3WKJC

The nucleosome containing human tsh2b
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
AKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human nucleosome containing the testis-specific histone variant TSH2B
doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 32
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wkjC00
3KSYA 1P3BB 5B32B 3C1CD 3REJA 1P3AD 1P3ID 1JFIA 3B6GC 1P3IB 1M1AC 3UTAC 1AOIA 3REKB 5B31D 4H9PB 2PYOA 4J8WB 4CSRB 3LELD 1TZYC 5JA4A 5B1MB 3AV2C 5B32C 3AZGD 2NZDB 4J8XA 5E5AB 2YFVA 5B31B 3TU4C 1ID3B 3RELC 1M1AD 4H9RB 1F66A 4XUJB 3AZHA 3VH6A 3TU4B 4KUDD 4YS3D 2NZDA 3AV1C 4WU9C 4XZQC 1ID3A 3AZNA 5JA4B 2FJ7D 1TZYB 5BS7C 1P3LA 3MNND 4WU8D 1AOID 3AZJB 2BYKA 5F99B 5B0YA 3VH5T 5GT3C 1S32A 5B24B 3WKJD 3AN2B 3B6FD 1JFIB 4WV4B 1M19D 1P3IA 5B2IA 4ZUXC 4HGAC 3X1SD 3MVDB 5JRGD 5DNNC 4H9QA 3AZLA 1P3BC 1P3MD 3WTPA 1WWSA 4CAYB 3AZJA 3AZKB 4J8UD 3KWQC 1P3GD 5GXQB 3WA9B 3REHC 2F8ND 3RELD 3AZKA 3MGSC 4XUJA 3AV1B 1HQ3C 5JRGC 5B1LA 4CAYA 1B6WA 2CV5A 3AFAA 2F8NG 4LD9C 1P34C 4H9QB 3AZLB 1M18D 1P3FD 5G49B 4KUDC 3UT9D 4Z2MG 1P3OB 5AV6B 4M6BA 3W97A 3LZ1C 1WWIA 1M18B 1AOIC 3B6GD 1HQ3D 2BYKB 2RVQC 3MGRD 1R4VA 4ZUXB 3UTBB 3AZEA 5AV6D 2CV5D 1TZYA 1Q9CA 3AV2A 1AOIB 3X1SB 3MVDD 3A6NB 4J8XC 5B2JA 1KU5A 1P3BD 1P3MB 1BH9B 3C1CA 3WTPD 4KGCB 3LJAA 3LELB 1P3GB 1P3AA 2YFVB 5GT0C 3X1UB 5B33D 4WNNA 5AVBA 1KX3C 5AV8B 1ID3D 3AV1D 2NQBB 4JJNB 3WA9D 3MNNC 4WU8C 2CWEA 4Z66C 4AWLC 5B0YC 3AZMA 5B1MC 1M18A 3B0BA 3UT9C 3X1VA 4J8UA 4XUJD 5BO0B 1P3PA 5CPJD 1M19C 5AVBD 3MGQC 4KHAA 5B31G 5B0YB 5AV5C 1U35B 3WAAD 3AZIA 4JJNC 5KDMA 1HQ3B 4J8VD 4E44A 4QLCC 3A6ND 1KX4C 3AZNB 1P3GC 2FJ7C 3TU4A 1B67A 3REIC 4XUJC 5B0ZC 1P3AB 5B1LC 3REKD 3C1CB 3C1BA 3NQJA 1F1EA 3WAAC 5AV5D 3VH5W 4LD9D 3MGRA 3AZED 5DNMC 3AZHC 5B32G 5FUGB 4WZSB 2NZDC 3KXBD 5BNVB 3X1VD 1ID3C 5AY8B 3LZ1A 3W97C 5DNNB 4H9OA 5BS7A 5B24C 5B32D 3KUYC 3W96B 4G92B 5GT3A 5AY8C 1P3LB 5AV6C 3B0DB 2F8NA 3AZHB 5CP6A 4J8XD 5GSUD 3AZLC 1P3BA 3W99B 4XZQB 4X23D 3NQUB 5B1LB 4Z2MH 5B31A 3V9RA 1TZYD 5B33A 1HTAA 3AV2D 5AV9C 3REHA 4YM6C 5CPID 3B6FA 1HQ3A 4H9PA 1P3KB 4Z66A 3AFAC 2JSSA 3LZ0D 3W96C 3MVDA 4G91B 2BYMB 1P3KD 4E45A 2YFWA 5CP6D 1EQZA 5CPIC 4YM6D 3O62B 5AV5A 4Z5TA 3VH6T 3X1TD 3AZFD 3B6FB 5DNMB 4YM6B 3RELA 5AY8D 3WTPE 2NQBA 5AV8C 2AROC 4WNNB 1P34B 1P3GA 5CPJB 3R45B 3LELC 5B0ZA 5GSUC 4XZQA 3NQJB 3LZ1D 3REID 3C1BC 5GXQC 5B1LD 5B0YD 3MGRC 3W99D 3B0CW 3AV2B 4J8XB 2AROD 3A6NA 3KXBA 1M19B 4H9SC 3MGQB 3REJC 1S32D 5F99A 4R8PC 1U35A 4WU8A 3MNNA 4EO5C 3REKA 1M1AA 2HIOC 3AZMC 5AY8A 1M18C 4J8UB 3UTAB 4ZBJC 2BYMA 3WTPC 5CPKB 1ZLAB 3WKJA 5G49A 3AYWC 1A7WA 3KWQA 1KX3D 5B40A 3AZGC 3AFAB 5GT0B 3X1UC 5B32A 1KX5D 4LD9B 3VH5A 1KX3B 4R8PD 3AZIC 4JJNA 3REHB 3WA9A 3MGSB 5AV8D 2CV5C 5DNMD 1P3MC 3AZGB 4YS3A 2NZDD 3O62D 3W98B 3LZ0A 4YM6A 5AVCC 3W98D 3KUYD 1TAFA 1H3OA 4X23A 1P3LC 3B0CT 4J8WC 3AN2A 3UTBC 1TAFB 4G92C 1P3KC 1EQZC 5B24A 4ZUXD 1P3FB 4Z5TC 2F8NK 5B0ZD 3AZFC 3X1TC 5DNNA 5AV8A 5AV6A 3C1CC 3AYWD 3MGRB 3UTBD 4KGCC 5GT0A 5AVBC 1KX3A 4QLCB 3KWQB 5B24D 3AFAD 5B2JB 3C1BD 5CPKC 2LY8A 2L5AA 5B31C 3B0DC 5E5AA 3W96D 4QLCD 3A6NC 2HIOB 2PYOB 3MGPD 5B2IC 4CSRA 3WTPB 3B6FC 4KGCD 1U35C 3REKC 1EQZB 1ULYA 3LZ1B 2YFWB 3AZEC 2PYOC 3REJB 5CHLB 2HUEB 4J8VA 4XZQD 4X23B 1P3PD 4H9NA 5B2ID 3R45A 5CPJC 3W98A 3AZID 1P34A 5BT1D 5GT3D 4KUDA 3LZ0C 3LELA 5AVCA 3O62C 3AZIB 1F66B 1BH9A 5AV5B 3AZFB 4J8VB 3X1TB 1KX5A 4X23C 3WKJB 5CP6B 5CPKD 1P3LD 4R8PB 5CPIB 5B1MD 1ZLAA 3AZJD 3MGPB 4H9SA 3KWQD 4Z66B 3AZMB 3AZHD 4NFTA 1P3IC 1M1AB 5F99C 4ZUXA 2IO5C 3REHD 4WU9D 1EQZD 5BNXB 3KXBB 2HIOA 1M19A 3MGQA 5GXQD 2PYOD 2NQBD 4WU9B 5AV9B 2FJ7B 4DRAA 3W99A 4KGCA 3REIB 4H9NB 4QLCA 5B33C 4H9RA 2AROB 3AZKC 1KX4B 2FJ7A 3X1SC 3B6GA 3WA9C 3UTAA 3AN2D 5E5AC 5B1MA 1ZLAD 3AYWB 3UT9A 3X1VC 4Z5TB 4HGAB 3MVDC 4J8UC 1P3FA 3MGPC 4Z5TD 3UT9B 4H9OB 1P3OC 3MGSD 3MGQD 5BNVA 3X1VB 3B6GB 1N1JB 3AN2C 1P34D 3LJAD 1KX4A 1F66C 4NE3A 5GT0D 1KX5B 4J8VC 1P3KA 4UUZB 5B2JC 4NE5A 3LZ0B 3VH6W 4WU9A 3W98C 3AZLD 3AZNC 5B33B 2HIOD 3WAAA 4Z66D 5GXQA 4J8WD 5BT1C 5DNMA 3RELB 3O62A 4UUZA 5C3IC 5AV9D 3NQUA 3KXBC 1U35D 3AZKD 3X1UD 1KX5C 1N1JA 5BO0A 1P3PB 5CPKA 4R8PA 4ZBJB 2IO5B 2F8NB 4JJND 1ZLAC 5GT3B 1S32B 4WU8B 3MNNB 3AZJC 5AVCD 1P3PC 3WKJC 5CP6C 5F99D 3TU4D 4KUDB 1P3OD 3V9RB 5C3IB 5B40D 3W97B 1BH8A 3AZMD 1F66D 4LD9A 1P3MA 2AROA 5B40B 4YS3C 5AV9A 2CV5B 5B2JD 3C1BB 1BH8B 3REIA 5JRGB 5CPJA 3AV1A 3AZND 3X1SA 4NE6A 2HUEC 3W96A 5E5AD 5BNXA 4J8WA 5KDMB 1P3FC 2F8NH 4KHAB 3UTBA 3MGPA 3AZEB 3REJD 1S32C 1KX4D 4EO5B 3KUYA 1BFMA 5CPIA 4G91C 1P3OA 5FUGA 5DNND 5B2IB 4DRBA 3KUYB 2NQBC 2RVQD 3AZFA 1H3OB 3X1TA 5AVCB 3LJAC 4AWLB 5B0ZB 1P3AC 5GSUA 3AYWA 3W97D 3WAAB 5B40C 3UTAD 3AZGA 4YS3B 3X1UA 3MGSA 5AVBB 5GSUB 3LJAB 5JRGA 3W99C
chains in the Genus database with same CATH superfamily
3KSYA 1P3BB 5B32B 3C1CD 3REJA 1P3AD 2ZY2A 2JCHA 1P3ID 2NZDB 1JFIA 3B6GC 1P3IB 1M1AC 3UTAC 1AOIA 3REKB 3EPLA 2G5IC 5B31D 4H9PB 2PYOA 4J8WB 4CSRB 3LELD 1TZYC 5JA4A 5B1MB 3AV2C 5B32C 3AZGD 2ZY3A 4J8XA 5E5AB 3AL0C 2YFVA 5B31B 3TU4C 1ID3B 3RELC 1M1AD 4H9RB 1F66A 4XUJB 3AZHA 3VH6A 3TU4B 4KUDD 4YS3D 2NZDA 3AV1C 4WU9C 4XZQC 1ID3A 3AZNA 5JA4B 2FJ7D 1TZYB 5BS7C 1P3LA 2ZY4A 3MNND 4WU8D 1AOID 3AZJB 2BYKA 5F99B 5B0YA 3VH5T 5GT3C 1S32A 5B24B 3WKJD 3AN2B 3B6FD 1JFIB 4WV4B 1M19D 1P3IA 5B2IA 4ZUXC 4HGAC 3X1SD 3MVDB 5JRGD 5DNNC 4H9QA 3AZLA 1P3BC 1P3MD 3WTPA 1WWSA 4CAYB 3AZJA 2Y2JA 3AZKB 4J8UD 3KWQC 1P3GD 5GXQB 2Y2MA 3WA9B 2Y2HA 3REHC 2F8ND 3RELD 3AZKA 3MGSC 4XUJA 3AV1B 1HQ3C 5JRGC 5B1LA 4CAYA 1B6WA 2CV5A 3AFAA 2F8NG 4LD9C 1P34C 4H9QB 3AZLB 1M18D 1P3FD 5G49B 4KUDC 3UT9D 4Z2MG 1P3OB 5AV6B 4M6BA 3W97A 3LZ1C 1WWIA 1M18B 1AOIC 3B6GD 2BG1A 1HQ3D 2RVQC 2BYKB 3MGRD 1R4VA 4ZUXB 3UTBB 3AZEA 5AV6D 2ZM5A 2CV5D 1TZYA 1Q9CA 4DQYB 3AV2A 1AOIB 3X1SB 3MVDD 3A6NB 4J8XC 5B2JA 2Y2GA 1KU5A 1P3BD 1P3MB 1BH9B 3C1CA 3WTPD 4KGCB 3LJAA 3LELB 1P3GB 1P3AA 2YFVB 5GT0C 3X1UB 5B33D 4WNNA 2Y2PA 5AVBA 1KX3C 5AV8B 1ID3D 3AV1D 2NQBB 2XD1A 4JJNB 3WA9D 3MNNC 4WU8C 2CWEA 4Z66C 3F6TA 4AWLC 5B0YC 3AZMA 5B1MC 1M18A 3B0BA 3UT9C 3X1VA 4J8UA 3H0MC 4XUJD 5BO0B 1P3PA 5CPJD 1M19C 5AVBD 3MGQC 4KHAA 5B31G 5B0YB 5AV5C 1U35B 3WAAD 3AZIA 4JJNC 5KDMA 1HQ3B 4J8VD 4E44A 2VQRA 4QLCC 3A6ND 1KX4C 3AZNB 1P3GC 2FJ7C 3TU4A 1B67A 3REIC 4XUJC 5B0ZC 1P3AB 5B1LC 3REKD 3C1CB 3C1BA 3NQJA 1F1EA 3WAAC 5AV5D 1PZRA 3VH5W 4LD9D 3MGRA 3AZED 5DNMC 3AZHC 5B32G 5FUGB 4WZSB 2NZDC 3KXBD 5BNVB 3X1VD 1ID3C 5AY8B 3LZ1A 3W97C 5DNNB 4H9OA 5BS7A 5B24C 5B32D 3KUYC 3W96B 2DF4C 4G92B 5GT3A 5AY8C 1P3LB 5AV6C 3B0DB 2F8NA 3AZHB 5CP6A 4J8XD 5GSUD 3AZLC 1P3BA 3W99B 4XZQB 4X23D 3NQUB 5B1LB 4Z2MH 5B31A 3V9RA 1TZYD 5B33A 1HTAA 3AV2D 5AV9C 3REHA 4YM6C 5CPID 3B6FA 1HQ3A 4H9PA 1P3KB 2DQNC 4Z66A 3AFAC 2Y2LA 2JSSA 3LZ0D 3W96C 3MVDA 4G91B 2BYMB 1P3KD 4E45A 2YFWA 5CP6D 1EQZA 5CPIC 4YM6D 3O62B 5AV5A 4Z5TA 3VH6T 3X1TD 3AZFD 3B6FB 5DNMB 4YM6B 3RELA 5AY8D 3WTPE 2NQBA 5AV8C 2AROC 4WNNB 1P34B 1P3GA 5CPJB 3R45B 3LELC 1T3UA 5B0ZA 3EPKA 5GSUC 4XZQA 3NQJB 3LZ1D 3REID 3C1BC 5GXQC 5B1LD 5B0YD 3MGRC 3W99D 3B0CW 3AV2B 4J8XB 2AROD 3A6NA 3KXBA 1M19B 4H9SC 3MGQB 3REJC 1S32D 5F99A 4R8PC 1U35A 2J8PA 4WU8A 3MNNA 3A1KA 4EO5C 3REKA 1M1AA 2HIOC 3AZMC 5AY8A 1M18C 4J8UB 3UTAB 4ZBJC 2BYMA 3WTPC 5CPKB 1ZLAB 3WKJA 2Y2QA 5G49A 3AYWC 1A7WA 3KWQA 1KX3D 5B40A 3AZGC 3AFAB 5GT0B 3X1UC 5B32A 1KX5D 4LD9B 3VH5A 1KX3B 4R8PD 3AZIC 4JJNA 3REHB 3WA9A 3MGSB 5AV8D 2CV5C 5DNMD 1P3MC 3AZGB 4YS3A 2NZDD 3O62D 3W98B 3LZ0A 4YM6A 5AVCC 3W98D 3IP4C 1W2EA 3KUYD 1TAFA 1H3OA 4X23A 1P3LC 3B0CT 4J8WC 3AN2A 3UTBC 1TAFB 4G92C 1P3KC 1EQZC 5B24A 4ZUXD 1P3FB 4Z5TC 2F8NK 5B0ZD 4WJ3C 3AZFC 3X1TC 5DNNA 2Y2OA 5AV8A 5AV6A 2ZY5A 3C1CC 3AYWD 3MGRB 3UTBD 4KGCC 5GT0A 5AVBC 1KX3A 4QLCB 3KWQB 5B24D 3AFAD 5B2JB 3C1BD 5CPKC 2LY8A 2L5AA 5B31C 3B0DC 5E5AA 3W96D 4QLCD 3A6NC 2HIOB 2PYOB 3MGPD 3H0LC 5B2IC 4CSRA 3WTPB 3B6FC 4KGCD 1U35C 3REKC 1EQZB 1ULYA 3LZ1B 2YFWB 3AZEC 2PYOC 3REJB 5CHLB 2HUEB 4J8VA 4XZQD 4X23B 1P3PD 4H9NA 5B2ID 3R45A 3FDDA 5CPJC 3W98A 3AZID 1P34A 1Z2CB 5BT1D 5GT3D 4KUDA 2F2AC 3LZ0C 3LELA 5AVCA 3O62C 3AZIB 1F66B 1BH9A 5AV5B 3AZFB 4J8VB 3X1TB 1KX5A 4X23C 3WKJB 5CP6B 3EG5B 5CPKD 1P3LD 4R8PB 5CPIB 5B1MD 1ZLAA 3AZJD 3MGPB 4H9SA 3KWQD 4Z66B 3AZMB 3AZHD 4NFTA 1P3IC 1M1AB 5F99C 4ZUXA 2IO5C 3REHD 4WU9D 1EQZD 5BNXB 3KXBB 2HIOA 1M19A 3MGQA 5GXQD 2PYOD 2NQBD 4WU9B 5AV9B 2RIQA 4DRAA 2FJ7B 3W99A 4KGCA 3REIB 4H9NB 4QLCA 5B33C 4H9RA 2AROB 3AZKC 1KX4B 2FJ7A 3X1SC 3EPJA 3B6GA 3WA9C 3UTAA 3AN2D 5E5AC 5B1MA 1ZLAD 3AYWB 3UT9A 3X1VC 4Z5TB 4HGAB 3MVDC 4J8UC 1P3FA 4UPKA 3MGPC 4Z5TD 3UT9B 4H9OB 1P3OC 3MGSD 3MGQD 5BNVA 3X1VB 3B6GB 1N1JB 3AN2C 1P34D 3LJAD 1KX4A 1F66C 4NE3A 5GT0D 1KX5B 4J8VC 1P3KA 4UUZB 5B2JC 4NE5A 3VH6W 3LZ0B 4WU9A 3W98C 3AZLD 3AZNC 5B33B 2HIOD 3WAAA 4Z66D 5GXQA 4J8WD 5BT1C 5DNMA 3RELB 3O62A 4UUZA 3P5JB 5C3IC 5AV9D 3NQUA 3KXBC 1U35D 3AZKD 3X1UD 1KX5C 1N1JA 5BO0A 1P3PB 5CPKA 4R8PA 4ZBJB 2IO5B 2Y2NA 2F8NB 4JJND 1ZLAC 5GT3B 1S32B 4WU8B 3MNNB 3AZJC 5AVCD 1P3PC 3WKJC 5CP6C 5F99D 3TU4D 4KUDB 1P3OD 3V9RB 5C3IB 2XD5A 5B40D 3W97B 2Y2IA 1BH8A 3AZMD 1F66D 4LD9A 1P3MA 2AROA 5B40B 4YS3C 5AV9A 2CV5B 5B2JD 3C1BB 1BH8B 3REIA 5JRGB 5CPJA 3AV1A 3AZND 3X1SA 4NE6A 2HUEC 3W96A 5E5AD 2G5HC 5BNXA 4J8WA 2Y2KA 5KDMB 3EPHA 1P3FC 2F8NH 4KHAB 3UTBA 3MGPA 3AZEB 3REJD 1S32C 1KX4D 2FFFB 4EO5B 3KUYA 1BFMA 5CPIA 3KFUG 4G91C 1P3OA 5FUGA 5DNND 5B2IB 3A1IA 3H0RC 4DRBA 3KUYB 2NQBC 2RVQD 3AZFA 1H3OB 3X1TA 5AVCB 3LJAC 4AWLB 5B0ZB 1P3AC 5GSUA 3AYWA 2UWXA 2W8SA 3W97D 2JE5A 3WAAB 5B40C 3UTAD 3AZGA 4YS3B 3X1UA 3MGSA 5AVBB 5GSUB 3LJAB 5JRGA 3W99C
chains in the Genus database with same CATH topology
3KSYA 1P3BB 5B32B 3C1CD 3REJA 1P3AD 2ZY2A 2JCHA 1P3ID 2NZDB 1JFIA 3B6GC 1P3IB 1M1AC 3UTAC 1AOIA 3REKB 3EPLA 2G5IC 5B31D 4H9PB 2PYOA 4J8WB 4CSRB 3LELD 1TZYC 5JA4A 5B1MB 3AV2C 5B32C 3AZGD 2ZY3A 4J8XA 5E5AB 3AL0C 2YFVA 5B31B 3TU4C 1ID3B 3RELC 1M1AD 4H9RB 1F66A 4XUJB 3AZHA 3VH6A 3TU4B 4KUDD 4YS3D 2NZDA 3AV1C 4WU9C 4XZQC 1ID3A 3AZNA 5JA4B 2FJ7D 1TZYB 5BS7C 1P3LA 2ZY4A 3MNND 4WU8D 1AOID 3AZJB 2BYKA 5F99B 5B0YA 3VH5T 5GT3C 1S32A 5B24B 3WKJD 3AN2B 3B6FD 1JFIB 4WV4B 1M19D 1P3IA 5B2IA 4ZUXC 4HGAC 3X1SD 3MVDB 5JRGD 5DNNC 4H9QA 3AZLA 1P3BC 1P3MD 3WTPA 1WWSA 4CAYB 3AZJA 2Y2JA 3AZKB 4J8UD 3KWQC 1P3GD 5GXQB 2Y2MA 3WA9B 2Y2HA 3REHC 2F8ND 3RELD 3AZKA 3MGSC 4XUJA 3AV1B 1HQ3C 5JRGC 5B1LA 4CAYA 1B6WA 2CV5A 3AFAA 2F8NG 4LD9C 1P34C 4H9QB 3AZLB 1M18D 1P3FD 5G49B 4KUDC 3UT9D 4Z2MG 1P3OB 5AV6B 4M6BA 3W97A 3LZ1C 1WWIA 1M18B 1AOIC 3B6GD 2BG1A 1HQ3D 2RVQC 2BYKB 3MGRD 1R4VA 4ZUXB 3UTBB 3AZEA 5AV6D 2ZM5A 2CV5D 1TZYA 1Q9CA 4DQYB 3AV2A 1AOIB 3X1SB 3MVDD 3A6NB 4J8XC 5B2JA 2Y2GA 1KU5A 1P3BD 1P3MB 1BH9B 3C1CA 3WTPD 4KGCB 3LJAA 3LELB 1P3GB 1P3AA 2YFVB 5GT0C 3X1UB 5B33D 4WNNA 2Y2PA 5AVBA 1KX3C 5AV8B 1ID3D 3AV1D 2NQBB 2XD1A 4JJNB 3WA9D 3MNNC 4WU8C 2CWEA 4Z66C 3F6TA 4AWLC 5B0YC 3AZMA 5B1MC 1M18A 3B0BA 3UT9C 3X1VA 4J8UA 3H0MC 4XUJD 5BO0B 1P3PA 5CPJD 1M19C 5AVBD 3MGQC 4KHAA 5B31G 5B0YB 5AV5C 1U35B 3WAAD 3AZIA 4JJNC 5KDMA 1HQ3B 4J8VD 4E44A 2VQRA 4QLCC 3A6ND 1KX4C 3AZNB 1P3GC 2FJ7C 3TU4A 1B67A 3REIC 4XUJC 5B0ZC 1P3AB 5B1LC 3REKD 3C1CB 3C1BA 3NQJA 1F1EA 3WAAC 5AV5D 1PZRA 3VH5W 4LD9D 3MGRA 3AZED 5DNMC 3AZHC 5B32G 5FUGB 4WZSB 2NZDC 3KXBD 5BNVB 3X1VD 1ID3C 5AY8B 3LZ1A 3W97C 5DNNB 4H9OA 5BS7A 5B24C 5B32D 3KUYC 3W96B 2DF4C 4G92B 5GT3A 5AY8C 1P3LB 5AV6C 3B0DB 2F8NA 3AZHB 5CP6A 4J8XD 5GSUD 3AZLC 1P3BA 3W99B 4XZQB 4X23D 3NQUB 5B1LB 4Z2MH 5B31A 3V9RA 1TZYD 5B33A 1HTAA 3AV2D 5AV9C 3REHA 4YM6C 5CPID 3B6FA 1HQ3A 4H9PA 1P3KB 2DQNC 4Z66A 3AFAC 2Y2LA 2JSSA 3LZ0D 3W96C 3MVDA 4G91B 2BYMB 1P3KD 4E45A 2YFWA 5CP6D 1EQZA 5CPIC 4YM6D 3O62B 5AV5A 4Z5TA 3VH6T 3X1TD 3AZFD 3B6FB 5DNMB 4YM6B 3RELA 5AY8D 3WTPE 2NQBA 5AV8C 2AROC 4WNNB 1P34B 1P3GA 5CPJB 3R45B 3LELC 1T3UA 5B0ZA 3EPKA 5GSUC 4XZQA 3NQJB 3LZ1D 3REID 3C1BC 5GXQC 5B1LD 5B0YD 3MGRC 3W99D 3B0CW 3AV2B 4J8XB 2AROD 3A6NA 3KXBA 1M19B 4H9SC 3MGQB 3REJC 1S32D 5F99A 4R8PC 1U35A 2J8PA 4WU8A 3MNNA 3A1KA 4EO5C 3REKA 1M1AA 2HIOC 3AZMC 5AY8A 1M18C 4J8UB 3UTAB 4ZBJC 2BYMA 3WTPC 5CPKB 1ZLAB 3WKJA 2Y2QA 5G49A 3AYWC 1A7WA 3KWQA 1KX3D 5B40A 3AZGC 3AFAB 5GT0B 3X1UC 5B32A 1KX5D 4LD9B 3VH5A 1KX3B 4R8PD 3AZIC 4JJNA 3REHB 3WA9A 3MGSB 5AV8D 2CV5C 5DNMD 1P3MC 3AZGB 4YS3A 2NZDD 3O62D 3W98B 3LZ0A 4YM6A 5AVCC 3W98D 3IP4C 1W2EA 3KUYD 1TAFA 1H3OA 4X23A 1P3LC 3B0CT 4J8WC 3AN2A 3UTBC 1TAFB 4G92C 1P3KC 1EQZC 5B24A 4ZUXD 1P3FB 4Z5TC 2F8NK 5B0ZD 4WJ3C 3AZFC 3X1TC 5DNNA 2Y2OA 5AV8A 5AV6A 2ZY5A 3C1CC 3AYWD 3MGRB 3UTBD 4KGCC 5GT0A 5AVBC 1KX3A 4QLCB 3KWQB 5B24D 3AFAD 5B2JB 3C1BD 5CPKC 2LY8A 2L5AA 5B31C 3B0DC 5E5AA 3W96D 4QLCD 3A6NC 2HIOB 2PYOB 3MGPD 3H0LC 5B2IC 4CSRA 3WTPB 3B6FC 4KGCD 1U35C 3REKC 1EQZB 1ULYA 3LZ1B 2YFWB 3AZEC 2PYOC 3REJB 5CHLB 2HUEB 4J8VA 4XZQD 4X23B 1P3PD 4H9NA 5B2ID 3R45A 3FDDA 5CPJC 3W98A 3AZID 1P34A 1Z2CB 5BT1D 5GT3D 4KUDA 2F2AC 3LZ0C 3LELA 5AVCA 3O62C 3AZIB 1F66B 1BH9A 5AV5B 3AZFB 4J8VB 3X1TB 1KX5A 4X23C 3WKJB 5CP6B 3EG5B 5CPKD 1P3LD 4R8PB 5CPIB 5B1MD 1ZLAA 3AZJD 3MGPB 4H9SA 3KWQD 4Z66B 3AZMB 3AZHD 4NFTA 1P3IC 1M1AB 5F99C 4ZUXA 2IO5C 3REHD 4WU9D 1EQZD 5BNXB 3KXBB 2HIOA 1M19A 3MGQA 5GXQD 2PYOD 2NQBD 4WU9B 5AV9B 2RIQA 4DRAA 2FJ7B 3W99A 4KGCA 3REIB 4H9NB 4QLCA 5B33C 4H9RA 2AROB 3AZKC 1KX4B 2FJ7A 3X1SC 3EPJA 3B6GA 3WA9C 3UTAA 3AN2D 5E5AC 5B1MA 1ZLAD 3AYWB 3UT9A 3X1VC 4Z5TB 4HGAB 3MVDC 4J8UC 1P3FA 4UPKA 3MGPC 4Z5TD 3UT9B 4H9OB 1P3OC 3MGSD 3MGQD 5BNVA 3X1VB 3B6GB 1N1JB 3AN2C 1P34D 3LJAD 1KX4A 1F66C 4NE3A 5GT0D 1KX5B 4J8VC 1P3KA 4UUZB 5B2JC 4NE5A 3VH6W 3LZ0B 4WU9A 3W98C 3AZLD 3AZNC 5B33B 2HIOD 3WAAA 4Z66D 5GXQA 4J8WD 5BT1C 5DNMA 3RELB 3O62A 4UUZA 3P5JB 5C3IC 5AV9D 3NQUA 3KXBC 1U35D 3AZKD 3X1UD 1KX5C 1N1JA 5BO0A 1P3PB 5CPKA 4R8PA 4ZBJB 2IO5B 2Y2NA 2F8NB 4JJND 1ZLAC 5GT3B 1S32B 4WU8B 3MNNB 3AZJC 5AVCD 1P3PC 3WKJC 5CP6C 5F99D 3TU4D 4KUDB 1P3OD 3V9RB 5C3IB 2XD5A 5B40D 3W97B 2Y2IA 1BH8A 3AZMD 1F66D 4LD9A 1P3MA 2AROA 5B40B 4YS3C 5AV9A 2CV5B 5B2JD 3C1BB 1BH8B 3REIA 5JRGB 5CPJA 3AV1A 3AZND 3X1SA 4NE6A 2HUEC 3W96A 5E5AD 2G5HC 5BNXA 4J8WA 2Y2KA 5KDMB 3EPHA 1P3FC 2F8NH 4KHAB 3UTBA 3MGPA 3AZEB 3REJD 1S32C 1KX4D 2FFFB 4EO5B 3KUYA 1BFMA 5CPIA 3KFUG 4G91C 1P3OA 5FUGA 5DNND 5B2IB 3A1IA 3H0RC 4DRBA 3KUYB 2NQBC 2RVQD 3AZFA 1H3OB 3X1TA 5AVCB 3LJAC 4AWLB 5B0ZB 1P3AC 5GSUA 3AYWA 2UWXA 2W8SA 3W97D 2JE5A 3WAAB 5B40C 3UTAD 3AZGA 4YS3B 3X1UA 3MGSA 5AVBB 5GSUB 3LJAB 5JRGA 3W99C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KSY A;  1P3B B;  5B32 B;  3C1C D;  3REJ A;  1P3A D;  1P3I D;  1JFI A;  3B6G C;  1P3I B;  1M1A C;  3UTA C;  1AOI A;  3REK B;  5B31 D;  4H9P B;  2PYO A;  4J8W B;  4CSR B;  3LEL D;  1TZY C;  5JA4 A;  5B1M B;  3AV2 C;  5B32 C;  3AZG D;  2NZD B;  4J8X A;  5E5A B;  2YFV A;  5B31 B;  3TU4 C;  1ID3 B;  3REL C;  1M1A D;  4H9R B;  1F66 A;  4XUJ B;  3AZH A;  3VH6 A;  3TU4 B;  4KUD D;  4YS3 D;  2NZD A;  3AV1 C;  4WU9 C;  4XZQ C;  1ID3 A;  3AZN A;  5JA4 B;  2FJ7 D;  1TZY B;  5BS7 C;  1P3L A;  3MNN D;  4WU8 D;  1AOI D;  3AZJ B;  2BYK A;  5F99 B;  5B0Y A;  3VH5 T;  5GT3 C;  1S32 A;  5B24 B;  3WKJ D;  3AN2 B;  3B6F D;  1JFI B;  4WV4 B;  1M19 D;  1P3I A;  5B2I A;  4ZUX C;  4HGA C;  3X1S D;  3MVD B;  5JRG D;  5DNN C;  4H9Q A;  3AZL A;  1P3B C;  1P3M D;  3WTP A;  1WWS A;  4CAY B;  3AZJ A;  3AZK B;  4J8U D;  3KWQ C;  1P3G D;  5GXQ B;  3WA9 B;  3REH C;  2F8N D;  3REL D;  3AZK A;  3MGS C;  4XUJ A;  3AV1 B;  1HQ3 C;  5JRG C;  5B1L A;  4CAY A;  1B6W A;  2CV5 A;  3AFA A;  2F8N G;  4LD9 C;  1P34 C;  4H9Q B;  3AZL B;  1M18 D;  1P3F D;  5G49 B;  4KUD C;  3UT9 D;  4Z2M G;  1P3O B;  5AV6 B;  4M6B A;  3W97 A;  3LZ1 C;  1WWI A;  1M18 B;  1AOI C;  3B6G D;  1HQ3 D;  2BYK B;  2RVQ C;  3MGR D;  1R4V A;  4ZUX B;  3UTB B;  3AZE A;  5AV6 D;  2CV5 D;  1TZY A;  1Q9C A;  3AV2 A;  1AOI B;  3X1S B;  3MVD D;  3A6N B;  4J8X C;  5B2J A;  1KU5 A;  1P3B D;  1P3M B;  1BH9 B;  3C1C A;  3WTP D;  4KGC B;  3LJA A;  3LEL B;  1P3G B;  1P3A A;  2YFV B;  5GT0 C;  3X1U B;  5B33 D;  4WNN A;  5AVB A;  1KX3 C;  5AV8 B;  1ID3 D;  3AV1 D;  2NQB B;  4JJN B;  3WA9 D;  3MNN C;  4WU8 C;  2CWE A;  4Z66 C;  4AWL C;  5B0Y C;  3AZM A;  5B1M C;  1M18 A;  3B0B A;  3UT9 C;  3X1V A;  4J8U A;  4XUJ D;  5BO0 B;  1P3P A;  5CPJ D;  1M19 C;  5AVB D;  3MGQ C;  4KHA A;  5B31 G;  5B0Y B;  5AV5 C;  1U35 B;  3WAA D;  3AZI A;  4JJN C;  5KDM A;  1HQ3 B;  4J8V D;  4E44 A;  4QLC C;  3A6N D;  1KX4 C;  3AZN B;  1P3G C;  2FJ7 C;  3TU4 A;  1B67 A;  3REI C;  4XUJ C;  5B0Z C;  1P3A B;  5B1L C;  3REK D;  3C1C B;  3C1B A;  3NQJ A;  1F1E A;  3WAA C;  5AV5 D;  3VH5 W;  4LD9 D;  3MGR A;  3AZE D;  5DNM C;  3AZH C;  5B32 G;  5FUG B;  4WZS B;  2NZD C;  3KXB D;  5BNV B;  3X1V D;  1ID3 C;  5AY8 B;  3LZ1 A;  3W97 C;  5DNN B;  4H9O A;  5BS7 A;  5B24 C;  5B32 D;  3KUY C;  3W96 B;  4G92 B;  5GT3 A;  5AY8 C;  1P3L B;  5AV6 C;  3B0D B;  2F8N A;  3AZH B;  5CP6 A;  4J8X D;  5GSU D;  3AZL C;  1P3B A;  3W99 B;  4XZQ B;  4X23 D;  3NQU B;  5B1L B;  4Z2M H;  5B31 A;  3V9R A;  1TZY D;  5B33 A;  1HTA A;  3AV2 D;  5AV9 C;  3REH A;  4YM6 C;  5CPI D;  3B6F A;  1HQ3 A;  4H9P A;  1P3K B;  4Z66 A;  3AFA C;  2JSS A;  3LZ0 D;  3W96 C;  3MVD A;  4G91 B;  2BYM B;  1P3K D;  4E45 A;  2YFW A;  5CP6 D;  1EQZ A;  5CPI C;  4YM6 D;  3O62 B;  5AV5 A;  4Z5T A;  3VH6 T;  3X1T D;  3AZF D;  3B6F B;  5DNM B;  4YM6 B;  3REL A;  5AY8 D;  3WTP E;  2NQB A;  5AV8 C;  2ARO C;  4WNN B;  1P34 B;  1P3G A;  5CPJ B;  3R45 B;  3LEL C;  5B0Z A;  5GSU C;  4XZQ A;  3NQJ B;  3LZ1 D;  3REI D;  3C1B C;  5GXQ C;  5B1L D;  5B0Y D;  3MGR C;  3W99 D;  3B0C W;  3AV2 B;  4J8X B;  2ARO D;  3A6N A;  3KXB A;  1M19 B;  4H9S C;  3MGQ B;  3REJ C;  1S32 D;  5F99 A;  4R8P C;  1U35 A;  4WU8 A;  3MNN A;  4EO5 C;  3REK A;  1M1A A;  2HIO C;  3AZM C;  5AY8 A;  1M18 C;  4J8U B;  3UTA B;  4ZBJ C;  2BYM A;  3WTP C;  5CPK B;  1ZLA B;  3WKJ A;  5G49 A;  3AYW C;  1A7W A;  3KWQ A;  1KX3 D;  5B40 A;  3AZG C;  3AFA B;  5GT0 B;  3X1U C;  5B32 A;  1KX5 D;  4LD9 B;  3VH5 A;  1KX3 B;  4R8P D;  3AZI C;  4JJN A;  3REH B;  3WA9 A;  3MGS B;  5AV8 D;  2CV5 C;  5DNM D;  1P3M C;  3AZG B;  4YS3 A;  2NZD D;  3O62 D;  3W98 B;  3LZ0 A;  4YM6 A;  5AVC C;  3W98 D;  3KUY D;  1TAF A;  1H3O A;  4X23 A;  1P3L C;  3B0C T;  4J8W C;  3AN2 A;  3UTB C;  1TAF B;  4G92 C;  1P3K C;  1EQZ C;  5B24 A;  4ZUX D;  1P3F B;  4Z5T C;  2F8N K;  5B0Z D;  3AZF C;  3X1T C;  5DNN A;  5AV8 A;  5AV6 A;  3C1C C;  3AYW D;  3MGR B;  3UTB D;  4KGC C;  5GT0 A;  5AVB C;  1KX3 A;  4QLC B;  3KWQ B;  5B24 D;  3AFA D;  5B2J B;  3C1B D;  5CPK C;  2LY8 A;  2L5A A;  5B31 C;  3B0D C;  5E5A A;  3W96 D;  4QLC D;  3A6N C;  2HIO B;  2PYO B;  3MGP D;  5B2I C;  4CSR A;  3WTP B;  3B6F C;  4KGC D;  1U35 C;  3REK C;  1EQZ B;  1ULY A;  3LZ1 B;  2YFW B;  3AZE C;  2PYO C;  3REJ B;  5CHL B;  2HUE B;  4J8V A;  4XZQ D;  4X23 B;  1P3P D;  4H9N A;  5B2I D;  3R45 A;  5CPJ C;  3W98 A;  3AZI D;  1P34 A;  5BT1 D;  5GT3 D;  4KUD A;  3LZ0 C;  3LEL A;  5AVC A;  3O62 C;  3AZI B;  1F66 B;  1BH9 A;  5AV5 B;  3AZF B;  4J8V B;  3X1T B;  1KX5 A;  4X23 C;  3WKJ B;  5CP6 B;  5CPK D;  1P3L D;  4R8P B;  5CPI B;  5B1M D;  1ZLA A;  3AZJ D;  3MGP B;  4H9S A;  3KWQ D;  4Z66 B;  3AZM B;  3AZH D;  4NFT A;  1P3I C;  1M1A B;  5F99 C;  4ZUX A;  2IO5 C;  3REH D;  4WU9 D;  1EQZ D;  5BNX B;  3KXB B;  2HIO A;  1M19 A;  3MGQ A;  5GXQ D;  2PYO D;  2NQB D;  4WU9 B;  5AV9 B;  2FJ7 B;  4DRA A;  3W99 A;  4KGC A;  3REI B;  4H9N B;  4QLC A;  5B33 C;  4H9R A;  2ARO B;  3AZK C;  1KX4 B;  2FJ7 A;  3X1S C;  3B6G A;  3WA9 C;  3UTA A;  3AN2 D;  5E5A C;  5B1M A;  1ZLA D;  3AYW B;  3UT9 A;  3X1V C;  4Z5T B;  4HGA B;  3MVD C;  4J8U C;  1P3F A;  3MGP C;  4Z5T D;  3UT9 B;  4H9O B;  1P3O C;  3MGS D;  3MGQ D;  5BNV A;  3X1V B;  3B6G B;  1N1J B;  3AN2 C;  1P34 D;  3LJA D;  1KX4 A;  1F66 C;  4NE3 A;  5GT0 D;  1KX5 B;  4J8V C;  1P3K A;  4UUZ B;  5B2J C;  4NE5 A;  3LZ0 B;  3VH6 W;  4WU9 A;  3W98 C;  3AZL D;  3AZN C;  5B33 B;  2HIO D;  3WAA A;  4Z66 D;  5GXQ A;  4J8W D;  5BT1 C;  5DNM A;  3REL B;  3O62 A;  4UUZ A;  5C3I C;  5AV9 D;  3NQU A;  3KXB C;  1U35 D;  3AZK D;  3X1U D;  1KX5 C;  1N1J A;  5BO0 A;  1P3P B;  5CPK A;  4R8P A;  4ZBJ B;  2IO5 B;  2F8N B;  4JJN D;  1ZLA C;  5GT3 B;  1S32 B;  4WU8 B;  3MNN B;  3AZJ C;  5AVC D;  1P3P C;  3WKJ C;  5CP6 C;  5F99 D;  3TU4 D;  4KUD B;  1P3O D;  3V9R B;  5C3I B;  5B40 D;  3W97 B;  1BH8 A;  3AZM D;  1F66 D;  4LD9 A;  1P3M A;  2ARO A;  5B40 B;  4YS3 C;  5AV9 A;  2CV5 B;  5B2J D;  3C1B B;  1BH8 B;  3REI A;  5JRG B;  5CPJ A;  3AV1 A;  3AZN D;  3X1S A;  4NE6 A;  2HUE C;  3W96 A;  5E5A D;  5BNX A;  4J8W A;  5KDM B;  1P3F C;  2F8N H;  4KHA B;  3UTB A;  3MGP A;  3AZE B;  3REJ D;  1S32 C;  1KX4 D;  4EO5 B;  3KUY A;  1BFM A;  5CPI A;  4G91 C;  1P3O A;  5FUG A;  5DNN D;  5B2I B;  4DRB A;  3KUY B;  2NQB C;  2RVQ D;  3AZF A;  1H3O B;  3X1T A;  5AVC B;  3LJA C;  4AWL B;  5B0Z B;  1P3A C;  5GSU A;  3AYW A;  3W97 D;  3WAA B;  5B40 C;  3UTA D;  3AZG A;  4YS3 B;  3X1U A;  3MGS A;  5AVB B;  5GSU B;  3LJA B;  5JRG A;  3W99 C; 
#chains in the Genus database with same CATH topology
 3KSY A;  1P3B B;  5B32 B;  3C1C D;  3REJ A;  1P3A D;  2ZY2 A;  2JCH A;  1P3I D;  2NZD B;  1JFI A;  3B6G C;  1P3I B;  1M1A C;  3UTA C;  1AOI A;  3REK B;  3EPL A;  2G5I C;  5B31 D;  4H9P B;  2PYO A;  4J8W B;  4CSR B;  3LEL D;  1TZY C;  5JA4 A;  5B1M B;  3AV2 C;  5B32 C;  3AZG D;  2ZY3 A;  4J8X A;  5E5A B;  3AL0 C;  2YFV A;  5B31 B;  3TU4 C;  1ID3 B;  3REL C;  1M1A D;  4H9R B;  1F66 A;  4XUJ B;  3AZH A;  3VH6 A;  3TU4 B;  4KUD D;  4YS3 D;  2NZD A;  3AV1 C;  4WU9 C;  4XZQ C;  1ID3 A;  3AZN A;  5JA4 B;  2FJ7 D;  1TZY B;  5BS7 C;  1P3L A;  2ZY4 A;  3MNN D;  4WU8 D;  1AOI D;  3AZJ B;  2BYK A;  5F99 B;  5B0Y A;  3VH5 T;  5GT3 C;  1S32 A;  5B24 B;  3WKJ D;  3AN2 B;  3B6F D;  1JFI B;  4WV4 B;  1M19 D;  1P3I A;  5B2I A;  4ZUX C;  4HGA C;  3X1S D;  3MVD B;  5JRG D;  5DNN C;  4H9Q A;  3AZL A;  1P3B C;  1P3M D;  3WTP A;  1WWS A;  4CAY B;  3AZJ A;  2Y2J A;  3AZK B;  4J8U D;  3KWQ C;  1P3G D;  5GXQ B;  2Y2M A;  3WA9 B;  2Y2H A;  3REH C;  2F8N D;  3REL D;  3AZK A;  3MGS C;  4XUJ A;  3AV1 B;  1HQ3 C;  5JRG C;  5B1L A;  4CAY A;  1B6W A;  2CV5 A;  3AFA A;  2F8N G;  4LD9 C;  1P34 C;  4H9Q B;  3AZL B;  1M18 D;  1P3F D;  5G49 B;  4KUD C;  3UT9 D;  4Z2M G;  1P3O B;  5AV6 B;  4M6B A;  3W97 A;  3LZ1 C;  1WWI A;  1M18 B;  1AOI C;  3B6G D;  2BG1 A;  1HQ3 D;  2RVQ C;  2BYK B;  3MGR D;  1R4V A;  4ZUX B;  3UTB B;  3AZE A;  5AV6 D;  2ZM5 A;  2CV5 D;  1TZY A;  1Q9C A;  4DQY B;  3AV2 A;  1AOI B;  3X1S B;  3MVD D;  3A6N B;  4J8X C;  5B2J A;  2Y2G A;  1KU5 A;  1P3B D;  1P3M B;  1BH9 B;  3C1C A;  3WTP D;  4KGC B;  3LJA A;  3LEL B;  1P3G B;  1P3A A;  2YFV B;  5GT0 C;  3X1U B;  5B33 D;  4WNN A;  2Y2P A;  5AVB A;  1KX3 C;  5AV8 B;  1ID3 D;  3AV1 D;  2NQB B;  2XD1 A;  4JJN B;  3WA9 D;  3MNN C;  4WU8 C;  2CWE A;  4Z66 C;  3F6T A;  4AWL C;  5B0Y C;  3AZM A;  5B1M C;  1M18 A;  3B0B A;  3UT9 C;  3X1V A;  4J8U A;  3H0M C;  4XUJ D;  5BO0 B;  1P3P A;  5CPJ D;  1M19 C;  5AVB D;  3MGQ C;  4KHA A;  5B31 G;  5B0Y B;  5AV5 C;  1U35 B;  3WAA D;  3AZI A;  4JJN C;  5KDM A;  1HQ3 B;  4J8V D;  4E44 A;  2VQR A;  4QLC C;  3A6N D;  1KX4 C;  3AZN B;  1P3G C;  2FJ7 C;  3TU4 A;  1B67 A;  3REI C;  4XUJ C;  5B0Z C;  1P3A B;  5B1L C;  3REK D;  3C1C B;  3C1B A;  3NQJ A;  1F1E A;  3WAA C;  5AV5 D;  1PZR A;  3VH5 W;  4LD9 D;  3MGR A;  3AZE D;  5DNM C;  3AZH C;  5B32 G;  5FUG B;  4WZS B;  2NZD C;  3KXB D;  5BNV B;  3X1V D;  1ID3 C;  5AY8 B;  3LZ1 A;  3W97 C;  5DNN B;  4H9O A;  5BS7 A;  5B24 C;  5B32 D;  3KUY C;  3W96 B;  2DF4 C;  4G92 B;  5GT3 A;  5AY8 C;  1P3L B;  5AV6 C;  3B0D B;  2F8N A;  3AZH B;  5CP6 A;  4J8X D;  5GSU D;  3AZL C;  1P3B A;  3W99 B;  4XZQ B;  4X23 D;  3NQU B;  5B1L B;  4Z2M H;  5B31 A;  3V9R A;  1TZY D;  5B33 A;  1HTA A;  3AV2 D;  5AV9 C;  3REH A;  4YM6 C;  5CPI D;  3B6F A;  1HQ3 A;  4H9P A;  1P3K B;  2DQN C;  4Z66 A;  3AFA C;  2Y2L A;  2JSS A;  3LZ0 D;  3W96 C;  3MVD A;  4G91 B;  2BYM B;  1P3K D;  4E45 A;  2YFW A;  5CP6 D;  1EQZ A;  5CPI C;  4YM6 D;  3O62 B;  5AV5 A;  4Z5T A;  3VH6 T;  3X1T D;  3AZF D;  3B6F B;  5DNM B;  4YM6 B;  3REL A;  5AY8 D;  3WTP E;  2NQB A;  5AV8 C;  2ARO C;  4WNN B;  1P34 B;  1P3G A;  5CPJ B;  3R45 B;  3LEL C;  1T3U A;  5B0Z A;  3EPK A;  5GSU C;  4XZQ A;  3NQJ B;  3LZ1 D;  3REI D;  3C1B C;  5GXQ C;  5B1L D;  5B0Y D;  3MGR C;  3W99 D;  3B0C W;  3AV2 B;  4J8X B;  2ARO D;  3A6N A;  3KXB A;  1M19 B;  4H9S C;  3MGQ B;  3REJ C;  1S32 D;  5F99 A;  4R8P C;  1U35 A;  2J8P A;  4WU8 A;  3MNN A;  3A1K A;  4EO5 C;  3REK A;  1M1A A;  2HIO C;  3AZM C;  5AY8 A;  1M18 C;  4J8U B;  3UTA B;  4ZBJ C;  2BYM A;  3WTP C;  5CPK B;  1ZLA B;  3WKJ A;  2Y2Q A;  5G49 A;  3AYW C;  1A7W A;  3KWQ A;  1KX3 D;  5B40 A;  3AZG C;  3AFA B;  5GT0 B;  3X1U C;  5B32 A;  1KX5 D;  4LD9 B;  3VH5 A;  1KX3 B;  4R8P D;  3AZI C;  4JJN A;  3REH B;  3WA9 A;  3MGS B;  5AV8 D;  2CV5 C;  5DNM D;  1P3M C;  3AZG B;  4YS3 A;  2NZD D;  3O62 D;  3W98 B;  3LZ0 A;  4YM6 A;  5AVC C;  3W98 D;  3IP4 C;  1W2E A;  3KUY D;  1TAF A;  1H3O A;  4X23 A;  1P3L C;  3B0C T;  4J8W C;  3AN2 A;  3UTB C;  1TAF B;  4G92 C;  1P3K C;  1EQZ C;  5B24 A;  4ZUX D;  1P3F B;  4Z5T C;  2F8N K;  5B0Z D;  4WJ3 C;  3AZF C;  3X1T C;  5DNN A;  2Y2O A;  5AV8 A;  5AV6 A;  2ZY5 A;  3C1C C;  3AYW D;  3MGR B;  3UTB D;  4KGC C;  5GT0 A;  5AVB C;  1KX3 A;  4QLC B;  3KWQ B;  5B24 D;  3AFA D;  5B2J B;  3C1B D;  5CPK C;  2LY8 A;  2L5A A;  5B31 C;  3B0D C;  5E5A A;  3W96 D;  4QLC D;  3A6N C;  2HIO B;  2PYO B;  3MGP D;  3H0L C;  5B2I C;  4CSR A;  3WTP B;  3B6F C;  4KGC D;  1U35 C;  3REK C;  1EQZ B;  1ULY A;  3LZ1 B;  2YFW B;  3AZE C;  2PYO C;  3REJ B;  5CHL B;  2HUE B;  4J8V A;  4XZQ D;  4X23 B;  1P3P D;  4H9N A;  5B2I D;  3R45 A;  3FDD A;  5CPJ C;  3W98 A;  3AZI D;  1P34 A;  1Z2C B;  5BT1 D;  5GT3 D;  4KUD A;  2F2A C;  3LZ0 C;  3LEL A;  5AVC A;  3O62 C;  3AZI B;  1F66 B;  1BH9 A;  5AV5 B;  3AZF B;  4J8V B;  3X1T B;  1KX5 A;  4X23 C;  3WKJ B;  5CP6 B;  3EG5 B;  5CPK D;  1P3L D;  4R8P B;  5CPI B;  5B1M D;  1ZLA A;  3AZJ D;  3MGP B;  4H9S A;  3KWQ D;  4Z66 B;  3AZM B;  3AZH D;  4NFT A;  1P3I C;  1M1A B;  5F99 C;  4ZUX A;  2IO5 C;  3REH D;  4WU9 D;  1EQZ D;  5BNX B;  3KXB B;  2HIO A;  1M19 A;  3MGQ A;  5GXQ D;  2PYO D;  2NQB D;  4WU9 B;  5AV9 B;  2RIQ A;  4DRA A;  2FJ7 B;  3W99 A;  4KGC A;  3REI B;  4H9N B;  4QLC A;  5B33 C;  4H9R A;  2ARO B;  3AZK C;  1KX4 B;  2FJ7 A;  3X1S C;  3EPJ A;  3B6G A;  3WA9 C;  3UTA A;  3AN2 D;  5E5A C;  5B1M A;  1ZLA D;  3AYW B;  3UT9 A;  3X1V C;  4Z5T B;  4HGA B;  3MVD C;  4J8U C;  1P3F A;  4UPK A;  3MGP C;  4Z5T D;  3UT9 B;  4H9O B;  1P3O C;  3MGS D;  3MGQ D;  5BNV A;  3X1V B;  3B6G B;  1N1J B;  3AN2 C;  1P34 D;  3LJA D;  1KX4 A;  1F66 C;  4NE3 A;  5GT0 D;  1KX5 B;  4J8V C;  1P3K A;  4UUZ B;  5B2J C;  4NE5 A;  3VH6 W;  3LZ0 B;  4WU9 A;  3W98 C;  3AZL D;  3AZN C;  5B33 B;  2HIO D;  3WAA A;  4Z66 D;  5GXQ A;  4J8W D;  5BT1 C;  5DNM A;  3REL B;  3O62 A;  4UUZ A;  3P5J B;  5C3I C;  5AV9 D;  3NQU A;  3KXB C;  1U35 D;  3AZK D;  3X1U D;  1KX5 C;  1N1J A;  5BO0 A;  1P3P B;  5CPK A;  4R8P A;  4ZBJ B;  2IO5 B;  2Y2N A;  2F8N B;  4JJN D;  1ZLA C;  5GT3 B;  1S32 B;  4WU8 B;  3MNN B;  3AZJ C;  5AVC D;  1P3P C;  3WKJ C;  5CP6 C;  5F99 D;  3TU4 D;  4KUD B;  1P3O D;  3V9R B;  5C3I B;  2XD5 A;  5B40 D;  3W97 B;  2Y2I A;  1BH8 A;  3AZM D;  1F66 D;  4LD9 A;  1P3M A;  2ARO A;  5B40 B;  4YS3 C;  5AV9 A;  2CV5 B;  5B2J D;  3C1B B;  1BH8 B;  3REI A;  5JRG B;  5CPJ A;  3AV1 A;  3AZN D;  3X1S A;  4NE6 A;  2HUE C;  3W96 A;  5E5A D;  2G5H C;  5BNX A;  4J8W A;  2Y2K A;  5KDM B;  3EPH A;  1P3F C;  2F8N H;  4KHA B;  3UTB A;  3MGP A;  3AZE B;  3REJ D;  1S32 C;  1KX4 D;  2FFF B;  4EO5 B;  3KUY A;  1BFM A;  5CPI A;  3KFU G;  4G91 C;  1P3O A;  5FUG A;  5DNN D;  5B2I B;  3A1I A;  3H0R C;  4DRB A;  3KUY B;  2NQB C;  2RVQ D;  3AZF A;  1H3O B;  3X1T A;  5AVC B;  3LJA C;  4AWL B;  5B0Z B;  1P3A C;  5GSU A;  3AYW A;  2UWX A;  2W8S A;  3W97 D;  2JE5 A;  3WAA B;  5B40 C;  3UTA D;  3AZG A;  4YS3 B;  3X1U A;  3MGS A;  5AVB B;  5GSU B;  3LJA B;  5JRG A;  3W99 C; 
#chains in the Genus database with same CATH homology
 3KSY A;  1P3B B;  5B32 B;  3C1C D;  3REJ A;  1P3A D;  2ZY2 A;  2JCH A;  1P3I D;  2NZD B;  1JFI A;  3B6G C;  1P3I B;  1M1A C;  3UTA C;  1AOI A;  3REK B;  3EPL A;  2G5I C;  5B31 D;  4H9P B;  2PYO A;  4J8W B;  4CSR B;  3LEL D;  1TZY C;  5JA4 A;  5B1M B;  3AV2 C;  5B32 C;  3AZG D;  2ZY3 A;  4J8X A;  5E5A B;  3AL0 C;  2YFV A;  5B31 B;  3TU4 C;  1ID3 B;  3REL C;  1M1A D;  4H9R B;  1F66 A;  4XUJ B;  3AZH A;  3VH6 A;  3TU4 B;  4KUD D;  4YS3 D;  2NZD A;  3AV1 C;  4WU9 C;  4XZQ C;  1ID3 A;  3AZN A;  5JA4 B;  2FJ7 D;  1TZY B;  5BS7 C;  1P3L A;  2ZY4 A;  3MNN D;  4WU8 D;  1AOI D;  3AZJ B;  2BYK A;  5F99 B;  5B0Y A;  3VH5 T;  5GT3 C;  1S32 A;  5B24 B;  3WKJ D;  3AN2 B;  3B6F D;  1JFI B;  4WV4 B;  1M19 D;  1P3I A;  5B2I A;  4ZUX C;  4HGA C;  3X1S D;  3MVD B;  5JRG D;  5DNN C;  4H9Q A;  3AZL A;  1P3B C;  1P3M D;  3WTP A;  1WWS A;  4CAY B;  3AZJ A;  2Y2J A;  3AZK B;  4J8U D;  3KWQ C;  1P3G D;  5GXQ B;  2Y2M A;  3WA9 B;  2Y2H A;  3REH C;  2F8N D;  3REL D;  3AZK A;  3MGS C;  4XUJ A;  3AV1 B;  1HQ3 C;  5JRG C;  5B1L A;  4CAY A;  1B6W A;  2CV5 A;  3AFA A;  2F8N G;  4LD9 C;  1P34 C;  4H9Q B;  3AZL B;  1M18 D;  1P3F D;  5G49 B;  4KUD C;  3UT9 D;  4Z2M G;  1P3O B;  5AV6 B;  4M6B A;  3W97 A;  3LZ1 C;  1WWI A;  1M18 B;  1AOI C;  3B6G D;  2BG1 A;  1HQ3 D;  2RVQ C;  2BYK B;  3MGR D;  1R4V A;  4ZUX B;  3UTB B;  3AZE A;  5AV6 D;  2ZM5 A;  2CV5 D;  1TZY A;  1Q9C A;  4DQY B;  3AV2 A;  1AOI B;  3X1S B;  3MVD D;  3A6N B;  4J8X C;  5B2J A;  2Y2G A;  1KU5 A;  1P3B D;  1P3M B;  1BH9 B;  3C1C A;  3WTP D;  4KGC B;  3LJA A;  3LEL B;  1P3G B;  1P3A A;  2YFV B;  5GT0 C;  3X1U B;  5B33 D;  4WNN A;  2Y2P A;  5AVB A;  1KX3 C;  5AV8 B;  1ID3 D;  3AV1 D;  2NQB B;  2XD1 A;  4JJN B;  3WA9 D;  3MNN C;  4WU8 C;  2CWE A;  4Z66 C;  3F6T A;  4AWL C;  5B0Y C;  3AZM A;  5B1M C;  1M18 A;  3B0B A;  3UT9 C;  3X1V A;  4J8U A;  3H0M C;  4XUJ D;  5BO0 B;  1P3P A;  5CPJ D;  1M19 C;  5AVB D;  3MGQ C;  4KHA A;  5B31 G;  5B0Y B;  5AV5 C;  1U35 B;  3WAA D;  3AZI A;  4JJN C;  5KDM A;  1HQ3 B;  4J8V D;  4E44 A;  2VQR A;  4QLC C;  3A6N D;  1KX4 C;  3AZN B;  1P3G C;  2FJ7 C;  3TU4 A;  1B67 A;  3REI C;  4XUJ C;  5B0Z C;  1P3A B;  5B1L C;  3REK D;  3C1C B;  3C1B A;  3NQJ A;  1F1E A;  3WAA C;  5AV5 D;  1PZR A;  3VH5 W;  4LD9 D;  3MGR A;  3AZE D;  5DNM C;  3AZH C;  5B32 G;  5FUG B;  4WZS B;  2NZD C;  3KXB D;  5BNV B;  3X1V D;  1ID3 C;  5AY8 B;  3LZ1 A;  3W97 C;  5DNN B;  4H9O A;  5BS7 A;  5B24 C;  5B32 D;  3KUY C;  3W96 B;  2DF4 C;  4G92 B;  5GT3 A;  5AY8 C;  1P3L B;  5AV6 C;  3B0D B;  2F8N A;  3AZH B;  5CP6 A;  4J8X D;  5GSU D;  3AZL C;  1P3B A;  3W99 B;  4XZQ B;  4X23 D;  3NQU B;  5B1L B;  4Z2M H;  5B31 A;  3V9R A;  1TZY D;  5B33 A;  1HTA A;  3AV2 D;  5AV9 C;  3REH A;  4YM6 C;  5CPI D;  3B6F A;  1HQ3 A;  4H9P A;  1P3K B;  2DQN C;  4Z66 A;  3AFA C;  2Y2L A;  2JSS A;  3LZ0 D;  3W96 C;  3MVD A;  4G91 B;  2BYM B;  1P3K D;  4E45 A;  2YFW A;  5CP6 D;  1EQZ A;  5CPI C;  4YM6 D;  3O62 B;  5AV5 A;  4Z5T A;  3VH6 T;  3X1T D;  3AZF D;  3B6F B;  5DNM B;  4YM6 B;  3REL A;  5AY8 D;  3WTP E;  2NQB A;  5AV8 C;  2ARO C;  4WNN B;  1P34 B;  1P3G A;  5CPJ B;  3R45 B;  3LEL C;  1T3U A;  5B0Z A;  3EPK A;  5GSU C;  4XZQ A;  3NQJ B;  3LZ1 D;  3REI D;  3C1B C;  5GXQ C;  5B1L D;  5B0Y D;  3MGR C;  3W99 D;  3B0C W;  3AV2 B;  4J8X B;  2ARO D;  3A6N A;  3KXB A;  1M19 B;  4H9S C;  3MGQ B;  3REJ C;  1S32 D;  5F99 A;  4R8P C;  1U35 A;  2J8P A;  4WU8 A;  3MNN A;  3A1K A;  4EO5 C;  3REK A;  1M1A A;  2HIO C;  3AZM C;  5AY8 A;  1M18 C;  4J8U B;  3UTA B;  4ZBJ C;  2BYM A;  3WTP C;  5CPK B;  1ZLA B;  3WKJ A;  2Y2Q A;  5G49 A;  3AYW C;  1A7W A;  3KWQ A;  1KX3 D;  5B40 A;  3AZG C;  3AFA B;  5GT0 B;  3X1U C;  5B32 A;  1KX5 D;  4LD9 B;  3VH5 A;  1KX3 B;  4R8P D;  3AZI C;  4JJN A;  3REH B;  3WA9 A;  3MGS B;  5AV8 D;  2CV5 C;  5DNM D;  1P3M C;  3AZG B;  4YS3 A;  2NZD D;  3O62 D;  3W98 B;  3LZ0 A;  4YM6 A;  5AVC C;  3W98 D;  3IP4 C;  1W2E A;  3KUY D;  1TAF A;  1H3O A;  4X23 A;  1P3L C;  3B0C T;  4J8W C;  3AN2 A;  3UTB C;  1TAF B;  4G92 C;  1P3K C;  1EQZ C;  5B24 A;  4ZUX D;  1P3F B;  4Z5T C;  2F8N K;  5B0Z D;  4WJ3 C;  3AZF C;  3X1T C;  5DNN A;  2Y2O A;  5AV8 A;  5AV6 A;  2ZY5 A;  3C1C C;  3AYW D;  3MGR B;  3UTB D;  4KGC C;  5GT0 A;  5AVB C;  1KX3 A;  4QLC B;  3KWQ B;  5B24 D;  3AFA D;  5B2J B;  3C1B D;  5CPK C;  2LY8 A;  2L5A A;  5B31 C;  3B0D C;  5E5A A;  3W96 D;  4QLC D;  3A6N C;  2HIO B;  2PYO B;  3MGP D;  3H0L C;  5B2I C;  4CSR A;  3WTP B;  3B6F C;  4KGC D;  1U35 C;  3REK C;  1EQZ B;  1ULY A;  3LZ1 B;  2YFW B;  3AZE C;  2PYO C;  3REJ B;  5CHL B;  2HUE B;  4J8V A;  4XZQ D;  4X23 B;  1P3P D;  4H9N A;  5B2I D;  3R45 A;  3FDD A;  5CPJ C;  3W98 A;  3AZI D;  1P34 A;  1Z2C B;  5BT1 D;  5GT3 D;  4KUD A;  2F2A C;  3LZ0 C;  3LEL A;  5AVC A;  3O62 C;  3AZI B;  1F66 B;  1BH9 A;  5AV5 B;  3AZF B;  4J8V B;  3X1T B;  1KX5 A;  4X23 C;  3WKJ B;  5CP6 B;  3EG5 B;  5CPK D;  1P3L D;  4R8P B;  5CPI B;  5B1M D;  1ZLA A;  3AZJ D;  3MGP B;  4H9S A;  3KWQ D;  4Z66 B;  3AZM B;  3AZH D;  4NFT A;  1P3I C;  1M1A B;  5F99 C;  4ZUX A;  2IO5 C;  3REH D;  4WU9 D;  1EQZ D;  5BNX B;  3KXB B;  2HIO A;  1M19 A;  3MGQ A;  5GXQ D;  2PYO D;  2NQB D;  4WU9 B;  5AV9 B;  2RIQ A;  4DRA A;  2FJ7 B;  3W99 A;  4KGC A;  3REI B;  4H9N B;  4QLC A;  5B33 C;  4H9R A;  2ARO B;  3AZK C;  1KX4 B;  2FJ7 A;  3X1S C;  3EPJ A;  3B6G A;  3WA9 C;  3UTA A;  3AN2 D;  5E5A C;  5B1M A;  1ZLA D;  3AYW B;  3UT9 A;  3X1V C;  4Z5T B;  4HGA B;  3MVD C;  4J8U C;  1P3F A;  4UPK A;  3MGP C;  4Z5T D;  3UT9 B;  4H9O B;  1P3O C;  3MGS D;  3MGQ D;  5BNV A;  3X1V B;  3B6G B;  1N1J B;  3AN2 C;  1P34 D;  3LJA D;  1KX4 A;  1F66 C;  4NE3 A;  5GT0 D;  1KX5 B;  4J8V C;  1P3K A;  4UUZ B;  5B2J C;  4NE5 A;  3VH6 W;  3LZ0 B;  4WU9 A;  3W98 C;  3AZL D;  3AZN C;  5B33 B;  2HIO D;  3WAA A;  4Z66 D;  5GXQ A;  4J8W D;  5BT1 C;  5DNM A;  3REL B;  3O62 A;  4UUZ A;  3P5J B;  5C3I C;  5AV9 D;  3NQU A;  3KXB C;  1U35 D;  3AZK D;  3X1U D;  1KX5 C;  1N1J A;  5BO0 A;  1P3P B;  5CPK A;  4R8P A;  4ZBJ B;  2IO5 B;  2Y2N A;  2F8N B;  4JJN D;  1ZLA C;  5GT3 B;  1S32 B;  4WU8 B;  3MNN B;  3AZJ C;  5AVC D;  1P3P C;  3WKJ C;  5CP6 C;  5F99 D;  3TU4 D;  4KUD B;  1P3O D;  3V9R B;  5C3I B;  2XD5 A;  5B40 D;  3W97 B;  2Y2I A;  1BH8 A;  3AZM D;  1F66 D;  4LD9 A;  1P3M A;  2ARO A;  5B40 B;  4YS3 C;  5AV9 A;  2CV5 B;  5B2J D;  3C1B B;  1BH8 B;  3REI A;  5JRG B;  5CPJ A;  3AV1 A;  3AZN D;  3X1S A;  4NE6 A;  2HUE C;  3W96 A;  5E5A D;  2G5H C;  5BNX A;  4J8W A;  2Y2K A;  5KDM B;  3EPH A;  1P3F C;  2F8N H;  4KHA B;  3UTB A;  3MGP A;  3AZE B;  3REJ D;  1S32 C;  1KX4 D;  2FFF B;  4EO5 B;  3KUY A;  1BFM A;  5CPI A;  3KFU G;  4G91 C;  1P3O A;  5FUG A;  5DNN D;  5B2I B;  3A1I A;  3H0R C;  4DRB A;  3KUY B;  2NQB C;  2RVQ D;  3AZF A;  1H3O B;  3X1T A;  5AVC B;  3LJA C;  4AWL B;  5B0Z B;  1P3A C;  5GSU A;  3AYW A;  2UWX A;  2W8S A;  3W97 D;  2JE5 A;  3WAA B;  5B40 C;  3UTA D;  3AZG A;  4YS3 B;  3X1U A;  3MGS A;  5AVB B;  5GSU B;  3LJA B;  5JRG A;  3W99 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...