD5A 2BYKA 4ZUXA 1N1JA 3LZ1C 4Z66C 2ZY2A 3UT9A 4J8XA 3VH6T 4Z66D 3NQUA 5GXQA 1M19B 5AV5C 5B33D 1ID3A 4NE6A 3AN2A 2PYOA 3AZIB 1P3FA 4XZQD 3X1TC 1S32B 5B0ZA 3REIC 2JCHA 1M18B 2L5AA 3WA9D 1H3OB 3X1UD 3R45B 3LELB 4Z5TC 5B0YC 1TZYC 3B6GD 4WU8A 3KUYC 4AWLB 1KX5C 1AOIB 5F99C 3AZMA 3REJD 4YM6C 3W96D 3B0CW 3AZGC 1KX4C 3FDDA 3X1SA 4XUJB 2AROB 2F8NB 3C1CB 4UUZA 5CPJC 3B0DB 4X23A 4WU9D 3A6NC 1Q9CA 5JRGD 3MNNA 5CPJD 1WWIA 3LJAC 5B2JD 3LZ0C 5B32A 3W97A 4WNNB 1HQ3B 4CAYA 1P3AD 2Y2GA 3AZLD 5B1LD 1ULYA 1P34D 5AV8B 5BO0A 1P3PA 4KGCA 2ZM5A 4YS3D 2NQBC 3UTBA 4NE5A 4LD9A 5B1MA 3O62B 2CV5C 5AVBB 3RELD 3WTPC 5DNMA 5C3IB 5B2IB 5AV6A 3WTPD 1P3LA 1F66C 2VQRA 2HIOD 1B6WA 5B40C 5B24C 1P3KD 4J8WD 5GT0D 3AZJC 3AZNC 1EQZC 1KX3B 5AVCA 4J8VB 3AZFC 3AFAB 4JJNC 5DNNB 3MGSA 3LZ1B 3AZKA 4Z66B 3EPLA 4H9NA 1M19D 3B6FC 1P3BA 3AV2C 5CPKC 3H0LC 1KU5A 5G49A 3AZID 1P3FC 5CPIC 5AV5B 5B0ZC 4WV4B 3X1UB 3TU4A 3X1TB 3REIB 2BG1A 2BYMA 5GT3C 5BNXA 4H9RB 3VH5W 4Z5TB 5B0YB 5BNVA 1TZYB 5GT3D 3KUYB 1TAFA 1KX5B 5B33A 5F99B 3X1SC 5CP6C 2AROD 4XUJD 3AZEC 2F8ND 3C1CD 4XZQA 3A1IA 4YM6B 3AZGB 4X23C 1KX4B 4UPKA 3MNNC 5CPJB 2YFWA 3A6NB 4QLCA 3B6GA 1ZLAC 3A1KA 3LJAB 1HQ3D 2YFVB 3LZ0B 1ZLAD 5AV8D 1P3PC 3MGPC 2FJ7A 3WKJC 1U35C 3O62D 2DF4C 5AVBD 5DNMC 2CWEA 2DQNC 4H9OB 4WU9A 5AV6C 2NQBB 5B2ID 4WJ3C 2CV5B 4DRAA 3WTPB 3EPJA 3MVDA 2F8NG 3NQJA 1F66B 3KXBA 1KX3D 4J8VD 5B1LA 3AZLA 5B40B 1A7WA 5B24B 1W2EA 3AFAD 3AZJB 3AZNB 1EQZB 1BH8A 5DNND 5GSUC 3AZFB 3LZ1D 5BS7C 5B31G 4JJNB 5AV9C 1P3BC 3RELA 1M1AC 1JFIA 1M1AD 5AV5D 3B6FB 5BT1C 3AV2B 3IP4C 5CPKB 2HIOA 1P3FB 5AY8C 4Z2MG 1P3KA 4J8WA 5GT0A 5CPIB 1R4VA 5B0ZB 3X1TD 3REID 2Y2KA 3W99C 2Y2PA 2NZDC 4H9QB 3AZHC 1P3IC 4Z5TD 5B0YD 1TZYD 5GT3B 4EO5C 3KUYD 1M19A 1KX5D 3KWQC 5F99D 3AZIA 3MGQC 4YM6D 3AZGD 3X1SB 5CP6B 1S32A 1M18A 1KX4D 3AZEB 1H3OA 3R45A 4E45A 4J8UA 4CSRB 3LELA 1PZRA 3P5JB 5FUGB 4QLCC 3REHA 3A6ND 3MNNB 3LJAD 3MGRC 4KUDA 3LZ0D 1AOIA 2G5HC 1P3OA 3UTAC 5E5AA 4R8PC 3X1VC 3MGRD 1ZLAB 3C1BC 2FJ7C 3WAAC 1BFMA 4R8PD 5BO0B 2AROA 4XUJA 2IO5C 2F8NA 3C1CA 3AYWC 1P3PB 3MGPB 4NE3A 3WKJB 1U35B 2RVQC 2NQBD 3AYWD 2F2AC 2CV5D 3REKC 5DNMB 1P3MC 5AV6B 3MVDC 5B31A 4WNNA 1HQ3A 3KXBC 1F66D 4ZUXC 5B40D 5B24D 5AV8A 1F1EA 3AZJD 3AZND 3UT9C 4J8XC 1EQZD 3AZFD 5GXQC 4JJND 3AV1A 3O62A 5GSUB 1P3GA 1ID3C 3EPHA 3AN2C 5AV9B 2PYOC 1P3BB 1M1AB 3B6FD 3AV2D 3W98A 5CPKD 2PYOD 1P3FD 1BH9B 5CPID 5B0ZD 1KX3A 4J8VA 4H9SA 3VH5A 5AY8B 3AFAA 4WU8C 4H9PB 5DNNA 2BYMB 3LZ1A 3W99B 2NZDB 3AZMC 3AZHB 4Z66A 1P3IB 5BNVB 3WTPE 2Y2LA 2Y2OA 4EO5B 5AV5A 3KWQB 5JA4B 3X1SD 5CP6D 3WA9A 3AZED 5KDMB 4J8UC 3MGQB 3X1UA 4G92C 3VH6A 3REHC 4X23D 3REIA 5B32C 3MNND 2YFWB 3W97C 4Z5TA 3V9RB 4KUDC 4QLCB 1P3OC 4DQYB 1TZYA 5E5AC 3MGRB 3REJA 3W96A 3UTAB 4R8PB 3X1VB 4KGCC 3UTBC 4LD9C 3C1BB 2FJ7B 3WAAB 5B1MC 1P3PD 3MGPD 3AZGA 3WKJD 1U35D 1KX4A 5JRGA 3AYWB 5CPJA 1P3LC 5DNMD 3A6NA 5B2JA 5AV6D 5B31C 2LY8A 2Y2HA 3LJAA 3REKB 1P3LD 3LZ0A 1P3MB 3MVDB 1P3AA 5AVCC 2Y2NA 1P34A 3KXBB 3MGSC 2BYKB 4ZUXB 1N1JB 3AZKC 3AV1C 4YS3A 3UT9B 4J8XB 3EG5B 5GSUD 1P3GC 4KHAA 2NQBA 3EPKA 3NQUB 5GXQB 5AV9D 2CV5A 1P3BD 3W98C 1ID3B 3WTPA 3AN2B 2PYOB 5BT1D 3TU4C 2G5IC 5B40A 5AY8D 5B24A 4G91C 3AZJA 3AZFA 3W99D 2ZY3A 4ZBJC 3AL0C 3AZHD 2NZDD 4WU8B 4JJNA 1P3ID 5B33C 4E44A 3AZMB 3H0MC 4XZQC 3KWQD 3B6FA 3AV2A 3WA9C 5CPKA 2JE5A 3X1UC 4UUZB 3MGQD 5CPIA 4M6BA 4X23B 2Y2MA 3B6GC 4J8UB 4H9QA 4DRBA 4G92B 2RIQA 3REHB 4QLCD 5B32B 5GT3A 3REJC 3W97B 4KUDB 4CAYB 1P3OB 3W96C 5E5AB 3UTAD 3X1VD 3C1BD 2FJ7D 3WAAD 4WZSB 5CP6A 4KGCB 4WU9C 3AZEA 5CHLB 5JRGC 3UTBB 4LD9B 1T3UA 5B1MB 4CSRA 5FUGA 2RVQD 5B2JC 2ZY4A 3REKD 1P3LB 2JSSA 1P3AC 1P3MD 3MVDD 5B31B 3AZLC 5B1LC 1ZLAA 1P34C 4HGAC 3KSYA 3KXBD 5AVCB 2Y2IA 4ZUXD 4YS3C 2HUEC 3UT9D 4J8XD 3MGPA 3RELC 3WKJA 3MGSB 3AZKB 1U35A 5AVBA 2Y2QA 3AV1B 2FFFB 4H9NB 5GXQD 5B2IA 1P3GB 1ID3D 3AN2D 2HIOC 5G49B 1P3KC 4J8WC 5GT0C 3W98B 3B0CT 4NFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TU4 B;  5BNX B;  4G91 B;  4WU8 D;  1HTA A;  1M19 C;  5GSU A;  5BS7 A;  4ZBJ B;  3AZM D;  5AV9 A;  3AZI C;  1TAF B;  1M1A A;  5B33 B;  1S32 C;  1M18 C;  1BH9 A;  4XZQ B;  3LEL C;  1S32 D;  1M18 D;  3WA9 B;  3X1T A;  5AY8 A;  1B67 A;  4J8U D;  3LEL D;  4H9R A;  3REH D;  4H9P A;  4AWL C;  5B0Y A;  1AOI C;  5B32 D;  3B6G B;  3W99 A;  2NZD A;  3AZH A;  1WWS A;  1P3I A;  3W97 D;  4KUD D;  3KUY A;  1P3O D;  1AOI D;  5E5A D;  1KX5 A;  2F8N H;  5F99 A;  2ARO C;  4XUJ C;  3REJ B;  3C1C C;  3W96 B;  3KWQ A;  4YM6 A;  2F8N K;  5JA4 A;  4KGC D;  3B0D C;  5KDM A;  3UTB D;  4LD9 D;  2IO5 B;  3MGQ A;  5B1M D;  4WU9 B;  5JRG B;  3V9R A;  3VH6 W;  1HQ3 C;  5B2J B;  2YFV A;  5B31 D;  3NQJ B;  5AV8 C;  3MGR A;  1P3A B;  3UTA A;  5AVC D;  3AZL B;  5B1L B;  4Z2M H;  4R8P A;  3X1V A;  4HGA B;  1P34 B;  3C1B A;  3B0B A;  3WAA A;  3O62 C;  1BH8 B;  5AVB C;  3MGS D;  5B32 G;  3AZK D;  4YS3 B;  2HUE B;  5C3I C;  4H9O A;  5B2I C;  3VH5 T;  3AV1 D;  3AYW A;  4KHA B;  3REL B;  1P3G D;  1JFI B;  3REK A;  3W98 D;  1P3M A;  1KX3 C;  1F66 A;  4J8V C;  2HIO B;  4H9S C;  3AFA C;  1P3K B;  4J8W B;  5GT0 B;  3TU4 D;  5DNN C;  3AZN A;  1EQZ A;  2BYK A;  4ZUX A;  1N1J A;  3LZ1 C;  4Z66 C;  3UT9 A;  4J8X A;  3VH6 T;  4Z66 D;  3NQU A;  5GXQ A;  1M19 B;  5AV5 C;  5B33 D;  1ID3 A;  4NE6 A;  3AN2 A;  2PYO A;  3AZI B;  1P3F A;  4XZQ D;  3X1T C;  1S32 B;  5B0Z A;  3REI C;  1M18 B;  3WA9 D;  2L5A A;  1H3O B;  3X1U D;  3R45 B;  3LEL B;  4Z5T C;  5B0Y C;  1TZY C;  3B6G D;  4WU8 A;  3KUY C;  4AWL B;  1KX5 C;  1AOI B;  5F99 C;  3AZM A;  3REJ D;  4YM6 C;  3W96 D;  3B0C W;  3AZG C;  1KX4 C;  3X1S A;  4XUJ B;  2ARO B;  2F8N B;  3C1C B;  4UUZ A;  5CPJ C;  3B0D B;  4X23 A;  4WU9 D;  3A6N C;  1Q9C A;  5JRG D;  3MNN A;  5CPJ D;  1WWI A;  3LJA C;  5B2J D;  3LZ0 C;  5B32 A;  3W97 A;  4WNN B;  1HQ3 B;  4CAY A;  1P3A D;  3AZL D;  5B1L D;  1ULY A;  1P34 D;  5AV8 B;  5BO0 A;  1P3P A;  4KGC A;  2NQB C;  4YS3 D;  3UTB A;  4NE5 A;  4LD9 A;  5B1M A;  3O62 B;  2CV5 C;  5AVB B;  3REL D;  3WTP C;  5DNM A;  5C3I B;  5B2I B;  5AV6 A;  3WTP D;  1P3L A;  1F66 C;  2HIO D;  1B6W A;  5B40 C;  5B24 C;  1P3K D;  4J8W D;  5GT0 D;  3AZJ C;  3AZN C;  1EQZ C;  1KX3 B;  5AVC A;  4J8V B;  3AZF C;  3AFA B;  4JJN C;  5DNN B;  3MGS A;  3LZ1 B;  3AZK A;  4Z66 B;  4H9N A;  1M19 D;  3B6F C;  1P3B A;  3AV2 C;  5CPK C;  1KU5 A;  5G49 A;  3AZI D;  1P3F C;  5CPI C;  5AV5 B;  5B0Z C;  4WV4 B;  3X1U B;  3TU4 A;  3X1T B;  3REI B;  2BYM A;  5GT3 C;  5BNX A;  4H9R B;  3VH5 W;  4Z5T B;  5B0Y B;  5BNV A;  1TZY B;  5GT3 D;  3KUY B;  1TAF A;  1KX5 B;  5B33 A;  5F99 B;  3X1S C;  5CP6 C;  2ARO D;  4XUJ D;  3AZE C;  2F8N D;  3C1C D;  4XZQ A;  4YM6 B;  3AZG B;  4X23 C;  1KX4 B;  3MNN C;  5CPJ B;  2YFW A;  3A6N B;  4QLC A;  3B6G A;  1ZLA C;  3LJA B;  1HQ3 D;  2YFV B;  3LZ0 B;  1ZLA D;  5AV8 D;  1P3P C;  3MGP C;  2FJ7 A;  3WKJ C;  1U35 C;  3O62 D;  5AVB D;  5DNM C;  2CWE A;  4WU9 A;  4H9O B;  2NQB B;  5AV6 C;  5B2I D;  2CV5 B;  4DRA A;  3WTP B;  3MVD A;  2F8N G;  3NQJ A;  1F66 B;  3KXB A;  1KX3 D;  4J8V D;  5B1L A;  3AZL A;  5B40 B;  1A7W A;  5B24 B;  3AFA D;  3AZJ B;  3AZN B;  1EQZ B;  1BH8 A;  5DNN D;  5GSU C;  3AZF B;  3LZ1 D;  5BS7 C;  5B31 G;  4JJN B;  5AV9 C;  1P3B C;  3REL A;  1M1A C;  1JFI A;  1M1A D;  5AV5 D;  3B6F B;  5BT1 C;  3AV2 B;  5CPK B;  2HIO A;  1P3F B;  5AY8 C;  4Z2M G;  1P3K A;  4J8W A;  5GT0 A;  5CPI B;  1R4V A;  5B0Z B;  3X1T D;  3REI D;  3W99 C;  2NZD C;  4H9Q B;  3AZH C;  1P3I C;  4Z5T D;  5B0Y D;  1TZY D;  5GT3 B;  4EO5 C;  3KUY D;  1M19 A;  1KX5 D;  3KWQ C;  5F99 D;  3AZI A;  3MGQ C;  4YM6 D;  3AZG D;  3X1S B;  5CP6 B;  1S32 A;  1M18 A;  1KX4 D;  3AZE B;  1H3O A;  3R45 A;  4E45 A;  4J8U A;  4CSR B;  3LEL A;  5FUG B;  4QLC C;  3REH A;  3A6N D;  3MNN B;  3LJA D;  3MGR C;  4KUD A;  3LZ0 D;  1AOI A;  1P3O A;  3UTA C;  5E5A A;  4R8P C;  3X1V C;  3MGR D;  1ZLA B;  3C1B C;  2FJ7 C;  3WAA C;  1BFM A;  4R8P D;  5BO0 B;  2ARO A;  4XUJ A;  2IO5 C;  2F8N A;  3C1C A;  3AYW C;  1P3P B;  3MGP B;  4NE3 A;  3WKJ B;  1U35 B;  2RVQ C;  2NQB D;  3AYW D;  2CV5 D;  3REK C;  5DNM B;  1P3M C;  5AV6 B;  3MVD C;  5B31 A;  4WNN A;  1HQ3 A;  3KXB C;  1F66 D;  4ZUX C;  5B40 D;  5B24 D;  5AV8 A;  1F1E A;  3AZJ D;  3AZN D;  3UT9 C;  4J8X C;  1EQZ D;  3AZF D;  5GXQ C;  4JJN D;  3AV1 A;  3O62 A;  5GSU B;  1P3G A;  1ID3 C;  3AN2 C;  5AV9 B;  2PYO C;  1P3B B;  1M1A B;  3B6F D;  3AV2 D;  3W98 A;  5CPK D;  2PYO D;  1P3F D;  1BH9 B;  5CPI D;  5B0Z D;  1KX3 A;  4J8V A;  4H9S A;  3VH5 A;  5AY8 B;  3AFA A;  4WU8 C;  4H9P B;  5DNN A;  2BYM B;  3LZ1 A;  3W99 B;  2NZD B;  3AZM C;  3AZH B;  4Z66 A;  1P3I B;  5BNV B;  3WTP E;  4EO5 B;  5AV5 A;  3KWQ B;  5JA4 B;  3X1S D;  5CP6 D;  3WA9 A;  3AZE D;  5KDM B;  4J8U C;  3MGQ B;  3X1U A;  4G92 C;  3VH6 A;  3REH C;  4X23 D;  3REI A;  5B32 C;  3MNN D;  2YFW B;  3W97 C;  4Z5T A;  3V9R B;  4KUD C;  4QLC B;  1P3O C;  1TZY A;  5E5A C;  3MGR B;  3REJ A;  3W96 A;  3UTA B;  4R8P B;  3X1V B;  4KGC C;  3UTB C;  4LD9 C;  3C1B B;  2FJ7 B;  3WAA B;  5B1M C;  1P3P D;  3MGP D;  3AZG A;  3WKJ D;  1U35 D;  1KX4 A;  5JRG A;  3AYW B;  5CPJ A;  1P3L C;  5DNM D;  3A6N A;  5B2J A;  5AV6 D;  5B31 C;  2LY8 A;  3LJA A;  3REK B;  1P3L D;  3LZ0 A;  1P3M B;  3MVD B;  1P3A A;  5AVC C;  1P34 A;  3KXB B;  3MGS C;  2BYK B;  4ZUX B;  1N1J B;  3AZK C;  3AV1 C;  4YS3 A;  3UT9 B;  4J8X B;  5GSU D;  1P3G C;  4KHA A;  2NQB A;  3NQU B;  5GXQ B;  5AV9 D;  2CV5 A;  1P3B D;  3W98 C;  1ID3 B;  3WTP A;  3AN2 B;  2PYO B;  5BT1 D;  3TU4 C;  5B40 A;  5AY8 D;  5B24 A;  4G91 C;  3AZJ A;  3AZF A;  3W99 D;  4ZBJ C;  2NZD D;  3AZH D;  4WU8 B;  4JJN A;  1P3I D;  5B33 C;  4E44 A;  3AZM B;  4XZQ C;  3B6F A;  3KWQ D;  3AV2 A;  3WA9 C;  5CPK A;  3X1U C;  4UUZ B;  3MGQ D;  5CPI A;  4M6B A;  4X23 B;  3B6G C;  4J8U B;  4H9Q A;  4DRB A;  4G92 B;  3REH B;  4QLC D;  5B32 B;  5GT3 A;  3REJ C;  3W97 B;  4KUD B;  4CAY B;  1P3O B;  3W96 C;  5E5A B;  3UTA D;  3X1V D;  3C1B D;  2FJ7 D;  3WAA D;  4WZS B;  5CP6 A;  4KGC B;  4WU9 C;  3AZE A;  5CHL B;  5JRG C;  3UTB B;  4LD9 B;  5B1M B;  4CSR A;  5FUG A;  2RVQ D;  5B2J C;  3REK D;  1P3L B;  2JSS A;  1P3A C;  1P3M D;  3MVD D;  5B31 B;  3AZL C;  5B1L C;  1ZLA A;  1P34 C;  4HGA C;  3KSY A;  3KXB D;  5AVC B;  4ZUX D;  4YS3 C;  2HUE C;  3UT9 D;  4J8X D;  3MGP A;  3REL C;  3WKJ A;  3MGS B;  3AZK B;  1U35 A;  5AVB A;  3AV1 B;  5GXQ D;  4H9N B;  5B2I A;  1P3G B;  1ID3 D;  3AN2 D;  2HIO C;  5G49 B;  1P3K C;  4J8W C;  5GT0 C;  3W98 B;  3B0C T;  4NFT A; 
#chains in the Genus database with same CATH topology
 3TU4 B;  1Z2C B;  5BNX B;  4G91 B;  4WU8 D;  1HTA A;  1M19 C;  5GSU A;  5BS7 A;  4ZBJ B;  3AZM D;  5AV9 A;  3AZI C;  1TAF B;  1M1A A;  5B33 B;  1S32 C;  1M18 C;  2ZY5 A;  1BH9 A;  4XZQ B;  3LEL C;  1S32 D;  1M18 D;  3WA9 B;  3X1T A;  5AY8 A;  1B67 A;  4J8U D;  3LEL D;  4H9R A;  3REH D;  4H9P A;  4AWL C;  5B0Y A;  1AOI C;  5B32 D;  2UWX A;  3B6G B;  3W99 A;  2NZD A;  3AZH A;  1WWS A;  1P3I A;  3W97 D;  4KUD D;  3F6T A;  3KUY A;  1P3O D;  1AOI D;  5E5A D;  1KX5 A;  2F8N H;  3KFU G;  5F99 A;  2ARO C;  4XUJ C;  3REJ B;  3C1C C;  3W96 B;  3KWQ A;  4YM6 A;  2F8N K;  5JA4 A;  4KGC D;  3B0D C;  5KDM A;  3UTB D;  4LD9 D;  2IO5 B;  3MGQ A;  5B1M D;  4WU9 B;  5JRG B;  3V9R A;  3VH6 W;  5B2J B;  1HQ3 C;  2XD1 A;  2YFV A;  5B31 D;  3NQJ B;  5AV8 C;  3MGR A;  1P3A B;  3UTA A;  5AVC D;  3AZL B;  5B1L B;  4Z2M H;  4R8P A;  3X1V A;  4HGA B;  1P34 B;  3C1B A;  3B0B A;  3WAA A;  2Y2J A;  1BH8 B;  3O62 C;  5AVB C;  3MGS D;  5B32 G;  3AZK D;  4YS3 B;  2J8P A;  2HUE B;  5C3I C;  4H9O A;  5B2I C;  3VH5 T;  3AV1 D;  3AYW A;  4KHA B;  3REL B;  1P3G D;  1JFI B;  3REK A;  3W98 D;  1P3M A;  1KX3 C;  1F66 A;  4J8V C;  2HIO B;  4H9S C;  3AFA C;  1P3K B;  4J8W B;  2W8S A;  5GT0 B;  3H0R C;  3TU4 D;  5DNN C;  3AZN A;  1EQZ A;  2XD5 A;  2BYK A;  4ZUX A;  1N1J A;  3LZ1 C;  4Z66 C;  2ZY2 A;  3UT9 A;  4J8X A;  3VH6 T;  4Z66 D;  3NQU A;  5GXQ A;  1M19 B;  5AV5 C;  5B33 D;  1ID3 A;  4NE6 A;  3AN2 A;  2PYO A;  3AZI B;  1P3F A;  4XZQ D;  3X1T C;  1S32 B;  5B0Z A;  3REI C;  2JCH A;  1M18 B;  2L5A A;  3WA9 D;  1H3O B;  3X1U D;  3R45 B;  3LEL B;  4Z5T C;  5B0Y C;  1TZY C;  3B6G D;  4WU8 A;  3KUY C;  4AWL B;  1KX5 C;  1AOI B;  5F99 C;  3AZM A;  3REJ D;  4YM6 C;  3W96 D;  3B0C W;  3AZG C;  1KX4 C;  3FDD A;  3X1S A;  4XUJ B;  2ARO B;  2F8N B;  3C1C B;  4UUZ A;  5CPJ C;  3B0D B;  4X23 A;  4WU9 D;  3A6N C;  1Q9C A;  5JRG D;  3MNN A;  5CPJ D;  1WWI A;  3LJA C;  5B2J D;  3LZ0 C;  5B32 A;  3W97 A;  4WNN B;  1HQ3 B;  4CAY A;  1P3A D;  2Y2G A;  3AZL D;  5B1L D;  1ULY A;  1P34 D;  5AV8 B;  5BO0 A;  1P3P A;  4KGC A;  2ZM5 A;  4YS3 D;  2NQB C;  3UTB A;  4NE5 A;  4LD9 A;  5B1M A;  3O62 B;  2CV5 C;  5AVB B;  3REL D;  3WTP C;  5DNM A;  5C3I B;  5B2I B;  5AV6 A;  3WTP D;  1P3L A;  1F66 C;  2VQR A;  2HIO D;  1B6W A;  5B40 C;  5B24 C;  1P3K D;  4J8W D;  5GT0 D;  3AZJ C;  3AZN C;  1EQZ C;  1KX3 B;  5AVC A;  4J8V B;  3AZF C;  3AFA B;  4JJN C;  5DNN B;  3MGS A;  3LZ1 B;  3AZK A;  4Z66 B;  3EPL A;  4H9N A;  1M19 D;  3B6F C;  1P3B A;  3AV2 C;  5CPK C;  3H0L C;  1KU5 A;  5G49 A;  3AZI D;  1P3F C;  5CPI C;  5AV5 B;  5B0Z C;  4WV4 B;  3X1U B;  3TU4 A;  3X1T B;  3REI B;  2BG1 A;  2BYM A;  5GT3 C;  5BNX A;  4H9R B;  3VH5 W;  4Z5T B;  5B0Y B;  5BNV A;  1TZY B;  5GT3 D;  3KUY B;  1TAF A;  1KX5 B;  5B33 A;  5F99 B;  3X1S C;  5CP6 C;  2ARO D;  4XUJ D;  3AZE C;  2F8N D;  3C1C D;  4XZQ A;  3A1I A;  4YM6 B;  3AZG B;  4X23 C;  1KX4 B;  4UPK A;  3MNN C;  5CPJ B;  2YFW A;  3A6N B;  4QLC A;  3B6G A;  1ZLA C;  3A1K A;  3LJA B;  1HQ3 D;  2YFV B;  3LZ0 B;  1ZLA D;  5AV8 D;  1P3P C;  3MGP C;  2FJ7 A;  3WKJ C;  1U35 C;  3O62 D;  2DF4 C;  5AVB D;  5DNM C;  2CWE A;  2DQN C;  4H9O B;  4WU9 A;  5AV6 C;  2NQB B;  5B2I D;  4WJ3 C;  2CV5 B;  4DRA A;  3WTP B;  3EPJ A;  3MVD A;  2F8N G;  3NQJ A;  1F66 B;  3KXB A;  1KX3 D;  4J8V D;  5B1L A;  3AZL A;  5B40 B;  1A7W A;  5B24 B;  1W2E A;  3AFA D;  3AZJ B;  3AZN B;  1EQZ B;  1BH8 A;  5DNN D;  5GSU C;  3AZF B;  3LZ1 D;  5BS7 C;  5B31 G;  4JJN B;  5AV9 C;  1P3B C;  3REL A;  1M1A C;  1JFI A;  1M1A D;  5AV5 D;  3B6F B;  5BT1 C;  3AV2 B;  3IP4 C;  5CPK B;  2HIO A;  1P3F B;  5AY8 C;  4Z2M G;  1P3K A;  4J8W A;  5GT0 A;  5CPI B;  1R4V A;  5B0Z B;  3X1T D;  3REI D;  2Y2K A;  3W99 C;  2Y2P A;  2NZD C;  4H9Q B;  3AZH C;  1P3I C;  4Z5T D;  5B0Y D;  1TZY D;  5GT3 B;  4EO5 C;  3KUY D;  1M19 A;  1KX5 D;  3KWQ C;  5F99 D;  3AZI A;  3MGQ C;  4YM6 D;  3AZG D;  3X1S B;  5CP6 B;  1S32 A;  1M18 A;  1KX4 D;  3AZE B;  1H3O A;  3R45 A;  4E45 A;  4J8U A;  4CSR B;  3LEL A;  1PZR A;  3P5J B;  5FUG B;  4QLC C;  3REH A;  3A6N D;  3MNN B;  3LJA D;  3MGR C;  4KUD A;  3LZ0 D;  1AOI A;  2G5H C;  1P3O A;  3UTA C;  5E5A A;  4R8P C;  3X1V C;  3MGR D;  1ZLA B;  3C1B C;  2FJ7 C;  3WAA C;  1BFM A;  4R8P D;  5BO0 B;  2ARO A;  4XUJ A;  2IO5 C;  2F8N A;  3C1C A;  3AYW C;  1P3P B;  3MGP B;  4NE3 A;  3WKJ B;  1U35 B;  2RVQ C;  2NQB D;  3AYW D;  2F2A C;  2CV5 D;  3REK C;  5DNM B;  1P3M C;  5AV6 B;  3MVD C;  5B31 A;  4WNN A;  1HQ3 A;  3KXB C;  1F66 D;  4ZUX C;  5B40 D;  5B24 D;  5AV8 A;  1F1E A;  3AZJ D;  3AZN D;  3UT9 C;  4J8X C;  1EQZ D;  3AZF D;  5GXQ C;  4JJN D;  3AV1 A;  3O62 A;  5GSU B;  1P3G A;  1ID3 C;  3EPH A;  3AN2 C;  5AV9 B;  2PYO C;  1P3B B;  1M1A B;  3B6F D;  3AV2 D;  3W98 A;  5CPK D;  2PYO D;  1P3F D;  1BH9 B;  5CPI D;  5B0Z D;  1KX3 A;  4J8V A;  4H9S A;  3VH5 A;  5AY8 B;  3AFA A;  4WU8 C;  4H9P B;  5DNN A;  2BYM B;  3LZ1 A;  3W99 B;  2NZD B;  3AZM C;  3AZH B;  4Z66 A;  1P3I B;  5BNV B;  3WTP E;  2Y2L A;  2Y2O A;  4EO5 B;  5AV5 A;  3KWQ B;  5JA4 B;  3X1S D;  5CP6 D;  3WA9 A;  3AZE D;  5KDM B;  4J8U C;  3MGQ B;  3X1U A;  4G92 C;  3VH6 A;  3REH C;  4X23 D;  3REI A;  5B32 C;  3MNN D;  2YFW B;  3W97 C;  4Z5T A;  3V9R B;  4KUD C;  4QLC B;  1P3O C;  4DQY B;  1TZY A;  5E5A C;  3MGR B;  3REJ A;  3W96 A;  3UTA B;  4R8P B;  3X1V B;  4KGC C;  3UTB C;  4LD9 C;  3C1B B;  2FJ7 B;  3WAA B;  5B1M C;  1P3P D;  3MGP D;  3AZG A;  3WKJ D;  1U35 D;  1KX4 A;  5JRG A;  3AYW B;  5CPJ A;  1P3L C;  5DNM D;  3A6N A;  5B2J A;  5AV6 D;  5B31 C;  2LY8 A;  2Y2H A;  3LJA A;  3REK B;  1P3L D;  3LZ0 A;  1P3M B;  3MVD B;  1P3A A;  5AVC C;  2Y2N A;  1P34 A;  3KXB B;  3MGS C;  2BYK B;  4ZUX B;  1N1J B;  3AZK C;  3AV1 C;  4YS3 A;  3UT9 B;  4J8X B;  3EG5 B;  5GSU D;  1P3G C;  4KHA A;  2NQB A;  3EPK A;  3NQU B;  5GXQ B;  5AV9 D;  2CV5 A;  1P3B D;  3W98 C;  1ID3 B;  3WTP A;  3AN2 B;  2PYO B;  5BT1 D;  3TU4 C;  2G5I C;  5B40 A;  5AY8 D;  5B24 A;  4G91 C;  3AZJ A;  3AZF A;  3W99 D;  2ZY3 A;  4ZBJ C;  3AL0 C;  3AZH D;  2NZD D;  4WU8 B;  4JJN A;  1P3I D;  5B33 C;  4E44 A;  3AZM B;  3H0M C;  4XZQ C;  3KWQ D;  3B6F A;  3AV2 A;  3WA9 C;  5CPK A;  2JE5 A;  3X1U C;  4UUZ B;  3MGQ D;  5CPI A;  4M6B A;  4X23 B;  2Y2M A;  3B6G C;  4J8U B;  4H9Q A;  4DRB A;  4G92 B;  2RIQ A;  3REH B;  4QLC D;  5B32 B;  5GT3 A;  3REJ C;  3W97 B;  4KUD B;  4CAY B;  1P3O B;  3W96 C;  5E5A B;  3UTA D;  3X1V D;  3C1B D;  2FJ7 D;  3WAA D;  4WZS B;  5CP6 A;  4KGC B;  4WU9 C;  3AZE A;  5CHL B;  5JRG C;  3UTB B;  4LD9 B;  1T3U A;  5B1M B;  4CSR A;  5FUG A;  2RVQ D;  5B2J C;  2ZY4 A;  3REK D;  1P3L B;  2JSS A;  1P3A C;  1P3M D;  3MVD D;  5B31 B;  3AZL C;  5B1L C;  1ZLA A;  1P34 C;  4HGA C;  3KSY A;  3KXB D;  5AVC B;  2Y2I A;  4ZUX D;  4YS3 C;  2HUE C;  3UT9 D;  4J8X D;  3MGP A;  3REL C;  3WKJ A;  3MGS B;  3AZK B;  1U35 A;  5AVB A;  2Y2Q A;  3AV1 B;  2FFF B;  4H9N B;  5GXQ D;  5B2I A;  1P3G B;  1ID3 D;  3AN2 D;  2HIO C;  5G49 B;  1P3K C;  4J8W C;  5GT0 C;  3W98 B;  3B0C T;  4NFT A; 
#chains in the Genus database with same CATH homology
 3TU4 B;  1Z2C B;  5BNX B;  4G91 B;  4WU8 D;  1HTA A;  1M19 C;  5GSU A;  5BS7 A;  4ZBJ B;  3AZM D;  5AV9 A;  3AZI C;  1TAF B;  1M1A A;  5B33 B;  1S32 C;  1M18 C;  2ZY5 A;  1BH9 A;  4XZQ B;  3LEL C;  1S32 D;  1M18 D;  3WA9 B;  3X1T A;  5AY8 A;  1B67 A;  4J8U D;  3LEL D;  4H9R A;  3REH D;  4H9P A;  4AWL C;  5B0Y A;  1AOI C;  5B32 D;  2UWX A;  3B6G B;  3W99 A;  2NZD A;  3AZH A;  1WWS A;  1P3I A;  3W97 D;  4KUD D;  3F6T A;  3KUY A;  1P3O D;  1AOI D;  5E5A D;  1KX5 A;  2F8N H;  3KFU G;  5F99 A;  2ARO C;  4XUJ C;  3REJ B;  3C1C C;  3W96 B;  3KWQ A;  4YM6 A;  2F8N K;  5JA4 A;  4KGC D;  3B0D C;  5KDM A;  3UTB D;  4LD9 D;  2IO5 B;  3MGQ A;  5B1M D;  4WU9 B;  5JRG B;  3V9R A;  3VH6 W;  5B2J B;  1HQ3 C;  2XD1 A;  2YFV A;  5B31 D;  3NQJ B;  5AV8 C;  3MGR A;  1P3A B;  3UTA A;  5AVC D;  3AZL B;  5B1L B;  4Z2M H;  4R8P A;  3X1V A;  4HGA B;  1P34 B;  3C1B A;  3B0B A;  3WAA A;  2Y2J A;  1BH8 B;  3O62 C;  5AVB C;  3MGS D;  5B32 G;  3AZK D;  4YS3 B;  2J8P A;  2HUE B;  5C3I C;  4H9O A;  5B2I C;  3VH5 T;  3AV1 D;  3AYW A;  4KHA B;  3REL B;  1P3G D;  1JFI B;  3REK A;  3W98 D;  1P3M A;  1KX3 C;  1F66 A;  4J8V C;  2HIO B;  4H9S C;  3AFA C;  1P3K B;  4J8W B;  2W8S A;  5GT0 B;  3H0R C;  3TU4 D;  5DNN C;  3AZN A;  1EQZ A;  2XD5 A;  2BYK A;  4ZUX A;  1N1J A;  3LZ1 C;  4Z66 C;  2ZY2 A;  3UT9 A;  4J8X A;  3VH6 T;  4Z66 D;  3NQU A;  5GXQ A;  1M19 B;  5AV5 C;  5B33 D;  1ID3 A;  4NE6 A;  3AN2 A;  2PYO A;  3AZI B;  1P3F A;  4XZQ D;  3X1T C;  1S32 B;  5B0Z A;  3REI C;  2JCH A;  1M18 B;  2L5A A;  3WA9 D;  1H3O B;  3X1U D;  3R45 B;  3LEL B;  4Z5T C;  5B0Y C;  1TZY C;  3B6G D;  4WU8 A;  3KUY C;  4AWL B;  1KX5 C;  1AOI B;  5F99 C;  3AZM A;  3REJ D;  4YM6 C;  3W96 D;  3B0C W;  3AZG C;  1KX4 C;  3FDD A;  3X1S A;  4XUJ B;  2ARO B;  2F8N B;  3C1C B;  4UUZ A;  5CPJ C;  3B0D B;  4X23 A;  4WU9 D;  3A6N C;  1Q9C A;  5JRG D;  3MNN A;  5CPJ D;  1WWI A;  3LJA C;  5B2J D;  3LZ0 C;  5B32 A;  3W97 A;  4WNN B;  1HQ3 B;  4CAY A;  1P3A D;  2Y2G A;  3AZL D;  5B1L D;  1ULY A;  1P34 D;  5AV8 B;  5BO0 A;  1P3P A;  4KGC A;  2ZM5 A;  4YS3 D;  2NQB C;  3UTB A;  4NE5 A;  4LD9 A;  5B1M A;  3O62 B;  2CV5 C;  5AVB B;  3REL D;  3WTP C;  5DNM A;  5C3I B;  5B2I B;  5AV6 A;  3WTP D;  1P3L A;  1F66 C;  2VQR A;  2HIO D;  1B6W A;  5B40 C;  5B24 C;  1P3K D;  4J8W D;  5GT0 D;  3AZJ C;  3AZN C;  1EQZ C;  1KX3 B;  5AVC A;  4J8V B;  3AZF C;  3AFA B;  4JJN C;  5DNN B;  3MGS A;  3LZ1 B;  3AZK A;  4Z66 B;  3EPL A;  4H9N A;  1M19 D;  3B6F C;  1P3B A;  3AV2 C;  5CPK C;  3H0L C;  1KU5 A;  5G49 A;  3AZI D;  1P3F C;  5CPI C;  5AV5 B;  5B0Z C;  4WV4 B;  3X1U B;  3TU4 A;  3X1T B;  3REI B;  2BG1 A;  2BYM A;  5GT3 C;  5BNX A;  4H9R B;  3VH5 W;  4Z5T B;  5B0Y B;  5BNV A;  1TZY B;  5GT3 D;  3KUY B;  1TAF A;  1KX5 B;  5B33 A;  5F99 B;  3X1S C;  5CP6 C;  2ARO D;  4XUJ D;  3AZE C;  2F8N D;  3C1C D;  4XZQ A;  3A1I A;  4YM6 B;  3AZG B;  4X23 C;  1KX4 B;  4UPK A;  3MNN C;  5CPJ B;  2YFW A;  3A6N B;  4QLC A;  3B6G A;  1ZLA C;  3A1K A;  3LJA B;  1HQ3 D;  2YFV B;  3LZ0 B;  1ZLA D;  5AV8 D;  1P3P C;  3MGP C;  2FJ7 A;  3WKJ C;  1U35 C;  3O62 D;  2DF4 C;  5AVB D;  5DNM C;  2CWE A;  2DQN C;  4H9O B;  4WU9 A;  5AV6 C;  2NQB B;  5B2I D;  4WJ3 C;  2CV5 B;  4DRA A;  3WTP B;  3EPJ A;  3MVD A;  2F8N G;  3NQJ A;  1F66 B;  3KXB A;  1KX3 D;  4J8V D;  5B1L A;  3AZL A;  5B40 B;  1A7W A;  5B24 B;  1W2E A;  3AFA D;  3AZJ B;  3AZN B;  1EQZ B;  1BH8 A;  5DNN D;  5GSU C;  3AZF B;  3LZ1 D;  5BS7 C;  5B31 G;  4JJN B;  5AV9 C;  1P3B C;  3REL A;  1M1A C;  1JFI A;  1M1A D;  5AV5 D;  3B6F B;  5BT1 C;  3AV2 B;  3IP4 C;  5CPK B;  2HIO A;  1P3F B;  5AY8 C;  4Z2M G;  1P3K A;  4J8W A;  5GT0 A;  5CPI B;  1R4V A;  5B0Z B;  3X1T D;  3REI D;  2Y2K A;  3W99 C;  2Y2P A;  2NZD C;  4H9Q B;  3AZH C;  1P3I C;  4Z5T D;  5B0Y D;  1TZY D;  5GT3 B;  4EO5 C;  3KUY D;  1M19 A;  1KX5 D;  3KWQ C;  5F99 D;  3AZI A;  3MGQ C;  4YM6 D;  3AZG D;  3X1S B;  5CP6 B;  1S32 A;  1M18 A;  1KX4 D;  3AZE B;  1H3O A;  3R45 A;  4E45 A;  4J8U A;  4CSR B;  3LEL A;  1PZR A;  3P5J B;  5FUG B;  4QLC C;  3REH A;  3A6N D;  3MNN B;  3LJA D;  3MGR C;  4KUD A;  3LZ0 D;  1AOI A;  2G5H C;  1P3O A;  3UTA C;  5E5A A;  4R8P C;  3X1V C;  3MGR D;  1ZLA B;  3C1B C;  2FJ7 C;  3WAA C;  1BFM A;  4R8P D;  5BO0 B;  2ARO A;  4XUJ A;  2IO5 C;  2F8N A;  3C1C A;  3AYW C;  1P3P B;  3MGP B;  4NE3 A;  3WKJ B;  1U35 B;  2RVQ C;  2NQB D;  3AYW D;  2F2A C;  2CV5 D;  3REK C;  5DNM B;  1P3M C;  5AV6 B;  3MVD C;  5B31 A;  4WNN A;  1HQ3 A;  3KXB C;  1F66 D;  4ZUX C;  5B40 D;  5B24 D;  5AV8 A;  1F1E A;  3AZJ D;  3AZN D;  3UT9 C;  4J8X C;  1EQZ D;  3AZF D;  5GXQ C;  4JJN D;  3AV1 A;  3O62 A;  5GSU B;  1P3G A;  1ID3 C;  3EPH A;  3AN2 C;  5AV9 B;  2PYO C;  1P3B B;  1M1A B;  3B6F D;  3AV2 D;  3W98 A;  5CPK D;  2PYO D;  1P3F D;  1BH9 B;  5CPI D;  5B0Z D;  1KX3 A;  4J8V A;  4H9S A;  3VH5 A;  5AY8 B;  3AFA A;  4WU8 C;  4H9P B;  5DNN A;  2BYM B;  3LZ1 A;  3W99 B;  2NZD B;  3AZM C;  3AZH B;  4Z66 A;  1P3I B;  5BNV B;  3WTP E;  2Y2L A;  2Y2O A;  4EO5 B;  5AV5 A;  3KWQ B;  5JA4 B;  3X1S D;  5CP6 D;  3WA9 A;  3AZE D;  5KDM B;  4J8U C;  3MGQ B;  3X1U A;  4G92 C;  3VH6 A;  3REH C;  4X23 D;  3REI A;  5B32 C;  3MNN D;  2YFW B;  3W97 C;  4Z5T A;  3V9R B;  4KUD C;  4QLC B;  1P3O C;  4DQY B;  1TZY A;  5E5A C;  3MGR B;  3REJ A;  3W96 A;  3UTA B;  4R8P B;  3X1V B;  4KGC C;  3UTB C;  4LD9 C;  3C1B B;  2FJ7 B;  3WAA B;  5B1M C;  1P3P D;  3MGP D;  3AZG A;  3WKJ D;  1U35 D;  1KX4 A;  5JRG A;  3AYW B;  5CPJ A;  1P3L C;  5DNM D;  3A6N A;  5B2J A;  5AV6 D;  5B31 C;  2LY8 A;  2Y2H A;  3LJA A;  3REK B;  1P3L D;  3LZ0 A;  1P3M B;  3MVD B;  1P3A A;  5AVC C;  2Y2N A;  1P34 A;  3KXB B;  3MGS C;  2BYK B;  4ZUX B;  1N1J B;  3AZK C;  3AV1 C;  4YS3 A;  3UT9 B;  4J8X B;  3EG5 B;  5GSU D;  1P3G C;  4KHA A;  2NQB A;  3EPK A;  3NQU B;  5GXQ B;  5AV9 D;  2CV5 A;  1P3B D;  3W98 C;  1ID3 B;  3WTP A;  3AN2 B;  2PYO B;  5BT1 D;  3TU4 C;  2G5I C;  5B40 A;  5AY8 D;  5B24 A;  4G91 C;  3AZJ A;  3AZF A;  3W99 D;  2ZY3 A;  4ZBJ C;  3AL0 C;  3AZH D;  2NZD D;  4WU8 B;  4JJN A;  1P3I D;  5B33 C;  4E44 A;  3AZM B;  3H0M C;  4XZQ C;  3KWQ D;  3B6F A;  3AV2 A;  3WA9 C;  5CPK A;  2JE5 A;  3X1U C;  4UUZ B;  3MGQ D;  5CPI A;  4M6B A;  4X23 B;  2Y2M A;  3B6G C;  4J8U B;  4H9Q A;  4DRB A;  4G92 B;  2RIQ A;  3REH B;  4QLC D;  5B32 B;  5GT3 A;  3REJ C;  3W97 B;  4KUD B;  4CAY B;  1P3O B;  3W96 C;  5E5A B;  3UTA D;  3X1V D;  3C1B D;  2FJ7 D;  3WAA D;  4WZS B;  5CP6 A;  4KGC B;  4WU9 C;  3AZE A;  5CHL B;  5JRG C;  3UTB B;  4LD9 B;  1T3U A;  5B1M B;  4CSR A;  5FUG A;  2RVQ D;  5B2J C;  2ZY4 A;  3REK D;  1P3L B;  2JSS A;  1P3A C;  1P3M D;  3MVD D;  5B31 B;  3AZL C;  5B1L C;  1ZLA A;  1P34 C;  4HGA C;  3KSY A;  3KXB D;  5AVC B;  2Y2I A;  4ZUX D;  4YS3 C;  2HUE C;  3UT9 D;  4J8X D;  3MGP A;  3REL C;  3WKJ A;  3MGS B;  3AZK B;  1U35 A;  5AVB A;  2Y2Q A;  3AV1 B;  2FFF B;  4H9N B;  5GXQ D;  5B2I A;  1P3G B;  1ID3 D;  3AN2 D;  2HIO C;  5G49 B;  1P3K C;  4J8W C;  5GT0 C;  3W98 B;  3B0C T;  4NFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...