3REIC

2.65 angstrom crystal structure of the nucleosome core particle assembled with a 145 bp alpha-satellite dna (ncp145) derivatized with triamminechloroplatinum(ii) chloride
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 32
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3reiC00
5AVBB 5BNVB 3AZLB 5B32A 3W96C 3W97A 5B40C 4ZBJC 4YS3B 3AZKA 5B32B 1U35C 4EO5C 2F8NK 2PYOA 1S32C 3AV1C 4XZQC 3W97B 3AZKB 3AZGA 3UT9D 2PYOB 3VH5W 3TU4D 3KUYA 1P3PD 3AZGB 4KUDA 2HIOB 4Z2MG 3W98C 1KU5A 3KUYB 4KUDB 5B24A 2BYMA 5B33C 1P3BC 5AV9D 3REID 5B24B 3UTBA 2BYMB 4Z5TD 5AV6C 3MGSC 3MGQB 3UTBB 2CV5D 1ZLAC 4J8VD 2JSSA 1KX3A 3X1UC 1M1AA 4Z66A 1KX4A 4J8UD 1KX3B 2HUEC 1AOID 1M1AB 1F66C 4Z66B 3AZEA 5GT3C 1KX4B 2LY8A 1P3LC 1ID3A 3AZEB 5B0ZC 1ID3B 5CPJA 1P3MD 3AV2A 1EQZC 3AZJD 3AZND 4XUJA 5DNND 4DRBA 3LZ1C 3AZMD 5GXQC 1M18D 3B6FD 4H9NB 1HQ3B 3AV2B 4YS3D 5AVCA 4XUJB 1P3AD 1P34D 5B31C 5AVCB 3C1BC 4J8WD 4X23C 2HIOD 3AZID 1TZYD 3X1TA 3KWQD 3UTAA 1WWIA 5AY8A 4CSRA 3WA9D 2AROD 4WU9C 3UTAB 3WAAC 4CSRB 5B31G 5AY8B 3V9RA 3MGQD 3W96D 3V9RB 1U35D 1A7WA 5E5AA 1S32D 3AV1D 3B0CT 4XZQD 4UUZA 5E5AB 3UT9C 5DNMC 5CPIC 4UUZB 5GT0A 3REHA 3KSYA 3O62B 4LD9A 3W98D 3AZFA 3VH5A 1H3OA 5AV8C 1P3OC 5GT0B 3REHB 4LD9B 5B2JA 5B33D 3VH6T 1P3BD 1H3OB 5G49A 3A6NA 5AV6D 4QLCA 3X1SC 5G49B 3MGSD 5B1LC 1HQ3D 3A6NB 1TAFA 4QLCB 1ZLAD 3B0DB 3LELC 1BH9A 4R8PC 3X1UD 1JFIB 1BH9B 4J8UC 4NE3A 5AV5C 5JRGA 1F66D 5GT3D 4G92C 1P3LD 5JRGB 3AN2C 5BS7A 3WTPB 5B2IC 5BT1C 3REJC 5AVBC 1EQZD 3B6GA 3AZLC 3LZ1D 5GXQD 4NE6A 3B6GB 4KGCA 3NQUA 4YS3C 1P3FA 5B32C 3X1VA 3LZ0A 5B31D 4KGCB 3NQUB 3W97C 5CPKA 3AZKC 3RELB 4KHAA 3X1VB 3LZ0B 3C1BD 2PYOC 4X23D 5CPKB 4H9SA 3AZGC 4KHAB 2HIOC 3O62D 3W99A 2YFWA 3KUYC 4KUDC 3C1CA 3W99B 1P3GA 3LJAA 2YFWB 4WU9D 5B32G 5B24C 3WAAD 1P3GB 3LJAB 2F8NG 4NFTA 3MGQC 3UTBC 4NE5A 4YM6A 2F8NA 1N1JA 2NQBA 4YM6B 2F8NB 1N1JB 5DNMD 2NQBB 5GSUA 5CPID 1KX3C 4AWLB 1M1AC 4Z66C 1KX4C 5CP6A 5AV8D 5GSUB 1P3OD 3WTPD 3AZEC 5CP6B 3B0CW 3MNNA 4J8XA 1KX5A 2L5AA 1ID3C 4HGAB 3MNNB 4J8XB 1KX5B 3X1SD 5B1LD 5BNXA 1HQ3C 3AV2C 1P3KA 4XUJC 3LELD 3MVDA 5BNXB 1P3KB 4R8PD 1M19A 5AVCC 3RELD 5AV5D 3MVDB 1M19B 4JJNA 5B1MA 3AN2D 2AROA 5B2ID 4JJNB 3MGPA 5BT1D 5B1MB 4DRAA 3REJD 5AVBD 3MGPB 3UTAC 5AY8C 3AZLD 5B40A 4ZUXA 5CPJB 4WU8A 2CWEA 3AYWA 4ZUXB 5B32D 4WU8B 3WKJA 3W97D 3AYWB 3AZKD 5F99A 1P3IA 3AZHA 2YFVA 5E5AC 2PYOD 3WKJB 3AZGD 5F99B 1P3IB 3AZHB 2YFVB 3O62C 5BO0A 5C3IB 5B0YA 3KUYD 5GT0C 3REHC 4KUDD 1ULYA 4WV4B 4LD9C 3X1TB 5BO0B 5B0YB 5B24D 2NZDA 3KXBA 3AFAA 5CHLB 2NZDB 3UTBD 3A6NC 3KXBB 3AFAB 5KDMA 4QLCC 3B0DC 3REKA 5KDMB 3REKB 1KX3D 1M1AD 4Z66D 1KX4D 5B0ZA 1R4VA 5JRGC 2FJ7A 1B67A 3AZED 3WTPC 3AZFB 3MGRA 2FJ7B 1ID3D 5BS7C 5B2JB 3VH5T 3MGRB 5CPJD 3AV2D 4H9PA 3B6GC 4H9RA 4XUJD 1F1EA 4Z2MH 1BFMA 4KGCC 5AVCD 4H9RB 1TAFB 3RELC 4WNNA 3X1VC 3LZ0C 5CPKC 4WNNB 1B6WA 4H9SC 3W99C 3NQJA 3UTAD 5AY8D 3B0BA 3LJAC 3NQJB 1P3GC 3UT9A 3TU4A 1P3FB 4YM6C 5E5AD 1P3PA 2NQBC 4G91B 1WWSA 3R45A 3TU4B 4AWLC 1P3PB 2IO5B 5GSUC 5JA4A 5AV9A 5GT0D 3REHD 3REIA 4LD9D 5CP6C 4H9OA 3AZFD 4Z5TA 5JA4B 5AV9B 3REIB 4HGAC 5B2JD 3MNNC 3C1CB 4Z5TB 4J8XC 1KX5C 2CV5A 3A6ND 4J8VA 2BYKA 4M6BA 4QLCD 2CV5B 4J8VB 4J8UA 2BYKB 1P3KC 1AOIA 3MVDC 1M19C 1AOIB 5JRGD 4JJNC 1P3MA 5B1MC 3AZJA 3AZNA 5DNNA 3AZMA 3MGPC 1M18A 3B6FA 1P3MB 4YS3A 3AZJB 3AZNB 5DNNB 5CPJC 3AZMB 1P34A 1P3AA 1M18B 3B6FB 3B6GD 4ZUXC 1P3AB 1P34B 4WU8C 3VH6W 4KGCD 1P3FD 4J8WA 3AYWC 4E45A 3X1VD 2HIOA 3LZ0D 3AZIA 3WKJC 1TZYA 3KWQA 4J8WB 5CPKD 5F99C 1P3IC 3AZHC 3AZIB 1TZYB 3WA9A 4E44A 5C3IC 3KWQB 3W99D 3WA9B 3X1TC 2AROB 5B0YC 3MGQA 3W96A 3C1CD 1P3GD 3LJAD 1U35A 2NZDC 1S32A 3AV1A 1BH8A 4XZQA 3KXBC 5B40B 3AFAC 4ZBJB 3W96B 1U35B 4EO5B 1S32B 3AV1B 1BH8B 2RVQC 4XZQB 4YM6D 5FUGA 2F8ND 3REKC 2NQBD 3W98A 5FUGB 5GSUD 5B33A 3W98B 1P3BA 5CP6D 5B33B 1Q9CA 3AZFC 5AV6A 1P3BB 2FJ7C 3MGSA 3MNND 4H9NA 1HQ3A 5B2JC 4J8XD 1KX5D 5AV6B 3MGRC 1ZLAA 3MGSB 3X1UA 1ZLAB 1P3KD 3X1UB 1F66A 5GT3A 1P3LA 3MVDD 2HUEB 1M19D 1F66B 5GT3B 1P3LB 2F8NH 4JJND 1EQZA 5B0ZB 5B1MD 3LZ1A 5GXQA 3MGPD 1EQZB 4H9QA 3LZ1B 5GXQB 4CAYA 5B31A 4H9QB 5B40D 4ZUXD 4WU8D 4CAYB 4H9PB 5B31B 3C1BA 4X23A 3AYWD 1P3FC 3O62A 3WKJD 3C1BB 3VH6A 4X23B 4G91C 3WTPE 5F99D 3TU4C 3AZHD 1P3ID 1P3PC 2IO5C 4WU9A 1HTAA 3WAAA 3X1TD 5B0YD 5AV9C 3REIC 4WU9B 3WAAB 3C1CC 4Z5TC 4WZSB 2NZDD 3KXBD 3AFAD 1JFIA 2CV5C 2RVQD 5DNMA 4J8VC 5CPIA 3REKD 3UT9B 5DNMB 5AV8A 5CPIB 1P3OA 1AOIC 3WTPA 5AV8B 1P3OB 3R45B 5B0ZD 2FJ7D 3X1SA 5B1LA 4H9OB 1P3MC 3MGRD 3X1SB 3AZJC 3AZNC 5DNNC 5B1LB 3LELA 3AZMC 1M18C 3B6FC 4R8PA 3RELA 3LELB 1P3AC 1P34C 5AV5A 4R8PB 4J8UB 5AV5B 4J8WC 3AN2A 4G92B 5B2IA 3AZIC 1TZYC 3KWQC 3AN2B 5B2IB 3REJA 5AVBA 5BNVA 3AZLA 3WA9C 2AROC 3REJB
chains in the Genus database with same CATH superfamily
5AVBB 5BNVB 3AZLB 5B32A 3W96C 3W97A 5B40C 4ZBJC 4YS3B 3AZKA 5B32B 1U35C 4EO5C 2F8NK 2PYOA 1S32C 3AV1C 4XZQC 3W97B 3AZKB 3AZGA 3UT9D 2PYOB 2VQRA 3VH5W 3TU4D 3KUYA 1P3PD 3AZGB 4KUDA 2HIOB 4Z2MG 3W98C 1KU5A 3KUYB 4KUDB 5B24A 2BYMA 5B33C 1P3BC 5AV9D 3REID 5B24B 3UTBA 2BYMB 4Z5TD 5AV6C 3MGSC 3MGQB 3UTBB 2CV5D 1ZLAC 1Z2CB 2Y2JA 4J8VD 2JSSA 1KX3A 3X1UC 1M1AA 4Z66A 1KX4A 4J8UD 1KX3B 2HUEC 1AOID 1M1AB 1F66C 4Z66B 3AZEA 5GT3C 1KX4B 2LY8A 1P3LC 1ID3A 3AZEB 5B0ZC 1ID3B 5CPJA 1P3MD 3AV2A 1EQZC 3AZJD 3AZND 4XUJA 5DNND 3EG5B 2Y2IA 4DRBA 3LZ1C 5GXQC 3AZMD 1M18D 2Y2MA 4H9NB 1HQ3B 2XD5A 4YS3D 3AV2B 3B6FD 5AVCA 4XUJB 1P3AD 2DQNC 1P34D 5B31C 5AVCB 3C1BC 4J8WD 4X23C 2HIOD 3AZID 1TZYD 3X1TA 4WJ3C 3KWQD 3UTAA 1WWIA 5AY8A 4CSRA 3WA9D 2AROD 4WU9C 3UTAB 3WAAC 4CSRB 5B31G 5AY8B 3V9RA 3MGQD 3W96D 3H0RC 3V9RB 2JCHA 1U35D 1A7WA 2ZY5A 5E5AA 1S32D 3AV1D 3B0CT 4XZQD 4UUZA 5E5AB 3UT9C 5DNMC 5CPIC 4UUZB 5GT0A 3REHA 3KSYA 3O62B 4UPKA 3W98D 4LD9A 3AZFA 3VH5A 1H3OA 5AV8C 1P3OC 5GT0B 3REHB 3FDDA 4LD9B 5B2JA 5B33D 3VH6T 1P3BD 1H3OB 5G49A 3A6NA 5AV6D 4QLCA 3X1SC 5G49B 3MGSD 5B1LC 1HQ3D 3A6NB 1TAFA 4QLCB 1ZLAD 3B0DB 3LELC 1BH9A 2XD1A 4R8PC 3X1UD 1JFIB 3H0MC 1BH9B 4J8UC 4NE3A 5AV5C 5JRGA 1F66D 5GT3D 4G92C 1P3LD 5JRGB 3AN2C 5BS7A 3WTPB 5B2IC 5BT1C 3REJC 5AVBC 1EQZD 3B6GA 3AZLC 3LZ1D 5GXQD 4NE6A 3B6GB 2W8SA 3NQUA 4KGCA 4YS3C 1P3FA 5B32C 3X1VA 3LZ0A 5B31D 2Y2HA 4KGCB 3NQUB 3W97C 5CPKA 3F6TA 3AZKC 3RELB 4KHAA 3X1VB 3LZ0B 3C1BD 2PYOC 4X23D 5CPKB 4H9SA 3AZGC 4KHAB 2HIOC 3O62D 3EPLA 3W99A 2YFWA 3KUYC 4KUDC 3C1CA 3W99B 1P3GA 3LJAA 2YFWB 4WU9D 5B32G 5B24C 3WAAD 1P3GB 3LJAB 2F8NG 4NFTA 3MGQC 2Y2PA 3UTBC 4NE5A 4YM6A 2F8NA 1N1JA 2NQBA 4YM6B 2F8NB 1N1JB 2G5HC 5DNMD 2NQBB 5GSUA 5CPID 1KX3C 4AWLB 1M1AC 4Z66C 1KX4C 5CP6A 2F2AC 5AV8D 5GSUB 1P3OD 3WTPD 3AZEC 5CP6B 3B0CW 3MNNA 4J8XA 1KX5A 2L5AA 2ZY2A 4HGAB 1ID3C 2UWXA 4DQYB 3MNNB 4J8XB 1KX5B 3X1SD 5B1LD 5BNXA 1HQ3C 3AV2C 1P3KA 4XUJC 3LELD 3MVDA 5BNXB 1P3KB 4R8PD 1M19A 5AVCC 3RELD 5AV5D 3MVDB 2DF4C 1M19B 4JJNA 5B1MA 3AN2D 2AROA 5B2ID 4JJNB 3MGPA 5BT1D 5B1MB 4DRAA 3REJD 5AVBD 3MGPB 3UTAC 5AY8C 3AZLD 5B40A 4ZUXA 5CPJB 4WU8A 2CWEA 3AYWA 4ZUXB 5B32D 4WU8B 3WKJA 3W97D 3AYWB 3AZKD 5F99A 2Y2GA 3AZHA 2YFVA 5E5AC 1P3IA 2PYOD 3WKJB 3AZGD 5F99B 1P3IB 3AZHB 2YFVB 3O62C 5BO0A 5C3IB 5B0YA 3KUYD 5GT0C 3REHC 4KUDD 1ULYA 4WV4B 4LD9C 3X1TB 5BO0B 5B0YB 5B24D 2NZDA 3KXBA 3AFAA 5CHLB 2NZDB 3UTBD 3A6NC 3KXBB 3AFAB 5KDMA 4QLCC 1PZRA 3B0DC 3REKA 2ZM5A 5KDMB 3REKB 1KX3D 1M1AD 4Z66D 1KX4D 5B0ZA 1R4VA 5JRGC 2FJ7A 1B67A 3AZED 3WTPC 3AZFB 3MGRA 2FJ7B 1ID3D 5BS7C 5B2JB 3VH5T 3MGRB 5CPJD 3P5JB 4H9PA 3AV2D 3B6GC 4H9RA 4XUJD 1F1EA 4Z2MH 1T3UA 1BFMA 2J8PA 4KGCC 5AVCD 1TAFB 4H9RB 3RELC 4WNNA 3X1VC 3LZ0C 5CPKC 4WNNB 1B6WA 4H9SC 3A1KA 3EPHA 3W99C 2Y2NA 3NQJA 3UTAD 3H0LC 5AY8D 2ZY4A 3B0BA 3LJAC 3NQJB 1P3GC 3UT9A 3TU4A 1P3FB 4YM6C 5E5AD 1P3PA 2NQBC 4G91B 1WWSA 3R45A 3TU4B 4AWLC 1P3PB 1W2EA 2IO5B 5GSUC 5JA4A 5AV9A 2Y2QA 5GT0D 3REHD 3REIA 4LD9D 5CP6C 4H9OA 3AZFD 4Z5TA 5JA4B 5AV9B 3REIB 4HGAC 5B2JD 3MNNC 3C1CB 4Z5TB 4J8XC 1KX5C 2CV5A 3A6ND 4J8VA 2BYKA 4M6BA 4QLCD 2CV5B 4J8VB 4J8UA 2BYKB 1P3KC 3KFUG 2JE5A 1AOIA 3MVDC 1M19C 1AOIB 5JRGD 4JJNC 1P3MA 5B1MC 3AZJA 3AZNA 5DNNA 2Y2KA 3AZMA 3MGPC 1M18A 3B6FA 1P3MB 4YS3A 3AZJB 3AZNB 5DNNB 5CPJC 3AZMB 1P34A 1P3AA 1M18B 3B6FB 3B6GD 4ZUXC 1P3AB 1P34B 4WU8C 3VH6W 4KGCD 1P3FD 4J8WA 3AYWC 4E45A 3X1VD 2HIOA 3LZ0D 3AZIA 3WKJC 1TZYA 3KWQA 4J8WB 5CPKD 5F99C 1P3IC 3AZHC 3AZIB 1TZYB 3WA9A 4E44A 5C3IC 3KWQB 3W99D 2G5IC 3X1TC 3WA9B 2AROB 5B0YC 3MGQA 2ZY3A 3W96A 3C1CD 1P3GD 3LJAD 1U35A 2NZDC 1S32A 3AV1A 1BH8A 4XZQA 3KXBC 5B40B 3AFAC 4ZBJB 3W96B 1U35B 4EO5B 1S32B 3AV1B 1BH8B 2RVQC 2FFFB 4XZQB 4YM6D 5FUGA 2F8ND 3AL0C 3REKC 2NQBD 3W98A 5FUGB 2Y2OA 5GSUD 5B33A 3W98B 1P3BA 3IP4C 5CP6D 5B33B 1Q9CA 3AZFC 5AV6A 1P3BB 2FJ7C 3MGSA 3MNND 4H9NA 1HQ3A 5B2JC 4J8XD 1KX5D 5AV6B 3MGRC 1ZLAA 3MGSB 3X1UA 1ZLAB 1P3KD 3X1UB 1F66A 5GT3A 1P3LA 3MVDD 2HUEB 1M19D 1F66B 5GT3B 1P3LB 2F8NH 4JJND 1EQZA 5B0ZB 5B1MD 3LZ1A 3EPJA 5GXQA 3MGPD 1EQZB 4H9QA 3LZ1B 5GXQB 4CAYA 5B31A 4H9QB 5B40D 4ZUXD 4WU8D 4CAYB 2BG1A 2RIQA 4H9PB 5B31B 3C1BA 4X23A 3AYWD 1P3FC 3O62A 3WKJD 3C1BB 3VH6A 4X23B 4G91C 3WTPE 5F99D 3TU4C 3AZHD 1P3ID 1P3PC 2IO5C 4WU9A 1HTAA 3WAAA 3X1TD 5B0YD 5AV9C 3REIC 4WU9B 3WAAB 3C1CC 4Z5TC 3EPKA 4WZSB 2NZDD 3KXBD 3AFAD 1JFIA 2CV5C 2RVQD 5DNMA 4J8VC 5CPIA 3REKD 3UT9B 5DNMB 5AV8A 5CPIB 1P3OA 1AOIC 3WTPA 5AV8B 1P3OB 3R45B 5B0ZD 2Y2LA 2FJ7D 3X1SA 5B1LA 4H9OB 1P3MC 3MGRD 3X1SB 3AZJC 3AZNC 5DNNC 5B1LB 3LELA 3AZMC 1M18C 3B6FC 4R8PA 3A1IA 3RELA 3LELB 1P3AC 1P34C 5AV5A 4R8PB 4J8UB 5AV5B 4J8WC 3AN2A 4G92B 5B2IA 3AZIC 1TZYC 3KWQC 3AN2B 5B2IB 3REJA 5AVBA 5BNVA 3AZLA 3WA9C 2AROC 3REJB
chains in the Genus database with same CATH topology
5AVBB 5BNVB 3AZLB 5B32A 3W96C 3W97A 5B40C 4ZBJC 4YS3B 3AZKA 5B32B 1U35C 4EO5C 2F8NK 2PYOA 1S32C 3AV1C 4XZQC 3W97B 3AZKB 3AZGA 3UT9D 2PYOB 2VQRA 3VH5W 3TU4D 3KUYA 1P3PD 3AZGB 4KUDA 2HIOB 4Z2MG 3W98C 1KU5A 3KUYB 4KUDB 5B24A 2BYMA 5B33C 1P3BC 5AV9D 3REID 5B24B 3UTBA 2BYMB 4Z5TD 5AV6C 3MGSC 3MGQB 3UTBB 2CV5D 1ZLAC 1Z2CB 2Y2JA 4J8VD 2JSSA 1KX3A 3X1UC 1M1AA 4Z66A 1KX4A 4J8UD 1KX3B 2HUEC 1AOID 1M1AB 1F66C 4Z66B 3AZEA 5GT3C 1KX4B 2LY8A 1P3LC 1ID3A 3AZEB 5B0ZC 1ID3B 5CPJA 1P3MD 3AV2A 1EQZC 3AZJD 3AZND 4XUJA 5DNND 3EG5B 2Y2IA 4DRBA 3LZ1C 5GXQC 3AZMD 1M18D 2Y2MA 4H9NB 1HQ3B 2XD5A 4YS3D 3AV2B 3B6FD 5AVCA 4XUJB 1P3AD 2DQNC 1P34D 5B31C 5AVCB 3C1BC 4J8WD 4X23C 2HIOD 3AZID 1TZYD 3X1TA 4WJ3C 3KWQD 3UTAA 1WWIA 5AY8A 4CSRA 3WA9D 2AROD 4WU9C 3UTAB 3WAAC 4CSRB 5B31G 5AY8B 3V9RA 3MGQD 3W96D 3H0RC 3V9RB 2JCHA 1U35D 1A7WA 2ZY5A 5E5AA 1S32D 3AV1D 3B0CT 4XZQD 4UUZA 5E5AB 3UT9C 5DNMC 5CPIC 4UUZB 5GT0A 3REHA 3KSYA 3O62B 4UPKA 3W98D 4LD9A 3AZFA 3VH5A 1H3OA 5AV8C 1P3OC 5GT0B 3REHB 3FDDA 4LD9B 5B2JA 5B33D 3VH6T 1P3BD 1H3OB 5G49A 3A6NA 5AV6D 4QLCA 3X1SC 5G49B 3MGSD 5B1LC 1HQ3D 3A6NB 1TAFA 4QLCB 1ZLAD 3B0DB 3LELC 1BH9A 2XD1A 4R8PC 3X1UD 1JFIB 3H0MC 1BH9B 4J8UC 4NE3A 5AV5C 5JRGA 1F66D 5GT3D 4G92C 1P3LD 5JRGB 3AN2C 5BS7A 3WTPB 5B2IC 5BT1C 3REJC 5AVBC 1EQZD 3B6GA 3AZLC 3LZ1D 5GXQD 4NE6A 3B6GB 2W8SA 3NQUA 4KGCA 4YS3C 1P3FA 5B32C 3X1VA 3LZ0A 5B31D 2Y2HA 4KGCB 3NQUB 3W97C 5CPKA 3F6TA 3AZKC 3RELB 4KHAA 3X1VB 3LZ0B 3C1BD 2PYOC 4X23D 5CPKB 4H9SA 3AZGC 4KHAB 2HIOC 3O62D 3EPLA 3W99A 2YFWA 3KUYC 4KUDC 3C1CA 3W99B 1P3GA 3LJAA 2YFWB 4WU9D 5B32G 5B24C 3WAAD 1P3GB 3LJAB 2F8NG 4NFTA 3MGQC 2Y2PA 3UTBC 4NE5A 4YM6A 2F8NA 1N1JA 2NQBA 4YM6B 2F8NB 1N1JB 2G5HC 5DNMD 2NQBB 5GSUA 5CPID 1KX3C 4AWLB 1M1AC 4Z66C 1KX4C 5CP6A 2F2AC 5AV8D 5GSUB 1P3OD 3WTPD 3AZEC 5CP6B 3B0CW 3MNNA 4J8XA 1KX5A 2L5AA 2ZY2A 4HGAB 1ID3C 2UWXA 4DQYB 3MNNB 4J8XB 1KX5B 3X1SD 5B1LD 5BNXA 1HQ3C 3AV2C 1P3KA 4XUJC 3LELD 3MVDA 5BNXB 1P3KB 4R8PD 1M19A 5AVCC 3RELD 5AV5D 3MVDB 2DF4C 1M19B 4JJNA 5B1MA 3AN2D 2AROA 5B2ID 4JJNB 3MGPA 5BT1D 5B1MB 4DRAA 3REJD 5AVBD 3MGPB 3UTAC 5AY8C 3AZLD 5B40A 4ZUXA 5CPJB 4WU8A 2CWEA 3AYWA 4ZUXB 5B32D 4WU8B 3WKJA 3W97D 3AYWB 3AZKD 5F99A 2Y2GA 3AZHA 2YFVA 5E5AC 1P3IA 2PYOD 3WKJB 3AZGD 5F99B 1P3IB 3AZHB 2YFVB 3O62C 5BO0A 5C3IB 5B0YA 3KUYD 5GT0C 3REHC 4KUDD 1ULYA 4WV4B 4LD9C 3X1TB 5BO0B 5B0YB 5B24D 2NZDA 3KXBA 3AFAA 5CHLB 2NZDB 3UTBD 3A6NC 3KXBB 3AFAB 5KDMA 4QLCC 1PZRA 3B0DC 3REKA 2ZM5A 5KDMB 3REKB 1KX3D 1M1AD 4Z66D 1KX4D 5B0ZA 1R4VA 5JRGC 2FJ7A 1B67A 3AZED 3WTPC 3AZFB 3MGRA 2FJ7B 1ID3D 5BS7C 5B2JB 3VH5T 3MGRB 5CPJD 3P5JB 4H9PA 3AV2D 3B6GC 4H9RA 4XUJD 1F1EA 4Z2MH 1T3UA 1BFMA 2J8PA 4KGCC 5AVCD 1TAFB 4H9RB 3RELC 4WNNA 3X1VC 3LZ0C 5CPKC 4WNNB 1B6WA 4H9SC 3A1KA 3EPHA 3W99C 2Y2NA 3NQJA 3UTAD 3H0LC 5AY8D 2ZY4A 3B0BA 3LJAC 3NQJB 1P3GC 3UT9A 3TU4A 1P3FB 4YM6C 5E5AD 1P3PA 2NQBC 4G91B 1WWSA 3R45A 3TU4B 4AWLC 1P3PB 1W2EA 2IO5B 5GSUC 5JA4A 5AV9A 2Y2QA 5GT0D 3REHD 3REIA 4LD9D 5CP6C 4H9OA 3AZFD 4Z5TA 5JA4B 5AV9B 3REIB 4HGAC 5B2JD 3MNNC 3C1CB 4Z5TB 4J8XC 1KX5C 2CV5A 3A6ND 4J8VA 2BYKA 4M6BA 4QLCD 2CV5B 4J8VB 4J8UA 2BYKB 1P3KC 3KFUG 2JE5A 1AOIA 3MVDC 1M19C 1AOIB 5JRGD 4JJNC 1P3MA 5B1MC 3AZJA 3AZNA 5DNNA 2Y2KA 3AZMA 3MGPC 1M18A 3B6FA 1P3MB 4YS3A 3AZJB 3AZNB 5DNNB 5CPJC 3AZMB 1P34A 1P3AA 1M18B 3B6FB 3B6GD 4ZUXC 1P3AB 1P34B 4WU8C 3VH6W 4KGCD 1P3FD 4J8WA 3AYWC 4E45A 3X1VD 2HIOA 3LZ0D 3AZIA 3WKJC 1TZYA 3KWQA 4J8WB 5CPKD 5F99C 1P3IC 3AZHC 3AZIB 1TZYB 3WA9A 4E44A 5C3IC 3KWQB 3W99D 2G5IC 3X1TC 3WA9B 2AROB 5B0YC 3MGQA 2ZY3A 3W96A 3C1CD 1P3GD 3LJAD 1U35A 2NZDC 1S32A 3AV1A 1BH8A 4XZQA 3KXBC 5B40B 3AFAC 4ZBJB 3W96B 1U35B 4EO5B 1S32B 3AV1B 1BH8B 2RVQC 2FFFB 4XZQB 4YM6D 5FUGA 2F8ND 3AL0C 3REKC 2NQBD 3W98A 5FUGB 2Y2OA 5GSUD 5B33A 3W98B 1P3BA 3IP4C 5CP6D 5B33B 1Q9CA 3AZFC 5AV6A 1P3BB 2FJ7C 3MGSA 3MNND 4H9NA 1HQ3A 5B2JC 4J8XD 1KX5D 5AV6B 3MGRC 1ZLAA 3MGSB 3X1UA 1ZLAB 1P3KD 3X1UB 1F66A 5GT3A 1P3LA 3MVDD 2HUEB 1M19D 1F66B 5GT3B 1P3LB 2F8NH 4JJND 1EQZA 5B0ZB 5B1MD 3LZ1A 3EPJA 5GXQA 3MGPD 1EQZB 4H9QA 3LZ1B 5GXQB 4CAYA 5B31A 4H9QB 5B40D 4ZUXD 4WU8D 4CAYB 2BG1A 2RIQA 4H9PB 5B31B 3C1BA 4X23A 3AYWD 1P3FC 3O62A 3WKJD 3C1BB 3VH6A 4X23B 4G91C 3WTPE 5F99D 3TU4C 3AZHD 1P3ID 1P3PC 2IO5C 4WU9A 1HTAA 3WAAA 3X1TD 5B0YD 5AV9C 3REIC 4WU9B 3WAAB 3C1CC 4Z5TC 3EPKA 4WZSB 2NZDD 3KXBD 3AFAD 1JFIA 2CV5C 2RVQD 5DNMA 4J8VC 5CPIA 3REKD 3UT9B 5DNMB 5AV8A 5CPIB 1P3OA 1AOIC 3WTPA 5AV8B 1P3OB 3R45B 5B0ZD 2Y2LA 2FJ7D 3X1SA 5B1LA 4H9OB 1P3MC 3MGRD 3X1SB 3AZJC 3AZNC 5DNNC 5B1LB 3LELA 3AZMC 1M18C 3B6FC 4R8PA 3A1IA 3RELA 3LELB 1P3AC 1P34C 5AV5A 4R8PB 4J8UB 5AV5B 4J8WC 3AN2A 4G92B 5B2IA 3AZIC 1TZYC 3KWQC 3AN2B 5B2IB 3REJA 5AVBA 5BNVA 3AZLA 3WA9C 2AROC 3REJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVB B;  5BNV B;  3AZL B;  5B32 A;  3W96 C;  3W97 A;  5B40 C;  4ZBJ C;  4YS3 B;  3AZK A;  5B32 B;  1U35 C;  4EO5 C;  2F8N K;  2PYO A;  1S32 C;  3AV1 C;  4XZQ C;  3W97 B;  3AZK B;  3AZG A;  3UT9 D;  2PYO B;  3VH5 W;  3TU4 D;  3KUY A;  1P3P D;  3AZG B;  4KUD A;  2HIO B;  4Z2M G;  3W98 C;  1KU5 A;  3KUY B;  4KUD B;  5B24 A;  2BYM A;  5B33 C;  1P3B C;  5AV9 D;  3REI D;  5B24 B;  3UTB A;  2BYM B;  4Z5T D;  5AV6 C;  3MGS C;  3MGQ B;  3UTB B;  2CV5 D;  1ZLA C;  4J8V D;  2JSS A;  1KX3 A;  3X1U C;  1M1A A;  4Z66 A;  1KX4 A;  4J8U D;  1KX3 B;  2HUE C;  1AOI D;  1M1A B;  1F66 C;  4Z66 B;  3AZE A;  5GT3 C;  1KX4 B;  2LY8 A;  1P3L C;  1ID3 A;  3AZE B;  5B0Z C;  1ID3 B;  5CPJ A;  1P3M D;  3AV2 A;  1EQZ C;  3AZJ D;  3AZN D;  4XUJ A;  5DNN D;  4DRB A;  3LZ1 C;  3AZM D;  5GXQ C;  1M18 D;  3B6F D;  4H9N B;  1HQ3 B;  3AV2 B;  4YS3 D;  5AVC A;  4XUJ B;  1P3A D;  1P34 D;  5B31 C;  5AVC B;  3C1B C;  4J8W D;  4X23 C;  2HIO D;  3AZI D;  1TZY D;  3X1T A;  3KWQ D;  3UTA A;  1WWI A;  5AY8 A;  4CSR A;  3WA9 D;  2ARO D;  4WU9 C;  3UTA B;  3WAA C;  4CSR B;  5B31 G;  5AY8 B;  3V9R A;  3MGQ D;  3W96 D;  3V9R B;  1U35 D;  1A7W A;  5E5A A;  1S32 D;  3AV1 D;  3B0C T;  4XZQ D;  4UUZ A;  5E5A B;  3UT9 C;  5DNM C;  5CPI C;  4UUZ B;  5GT0 A;  3REH A;  3KSY A;  3O62 B;  4LD9 A;  3W98 D;  3AZF A;  3VH5 A;  1H3O A;  5AV8 C;  1P3O C;  5GT0 B;  3REH B;  4LD9 B;  5B2J A;  5B33 D;  3VH6 T;  1P3B D;  1H3O B;  5G49 A;  3A6N A;  5AV6 D;  4QLC A;  3X1S C;  5G49 B;  3MGS D;  5B1L C;  1HQ3 D;  3A6N B;  1TAF A;  4QLC B;  1ZLA D;  3B0D B;  3LEL C;  1BH9 A;  4R8P C;  3X1U D;  1JFI B;  1BH9 B;  4J8U C;  4NE3 A;  5AV5 C;  5JRG A;  1F66 D;  5GT3 D;  4G92 C;  1P3L D;  5JRG B;  3AN2 C;  5BS7 A;  3WTP B;  5B2I C;  5BT1 C;  3REJ C;  5AVB C;  1EQZ D;  3B6G A;  3AZL C;  3LZ1 D;  5GXQ D;  4NE6 A;  3B6G B;  4KGC A;  3NQU A;  4YS3 C;  1P3F A;  5B32 C;  3X1V A;  3LZ0 A;  5B31 D;  4KGC B;  3NQU B;  3W97 C;  5CPK A;  3AZK C;  3REL B;  4KHA A;  3X1V B;  3LZ0 B;  3C1B D;  2PYO C;  4X23 D;  5CPK B;  4H9S A;  3AZG C;  4KHA B;  2HIO C;  3O62 D;  3W99 A;  2YFW A;  3KUY C;  4KUD C;  3C1C A;  3W99 B;  1P3G A;  3LJA A;  2YFW B;  4WU9 D;  5B32 G;  5B24 C;  3WAA D;  1P3G B;  3LJA B;  2F8N G;  4NFT A;  3MGQ C;  3UTB C;  4NE5 A;  4YM6 A;  2F8N A;  1N1J A;  2NQB A;  4YM6 B;  2F8N B;  1N1J B;  5DNM D;  2NQB B;  5GSU A;  5CPI D;  1KX3 C;  4AWL B;  1M1A C;  4Z66 C;  1KX4 C;  5CP6 A;  5AV8 D;  5GSU B;  1P3O D;  3WTP D;  3AZE C;  5CP6 B;  3B0C W;  3MNN A;  4J8X A;  1KX5 A;  2L5A A;  1ID3 C;  4HGA B;  3MNN B;  4J8X B;  1KX5 B;  3X1S D;  5B1L D;  5BNX A;  1HQ3 C;  3AV2 C;  1P3K A;  4XUJ C;  3LEL D;  3MVD A;  5BNX B;  1P3K B;  4R8P D;  1M19 A;  5AVC C;  3REL D;  5AV5 D;  3MVD B;  1M19 B;  4JJN A;  5B1M A;  3AN2 D;  2ARO A;  5B2I D;  4JJN B;  3MGP A;  5BT1 D;  5B1M B;  4DRA A;  3REJ D;  5AVB D;  3MGP B;  3UTA C;  5AY8 C;  3AZL D;  5B40 A;  4ZUX A;  5CPJ B;  4WU8 A;  2CWE A;  3AYW A;  4ZUX B;  5B32 D;  4WU8 B;  3WKJ A;  3W97 D;  3AYW B;  3AZK D;  5F99 A;  1P3I A;  3AZH A;  2YFV A;  5E5A C;  2PYO D;  3WKJ B;  3AZG D;  5F99 B;  1P3I B;  3AZH B;  2YFV B;  3O62 C;  5BO0 A;  5C3I B;  5B0Y A;  3KUY D;  5GT0 C;  3REH C;  4KUD D;  1ULY A;  4WV4 B;  4LD9 C;  3X1T B;  5BO0 B;  5B0Y B;  5B24 D;  2NZD A;  3KXB A;  3AFA A;  5CHL B;  2NZD B;  3UTB D;  3A6N C;  3KXB B;  3AFA B;  5KDM A;  4QLC C;  3B0D C;  3REK A;  5KDM B;  3REK B;  1KX3 D;  1M1A D;  4Z66 D;  1KX4 D;  5B0Z A;  1R4V A;  5JRG C;  2FJ7 A;  1B67 A;  3AZE D;  3WTP C;  3AZF B;  3MGR A;  2FJ7 B;  1ID3 D;  5BS7 C;  5B2J B;  3VH5 T;  3MGR B;  5CPJ D;  3AV2 D;  4H9P A;  3B6G C;  4H9R A;  4XUJ D;  1F1E A;  4Z2M H;  1BFM A;  4KGC C;  5AVC D;  4H9R B;  1TAF B;  3REL C;  4WNN A;  3X1V C;  3LZ0 C;  5CPK C;  4WNN B;  1B6W A;  4H9S C;  3W99 C;  3NQJ A;  3UTA D;  5AY8 D;  3B0B A;  3LJA C;  3NQJ B;  1P3G C;  3UT9 A;  3TU4 A;  1P3F B;  4YM6 C;  5E5A D;  1P3P A;  2NQB C;  4G91 B;  1WWS A;  3R45 A;  3TU4 B;  4AWL C;  1P3P B;  2IO5 B;  5GSU C;  5JA4 A;  5AV9 A;  5GT0 D;  3REH D;  3REI A;  4LD9 D;  5CP6 C;  4H9O A;  3AZF D;  4Z5T A;  5JA4 B;  5AV9 B;  3REI B;  4HGA C;  5B2J D;  3MNN C;  3C1C B;  4Z5T B;  4J8X C;  1KX5 C;  2CV5 A;  3A6N D;  4J8V A;  2BYK A;  4M6B A;  4QLC D;  2CV5 B;  4J8V B;  4J8U A;  2BYK B;  1P3K C;  1AOI A;  3MVD C;  1M19 C;  1AOI B;  5JRG D;  4JJN C;  1P3M A;  5B1M C;  3AZJ A;  3AZN A;  5DNN A;  3AZM A;  3MGP C;  1M18 A;  3B6F A;  1P3M B;  4YS3 A;  3AZJ B;  3AZN B;  5DNN B;  5CPJ C;  3AZM B;  1P34 A;  1P3A A;  1M18 B;  3B6F B;  3B6G D;  4ZUX C;  1P3A B;  1P34 B;  4WU8 C;  3VH6 W;  4KGC D;  1P3F D;  4J8W A;  3AYW C;  4E45 A;  3X1V D;  2HIO A;  3LZ0 D;  3AZI A;  3WKJ C;  1TZY A;  3KWQ A;  4J8W B;  5CPK D;  5F99 C;  1P3I C;  3AZH C;  3AZI B;  1TZY B;  3WA9 A;  4E44 A;  5C3I C;  3KWQ B;  3W99 D;  3WA9 B;  3X1T C;  2ARO B;  5B0Y C;  3MGQ A;  3W96 A;  3C1C D;  1P3G D;  3LJA D;  1U35 A;  2NZD C;  1S32 A;  3AV1 A;  1BH8 A;  4XZQ A;  3KXB C;  5B40 B;  3AFA C;  4ZBJ B;  3W96 B;  1U35 B;  4EO5 B;  1S32 B;  3AV1 B;  1BH8 B;  2RVQ C;  4XZQ B;  4YM6 D;  5FUG A;  2F8N D;  3REK C;  2NQB D;  3W98 A;  5FUG B;  5GSU D;  5B33 A;  3W98 B;  1P3B A;  5CP6 D;  5B33 B;  1Q9C A;  3AZF C;  5AV6 A;  1P3B B;  2FJ7 C;  3MGS A;  3MNN D;  4H9N A;  1HQ3 A;  5B2J C;  4J8X D;  1KX5 D;  5AV6 B;  3MGR C;  1ZLA A;  3MGS B;  3X1U A;  1ZLA B;  1P3K D;  3X1U B;  1F66 A;  5GT3 A;  1P3L A;  3MVD D;  2HUE B;  1M19 D;  1F66 B;  5GT3 B;  1P3L B;  2F8N H;  4JJN D;  1EQZ A;  5B0Z B;  5B1M D;  3LZ1 A;  5GXQ A;  3MGP D;  1EQZ B;  4H9Q A;  3LZ1 B;  5GXQ B;  4CAY A;  5B31 A;  4H9Q B;  5B40 D;  4ZUX D;  4WU8 D;  4CAY B;  4H9P B;  5B31 B;  3C1B A;  4X23 A;  3AYW D;  1P3F C;  3O62 A;  3WKJ D;  3C1B B;  3VH6 A;  4X23 B;  4G91 C;  3WTP E;  5F99 D;  3TU4 C;  3AZH D;  1P3I D;  1P3P C;  2IO5 C;  4WU9 A;  1HTA A;  3WAA A;  3X1T D;  5B0Y D;  5AV9 C;  3REI C;  4WU9 B;  3WAA B;  3C1C C;  4Z5T C;  4WZS B;  2NZD D;  3KXB D;  3AFA D;  1JFI A;  2CV5 C;  2RVQ D;  5DNM A;  4J8V C;  5CPI A;  3REK D;  3UT9 B;  5DNM B;  5AV8 A;  5CPI B;  1P3O A;  1AOI C;  3WTP A;  5AV8 B;  1P3O B;  3R45 B;  5B0Z D;  2FJ7 D;  3X1S A;  5B1L A;  4H9O B;  1P3M C;  3MGR D;  3X1S B;  3AZJ C;  3AZN C;  5DNN C;  5B1L B;  3LEL A;  3AZM C;  1M18 C;  3B6F C;  4R8P A;  3REL A;  3LEL B;  1P3A C;  1P34 C;  5AV5 A;  4R8P B;  4J8U B;  5AV5 B;  4J8W C;  3AN2 A;  4G92 B;  5B2I A;  3AZI C;  1TZY C;  3KWQ C;  3AN2 B;  5B2I B;  3REJ A;  5AVB A;  5BNV A;  3AZL A;  3WA9 C;  2ARO C;  3REJ B; 
#chains in the Genus database with same CATH topology
 5AVB B;  5BNV B;  3AZL B;  5B32 A;  3W96 C;  3W97 A;  5B40 C;  4ZBJ C;  4YS3 B;  3AZK A;  5B32 B;  1U35 C;  4EO5 C;  2F8N K;  2PYO A;  1S32 C;  3AV1 C;  4XZQ C;  3W97 B;  3AZK B;  3AZG A;  3UT9 D;  2PYO B;  2VQR A;  3VH5 W;  3TU4 D;  3KUY A;  1P3P D;  3AZG B;  4KUD A;  2HIO B;  4Z2M G;  3W98 C;  1KU5 A;  3KUY B;  4KUD B;  5B24 A;  2BYM A;  5B33 C;  1P3B C;  5AV9 D;  3REI D;  5B24 B;  3UTB A;  2BYM B;  4Z5T D;  5AV6 C;  3MGS C;  3MGQ B;  3UTB B;  2CV5 D;  1ZLA C;  1Z2C B;  2Y2J A;  4J8V D;  2JSS A;  1KX3 A;  3X1U C;  1M1A A;  4Z66 A;  1KX4 A;  4J8U D;  1KX3 B;  2HUE C;  1AOI D;  1M1A B;  1F66 C;  4Z66 B;  3AZE A;  5GT3 C;  1KX4 B;  2LY8 A;  1P3L C;  1ID3 A;  3AZE B;  5B0Z C;  1ID3 B;  5CPJ A;  1P3M D;  3AV2 A;  1EQZ C;  3AZJ D;  3AZN D;  4XUJ A;  5DNN D;  3EG5 B;  2Y2I A;  4DRB A;  3LZ1 C;  5GXQ C;  3AZM D;  1M18 D;  2Y2M A;  4H9N B;  1HQ3 B;  2XD5 A;  4YS3 D;  3AV2 B;  3B6F D;  5AVC A;  4XUJ B;  1P3A D;  2DQN C;  1P34 D;  5B31 C;  5AVC B;  3C1B C;  4J8W D;  4X23 C;  2HIO D;  3AZI D;  1TZY D;  3X1T A;  4WJ3 C;  3KWQ D;  3UTA A;  1WWI A;  5AY8 A;  4CSR A;  3WA9 D;  2ARO D;  4WU9 C;  3UTA B;  3WAA C;  4CSR B;  5B31 G;  5AY8 B;  3V9R A;  3MGQ D;  3W96 D;  3H0R C;  3V9R B;  2JCH A;  1U35 D;  1A7W A;  2ZY5 A;  5E5A A;  1S32 D;  3AV1 D;  3B0C T;  4XZQ D;  4UUZ A;  5E5A B;  3UT9 C;  5DNM C;  5CPI C;  4UUZ B;  5GT0 A;  3REH A;  3KSY A;  3O62 B;  4UPK A;  3W98 D;  4LD9 A;  3AZF A;  3VH5 A;  1H3O A;  5AV8 C;  1P3O C;  5GT0 B;  3REH B;  3FDD A;  4LD9 B;  5B2J A;  5B33 D;  3VH6 T;  1P3B D;  1H3O B;  5G49 A;  3A6N A;  5AV6 D;  4QLC A;  3X1S C;  5G49 B;  3MGS D;  5B1L C;  1HQ3 D;  3A6N B;  1TAF A;  4QLC B;  1ZLA D;  3B0D B;  3LEL C;  1BH9 A;  2XD1 A;  4R8P C;  3X1U D;  1JFI B;  3H0M C;  1BH9 B;  4J8U C;  4NE3 A;  5AV5 C;  5JRG A;  1F66 D;  5GT3 D;  4G92 C;  1P3L D;  5JRG B;  3AN2 C;  5BS7 A;  3WTP B;  5B2I C;  5BT1 C;  3REJ C;  5AVB C;  1EQZ D;  3B6G A;  3AZL C;  3LZ1 D;  5GXQ D;  4NE6 A;  3B6G B;  2W8S A;  3NQU A;  4KGC A;  4YS3 C;  1P3F A;  5B32 C;  3X1V A;  3LZ0 A;  5B31 D;  2Y2H A;  4KGC B;  3NQU B;  3W97 C;  5CPK A;  3F6T A;  3AZK C;  3REL B;  4KHA A;  3X1V B;  3LZ0 B;  3C1B D;  2PYO C;  4X23 D;  5CPK B;  4H9S A;  3AZG C;  4KHA B;  2HIO C;  3O62 D;  3EPL A;  3W99 A;  2YFW A;  3KUY C;  4KUD C;  3C1C A;  3W99 B;  1P3G A;  3LJA A;  2YFW B;  4WU9 D;  5B32 G;  5B24 C;  3WAA D;  1P3G B;  3LJA B;  2F8N G;  4NFT A;  3MGQ C;  2Y2P A;  3UTB C;  4NE5 A;  4YM6 A;  2F8N A;  1N1J A;  2NQB A;  4YM6 B;  2F8N B;  1N1J B;  2G5H C;  5DNM D;  2NQB B;  5GSU A;  5CPI D;  1KX3 C;  4AWL B;  1M1A C;  4Z66 C;  1KX4 C;  5CP6 A;  2F2A C;  5AV8 D;  5GSU B;  1P3O D;  3WTP D;  3AZE C;  5CP6 B;  3B0C W;  3MNN A;  4J8X A;  1KX5 A;  2L5A A;  2ZY2 A;  4HGA B;  1ID3 C;  2UWX A;  4DQY B;  3MNN B;  4J8X B;  1KX5 B;  3X1S D;  5B1L D;  5BNX A;  1HQ3 C;  3AV2 C;  1P3K A;  4XUJ C;  3LEL D;  3MVD A;  5BNX B;  1P3K B;  4R8P D;  1M19 A;  5AVC C;  3REL D;  5AV5 D;  3MVD B;  2DF4 C;  1M19 B;  4JJN A;  5B1M A;  3AN2 D;  2ARO A;  5B2I D;  4JJN B;  3MGP A;  5BT1 D;  5B1M B;  4DRA A;  3REJ D;  5AVB D;  3MGP B;  3UTA C;  5AY8 C;  3AZL D;  5B40 A;  4ZUX A;  5CPJ B;  4WU8 A;  2CWE A;  3AYW A;  4ZUX B;  5B32 D;  4WU8 B;  3WKJ A;  3W97 D;  3AYW B;  3AZK D;  5F99 A;  2Y2G A;  3AZH A;  2YFV A;  5E5A C;  1P3I A;  2PYO D;  3WKJ B;  3AZG D;  5F99 B;  1P3I B;  3AZH B;  2YFV B;  3O62 C;  5BO0 A;  5C3I B;  5B0Y A;  3KUY D;  5GT0 C;  3REH C;  4KUD D;  1ULY A;  4WV4 B;  4LD9 C;  3X1T B;  5BO0 B;  5B0Y B;  5B24 D;  2NZD A;  3KXB A;  3AFA A;  5CHL B;  2NZD B;  3UTB D;  3A6N C;  3KXB B;  3AFA B;  5KDM A;  4QLC C;  1PZR A;  3B0D C;  3REK A;  2ZM5 A;  5KDM B;  3REK B;  1KX3 D;  1M1A D;  4Z66 D;  1KX4 D;  5B0Z A;  1R4V A;  5JRG C;  2FJ7 A;  1B67 A;  3AZE D;  3WTP C;  3AZF B;  3MGR A;  2FJ7 B;  1ID3 D;  5BS7 C;  5B2J B;  3VH5 T;  3MGR B;  5CPJ D;  3P5J B;  4H9P A;  3AV2 D;  3B6G C;  4H9R A;  4XUJ D;  1F1E A;  4Z2M H;  1T3U A;  1BFM A;  2J8P A;  4KGC C;  5AVC D;  1TAF B;  4H9R B;  3REL C;  4WNN A;  3X1V C;  3LZ0 C;  5CPK C;  4WNN B;  1B6W A;  4H9S C;  3A1K A;  3EPH A;  3W99 C;  2Y2N A;  3NQJ A;  3UTA D;  3H0L C;  5AY8 D;  2ZY4 A;  3B0B A;  3LJA C;  3NQJ B;  1P3G C;  3UT9 A;  3TU4 A;  1P3F B;  4YM6 C;  5E5A D;  1P3P A;  2NQB C;  4G91 B;  1WWS A;  3R45 A;  3TU4 B;  4AWL C;  1P3P B;  1W2E A;  2IO5 B;  5GSU C;  5JA4 A;  5AV9 A;  2Y2Q A;  5GT0 D;  3REH D;  3REI A;  4LD9 D;  5CP6 C;  4H9O A;  3AZF D;  4Z5T A;  5JA4 B;  5AV9 B;  3REI B;  4HGA C;  5B2J D;  3MNN C;  3C1C B;  4Z5T B;  4J8X C;  1KX5 C;  2CV5 A;  3A6N D;  4J8V A;  2BYK A;  4M6B A;  4QLC D;  2CV5 B;  4J8V B;  4J8U A;  2BYK B;  1P3K C;  3KFU G;  2JE5 A;  1AOI A;  3MVD C;  1M19 C;  1AOI B;  5JRG D;  4JJN C;  1P3M A;  5B1M C;  3AZJ A;  3AZN A;  5DNN A;  2Y2K A;  3AZM A;  3MGP C;  1M18 A;  3B6F A;  1P3M B;  4YS3 A;  3AZJ B;  3AZN B;  5DNN B;  5CPJ C;  3AZM B;  1P34 A;  1P3A A;  1M18 B;  3B6F B;  3B6G D;  4ZUX C;  1P3A B;  1P34 B;  4WU8 C;  3VH6 W;  4KGC D;  1P3F D;  4J8W A;  3AYW C;  4E45 A;  3X1V D;  2HIO A;  3LZ0 D;  3AZI A;  3WKJ C;  1TZY A;  3KWQ A;  4J8W B;  5CPK D;  5F99 C;  1P3I C;  3AZH C;  3AZI B;  1TZY B;  3WA9 A;  4E44 A;  5C3I C;  3KWQ B;  3W99 D;  2G5I C;  3X1T C;  3WA9 B;  2ARO B;  5B0Y C;  3MGQ A;  2ZY3 A;  3W96 A;  3C1C D;  1P3G D;  3LJA D;  1U35 A;  2NZD C;  1S32 A;  3AV1 A;  1BH8 A;  4XZQ A;  3KXB C;  5B40 B;  3AFA C;  4ZBJ B;  3W96 B;  1U35 B;  4EO5 B;  1S32 B;  3AV1 B;  1BH8 B;  2RVQ C;  2FFF B;  4XZQ B;  4YM6 D;  5FUG A;  2F8N D;  3AL0 C;  3REK C;  2NQB D;  3W98 A;  5FUG B;  2Y2O A;  5GSU D;  5B33 A;  3W98 B;  1P3B A;  3IP4 C;  5CP6 D;  5B33 B;  1Q9C A;  3AZF C;  5AV6 A;  1P3B B;  2FJ7 C;  3MGS A;  3MNN D;  4H9N A;  1HQ3 A;  5B2J C;  4J8X D;  1KX5 D;  5AV6 B;  3MGR C;  1ZLA A;  3MGS B;  3X1U A;  1ZLA B;  1P3K D;  3X1U B;  1F66 A;  5GT3 A;  1P3L A;  3MVD D;  2HUE B;  1M19 D;  1F66 B;  5GT3 B;  1P3L B;  2F8N H;  4JJN D;  1EQZ A;  5B0Z B;  5B1M D;  3LZ1 A;  3EPJ A;  5GXQ A;  3MGP D;  1EQZ B;  4H9Q A;  3LZ1 B;  5GXQ B;  4CAY A;  5B31 A;  4H9Q B;  5B40 D;  4ZUX D;  4WU8 D;  4CAY B;  2BG1 A;  2RIQ A;  4H9P B;  5B31 B;  3C1B A;  4X23 A;  3AYW D;  1P3F C;  3O62 A;  3WKJ D;  3C1B B;  3VH6 A;  4X23 B;  4G91 C;  3WTP E;  5F99 D;  3TU4 C;  3AZH D;  1P3I D;  1P3P C;  2IO5 C;  4WU9 A;  1HTA A;  3WAA A;  3X1T D;  5B0Y D;  5AV9 C;  3REI C;  4WU9 B;  3WAA B;  3C1C C;  4Z5T C;  3EPK A;  4WZS B;  2NZD D;  3KXB D;  3AFA D;  1JFI A;  2CV5 C;  2RVQ D;  5DNM A;  4J8V C;  5CPI A;  3REK D;  3UT9 B;  5DNM B;  5AV8 A;  5CPI B;  1P3O A;  1AOI C;  3WTP A;  5AV8 B;  1P3O B;  3R45 B;  5B0Z D;  2Y2L A;  2FJ7 D;  3X1S A;  5B1L A;  4H9O B;  1P3M C;  3MGR D;  3X1S B;  3AZJ C;  3AZN C;  5DNN C;  5B1L B;  3LEL A;  3AZM C;  1M18 C;  3B6F C;  4R8P A;  3A1I A;  3REL A;  3LEL B;  1P3A C;  1P34 C;  5AV5 A;  4R8P B;  4J8U B;  5AV5 B;  4J8W C;  3AN2 A;  4G92 B;  5B2I A;  3AZI C;  1TZY C;  3KWQ C;  3AN2 B;  5B2I B;  3REJ A;  5AVB A;  5BNV A;  3AZL A;  3WA9 C;  2ARO C;  3REJ B; 
#chains in the Genus database with same CATH homology
 5AVB B;  5BNV B;  3AZL B;  5B32 A;  3W96 C;  3W97 A;  5B40 C;  4ZBJ C;  4YS3 B;  3AZK A;  5B32 B;  1U35 C;  4EO5 C;  2F8N K;  2PYO A;  1S32 C;  3AV1 C;  4XZQ C;  3W97 B;  3AZK B;  3AZG A;  3UT9 D;  2PYO B;  2VQR A;  3VH5 W;  3TU4 D;  3KUY A;  1P3P D;  3AZG B;  4KUD A;  2HIO B;  4Z2M G;  3W98 C;  1KU5 A;  3KUY B;  4KUD B;  5B24 A;  2BYM A;  5B33 C;  1P3B C;  5AV9 D;  3REI D;  5B24 B;  3UTB A;  2BYM B;  4Z5T D;  5AV6 C;  3MGS C;  3MGQ B;  3UTB B;  2CV5 D;  1ZLA C;  1Z2C B;  2Y2J A;  4J8V D;  2JSS A;  1KX3 A;  3X1U C;  1M1A A;  4Z66 A;  1KX4 A;  4J8U D;  1KX3 B;  2HUE C;  1AOI D;  1M1A B;  1F66 C;  4Z66 B;  3AZE A;  5GT3 C;  1KX4 B;  2LY8 A;  1P3L C;  1ID3 A;  3AZE B;  5B0Z C;  1ID3 B;  5CPJ A;  1P3M D;  3AV2 A;  1EQZ C;  3AZJ D;  3AZN D;  4XUJ A;  5DNN D;  3EG5 B;  2Y2I A;  4DRB A;  3LZ1 C;  5GXQ C;  3AZM D;  1M18 D;  2Y2M A;  4H9N B;  1HQ3 B;  2XD5 A;  4YS3 D;  3AV2 B;  3B6F D;  5AVC A;  4XUJ B;  1P3A D;  2DQN C;  1P34 D;  5B31 C;  5AVC B;  3C1B C;  4J8W D;  4X23 C;  2HIO D;  3AZI D;  1TZY D;  3X1T A;  4WJ3 C;  3KWQ D;  3UTA A;  1WWI A;  5AY8 A;  4CSR A;  3WA9 D;  2ARO D;  4WU9 C;  3UTA B;  3WAA C;  4CSR B;  5B31 G;  5AY8 B;  3V9R A;  3MGQ D;  3W96 D;  3H0R C;  3V9R B;  2JCH A;  1U35 D;  1A7W A;  2ZY5 A;  5E5A A;  1S32 D;  3AV1 D;  3B0C T;  4XZQ D;  4UUZ A;  5E5A B;  3UT9 C;  5DNM C;  5CPI C;  4UUZ B;  5GT0 A;  3REH A;  3KSY A;  3O62 B;  4UPK A;  3W98 D;  4LD9 A;  3AZF A;  3VH5 A;  1H3O A;  5AV8 C;  1P3O C;  5GT0 B;  3REH B;  3FDD A;  4LD9 B;  5B2J A;  5B33 D;  3VH6 T;  1P3B D;  1H3O B;  5G49 A;  3A6N A;  5AV6 D;  4QLC A;  3X1S C;  5G49 B;  3MGS D;  5B1L C;  1HQ3 D;  3A6N B;  1TAF A;  4QLC B;  1ZLA D;  3B0D B;  3LEL C;  1BH9 A;  2XD1 A;  4R8P C;  3X1U D;  1JFI B;  3H0M C;  1BH9 B;  4J8U C;  4NE3 A;  5AV5 C;  5JRG A;  1F66 D;  5GT3 D;  4G92 C;  1P3L D;  5JRG B;  3AN2 C;  5BS7 A;  3WTP B;  5B2I C;  5BT1 C;  3REJ C;  5AVB C;  1EQZ D;  3B6G A;  3AZL C;  3LZ1 D;  5GXQ D;  4NE6 A;  3B6G B;  2W8S A;  3NQU A;  4KGC A;  4YS3 C;  1P3F A;  5B32 C;  3X1V A;  3LZ0 A;  5B31 D;  2Y2H A;  4KGC B;  3NQU B;  3W97 C;  5CPK A;  3F6T A;  3AZK C;  3REL B;  4KHA A;  3X1V B;  3LZ0 B;  3C1B D;  2PYO C;  4X23 D;  5CPK B;  4H9S A;  3AZG C;  4KHA B;  2HIO C;  3O62 D;  3EPL A;  3W99 A;  2YFW A;  3KUY C;  4KUD C;  3C1C A;  3W99 B;  1P3G A;  3LJA A;  2YFW B;  4WU9 D;  5B32 G;  5B24 C;  3WAA D;  1P3G B;  3LJA B;  2F8N G;  4NFT A;  3MGQ C;  2Y2P A;  3UTB C;  4NE5 A;  4YM6 A;  2F8N A;  1N1J A;  2NQB A;  4YM6 B;  2F8N B;  1N1J B;  2G5H C;  5DNM D;  2NQB B;  5GSU A;  5CPI D;  1KX3 C;  4AWL B;  1M1A C;  4Z66 C;  1KX4 C;  5CP6 A;  2F2A C;  5AV8 D;  5GSU B;  1P3O D;  3WTP D;  3AZE C;  5CP6 B;  3B0C W;  3MNN A;  4J8X A;  1KX5 A;  2L5A A;  2ZY2 A;  4HGA B;  1ID3 C;  2UWX A;  4DQY B;  3MNN B;  4J8X B;  1KX5 B;  3X1S D;  5B1L D;  5BNX A;  1HQ3 C;  3AV2 C;  1P3K A;  4XUJ C;  3LEL D;  3MVD A;  5BNX B;  1P3K B;  4R8P D;  1M19 A;  5AVC C;  3REL D;  5AV5 D;  3MVD B;  2DF4 C;  1M19 B;  4JJN A;  5B1M A;  3AN2 D;  2ARO A;  5B2I D;  4JJN B;  3MGP A;  5BT1 D;  5B1M B;  4DRA A;  3REJ D;  5AVB D;  3MGP B;  3UTA C;  5AY8 C;  3AZL D;  5B40 A;  4ZUX A;  5CPJ B;  4WU8 A;  2CWE A;  3AYW A;  4ZUX B;  5B32 D;  4WU8 B;  3WKJ A;  3W97 D;  3AYW B;  3AZK D;  5F99 A;  2Y2G A;  3AZH A;  2YFV A;  5E5A C;  1P3I A;  2PYO D;  3WKJ B;  3AZG D;  5F99 B;  1P3I B;  3AZH B;  2YFV B;  3O62 C;  5BO0 A;  5C3I B;  5B0Y A;  3KUY D;  5GT0 C;  3REH C;  4KUD D;  1ULY A;  4WV4 B;  4LD9 C;  3X1T B;  5BO0 B;  5B0Y B;  5B24 D;  2NZD A;  3KXB A;  3AFA A;  5CHL B;  2NZD B;  3UTB D;  3A6N C;  3KXB B;  3AFA B;  5KDM A;  4QLC C;  1PZR A;  3B0D C;  3REK A;  2ZM5 A;  5KDM B;  3REK B;  1KX3 D;  1M1A D;  4Z66 D;  1KX4 D;  5B0Z A;  1R4V A;  5JRG C;  2FJ7 A;  1B67 A;  3AZE D;  3WTP C;  3AZF B;  3MGR A;  2FJ7 B;  1ID3 D;  5BS7 C;  5B2J B;  3VH5 T;  3MGR B;  5CPJ D;  3P5J B;  4H9P A;  3AV2 D;  3B6G C;  4H9R A;  4XUJ D;  1F1E A;  4Z2M H;  1T3U A;  1BFM A;  2J8P A;  4KGC C;  5AVC D;  1TAF B;  4H9R B;  3REL C;  4WNN A;  3X1V C;  3LZ0 C;  5CPK C;  4WNN B;  1B6W A;  4H9S C;  3A1K A;  3EPH A;  3W99 C;  2Y2N A;  3NQJ A;  3UTA D;  3H0L C;  5AY8 D;  2ZY4 A;  3B0B A;  3LJA C;  3NQJ B;  1P3G C;  3UT9 A;  3TU4 A;  1P3F B;  4YM6 C;  5E5A D;  1P3P A;  2NQB C;  4G91 B;  1WWS A;  3R45 A;  3TU4 B;  4AWL C;  1P3P B;  1W2E A;  2IO5 B;  5GSU C;  5JA4 A;  5AV9 A;  2Y2Q A;  5GT0 D;  3REH D;  3REI A;  4LD9 D;  5CP6 C;  4H9O A;  3AZF D;  4Z5T A;  5JA4 B;  5AV9 B;  3REI B;  4HGA C;  5B2J D;  3MNN C;  3C1C B;  4Z5T B;  4J8X C;  1KX5 C;  2CV5 A;  3A6N D;  4J8V A;  2BYK A;  4M6B A;  4QLC D;  2CV5 B;  4J8V B;  4J8U A;  2BYK B;  1P3K C;  3KFU G;  2JE5 A;  1AOI A;  3MVD C;  1M19 C;  1AOI B;  5JRG D;  4JJN C;  1P3M A;  5B1M C;  3AZJ A;  3AZN A;  5DNN A;  2Y2K A;  3AZM A;  3MGP C;  1M18 A;  3B6F A;  1P3M B;  4YS3 A;  3AZJ B;  3AZN B;  5DNN B;  5CPJ C;  3AZM B;  1P34 A;  1P3A A;  1M18 B;  3B6F B;  3B6G D;  4ZUX C;  1P3A B;  1P34 B;  4WU8 C;  3VH6 W;  4KGC D;  1P3F D;  4J8W A;  3AYW C;  4E45 A;  3X1V D;  2HIO A;  3LZ0 D;  3AZI A;  3WKJ C;  1TZY A;  3KWQ A;  4J8W B;  5CPK D;  5F99 C;  1P3I C;  3AZH C;  3AZI B;  1TZY B;  3WA9 A;  4E44 A;  5C3I C;  3KWQ B;  3W99 D;  2G5I C;  3X1T C;  3WA9 B;  2ARO B;  5B0Y C;  3MGQ A;  2ZY3 A;  3W96 A;  3C1C D;  1P3G D;  3LJA D;  1U35 A;  2NZD C;  1S32 A;  3AV1 A;  1BH8 A;  4XZQ A;  3KXB C;  5B40 B;  3AFA C;  4ZBJ B;  3W96 B;  1U35 B;  4EO5 B;  1S32 B;  3AV1 B;  1BH8 B;  2RVQ C;  2FFF B;  4XZQ B;  4YM6 D;  5FUG A;  2F8N D;  3AL0 C;  3REK C;  2NQB D;  3W98 A;  5FUG B;  2Y2O A;  5GSU D;  5B33 A;  3W98 B;  1P3B A;  3IP4 C;  5CP6 D;  5B33 B;  1Q9C A;  3AZF C;  5AV6 A;  1P3B B;  2FJ7 C;  3MGS A;  3MNN D;  4H9N A;  1HQ3 A;  5B2J C;  4J8X D;  1KX5 D;  5AV6 B;  3MGR C;  1ZLA A;  3MGS B;  3X1U A;  1ZLA B;  1P3K D;  3X1U B;  1F66 A;  5GT3 A;  1P3L A;  3MVD D;  2HUE B;  1M19 D;  1F66 B;  5GT3 B;  1P3L B;  2F8N H;  4JJN D;  1EQZ A;  5B0Z B;  5B1M D;  3LZ1 A;  3EPJ A;  5GXQ A;  3MGP D;  1EQZ B;  4H9Q A;  3LZ1 B;  5GXQ B;  4CAY A;  5B31 A;  4H9Q B;  5B40 D;  4ZUX D;  4WU8 D;  4CAY B;  2BG1 A;  2RIQ A;  4H9P B;  5B31 B;  3C1B A;  4X23 A;  3AYW D;  1P3F C;  3O62 A;  3WKJ D;  3C1B B;  3VH6 A;  4X23 B;  4G91 C;  3WTP E;  5F99 D;  3TU4 C;  3AZH D;  1P3I D;  1P3P C;  2IO5 C;  4WU9 A;  1HTA A;  3WAA A;  3X1T D;  5B0Y D;  5AV9 C;  3REI C;  4WU9 B;  3WAA B;  3C1C C;  4Z5T C;  3EPK A;  4WZS B;  2NZD D;  3KXB D;  3AFA D;  1JFI A;  2CV5 C;  2RVQ D;  5DNM A;  4J8V C;  5CPI A;  3REK D;  3UT9 B;  5DNM B;  5AV8 A;  5CPI B;  1P3O A;  1AOI C;  3WTP A;  5AV8 B;  1P3O B;  3R45 B;  5B0Z D;  2Y2L A;  2FJ7 D;  3X1S A;  5B1L A;  4H9O B;  1P3M C;  3MGR D;  3X1S B;  3AZJ C;  3AZN C;  5DNN C;  5B1L B;  3LEL A;  3AZM C;  1M18 C;  3B6F C;  4R8P A;  3A1I A;  3REL A;  3LEL B;  1P3A C;  1P34 C;  5AV5 A;  4R8P B;  4J8U B;  5AV5 B;  4J8W C;  3AN2 A;  4G92 B;  5B2I A;  3AZI C;  1TZY C;  3KWQ C;  3AN2 B;  5B2I B;  3REJ A;  5AVB A;  5BNV A;  3AZL A;  3WA9 C;  2ARO C;  3REJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...