3WKJC

The nucleosome containing human tsh2b
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
AKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structure of human nucleosome containing the testis-specific histone variant TSH2B
doi rcsb
source organism Homo sapiens
total genus 32
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3wkjC00
3AZJB 3W99C 1S32D 1P3IC 2NZDA 2PYOA 3REHA 2BYKB 5B32C 1KX3C 5B1MD 3AZFC 3AZEB 4XZQC 3B6GB 1HQ3C 4J8XA 5B40B 3WTPC 3WAAB 5AVBB 5CPIC 3RELD 2F8NH 2JSSA 4G92C 3X1SC 1P3PB 3UTBD 5AV8C 4Z66A 3C1CB 5B2IC 4J8WD 3WTPE 3R45A 5AY8D 5B24B 4NE6A 4X23D 1ID3B 1EQZB 4J8UB 5GT3B 1TZYC 5CPID 5B33B 3KXBC 3NQUB 4DRBA 3AV1C 1P3OB 1BH9A 4YM6B 3VH6A 3MGQB 4DRAA 3X1UD 3REKC 1P3LD 5DNMC 4H9PA 4QLCC 1P3MA 1KX4D 3LZ0A 3O62A 3C1BB 1P3BA 4LD9A 5CPJB 4Z5TC 3WKJB 1P3MC 3UTAC 1ZLAC 3REKD 3B6FB 4WU9A 4E44A 4KHAA 3KUYD 4AWLB 1S32B 2FJ7C 3B0DC 1P34B 2CV5B 1Q9CA 4XUJC 3REID 5GSUB 3UTAD 3MGRB 5B0ZC 3LELB 3AZLD 1WWIA 4ZBJC 5GT0D 1KX5A 3W98D 4J8VA 3MNND 1P3IB 3W99B 4KUDA 3UT9A 5AVCD 1KX3B 5B32B 1H3OA 4XUJD 3AZFB 4H9QB 3AZND 4XZQB 1HQ3B 2CWEA 1P3FD 4KUDC 3WTPB 5JA4A 3MGPA 1M1AA 5CPIB 3AZJA 3UT9C 5B0YD 4G92B 2BYKA 3X1SB 5AV8B 5B2IB 3AZEA 5CP6C 3B6GA 3AZGC 1M1AC 3AZJC 3LZ1D 5B40A 3WAAA 2F8ND 5AVBA 3MGSC 1TZYB 3KXBB 5B1LC 1P3PA 3AV1B 3C1CA 1P3GD 1M19D 3AFAD 4CAYB 4JJND 5B24A 1ID3A 3REKB 4WU8C 3X1TD 4QLCB 5DNMB 4J8UA 5GT3A 5B33A 3NQUA 2NQBD 1P3OA 5B24C 1F1EA 5JRGD 3REIB 4Z5TB 1P3KC 4H9OB 3NQJB 1P3MB 3UTAB 4J8UC 2BYMB 1ZLAB 4R8PD 4YS3D 1M18C 2FJ7B 3B0DB 3C1BA 1P3AC 5CPJA 3WKJA 1U35C 4XUJB 5AV5D 3AZNB 3TU4C 3B6FA 5B0ZB 4ZBJB 1S32A 1P34A 3X1VC 3AYWC 1P3AD 3AV2D 1JFIB 4ZUXC 5GSUA 3AZID 3MGRA 3LELA 4KUDB 2HUEC 5B1MC 1P3IA 3AZKD 5B31D 3UTBA 3AN2D 1KX3A 5B32A 5AV6C 1M19B 3VH5A 3RELC 5FUGA 4XZQA 5CP6B 5AV9D 3AZGB 1HQ3A 1M1AB 1BFMA 3WTPA 3UTBC 1AOID 3MGSB 5CPIA 4J8WC 5BT1D 5AY8C 5B1LB 3X1SA 4E45A 5AV8A 4X23C 5B2IA 5AV6D 3VH6W 3REJC 3A6ND 5G49B 4WU8B 1KX4A 1TZYA 3KXBA 5GXQD 4WNNA 3X1UC 3AV1A 1P3LC 4CAYA 1KX4C 3W96D 1P3KB 1A7WA 3KWQD 3REJD 3REKA 5DNMA 4QLCA 5E5AC 5KDMB 4Z2MG 3AZMD 1M18B 3B0CW 1P3AB 3REIA 3VH6T 2AROD 4Z5TA 4H9OA 3NQJA 1U35B 3UTAA 5B2JC 2BYMA 3KUYC 3W97D 1ZLAA 3TU4B 5GT0A 4H9NB 5CPKD 5E5AD 3AZHD 3REIC 2FJ7A 3X1VB 3AYWB 4H9RB 2YFWB 4XUJA 4ZUXB 4G91C 3AZLC 2NZDD 5GT0C 2PYOD 3W98C 5B2JD 3AZNA 3REHD 3MNNC 5B0ZA 1AOIB 5F99D 5AVCC 2F8NG 3B0CT 2HUEB 5B1MB 4J8XD 3AZNC 1JFIA 3V9RB 5AV6B 1P3FC 3RELB 5B0YC 4Z66D 3UTBB 4J8WB 5AY8B 5FUGB 3LZ1C 1M19A 4X23B 5CP6A 3AZGA 3REJB 3WA9C 3MGSA 1P3GC 1M19C 3AFAC 4JJNC 5B1LA 3X1UB 3O62D 1P3LB 3X1TC 2HIOD 1KX4B 4HGAC 1P3BD 4LD9D 2NQBC 5G49A 4WU8A 3WA9D 5E5AB 4WNNB 5JRGC 1F66D 4WU9D 3MVDC 4R8PC 1P3KA 4YS3C 5BNXB 5B2JB 3KUYB 5KDMA 1M18A 4NE5A 5AV5C 3MVDD 1P3AA 3AV2A 1KX5D 4J8VD 5B31G 1U35A 3AZLB 4G91B 5GT0B 3W98B 3TU4A 4KGCD 3MNNB 4H9NA 5BNVB 2IO5C 5BO0B 3AV2C 5AVCB 5B31A 3AYWA 3X1VA 4H9RA 3AZIC 4WV4B 2YFWA 3MGPD 4ZUXA 2YFVB 1P3FB 3VH5W 1TAFB 4H9SC 5B0YB 3AZKC 5B31C 1AOIA 5DNND 3AZED 3AN2C 3B6GD 5B1MA 3B0BA 4M6BA 5B40D 3WAAD 5AVBD 5AV9C 3V9RA 5AV6A 3LZ1B 1N1JB 2F8NB 3RELA 1AOIC 3A6NA 1P3PD 3C1CD 5BT1C 3WA9B 4J8WA 1P3GB 1WWSA 3AFAB 1ID3D 1EQZD 5AY8A 4JJNB 3A6NC 5B33D 4X23A 2RVQD 3X1TB 1P3OD 4HGAB 3REJA 4NFTA 4YM6D 3MGQD 2NQBB 5GXQC 4NE3A 3W96C 5JRGB 3MVDB 3KWQC 3X1UA 3LJAC 1P3LA 4R8PB 3W97A 3C1BD 4YS3B 3AZMC 5CPJD 3WKJD 4UUZB 5E5AA 5BS7A 2AROC 3B6FD 3W97C 5AV5B 3LJAD 1P34D 4CSRA 5BNXA 5B2JA 5CPKC 2CV5D 3KUYA 3AZHC 5BS7C 5GSUD 5F99A 5DNNB 2IO5B 3KSYA 3AV2B 3MGRD 3LELD 2NZDC 2PYOC 3REHC 3AZIB 3W99D 3AZLA 1P3ID 5F99C 3W98A 2L5AA 1KX3D 5B32D 4J8XC 3MNNA 3AZKB 5BNVA 3AZFD 5BO0A 5B31B 4XZQD 5AVCA 3AN2B 1HQ3D 3WTPD 4Z66C 5AV9B 2YFVA 1P3FA 3X1SD 1TAFA 5B0YA 5AV8D 5B2ID 5CHLB 3A6NB 3LZ1A 1TZYD 3KXBD 4EO5C 1N1JA 2HIOA 2F8NA 3AV1D 3WA9A 5GXQB 3LZ0C 5C3IC 3O62C 1F66A 1P3GA 3AFAA 2HIOC 5DNMD 4QLCD 4JJNA 2LY8A 3W96B 1P3BC 4LD9C 3KWQB 3LJAB 3X1TA 1F66C 3AZMB 2NQBA 4Z5TD 4WU9C 1P3MD 3LZ0D 1ZLAD 5JRGA 2AROB 3MVDA 1BH8B 3W97B 4R8PA 2FJ7D 4YS3A 5CPKB 3AZHB 4KGCA 4UUZA 1KX5C 4J8VC 5B0ZD 2NZDB 4CSRB 2PYOB 5AV5A 3REHB 4KGCC 5F99B 4J8XB 5DNNA 3MGPC 4KUDD 3AZIA 4Z66B 3UT9D 1B67A 5DNNC 3AZEC 3B6GC 3R45B 4H9SA 3WAAC 5B40C 3AZKA 5AVBC 5CP6D 3AN2A 1B6WA 3AZGD 3AZJD 1M1AD 2F8NK 1EQZA 1ULYA 1P3PC 3MGSD 3C1CC 5AV9A 1BH9B 4EO5B 5B1LD 4YM6A 1ID3C 3MGQA 1EQZC 4H9PB 5GT3C 3LZ0B 5C3IB 3O62B 2RVQC 5B33C 4WU8D 1P3OC 2HIOB 1P3BB 4YM6C 4LD9B 3MGQC 5B24D 1F66B 4WZSB 5GXQA 4WU9B 1R4VA 1P3KD 4J8UD 4KHAB 5GT3D 3W96A 3VH5T 3C1BC 3KWQA 5CPJC 3LJAA 3WKJC 1M18D 2CV5A 3AZMA 3B6FC 1U35D 5B32G 4AWLC 1HTAA 1S32C 4J8VB 1KX5B 4Z2MH 2AROA 3TU4D 1P34C 2CV5C 1BH8A 3UT9B 3W99A 4KGCB 5GSUC 1H3OB 3X1VD 3AYWD 5CPKA 3AZHA 3MGRC 3LELC 4ZUXD 3AZFA 4H9QA 1KU5A 5JA4B 3MGPB
chains in the Genus database with same CATH superfamily
3AZJB 3W99C 1S32D 1P3IC 2NZDA 2PYOA 3REHA 2BYKB 5B32C 1KX3C 5B1MD 3AZFC 3AZEB 4XZQC 3B6GB 1HQ3C 4J8XA 5B40B 3WTPC 3WAAB 5AVBB 5CPIC 3RELD 2F8NH 2JSSA 4G92C 3X1SC 1P3PB 3UTBD 5AV8C 4Z66A 3C1CB 5B2IC 4J8WD 3WTPE 3R45A 5AY8D 5B24B 4NE6A 4X23D 1ID3B 1EQZB 4J8UB 5GT3B 1TZYC 5CPID 5B33B 3KXBC 3NQUB 4DRBA 3AV1C 1P3OB 1BH9A 4YM6B 3VH6A 3MGQB 4DRAA 3X1UD 3REKC 2ZM5A 1P3LD 5DNMC 4H9PA 4QLCC 1P3MA 1KX4D 3LZ0A 3O62A 1W2EA 2G5HC 3C1BB 1P3BA 4LD9A 5CPJB 4Z5TC 3WKJB 1P3MC 3UTAC 1ZLAC 3A1IA 3REKD 3B6FB 4WU9A 4E44A 4KHAA 3KUYD 4AWLB 1S32B 2FJ7C 3B0DC 1P34B 2CV5B 1Q9CA 4XUJC 3REID 5GSUB 3UTAD 2DF4C 3MGRB 5B0ZC 3LELB 3AZLD 1WWIA 4ZBJC 5GT0D 1KX5A 3W98D 4J8VA 3MNND 1P3IB 3W99B 4KUDA 2XD5A 3UT9A 5AVCD 1KX3B 5B32B 1H3OA 4XUJD 3AZFB 4H9QB 3AZND 4XZQB 1HQ3B 2CWEA 1P3FD 4KUDC 3WTPB 5JA4A 3MGPA 1M1AA 5CPIB 3AZJA 3UT9C 5B0YD 2ZY5A 4G92B 4DQYB 2BYKA 3X1SB 5AV8B 3FDDA 5B2IB 3EPHA 3AZEA 5CP6C 3B6GA 4WJ3C 3AZGC 1M1AC 3AZJC 3LZ1D 5B40A 3WAAA 2F8ND 5AVBA 3MGSC 1TZYB 3KXBB 5B1LC 1P3PA 3AV1B 3C1CA 1P3GD 1M19D 3AFAD 4CAYB 4JJND 5B24A 1ID3A 3REKB 4WU8C 3X1TD 4QLCB 5DNMB 4J8UA 5GT3A 5B33A 2J8PA 3NQUA 2NQBD 1P3OA 5B24C 3IP4C 2Y2PA 1F1EA 5JRGD 3REIB 4Z5TB 1P3KC 4H9OB 3NQJB 1P3MB 3UTAB 4J8UC 2BYMB 1ZLAB 4R8PD 2DQNC 4YS3D 1M18C 2FJ7B 3B0DB 3C1BA 1P3AC 2UWXA 5CPJA 3WKJA 1U35C 4XUJB 5AV5D 3AZNB 3TU4C 3B6FA 5B0ZB 4ZBJB 1S32A 1P34A 3X1VC 3AYWC 1P3AD 3AV2D 1JFIB 4ZUXC 5GSUA 2ZY2A 3AZID 3MGRA 3LELA 2FFFB 4KUDB 2HUEC 5B1MC 1P3IA 3AZKD 5B31D 3UTBA 3AN2D 1KX3A 5B32A 5AV6C 1M19B 3VH5A 3RELC 5FUGA 4XZQA 5CP6B 5AV9D 3AZGB 1HQ3A 1M1AB 1BFMA 3WTPA 3UTBC 1AOID 3MGSB 5CPIA 3H0RC 4J8WC 5BT1D 5AY8C 2Y2IA 5B1LB 3X1SA 2RIQA 4E45A 5AV8A 4X23C 5B2IA 5AV6D 3VH6W 3REJC 3A6ND 5G49B 4WU8B 1KX4A 1TZYA 3KXBA 5GXQD 4WNNA 3X1UC 3AV1A 1P3LC 4CAYA 1KX4C 3W96D 1P3KB 1A7WA 3KWQD 3REJD 3REKA 5DNMA 4QLCA 5E5AC 5KDMB 4Z2MG 3AZMD 1M18B 3B0CW 1P3AB 3REIA 3VH6T 2AROD 4Z5TA 4H9OA 3NQJA 1U35B 3UTAA 5B2JC 2JCHA 2BYMA 3KUYC 3W97D 1ZLAA 3TU4B 5GT0A 4H9NB 2Y2KA 5CPKD 5E5AD 3AZHD 3REIC 2FJ7A 3X1VB 3AYWB 4H9RB 2YFWB 4XUJA 4ZUXB 4G91C 3AZLC 2NZDD 5GT0C 2PYOD 3W98C 5B2JD 3AZNA 3REHD 3MNNC 5B0ZA 1AOIB 5F99D 5AVCC 2F8NG 3B0CT 2HUEB 5B1MB 4J8XD 3AZNC 1JFIA 3V9RB 2Y2GA 3A1KA 5AV6B 1P3FC 3RELB 5B0YC 4Z66D 3UTBB 4J8WB 5AY8B 5FUGB 3LZ1C 1M19A 4X23B 5CP6A 3AZGA 3REJB 1T3UA 3WA9C 4UPKA 3MGSA 1P3GC 1M19C 3AFAC 4JJNC 5B1LA 3X1UB 3O62D 3H0MC 1P3LB 3X1TC 2HIOD 2Y2OA 1KX4B 4HGAC 1P3BD 4LD9D 2VQRA 2NQBC 5G49A 4WU8A 3WA9D 5E5AB 4WNNB 5JRGC 1F66D 4WU9D 3MVDC 4R8PC 1P3KA 4YS3C 5BNXB 5B2JB 3KUYB 3EPJA 5KDMA 2XD1A 1M18A 4NE5A 5AV5C 3MVDD 1P3AA 3AV2A 1KX5D 4J8VD 5B31G 1U35A 3AZLB 4G91B 5GT0B 3W98B 2Y2HA 3TU4A 4KGCD 3MNNB 4H9NA 5BNVB 2IO5C 5BO0B 3AV2C 2Y2LA 5AVCB 5B31A 3AYWA 3X1VA 4H9RA 3AZIC 4WV4B 2YFWA 3MGPD 4ZUXA 2YFVB 1P3FB 2G5IC 3VH5W 1TAFB 4H9SC 5B0YB 3AZKC 5B31C 1AOIA 5DNND 3AZED 3AN2C 3B6GD 5B1MA 2F2AC 3B0BA 4M6BA 5B40D 3WAAD 5AVBD 5AV9C 3V9RA 5AV6A 3LZ1B 1N1JB 2F8NB 3RELA 1AOIC 3A6NA 1P3PD 3C1CD 5BT1C 3WA9B 3P5JB 4J8WA 1P3GB 1WWSA 3AFAB 1ID3D 1EQZD 5AY8A 4JJNB 3A6NC 5B33D 4X23A 2RVQD 3X1TB 1P3OD 4HGAB 3REJA 4NFTA 4YM6D 3MGQD 2NQBB 5GXQC 4NE3A 3W96C 1PZRA 5JRGB 3MVDB 3KWQC 3X1UA 3LJAC 1P3LA 2ZY4A 4R8PB 3W97A 3C1BD 4YS3B 3AZMC 5CPJD 3WKJD 4UUZB 5E5AA 5BS7A 2AROC 3B6FD 3W97C 5AV5B 3LJAD 1P34D 4CSRA 5BNXA 5B2JA 5CPKC 2CV5D 3KUYA 3AZHC 5BS7C 5GSUD 5F99A 5DNNB 2IO5B 3KSYA 3AV2B 3MGRD 3LELD 2NZDC 2PYOC 3EPLA 3REHC 2JE5A 3AZIB 3W99D 3AZLA 1P3ID 5F99C 3W98A 2L5AA 1KX3D 5B32D 4J8XC 3MNNA 3AZKB 5BNVA 3AZFD 5BO0A 5B31B 2BG1A 4XZQD 5AVCA 3AN2B 1HQ3D 3KFUG 3WTPD 4Z66C 5AV9B 2YFVA 1P3FA 3X1SD 1TAFA 5AV8D 5B0YA 5B2ID 5CHLB 3EG5B 3A6NB 3LZ1A 1TZYD 3KXBD 4EO5C 1N1JA 2HIOA 2F8NA 3AV1D 3WA9A 5GXQB 3LZ0C 5C3IC 3O62C 1F66A 1P3GA 3AFAA 2HIOC 5DNMD 4QLCD 4JJNA 2LY8A 3W96B 1P3BC 4LD9C 3KWQB 3LJAB 3X1TA 1F66C 3AZMB 2NQBA 4Z5TD 4WU9C 1P3MD 3LZ0D 1ZLAD 5JRGA 2AROB 3MVDA 1BH8B 3W97B 2Y2MA 4R8PA 2FJ7D 4YS3A 5CPKB 3AZHB 4KGCA 4UUZA 1KX5C 4J8VC 5B0ZD 2NZDB 4CSRB 2PYOB 5AV5A 3REHB 4KGCC 2Y2QA 5F99B 2Y2JA 4J8XB 2Y2NA 5DNNA 3MGPC 4KUDD 3AZIA 4Z66B 3UT9D 1B67A 5DNNC 3AZEC 3B6GC 3R45B 3F6TA 2W8SA 4H9SA 3WAAC 5B40C 3AZKA 5AVBC 5CP6D 3AN2A 1B6WA 3AZGD 3AZJD 1M1AD 2F8NK 1EQZA 1ULYA 1P3PC 3MGSD 3C1CC 5AV9A 1BH9B 3H0LC 4EO5B 5B1LD 4YM6A 3EPKA 1ID3C 3MGQA 1EQZC 4H9PB 5GT3C 3LZ0B 5C3IB 3O62B 2RVQC 5B33C 4WU8D 1P3OC 2HIOB 2ZY3A 1P3BB 4YM6C 1Z2CB 4LD9B 3MGQC 5B24D 1F66B 4WZSB 5GXQA 4WU9B 1R4VA 1P3KD 4J8UD 4KHAB 5GT3D 3W96A 3VH5T 3C1BC 3KWQA 5CPJC 3LJAA 3WKJC 1M18D 2CV5A 3AZMA 3B6FC 1U35D 5B32G 4AWLC 1HTAA 1S32C 4J8VB 1KX5B 4Z2MH 2AROA 3TU4D 1P34C 3AL0C 2CV5C 1BH8A 3UT9B 3W99A 4KGCB 5GSUC 1H3OB 3X1VD 3AYWD 5CPKA 3AZHA 3MGRC 3LELC 4ZUXD 3AZFA 4H9QA 1KU5A 5JA4B 3MGPB
chains in the Genus database with same CATH topology
3AZJB 3W99C 1S32D 1P3IC 2NZDA 2PYOA 3REHA 2BYKB 5B32C 1KX3C 5B1MD 3AZFC 3AZEB 4XZQC 3B6GB 1HQ3C 4J8XA 5B40B 3WTPC 3WAAB 5AVBB 5CPIC 3RELD 2F8NH 2JSSA 4G92C 3X1SC 1P3PB 3UTBD 5AV8C 4Z66A 3C1CB 5B2IC 4J8WD 3WTPE 3R45A 5AY8D 5B24B 4NE6A 4X23D 1ID3B 1EQZB 4J8UB 5GT3B 1TZYC 5CPID 5B33B 3KXBC 3NQUB 4DRBA 3AV1C 1P3OB 1BH9A 4YM6B 3VH6A 3MGQB 4DRAA 3X1UD 3REKC 2ZM5A 1P3LD 5DNMC 4H9PA 4QLCC 1P3MA 1KX4D 3LZ0A 3O62A 1W2EA 2G5HC 3C1BB 1P3BA 4LD9A 5CPJB 4Z5TC 3WKJB 1P3MC 3UTAC 1ZLAC 3A1IA 3REKD 3B6FB 4WU9A 4E44A 4KHAA 3KUYD 4AWLB 1S32B 2FJ7C 3B0DC 1P34B 2CV5B 1Q9CA 4XUJC 3REID 5GSUB 3UTAD 2DF4C 3MGRB 5B0ZC 3LELB 3AZLD 1WWIA 4ZBJC 5GT0D 1KX5A 3W98D 4J8VA 3MNND 1P3IB 3W99B 4KUDA 2XD5A 3UT9A 5AVCD 1KX3B 5B32B 1H3OA 4XUJD 3AZFB 4H9QB 3AZND 4XZQB 1HQ3B 2CWEA 1P3FD 4KUDC 3WTPB 5JA4A 3MGPA 1M1AA 5CPIB 3AZJA 3UT9C 5B0YD 2ZY5A 4G92B 4DQYB 2BYKA 3X1SB 5AV8B 3FDDA 5B2IB 3EPHA 3AZEA 5CP6C 3B6GA 4WJ3C 3AZGC 1M1AC 3AZJC 3LZ1D 5B40A 3WAAA 2F8ND 5AVBA 3MGSC 1TZYB 3KXBB 5B1LC 1P3PA 3AV1B 3C1CA 1P3GD 1M19D 3AFAD 4CAYB 4JJND 5B24A 1ID3A 3REKB 4WU8C 3X1TD 4QLCB 5DNMB 4J8UA 5GT3A 5B33A 2J8PA 3NQUA 2NQBD 1P3OA 5B24C 3IP4C 2Y2PA 1F1EA 5JRGD 3REIB 4Z5TB 1P3KC 4H9OB 3NQJB 1P3MB 3UTAB 4J8UC 2BYMB 1ZLAB 4R8PD 2DQNC 4YS3D 1M18C 2FJ7B 3B0DB 3C1BA 1P3AC 2UWXA 5CPJA 3WKJA 1U35C 4XUJB 5AV5D 3AZNB 3TU4C 3B6FA 5B0ZB 4ZBJB 1S32A 1P34A 3X1VC 3AYWC 1P3AD 3AV2D 1JFIB 4ZUXC 5GSUA 2ZY2A 3AZID 3MGRA 3LELA 2FFFB 4KUDB 2HUEC 5B1MC 1P3IA 3AZKD 5B31D 3UTBA 3AN2D 1KX3A 5B32A 5AV6C 1M19B 3VH5A 3RELC 5FUGA 4XZQA 5CP6B 5AV9D 3AZGB 1HQ3A 1M1AB 1BFMA 3WTPA 3UTBC 1AOID 3MGSB 5CPIA 3H0RC 4J8WC 5BT1D 5AY8C 2Y2IA 5B1LB 3X1SA 2RIQA 4E45A 5AV8A 4X23C 5B2IA 5AV6D 3VH6W 3REJC 3A6ND 5G49B 4WU8B 1KX4A 1TZYA 3KXBA 5GXQD 4WNNA 3X1UC 3AV1A 1P3LC 4CAYA 1KX4C 3W96D 1P3KB 1A7WA 3KWQD 3REJD 3REKA 5DNMA 4QLCA 5E5AC 5KDMB 4Z2MG 3AZMD 1M18B 3B0CW 1P3AB 3REIA 3VH6T 2AROD 4Z5TA 4H9OA 3NQJA 1U35B 3UTAA 5B2JC 2JCHA 2BYMA 3KUYC 3W97D 1ZLAA 3TU4B 5GT0A 4H9NB 2Y2KA 5CPKD 5E5AD 3AZHD 3REIC 2FJ7A 3X1VB 3AYWB 4H9RB 2YFWB 4XUJA 4ZUXB 4G91C 3AZLC 2NZDD 5GT0C 2PYOD 3W98C 5B2JD 3AZNA 3REHD 3MNNC 5B0ZA 1AOIB 5F99D 5AVCC 2F8NG 3B0CT 2HUEB 5B1MB 4J8XD 3AZNC 1JFIA 3V9RB 2Y2GA 3A1KA 5AV6B 1P3FC 3RELB 5B0YC 4Z66D 3UTBB 4J8WB 5AY8B 5FUGB 3LZ1C 1M19A 4X23B 5CP6A 3AZGA 3REJB 1T3UA 3WA9C 4UPKA 3MGSA 1P3GC 1M19C 3AFAC 4JJNC 5B1LA 3X1UB 3O62D 3H0MC 1P3LB 3X1TC 2HIOD 2Y2OA 1KX4B 4HGAC 1P3BD 4LD9D 2VQRA 2NQBC 5G49A 4WU8A 3WA9D 5E5AB 4WNNB 5JRGC 1F66D 4WU9D 3MVDC 4R8PC 1P3KA 4YS3C 5BNXB 5B2JB 3KUYB 3EPJA 5KDMA 2XD1A 1M18A 4NE5A 5AV5C 3MVDD 1P3AA 3AV2A 1KX5D 4J8VD 5B31G 1U35A 3AZLB 4G91B 5GT0B 3W98B 2Y2HA 3TU4A 4KGCD 3MNNB 4H9NA 5BNVB 2IO5C 5BO0B 3AV2C 2Y2LA 5AVCB 5B31A 3AYWA 3X1VA 4H9RA 3AZIC 4WV4B 2YFWA 3MGPD 4ZUXA 2YFVB 1P3FB 2G5IC 3VH5W 1TAFB 4H9SC 5B0YB 3AZKC 5B31C 1AOIA 5DNND 3AZED 3AN2C 3B6GD 5B1MA 2F2AC 3B0BA 4M6BA 5B40D 3WAAD 5AVBD 5AV9C 3V9RA 5AV6A 3LZ1B 1N1JB 2F8NB 3RELA 1AOIC 3A6NA 1P3PD 3C1CD 5BT1C 3WA9B 3P5JB 4J8WA 1P3GB 1WWSA 3AFAB 1ID3D 1EQZD 5AY8A 4JJNB 3A6NC 5B33D 4X23A 2RVQD 3X1TB 1P3OD 4HGAB 3REJA 4NFTA 4YM6D 3MGQD 2NQBB 5GXQC 4NE3A 3W96C 1PZRA 5JRGB 3MVDB 3KWQC 3X1UA 3LJAC 1P3LA 2ZY4A 4R8PB 3W97A 3C1BD 4YS3B 3AZMC 5CPJD 3WKJD 4UUZB 5E5AA 5BS7A 2AROC 3B6FD 3W97C 5AV5B 3LJAD 1P34D 4CSRA 5BNXA 5B2JA 5CPKC 2CV5D 3KUYA 3AZHC 5BS7C 5GSUD 5F99A 5DNNB 2IO5B 3KSYA 3AV2B 3MGRD 3LELD 2NZDC 2PYOC 3EPLA 3REHC 2JE5A 3AZIB 3W99D 3AZLA 1P3ID 5F99C 3W98A 2L5AA 1KX3D 5B32D 4J8XC 3MNNA 3AZKB 5BNVA 3AZFD 5BO0A 5B31B 2BG1A 4XZQD 5AVCA 3AN2B 1HQ3D 3KFUG 3WTPD 4Z66C 5AV9B 2YFVA 1P3FA 3X1SD 1TAFA 5AV8D 5B0YA 5B2ID 5CHLB 3EG5B 3A6NB 3LZ1A 1TZYD 3KXBD 4EO5C 1N1JA 2HIOA 2F8NA 3AV1D 3WA9A 5GXQB 3LZ0C 5C3IC 3O62C 1F66A 1P3GA 3AFAA 2HIOC 5DNMD 4QLCD 4JJNA 2LY8A 3W96B 1P3BC 4LD9C 3KWQB 3LJAB 3X1TA 1F66C 3AZMB 2NQBA 4Z5TD 4WU9C 1P3MD 3LZ0D 1ZLAD 5JRGA 2AROB 3MVDA 1BH8B 3W97B 2Y2MA 4R8PA 2FJ7D 4YS3A 5CPKB 3AZHB 4KGCA 4UUZA 1KX5C 4J8VC 5B0ZD 2NZDB 4CSRB 2PYOB 5AV5A 3REHB 4KGCC 2Y2QA 5F99B 2Y2JA 4J8XB 2Y2NA 5DNNA 3MGPC 4KUDD 3AZIA 4Z66B 3UT9D 1B67A 5DNNC 3AZEC 3B6GC 3R45B 3F6TA 2W8SA 4H9SA 3WAAC 5B40C 3AZKA 5AVBC 5CP6D 3AN2A 1B6WA 3AZGD 3AZJD 1M1AD 2F8NK 1EQZA 1ULYA 1P3PC 3MGSD 3C1CC 5AV9A 1BH9B 3H0LC 4EO5B 5B1LD 4YM6A 3EPKA 1ID3C 3MGQA 1EQZC 4H9PB 5GT3C 3LZ0B 5C3IB 3O62B 2RVQC 5B33C 4WU8D 1P3OC 2HIOB 2ZY3A 1P3BB 4YM6C 1Z2CB 4LD9B 3MGQC 5B24D 1F66B 4WZSB 5GXQA 4WU9B 1R4VA 1P3KD 4J8UD 4KHAB 5GT3D 3W96A 3VH5T 3C1BC 3KWQA 5CPJC 3LJAA 3WKJC 1M18D 2CV5A 3AZMA 3B6FC 1U35D 5B32G 4AWLC 1HTAA 1S32C 4J8VB 1KX5B 4Z2MH 2AROA 3TU4D 1P34C 3AL0C 2CV5C 1BH8A 3UT9B 3W99A 4KGCB 5GSUC 1H3OB 3X1VD 3AYWD 5CPKA 3AZHA 3MGRC 3LELC 4ZUXD 3AZFA 4H9QA 1KU5A 5JA4B 3MGPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZJ B;  3W99 C;  1S32 D;  1P3I C;  2NZD A;  2PYO A;  3REH A;  2BYK B;  5B32 C;  1KX3 C;  5B1M D;  3AZF C;  3AZE B;  4XZQ C;  3B6G B;  1HQ3 C;  4J8X A;  5B40 B;  3WTP C;  3WAA B;  5AVB B;  5CPI C;  3REL D;  2F8N H;  2JSS A;  4G92 C;  3X1S C;  1P3P B;  3UTB D;  5AV8 C;  4Z66 A;  3C1C B;  5B2I C;  4J8W D;  3WTP E;  3R45 A;  5AY8 D;  5B24 B;  4NE6 A;  4X23 D;  1ID3 B;  1EQZ B;  4J8U B;  5GT3 B;  1TZY C;  5CPI D;  5B33 B;  3KXB C;  3NQU B;  4DRB A;  3AV1 C;  1P3O B;  1BH9 A;  4YM6 B;  3VH6 A;  3MGQ B;  4DRA A;  3X1U D;  3REK C;  1P3L D;  5DNM C;  4H9P A;  4QLC C;  1P3M A;  1KX4 D;  3LZ0 A;  3O62 A;  3C1B B;  1P3B A;  4LD9 A;  5CPJ B;  4Z5T C;  3WKJ B;  1P3M C;  3UTA C;  1ZLA C;  3REK D;  3B6F B;  4WU9 A;  4E44 A;  4KHA A;  3KUY D;  4AWL B;  1S32 B;  2FJ7 C;  3B0D C;  1P34 B;  2CV5 B;  1Q9C A;  4XUJ C;  3REI D;  5GSU B;  3UTA D;  3MGR B;  5B0Z C;  3LEL B;  3AZL D;  1WWI A;  4ZBJ C;  5GT0 D;  1KX5 A;  3W98 D;  4J8V A;  3MNN D;  1P3I B;  3W99 B;  4KUD A;  3UT9 A;  5AVC D;  1KX3 B;  5B32 B;  1H3O A;  4XUJ D;  3AZF B;  4H9Q B;  3AZN D;  4XZQ B;  1HQ3 B;  2CWE A;  1P3F D;  4KUD C;  3WTP B;  5JA4 A;  3MGP A;  1M1A A;  5CPI B;  3AZJ A;  3UT9 C;  5B0Y D;  4G92 B;  2BYK A;  3X1S B;  5AV8 B;  5B2I B;  3AZE A;  5CP6 C;  3B6G A;  3AZG C;  1M1A C;  3AZJ C;  3LZ1 D;  5B40 A;  3WAA A;  2F8N D;  5AVB A;  3MGS C;  1TZY B;  3KXB B;  5B1L C;  1P3P A;  3AV1 B;  3C1C A;  1P3G D;  1M19 D;  3AFA D;  4CAY B;  4JJN D;  5B24 A;  1ID3 A;  3REK B;  4WU8 C;  3X1T D;  4QLC B;  5DNM B;  4J8U A;  5GT3 A;  5B33 A;  3NQU A;  2NQB D;  1P3O A;  5B24 C;  1F1E A;  5JRG D;  3REI B;  4Z5T B;  1P3K C;  4H9O B;  3NQJ B;  1P3M B;  3UTA B;  4J8U C;  2BYM B;  1ZLA B;  4R8P D;  4YS3 D;  1M18 C;  2FJ7 B;  3B0D B;  3C1B A;  1P3A C;  5CPJ A;  3WKJ A;  1U35 C;  4XUJ B;  5AV5 D;  3AZN B;  3TU4 C;  3B6F A;  5B0Z B;  4ZBJ B;  1S32 A;  1P34 A;  3X1V C;  3AYW C;  1P3A D;  3AV2 D;  1JFI B;  4ZUX C;  5GSU A;  3AZI D;  3MGR A;  3LEL A;  4KUD B;  2HUE C;  5B1M C;  1P3I A;  3AZK D;  5B31 D;  3UTB A;  3AN2 D;  1KX3 A;  5B32 A;  5AV6 C;  1M19 B;  3VH5 A;  3REL C;  5FUG A;  4XZQ A;  5CP6 B;  5AV9 D;  3AZG B;  1HQ3 A;  1M1A B;  1BFM A;  3WTP A;  3UTB C;  1AOI D;  3MGS B;  5CPI A;  4J8W C;  5BT1 D;  5AY8 C;  5B1L B;  3X1S A;  4E45 A;  5AV8 A;  4X23 C;  5B2I A;  5AV6 D;  3VH6 W;  3REJ C;  3A6N D;  5G49 B;  4WU8 B;  1KX4 A;  1TZY A;  3KXB A;  5GXQ D;  4WNN A;  3X1U C;  3AV1 A;  1P3L C;  4CAY A;  1KX4 C;  3W96 D;  1P3K B;  1A7W A;  3KWQ D;  3REJ D;  3REK A;  5DNM A;  4QLC A;  5E5A C;  5KDM B;  4Z2M G;  3AZM D;  1M18 B;  3B0C W;  1P3A B;  3REI A;  3VH6 T;  2ARO D;  4Z5T A;  4H9O A;  3NQJ A;  1U35 B;  3UTA A;  5B2J C;  2BYM A;  3KUY C;  3W97 D;  1ZLA A;  3TU4 B;  5GT0 A;  4H9N B;  5CPK D;  5E5A D;  3AZH D;  3REI C;  2FJ7 A;  3X1V B;  3AYW B;  4H9R B;  2YFW B;  4XUJ A;  4ZUX B;  4G91 C;  3AZL C;  2NZD D;  5GT0 C;  2PYO D;  3W98 C;  5B2J D;  3AZN A;  3REH D;  3MNN C;  5B0Z A;  1AOI B;  5F99 D;  5AVC C;  2F8N G;  3B0C T;  2HUE B;  5B1M B;  4J8X D;  3AZN C;  1JFI A;  3V9R B;  5AV6 B;  1P3F C;  3REL B;  5B0Y C;  4Z66 D;  3UTB B;  4J8W B;  5AY8 B;  5FUG B;  3LZ1 C;  1M19 A;  4X23 B;  5CP6 A;  3AZG A;  3REJ B;  3WA9 C;  3MGS A;  1P3G C;  1M19 C;  3AFA C;  4JJN C;  5B1L A;  3X1U B;  3O62 D;  1P3L B;  3X1T C;  2HIO D;  1KX4 B;  4HGA C;  1P3B D;  4LD9 D;  2NQB C;  5G49 A;  4WU8 A;  3WA9 D;  5E5A B;  4WNN B;  5JRG C;  1F66 D;  4WU9 D;  3MVD C;  4R8P C;  1P3K A;  4YS3 C;  5BNX B;  5B2J B;  3KUY B;  5KDM A;  1M18 A;  4NE5 A;  5AV5 C;  3MVD D;  1P3A A;  3AV2 A;  1KX5 D;  4J8V D;  5B31 G;  1U35 A;  3AZL B;  4G91 B;  5GT0 B;  3W98 B;  3TU4 A;  4KGC D;  3MNN B;  4H9N A;  5BNV B;  2IO5 C;  5BO0 B;  3AV2 C;  5AVC B;  5B31 A;  3AYW A;  3X1V A;  4H9R A;  3AZI C;  4WV4 B;  2YFW A;  3MGP D;  4ZUX A;  2YFV B;  1P3F B;  3VH5 W;  1TAF B;  4H9S C;  5B0Y B;  3AZK C;  5B31 C;  1AOI A;  5DNN D;  3AZE D;  3AN2 C;  3B6G D;  5B1M A;  3B0B A;  4M6B A;  5B40 D;  3WAA D;  5AVB D;  5AV9 C;  3V9R A;  5AV6 A;  3LZ1 B;  1N1J B;  2F8N B;  3REL A;  1AOI C;  3A6N A;  1P3P D;  3C1C D;  5BT1 C;  3WA9 B;  4J8W A;  1P3G B;  1WWS A;  3AFA B;  1ID3 D;  1EQZ D;  5AY8 A;  4JJN B;  3A6N C;  5B33 D;  4X23 A;  2RVQ D;  3X1T B;  1P3O D;  4HGA B;  3REJ A;  4NFT A;  4YM6 D;  3MGQ D;  2NQB B;  5GXQ C;  4NE3 A;  3W96 C;  5JRG B;  3MVD B;  3KWQ C;  3X1U A;  3LJA C;  1P3L A;  4R8P B;  3W97 A;  3C1B D;  4YS3 B;  3AZM C;  5CPJ D;  3WKJ D;  4UUZ B;  5E5A A;  5BS7 A;  2ARO C;  3B6F D;  3W97 C;  5AV5 B;  3LJA D;  1P34 D;  4CSR A;  5BNX A;  5B2J A;  5CPK C;  2CV5 D;  3KUY A;  3AZH C;  5BS7 C;  5GSU D;  5F99 A;  5DNN B;  2IO5 B;  3KSY A;  3AV2 B;  3MGR D;  3LEL D;  2NZD C;  2PYO C;  3REH C;  3AZI B;  3W99 D;  3AZL A;  1P3I D;  5F99 C;  3W98 A;  2L5A A;  1KX3 D;  5B32 D;  4J8X C;  3MNN A;  3AZK B;  5BNV A;  3AZF D;  5BO0 A;  5B31 B;  4XZQ D;  5AVC A;  3AN2 B;  1HQ3 D;  3WTP D;  4Z66 C;  5AV9 B;  2YFV A;  1P3F A;  3X1S D;  1TAF A;  5B0Y A;  5AV8 D;  5B2I D;  5CHL B;  3A6N B;  3LZ1 A;  1TZY D;  3KXB D;  4EO5 C;  1N1J A;  2HIO A;  2F8N A;  3AV1 D;  3WA9 A;  5GXQ B;  3LZ0 C;  5C3I C;  3O62 C;  1F66 A;  1P3G A;  3AFA A;  2HIO C;  5DNM D;  4QLC D;  4JJN A;  2LY8 A;  3W96 B;  1P3B C;  4LD9 C;  3KWQ B;  3LJA B;  3X1T A;  1F66 C;  3AZM B;  2NQB A;  4Z5T D;  4WU9 C;  1P3M D;  3LZ0 D;  1ZLA D;  5JRG A;  2ARO B;  3MVD A;  1BH8 B;  3W97 B;  4R8P A;  2FJ7 D;  4YS3 A;  5CPK B;  3AZH B;  4KGC A;  4UUZ A;  1KX5 C;  4J8V C;  5B0Z D;  2NZD B;  4CSR B;  2PYO B;  5AV5 A;  3REH B;  4KGC C;  5F99 B;  4J8X B;  5DNN A;  3MGP C;  4KUD D;  3AZI A;  4Z66 B;  3UT9 D;  1B67 A;  5DNN C;  3AZE C;  3B6G C;  3R45 B;  4H9S A;  3WAA C;  5B40 C;  3AZK A;  5AVB C;  5CP6 D;  3AN2 A;  1B6W A;  3AZG D;  3AZJ D;  1M1A D;  2F8N K;  1EQZ A;  1ULY A;  1P3P C;  3MGS D;  3C1C C;  5AV9 A;  1BH9 B;  4EO5 B;  5B1L D;  4YM6 A;  1ID3 C;  3MGQ A;  1EQZ C;  4H9P B;  5GT3 C;  3LZ0 B;  5C3I B;  3O62 B;  2RVQ C;  5B33 C;  4WU8 D;  1P3O C;  2HIO B;  1P3B B;  4YM6 C;  4LD9 B;  3MGQ C;  5B24 D;  1F66 B;  4WZS B;  5GXQ A;  4WU9 B;  1R4V A;  1P3K D;  4J8U D;  4KHA B;  5GT3 D;  3W96 A;  3VH5 T;  3C1B C;  3KWQ A;  5CPJ C;  3LJA A;  3WKJ C;  1M18 D;  2CV5 A;  3AZM A;  3B6F C;  1U35 D;  5B32 G;  4AWL C;  1HTA A;  1S32 C;  4J8V B;  1KX5 B;  4Z2M H;  2ARO A;  3TU4 D;  1P34 C;  2CV5 C;  1BH8 A;  3UT9 B;  3W99 A;  4KGC B;  5GSU C;  1H3O B;  3X1V D;  3AYW D;  5CPK A;  3AZH A;  3MGR C;  3LEL C;  4ZUX D;  3AZF A;  4H9Q A;  1KU5 A;  5JA4 B;  3MGP B; 
#chains in the Genus database with same CATH topology
 3AZJ B;  3W99 C;  1S32 D;  1P3I C;  2NZD A;  2PYO A;  3REH A;  2BYK B;  5B32 C;  1KX3 C;  5B1M D;  3AZF C;  3AZE B;  4XZQ C;  3B6G B;  1HQ3 C;  4J8X A;  5B40 B;  3WTP C;  3WAA B;  5AVB B;  5CPI C;  3REL D;  2F8N H;  2JSS A;  4G92 C;  3X1S C;  1P3P B;  3UTB D;  5AV8 C;  4Z66 A;  3C1C B;  5B2I C;  4J8W D;  3WTP E;  3R45 A;  5AY8 D;  5B24 B;  4NE6 A;  4X23 D;  1ID3 B;  1EQZ B;  4J8U B;  5GT3 B;  1TZY C;  5CPI D;  5B33 B;  3KXB C;  3NQU B;  4DRB A;  3AV1 C;  1P3O B;  1BH9 A;  4YM6 B;  3VH6 A;  3MGQ B;  4DRA A;  3X1U D;  3REK C;  2ZM5 A;  1P3L D;  5DNM C;  4H9P A;  4QLC C;  1P3M A;  1KX4 D;  3LZ0 A;  3O62 A;  1W2E A;  2G5H C;  3C1B B;  1P3B A;  4LD9 A;  5CPJ B;  4Z5T C;  3WKJ B;  1P3M C;  3UTA C;  1ZLA C;  3A1I A;  3REK D;  3B6F B;  4WU9 A;  4E44 A;  4KHA A;  3KUY D;  4AWL B;  1S32 B;  2FJ7 C;  3B0D C;  1P34 B;  2CV5 B;  1Q9C A;  4XUJ C;  3REI D;  5GSU B;  3UTA D;  2DF4 C;  3MGR B;  5B0Z C;  3LEL B;  3AZL D;  1WWI A;  4ZBJ C;  5GT0 D;  1KX5 A;  3W98 D;  4J8V A;  3MNN D;  1P3I B;  3W99 B;  4KUD A;  2XD5 A;  3UT9 A;  5AVC D;  1KX3 B;  5B32 B;  1H3O A;  4XUJ D;  3AZF B;  4H9Q B;  3AZN D;  4XZQ B;  1HQ3 B;  2CWE A;  1P3F D;  4KUD C;  3WTP B;  5JA4 A;  3MGP A;  1M1A A;  5CPI B;  3AZJ A;  3UT9 C;  5B0Y D;  2ZY5 A;  4G92 B;  4DQY B;  2BYK A;  3X1S B;  5AV8 B;  3FDD A;  5B2I B;  3EPH A;  3AZE A;  5CP6 C;  3B6G A;  4WJ3 C;  3AZG C;  1M1A C;  3AZJ C;  3LZ1 D;  5B40 A;  3WAA A;  2F8N D;  5AVB A;  3MGS C;  1TZY B;  3KXB B;  5B1L C;  1P3P A;  3AV1 B;  3C1C A;  1P3G D;  1M19 D;  3AFA D;  4CAY B;  4JJN D;  5B24 A;  1ID3 A;  3REK B;  4WU8 C;  3X1T D;  4QLC B;  5DNM B;  4J8U A;  5GT3 A;  5B33 A;  2J8P A;  3NQU A;  2NQB D;  1P3O A;  5B24 C;  3IP4 C;  2Y2P A;  1F1E A;  5JRG D;  3REI B;  4Z5T B;  1P3K C;  4H9O B;  3NQJ B;  1P3M B;  3UTA B;  4J8U C;  2BYM B;  1ZLA B;  4R8P D;  2DQN C;  4YS3 D;  1M18 C;  2FJ7 B;  3B0D B;  3C1B A;  1P3A C;  2UWX A;  5CPJ A;  3WKJ A;  1U35 C;  4XUJ B;  5AV5 D;  3AZN B;  3TU4 C;  3B6F A;  5B0Z B;  4ZBJ B;  1S32 A;  1P34 A;  3X1V C;  3AYW C;  1P3A D;  3AV2 D;  1JFI B;  4ZUX C;  5GSU A;  2ZY2 A;  3AZI D;  3MGR A;  3LEL A;  2FFF B;  4KUD B;  2HUE C;  5B1M C;  1P3I A;  3AZK D;  5B31 D;  3UTB A;  3AN2 D;  1KX3 A;  5B32 A;  5AV6 C;  1M19 B;  3VH5 A;  3REL C;  5FUG A;  4XZQ A;  5CP6 B;  5AV9 D;  3AZG B;  1HQ3 A;  1M1A B;  1BFM A;  3WTP A;  3UTB C;  1AOI D;  3MGS B;  5CPI A;  3H0R C;  4J8W C;  5BT1 D;  5AY8 C;  2Y2I A;  5B1L B;  3X1S A;  2RIQ A;  4E45 A;  5AV8 A;  4X23 C;  5B2I A;  5AV6 D;  3VH6 W;  3REJ C;  3A6N D;  5G49 B;  4WU8 B;  1KX4 A;  1TZY A;  3KXB A;  5GXQ D;  4WNN A;  3X1U C;  3AV1 A;  1P3L C;  4CAY A;  1KX4 C;  3W96 D;  1P3K B;  1A7W A;  3KWQ D;  3REJ D;  3REK A;  5DNM A;  4QLC A;  5E5A C;  5KDM B;  4Z2M G;  3AZM D;  1M18 B;  3B0C W;  1P3A B;  3REI A;  3VH6 T;  2ARO D;  4Z5T A;  4H9O A;  3NQJ A;  1U35 B;  3UTA A;  5B2J C;  2JCH A;  2BYM A;  3KUY C;  3W97 D;  1ZLA A;  3TU4 B;  5GT0 A;  4H9N B;  2Y2K A;  5CPK D;  5E5A D;  3AZH D;  3REI C;  2FJ7 A;  3X1V B;  3AYW B;  4H9R B;  2YFW B;  4XUJ A;  4ZUX B;  4G91 C;  3AZL C;  2NZD D;  5GT0 C;  2PYO D;  3W98 C;  5B2J D;  3AZN A;  3REH D;  3MNN C;  5B0Z A;  1AOI B;  5F99 D;  5AVC C;  2F8N G;  3B0C T;  2HUE B;  5B1M B;  4J8X D;  3AZN C;  1JFI A;  3V9R B;  2Y2G A;  3A1K A;  5AV6 B;  1P3F C;  3REL B;  5B0Y C;  4Z66 D;  3UTB B;  4J8W B;  5AY8 B;  5FUG B;  3LZ1 C;  1M19 A;  4X23 B;  5CP6 A;  3AZG A;  3REJ B;  1T3U A;  3WA9 C;  4UPK A;  3MGS A;  1P3G C;  1M19 C;  3AFA C;  4JJN C;  5B1L A;  3X1U B;  3O62 D;  3H0M C;  1P3L B;  3X1T C;  2HIO D;  2Y2O A;  1KX4 B;  4HGA C;  1P3B D;  4LD9 D;  2VQR A;  2NQB C;  5G49 A;  4WU8 A;  3WA9 D;  5E5A B;  4WNN B;  5JRG C;  1F66 D;  4WU9 D;  3MVD C;  4R8P C;  1P3K A;  4YS3 C;  5BNX B;  5B2J B;  3KUY B;  3EPJ A;  5KDM A;  2XD1 A;  1M18 A;  4NE5 A;  5AV5 C;  3MVD D;  1P3A A;  3AV2 A;  1KX5 D;  4J8V D;  5B31 G;  1U35 A;  3AZL B;  4G91 B;  5GT0 B;  3W98 B;  2Y2H A;  3TU4 A;  4KGC D;  3MNN B;  4H9N A;  5BNV B;  2IO5 C;  5BO0 B;  3AV2 C;  2Y2L A;  5AVC B;  5B31 A;  3AYW A;  3X1V A;  4H9R A;  3AZI C;  4WV4 B;  2YFW A;  3MGP D;  4ZUX A;  2YFV B;  1P3F B;  2G5I C;  3VH5 W;  1TAF B;  4H9S C;  5B0Y B;  3AZK C;  5B31 C;  1AOI A;  5DNN D;  3AZE D;  3AN2 C;  3B6G D;  5B1M A;  2F2A C;  3B0B A;  4M6B A;  5B40 D;  3WAA D;  5AVB D;  5AV9 C;  3V9R A;  5AV6 A;  3LZ1 B;  1N1J B;  2F8N B;  3REL A;  1AOI C;  3A6N A;  1P3P D;  3C1C D;  5BT1 C;  3WA9 B;  3P5J B;  4J8W A;  1P3G B;  1WWS A;  3AFA B;  1ID3 D;  1EQZ D;  5AY8 A;  4JJN B;  3A6N C;  5B33 D;  4X23 A;  2RVQ D;  3X1T B;  1P3O D;  4HGA B;  3REJ A;  4NFT A;  4YM6 D;  3MGQ D;  2NQB B;  5GXQ C;  4NE3 A;  3W96 C;  1PZR A;  5JRG B;  3MVD B;  3KWQ C;  3X1U A;  3LJA C;  1P3L A;  2ZY4 A;  4R8P B;  3W97 A;  3C1B D;  4YS3 B;  3AZM C;  5CPJ D;  3WKJ D;  4UUZ B;  5E5A A;  5BS7 A;  2ARO C;  3B6F D;  3W97 C;  5AV5 B;  3LJA D;  1P34 D;  4CSR A;  5BNX A;  5B2J A;  5CPK C;  2CV5 D;  3KUY A;  3AZH C;  5BS7 C;  5GSU D;  5F99 A;  5DNN B;  2IO5 B;  3KSY A;  3AV2 B;  3MGR D;  3LEL D;  2NZD C;  2PYO C;  3EPL A;  3REH C;  2JE5 A;  3AZI B;  3W99 D;  3AZL A;  1P3I D;  5F99 C;  3W98 A;  2L5A A;  1KX3 D;  5B32 D;  4J8X C;  3MNN A;  3AZK B;  5BNV A;  3AZF D;  5BO0 A;  5B31 B;  2BG1 A;  4XZQ D;  5AVC A;  3AN2 B;  1HQ3 D;  3KFU G;  3WTP D;  4Z66 C;  5AV9 B;  2YFV A;  1P3F A;  3X1S D;  1TAF A;  5AV8 D;  5B0Y A;  5B2I D;  5CHL B;  3EG5 B;  3A6N B;  3LZ1 A;  1TZY D;  3KXB D;  4EO5 C;  1N1J A;  2HIO A;  2F8N A;  3AV1 D;  3WA9 A;  5GXQ B;  3LZ0 C;  5C3I C;  3O62 C;  1F66 A;  1P3G A;  3AFA A;  2HIO C;  5DNM D;  4QLC D;  4JJN A;  2LY8 A;  3W96 B;  1P3B C;  4LD9 C;  3KWQ B;  3LJA B;  3X1T A;  1F66 C;  3AZM B;  2NQB A;  4Z5T D;  4WU9 C;  1P3M D;  3LZ0 D;  1ZLA D;  5JRG A;  2ARO B;  3MVD A;  1BH8 B;  3W97 B;  2Y2M A;  4R8P A;  2FJ7 D;  4YS3 A;  5CPK B;  3AZH B;  4KGC A;  4UUZ A;  1KX5 C;  4J8V C;  5B0Z D;  2NZD B;  4CSR B;  2PYO B;  5AV5 A;  3REH B;  4KGC C;  2Y2Q A;  5F99 B;  2Y2J A;  4J8X B;  2Y2N A;  5DNN A;  3MGP C;  4KUD D;  3AZI A;  4Z66 B;  3UT9 D;  1B67 A;  5DNN C;  3AZE C;  3B6G C;  3R45 B;  3F6T A;  2W8S A;  4H9S A;  3WAA C;  5B40 C;  3AZK A;  5AVB C;  5CP6 D;  3AN2 A;  1B6W A;  3AZG D;  3AZJ D;  1M1A D;  2F8N K;  1EQZ A;  1ULY A;  1P3P C;  3MGS D;  3C1C C;  5AV9 A;  1BH9 B;  3H0L C;  4EO5 B;  5B1L D;  4YM6 A;  3EPK A;  1ID3 C;  3MGQ A;  1EQZ C;  4H9P B;  5GT3 C;  3LZ0 B;  5C3I B;  3O62 B;  2RVQ C;  5B33 C;  4WU8 D;  1P3O C;  2HIO B;  2ZY3 A;  1P3B B;  4YM6 C;  1Z2C B;  4LD9 B;  3MGQ C;  5B24 D;  1F66 B;  4WZS B;  5GXQ A;  4WU9 B;  1R4V A;  1P3K D;  4J8U D;  4KHA B;  5GT3 D;  3W96 A;  3VH5 T;  3C1B C;  3KWQ A;  5CPJ C;  3LJA A;  3WKJ C;  1M18 D;  2CV5 A;  3AZM A;  3B6F C;  1U35 D;  5B32 G;  4AWL C;  1HTA A;  1S32 C;  4J8V B;  1KX5 B;  4Z2M H;  2ARO A;  3TU4 D;  1P34 C;  3AL0 C;  2CV5 C;  1BH8 A;  3UT9 B;  3W99 A;  4KGC B;  5GSU C;  1H3O B;  3X1V D;  3AYW D;  5CPK A;  3AZH A;  3MGR C;  3LEL C;  4ZUX D;  3AZF A;  4H9Q A;  1KU5 A;  5JA4 B;  3MGP B; 
#chains in the Genus database with same CATH homology
 3AZJ B;  3W99 C;  1S32 D;  1P3I C;  2NZD A;  2PYO A;  3REH A;  2BYK B;  5B32 C;  1KX3 C;  5B1M D;  3AZF C;  3AZE B;  4XZQ C;  3B6G B;  1HQ3 C;  4J8X A;  5B40 B;  3WTP C;  3WAA B;  5AVB B;  5CPI C;  3REL D;  2F8N H;  2JSS A;  4G92 C;  3X1S C;  1P3P B;  3UTB D;  5AV8 C;  4Z66 A;  3C1C B;  5B2I C;  4J8W D;  3WTP E;  3R45 A;  5AY8 D;  5B24 B;  4NE6 A;  4X23 D;  1ID3 B;  1EQZ B;  4J8U B;  5GT3 B;  1TZY C;  5CPI D;  5B33 B;  3KXB C;  3NQU B;  4DRB A;  3AV1 C;  1P3O B;  1BH9 A;  4YM6 B;  3VH6 A;  3MGQ B;  4DRA A;  3X1U D;  3REK C;  2ZM5 A;  1P3L D;  5DNM C;  4H9P A;  4QLC C;  1P3M A;  1KX4 D;  3LZ0 A;  3O62 A;  1W2E A;  2G5H C;  3C1B B;  1P3B A;  4LD9 A;  5CPJ B;  4Z5T C;  3WKJ B;  1P3M C;  3UTA C;  1ZLA C;  3A1I A;  3REK D;  3B6F B;  4WU9 A;  4E44 A;  4KHA A;  3KUY D;  4AWL B;  1S32 B;  2FJ7 C;  3B0D C;  1P34 B;  2CV5 B;  1Q9C A;  4XUJ C;  3REI D;  5GSU B;  3UTA D;  2DF4 C;  3MGR B;  5B0Z C;  3LEL B;  3AZL D;  1WWI A;  4ZBJ C;  5GT0 D;  1KX5 A;  3W98 D;  4J8V A;  3MNN D;  1P3I B;  3W99 B;  4KUD A;  2XD5 A;  3UT9 A;  5AVC D;  1KX3 B;  5B32 B;  1H3O A;  4XUJ D;  3AZF B;  4H9Q B;  3AZN D;  4XZQ B;  1HQ3 B;  2CWE A;  1P3F D;  4KUD C;  3WTP B;  5JA4 A;  3MGP A;  1M1A A;  5CPI B;  3AZJ A;  3UT9 C;  5B0Y D;  2ZY5 A;  4G92 B;  4DQY B;  2BYK A;  3X1S B;  5AV8 B;  3FDD A;  5B2I B;  3EPH A;  3AZE A;  5CP6 C;  3B6G A;  4WJ3 C;  3AZG C;  1M1A C;  3AZJ C;  3LZ1 D;  5B40 A;  3WAA A;  2F8N D;  5AVB A;  3MGS C;  1TZY B;  3KXB B;  5B1L C;  1P3P A;  3AV1 B;  3C1C A;  1P3G D;  1M19 D;  3AFA D;  4CAY B;  4JJN D;  5B24 A;  1ID3 A;  3REK B;  4WU8 C;  3X1T D;  4QLC B;  5DNM B;  4J8U A;  5GT3 A;  5B33 A;  2J8P A;  3NQU A;  2NQB D;  1P3O A;  5B24 C;  3IP4 C;  2Y2P A;  1F1E A;  5JRG D;  3REI B;  4Z5T B;  1P3K C;  4H9O B;  3NQJ B;  1P3M B;  3UTA B;  4J8U C;  2BYM B;  1ZLA B;  4R8P D;  2DQN C;  4YS3 D;  1M18 C;  2FJ7 B;  3B0D B;  3C1B A;  1P3A C;  2UWX A;  5CPJ A;  3WKJ A;  1U35 C;  4XUJ B;  5AV5 D;  3AZN B;  3TU4 C;  3B6F A;  5B0Z B;  4ZBJ B;  1S32 A;  1P34 A;  3X1V C;  3AYW C;  1P3A D;  3AV2 D;  1JFI B;  4ZUX C;  5GSU A;  2ZY2 A;  3AZI D;  3MGR A;  3LEL A;  2FFF B;  4KUD B;  2HUE C;  5B1M C;  1P3I A;  3AZK D;  5B31 D;  3UTB A;  3AN2 D;  1KX3 A;  5B32 A;  5AV6 C;  1M19 B;  3VH5 A;  3REL C;  5FUG A;  4XZQ A;  5CP6 B;  5AV9 D;  3AZG B;  1HQ3 A;  1M1A B;  1BFM A;  3WTP A;  3UTB C;  1AOI D;  3MGS B;  5CPI A;  3H0R C;  4J8W C;  5BT1 D;  5AY8 C;  2Y2I A;  5B1L B;  3X1S A;  2RIQ A;  4E45 A;  5AV8 A;  4X23 C;  5B2I A;  5AV6 D;  3VH6 W;  3REJ C;  3A6N D;  5G49 B;  4WU8 B;  1KX4 A;  1TZY A;  3KXB A;  5GXQ D;  4WNN A;  3X1U C;  3AV1 A;  1P3L C;  4CAY A;  1KX4 C;  3W96 D;  1P3K B;  1A7W A;  3KWQ D;  3REJ D;  3REK A;  5DNM A;  4QLC A;  5E5A C;  5KDM B;  4Z2M G;  3AZM D;  1M18 B;  3B0C W;  1P3A B;  3REI A;  3VH6 T;  2ARO D;  4Z5T A;  4H9O A;  3NQJ A;  1U35 B;  3UTA A;  5B2J C;  2JCH A;  2BYM A;  3KUY C;  3W97 D;  1ZLA A;  3TU4 B;  5GT0 A;  4H9N B;  2Y2K A;  5CPK D;  5E5A D;  3AZH D;  3REI C;  2FJ7 A;  3X1V B;  3AYW B;  4H9R B;  2YFW B;  4XUJ A;  4ZUX B;  4G91 C;  3AZL C;  2NZD D;  5GT0 C;  2PYO D;  3W98 C;  5B2J D;  3AZN A;  3REH D;  3MNN C;  5B0Z A;  1AOI B;  5F99 D;  5AVC C;  2F8N G;  3B0C T;  2HUE B;  5B1M B;  4J8X D;  3AZN C;  1JFI A;  3V9R B;  2Y2G A;  3A1K A;  5AV6 B;  1P3F C;  3REL B;  5B0Y C;  4Z66 D;  3UTB B;  4J8W B;  5AY8 B;  5FUG B;  3LZ1 C;  1M19 A;  4X23 B;  5CP6 A;  3AZG A;  3REJ B;  1T3U A;  3WA9 C;  4UPK A;  3MGS A;  1P3G C;  1M19 C;  3AFA C;  4JJN C;  5B1L A;  3X1U B;  3O62 D;  3H0M C;  1P3L B;  3X1T C;  2HIO D;  2Y2O A;  1KX4 B;  4HGA C;  1P3B D;  4LD9 D;  2VQR A;  2NQB C;  5G49 A;  4WU8 A;  3WA9 D;  5E5A B;  4WNN B;  5JRG C;  1F66 D;  4WU9 D;  3MVD C;  4R8P C;  1P3K A;  4YS3 C;  5BNX B;  5B2J B;  3KUY B;  3EPJ A;  5KDM A;  2XD1 A;  1M18 A;  4NE5 A;  5AV5 C;  3MVD D;  1P3A A;  3AV2 A;  1KX5 D;  4J8V D;  5B31 G;  1U35 A;  3AZL B;  4G91 B;  5GT0 B;  3W98 B;  2Y2H A;  3TU4 A;  4KGC D;  3MNN B;  4H9N A;  5BNV B;  2IO5 C;  5BO0 B;  3AV2 C;  2Y2L A;  5AVC B;  5B31 A;  3AYW A;  3X1V A;  4H9R A;  3AZI C;  4WV4 B;  2YFW A;  3MGP D;  4ZUX A;  2YFV B;  1P3F B;  2G5I C;  3VH5 W;  1TAF B;  4H9S C;  5B0Y B;  3AZK C;  5B31 C;  1AOI A;  5DNN D;  3AZE D;  3AN2 C;  3B6G D;  5B1M A;  2F2A C;  3B0B A;  4M6B A;  5B40 D;  3WAA D;  5AVB D;  5AV9 C;  3V9R A;  5AV6 A;  3LZ1 B;  1N1J B;  2F8N B;  3REL A;  1AOI C;  3A6N A;  1P3P D;  3C1C D;  5BT1 C;  3WA9 B;  3P5J B;  4J8W A;  1P3G B;  1WWS A;  3AFA B;  1ID3 D;  1EQZ D;  5AY8 A;  4JJN B;  3A6N C;  5B33 D;  4X23 A;  2RVQ D;  3X1T B;  1P3O D;  4HGA B;  3REJ A;  4NFT A;  4YM6 D;  3MGQ D;  2NQB B;  5GXQ C;  4NE3 A;  3W96 C;  1PZR A;  5JRG B;  3MVD B;  3KWQ C;  3X1U A;  3LJA C;  1P3L A;  2ZY4 A;  4R8P B;  3W97 A;  3C1B D;  4YS3 B;  3AZM C;  5CPJ D;  3WKJ D;  4UUZ B;  5E5A A;  5BS7 A;  2ARO C;  3B6F D;  3W97 C;  5AV5 B;  3LJA D;  1P34 D;  4CSR A;  5BNX A;  5B2J A;  5CPK C;  2CV5 D;  3KUY A;  3AZH C;  5BS7 C;  5GSU D;  5F99 A;  5DNN B;  2IO5 B;  3KSY A;  3AV2 B;  3MGR D;  3LEL D;  2NZD C;  2PYO C;  3EPL A;  3REH C;  2JE5 A;  3AZI B;  3W99 D;  3AZL A;  1P3I D;  5F99 C;  3W98 A;  2L5A A;  1KX3 D;  5B32 D;  4J8X C;  3MNN A;  3AZK B;  5BNV A;  3AZF D;  5BO0 A;  5B31 B;  2BG1 A;  4XZQ D;  5AVC A;  3AN2 B;  1HQ3 D;  3KFU G;  3WTP D;  4Z66 C;  5AV9 B;  2YFV A;  1P3F A;  3X1S D;  1TAF A;  5AV8 D;  5B0Y A;  5B2I D;  5CHL B;  3EG5 B;  3A6N B;  3LZ1 A;  1TZY D;  3KXB D;  4EO5 C;  1N1J A;  2HIO A;  2F8N A;  3AV1 D;  3WA9 A;  5GXQ B;  3LZ0 C;  5C3I C;  3O62 C;  1F66 A;  1P3G A;  3AFA A;  2HIO C;  5DNM D;  4QLC D;  4JJN A;  2LY8 A;  3W96 B;  1P3B C;  4LD9 C;  3KWQ B;  3LJA B;  3X1T A;  1F66 C;  3AZM B;  2NQB A;  4Z5T D;  4WU9 C;  1P3M D;  3LZ0 D;  1ZLA D;  5JRG A;  2ARO B;  3MVD A;  1BH8 B;  3W97 B;  2Y2M A;  4R8P A;  2FJ7 D;  4YS3 A;  5CPK B;  3AZH B;  4KGC A;  4UUZ A;  1KX5 C;  4J8V C;  5B0Z D;  2NZD B;  4CSR B;  2PYO B;  5AV5 A;  3REH B;  4KGC C;  2Y2Q A;  5F99 B;  2Y2J A;  4J8X B;  2Y2N A;  5DNN A;  3MGP C;  4KUD D;  3AZI A;  4Z66 B;  3UT9 D;  1B67 A;  5DNN C;  3AZE C;  3B6G C;  3R45 B;  3F6T A;  2W8S A;  4H9S A;  3WAA C;  5B40 C;  3AZK A;  5AVB C;  5CP6 D;  3AN2 A;  1B6W A;  3AZG D;  3AZJ D;  1M1A D;  2F8N K;  1EQZ A;  1ULY A;  1P3P C;  3MGS D;  3C1C C;  5AV9 A;  1BH9 B;  3H0L C;  4EO5 B;  5B1L D;  4YM6 A;  3EPK A;  1ID3 C;  3MGQ A;  1EQZ C;  4H9P B;  5GT3 C;  3LZ0 B;  5C3I B;  3O62 B;  2RVQ C;  5B33 C;  4WU8 D;  1P3O C;  2HIO B;  2ZY3 A;  1P3B B;  4YM6 C;  1Z2C B;  4LD9 B;  3MGQ C;  5B24 D;  1F66 B;  4WZS B;  5GXQ A;  4WU9 B;  1R4V A;  1P3K D;  4J8U D;  4KHA B;  5GT3 D;  3W96 A;  3VH5 T;  3C1B C;  3KWQ A;  5CPJ C;  3LJA A;  3WKJ C;  1M18 D;  2CV5 A;  3AZM A;  3B6F C;  1U35 D;  5B32 G;  4AWL C;  1HTA A;  1S32 C;  4J8V B;  1KX5 B;  4Z2M H;  2ARO A;  3TU4 D;  1P34 C;  3AL0 C;  2CV5 C;  1BH8 A;  3UT9 B;  3W99 A;  4KGC B;  5GSU C;  1H3O B;  3X1V D;  3AYW D;  5CPK A;  3AZH A;  3MGR C;  3LEL C;  4ZUX D;  3AZF A;  4H9Q A;  1KU5 A;  5JA4 B;  3MGP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...