3TU4C

Crystal structure of the sir3 bah domain in complex with a nucleosome core particle.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/structural protein/dna
molecule keywords Histone H3.2
publication title Structural basis of silencing: Sir3 BAH domain in complex with a nucleosome at 3.0 A resolution.
pubmed doi rcsb
source organism Xenopus laevis
total genus 32
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3tu4C00
3WKJA 2NZDA 3KSYA 1P3GD 3KXBD 5B40B 3KWQA 3WKJC 3UTAA 2NZDC 5AY8B 3A6ND 3KWQC 3LELD 3UTAC 3NQJB 5GSUA 3AN2B 1P3PB 3AZNA 5C3IB 4WU9A 1P3OA 1BH8B 5GSUC 5B32A 4KGCB 3AZNC 4WU9C 5FUGB 1P3OC 3R45B 1EQZA 1M1AB 3AZLB 5B32C 2NZDB 4ZUXB 3MGSB 1S32B 3KWQB 1EQZC 3UTAB 2F8NK 4H9QB 3KUYA 5KDMA 3UT9D 3KUYC 5B1LD 3AZNB 1KX4D 1M19A 1P3MD 5BO0A 4NE3A 1ZLAA 5DNMC 4XUJA 3MGQD 2F8ND 1BFMA 5GT0A 4J8WA 1M18D 3V9RA 1ZLAC 4XUJC 2F8NH 4CAYB 3LZ1B 3KUYB 1H3OA 3X1UB 4J8WC 3B0BA 1KX5C 1P3GA 4HGAC 3KXBA 1F66D 3AZFD 1P3GC 1M19B 3KXBC 5CP6B 3A6NA 4WU8D 3LELA 4Z66D 5JA4B 3W96A 3A6NC 3W99B 3LELC 1ZLAB 4XUJB 3X1SA 4H9PA 3LZ0D 3REHB 3W96C 3WTPA 5GT0B 5CPID 3V9RB 4H9NA 3WAAB 3VH6W 3X1SC 1H3OB 4H9RA 3WTPC 3X1VA 2AROA 4QLCA 5AY8D 1P3IB 4QLCC 5AV9A 4DRBA 2CV5B 3B6GD 3LELB 3AN2D 3REJB 4CSRB 1P3PD 2LY8A 5AV9C 3UT9A 3W96B 3NQUA 4UUZA 5B2JB 4KGCD 5B1LA 5BNXA 4YM6B 3X1SB 1KX4A 5B31B 4KHAA 3WTPB 3UT9C 1M1AD 3AZLD 5B1LC 1P3MA 4ZUXD 3MGSD 1S32D 2IO5C 1KX4C 1B67A 4H9RB 3MGRD 3X1VB 3UTAD 2AROB 4QLCB 2BYMA 1P3MC 2F8NA 5AV8B 5B0ZB 3MGQC 3W98D 5AV9B 4JJND 5B2IB 3O62B 4UUZB 2IO5B 3AZFA 1KX4B 4KHAB 4WU8A 2HUEC 5B1MB 3AZIA 1TZYB 4Z66A 2NQBA 5GT3D 3AZFC 3B6FB 4WU8C 3AZIC 4Z66C 2BYMB 2NQBC 3LZ1D 3KUYD 3X1UD 5CPIA 4M6BA 1U35B 5CPIC 5AY8A 1M19D 1WWSA 5CP6D 5AY8C 3B6GA 3AZIB 3NQJA 3W99D 4XUJD 5AVBB 4Z2MH 2NQBB 3REHD 3B6GC 5GT0D 1BH8A 3WAAD 3AZJD 3R45A 3C1BA 5CPIB 1M1AA 3AZLA 4KGCC 4ZUXA 3MGSA 1P34D 1S32A 5BNVA 3MGRA 2CWEA 1M1AC 3AZLC 1P3ID 4ZUXC 3MGSC 4H9QA 1S32C 1BH9B 3VH6A 2CV5D 3MGRC 3AZHA 3REJD 3W98A 3B6GB 3W96D 4JJNA 5B2JD 3W98C 4YM6D 3X1SD 3REKB 5CPKD 5B31D 3WTPD 4JJNC 5BT1D 1KU5A 3RELD 4ZBJC 4H9OB 5GXQD 3C1BB 1AOID 3WTPE 3X1VD 2AROD 4QLCD 5GT3A 5BNVB 3MGRB 2YFWA 5AV8D 5B0ZD 4J8VA 5AV9D 5GT3C 4CAYA 3MGPD 3LZ1A 3X1UA 3AZHB 3AZGA 4AWLB 3W98B 5B2ID 3LZ1C 3O62D 4JJNB 3X1UC 3AZGC 5CHLB 4ZBJB 2HIOD 5CP6A 1B6WA 5B1MD 1TZYD 3X1TB 5JA4A 3TU4B 1M19C 5CP6C 3B6FD 3W99A 5GT3B 4KUDB 3REHA 2YFWB 3W99C 4J8VB 1TAFA 3WAAA 3AZJA 3B0CT 1U35D 3REHC 3AZGB 5GT0C 3AV2A 3WAAC 1P34A 3AZJC 1F1EA 3AV2C 1P3IA 1P34C 2PYOB 1A7WA 2CV5A 3AZID 3REJA 4CSRA 5AVBD 3LJAB 1P3IC 1P3FD 2NQBD 3WA9B 4LD9B 2CV5C 4E45A 5B2JA 3VH5T 3REJC 4J8UA 4YM6A 5CPKA 5B31A 4XZQB 5B2JC 1TAFB 3RELA 4NFTA 4J8UC 4YM6C 2L5AA 5GXQA 3AZJB 5B31C 5CPKC 1AOIA 5BT1C 4G92B 3AV2B 1P34B 3RELC 5GXQC 1AOIC 5AV8A 5B0YD 3X1VC 5B0ZA 2AROC 3MGPA 5AV8C 5B32G 5B0ZC 5B2IA 3MGPC 3REKD 1P3KD 3O62A 2RVQD 4J8UB 5CPKB 5B2IC 2HIOA 3O62C 3C1BD 5B1MA 3MNNB 3AZKB 2BYKA 1TZYA 3RELB 1HQ3B 5GXQB 2HIOC 3B6FA 1AOIB 5B1MC 5B33B 1TZYC 3AFAB 3MVDD 3B6FC 3AZHD 5JRGB 3MGPB 1U35A 5BS7A 4Z2MG 1U35C 5BS7C 3AYWA 5DNNB 3UTBB 2FJ7B 2HIOB 3X1TD 3TU4D 3REID 2BYKB 1N1JB 5AVBA 1P3FA 4KUDD 3B0DB 3C1CA 5AVBC 4J8VD 1P3FC 1Q9CA 3AZGD 3C1CC 3B0CW 5AV6B 2PYOD 1BH9A 3AYWB 5B0YA 4EO5B 4LD9D 3LJAD 3WA9D 5B31G 1JFIA 5B0YC 1P3FB 3REKA 1P3KA 4XZQD 3C1CB 4H9OA 3VH5W 3REKC 1P3KC 2RVQC 3AV2D 3C1BC 4X23A 4R8PB 3MVDA 1KX3B 4X23C 2YFVB 5B0YB 3AV1B 3AZEB 3MVDC 4YS3B 4G91B 3AZHC 3AZMD 1JFIB 4AWLC 4J8UD 1P3KB 4WV4B 5CPJD 5AVCB 3AZKD 3MNND 2F8NG 1HQ3D 3X1TA 3TU4A 1P3LD 3REIA 5B33D 3AFAD 4KUDA 3X1TC 3TU4C 4X23B 3REIC 5JRGD 3MVDB 4J8XB 4Z5TA 4KUDC 4J8VC 4Z5TC 4H9SA 5DNND 3UTBD 2FJ7D 2PYOA 4H9SC 1ID3A 5E5AB 4LD9A 3LJAA 3WA9A 2PYOC 1ID3C 3REIB 4LD9C 3LJAC 4WZSB 3WKJB 3WA9C 4XZQA 1P3AD 4Z5TB 4XZQC 5AV6D 5AV5D 4G92C 3AYWD 5B24A 5GSUB 1ID3B 4WU9B 1P3OB 5B24C 5B32B 5DNMA 3W97D 3AZMA 3C1CD 1EQZB 1WWIA 5CPJA 3AZKA 3MNNA 3AZMC 1HQ3A 5CPJC 1KX5A 1P3LA 3AZKC 4R8PD 5F99A 3MNNC 5KDMB 5B33A 3AFAA 1HQ3C 1KX3D 3VH5A 1P3LC 5B24B 5F99C 5JRGA 5B33C 3AV1D 3AFAC 3AZED 4YS3D 5JRGC 1P3BD 5DNMB 5BO0B 5AVCD 3AZMB 5G49A 5DNNA 3UTBA 2FJ7A 5CPJB 5DNNC 1N1JA 3UTBC 4J8WB 2FJ7C 1KX5B 1P3LB 4X23D 4HGAB 5F99B 5B40D 4J8XD 1P3GB 3KXBB 3B0DC 1P3AA 3A6NB 5AV6A 5AV5A 1P3AC 5E5AD 5G49B 5AV6C 5AV5C 1R4VA 4H9PB 3AYWC 4EO5C 3WKJD 2NZDD 4H9NB 3W97A 3KWQD 4Z5TD 3MGQA 4NE6A 3W97C 1P3AB 1M18A 4WNNA 4DRAA 4R8PA 5AV5B 5GSUD 1M18C 1ID3D 1KX3A 3AZND 4WU9D 2YFVA 3UT9B 4R8PC 1P3OD 3NQUB 3AV1A 3AZEA 1F66A 5B1LB 5B32D 4YS3A 5BNXB 1KX3C 3AV1C 1EQZD 1P3BA 3AZEC 1F66C 1P3MB 4YS3C 5AVCA 4G91C 3W97B 1P3BC 3MGQB 2F8NB 5AVCC 3LZ0A 1M18B 1ULYA 4WNNB 4NE5A 5B24D 3LZ0C 5B40A 4J8XA 4E44A 1HTAA 2HUEB 5B40C 1F66B 4J8XC 5DNMD 3AZFB 4WU8B 2JSSA 1P3BB 3AN2A 4Z66B 1ZLAD 1P3PA 5E5AA 4J8WD 3VH6T 3AN2C 4KGCA 1KX5D 1P3PC 5E5AC 3LZ0B 5C3IC 5F99D 5FUGA
chains in the Genus database with same CATH superfamily
3WKJA 2NZDA 3KSYA 1P3GD 3KXBD 5B40B 3KWQA 2VQRA 3WKJC 2J8PA 3UTAA 2NZDC 2DF4C 5AY8B 3A6ND 3KWQC 3LELD 3UTAC 3NQJB 5GSUA 3AN2B 1P3PB 3AZNA 5C3IB 4WU9A 1P3OA 1BH8B 5GSUC 5B32A 4KGCB 3H0MC 3AZNC 4WU9C 5FUGB 1P3OC 3R45B 1EQZA 1M1AB 3AZLB 5B32C 2NZDB 4ZUXB 2G5HC 3MGSB 1S32B 3KWQB 1EQZC 3EPLA 3UTAB 2F8NK 4H9QB 3KUYA 2DQNC 5KDMA 2ZY3A 2RIQA 3UT9D 3KUYC 5B1LD 3AZNB 1KX4D 1M19A 2G5IC 1P3MD 5BO0A 4NE3A 1ZLAA 5DNMC 4XUJA 3MGQD 2F8ND 4UPKA 1BFMA 5GT0A 4J8WA 1M18D 3V9RA 1ZLAC 4XUJC 2F8NH 4CAYB 3LZ1B 3KUYB 1H3OA 3X1UB 4J8WC 3B0BA 1KX5C 1P3GA 4HGAC 3KXBA 2JCHA 1T3UA 1F66D 3AZFD 1P3GC 1M19B 3KXBC 5CP6B 3A6NA 4WU8D 3LELA 4Z66D 5JA4B 3W96A 3A6NC 3W99B 3LELC 1ZLAB 4XUJB 3X1SA 4H9PA 3LZ0D 3REHB 3W96C 3WTPA 5GT0B 5CPID 3V9RB 4H9NA 3WAAB 3VH6W 3X1SC 1H3OB 2Y2PA 4H9RA 3WTPC 3X1VA 2AROA 4QLCA 5AY8D 1P3IB 2Y2LA 4QLCC 5AV9A 4DRBA 2CV5B 3B6GD 3LELB 3AN2D 3REJB 4CSRB 1P3PD 2LY8A 5AV9C 3UT9A 3W96B 3NQUA 4UUZA 5B2JB 4KGCD 5B1LA 5BNXA 4YM6B 3X1SB 1KX4A 5B31B 4KHAA 3WTPB 3UT9C 1M1AD 3AZLD 5B1LC 1P3MA 4ZUXD 3MGSD 1S32D 2IO5C 1KX4C 1B67A 4H9RB 3MGRD 3X1VB 3UTAD 2AROB 4QLCB 2BYMA 1P3MC 2F8NA 5AV8B 5B0ZB 3MGQC 3W98D 5AV9B 4JJND 5B2IB 1Z2CB 3O62B 4UUZB 2XD1A 3EPKA 2IO5B 3AZFA 1KX4B 4KHAB 4WU8A 2HUEC 5B1MB 3AZIA 1TZYB 4Z66A 2NQBA 5GT3D 3AZFC 2ZM5A 3B6FB 4WU8C 3AZIC 4Z66C 2BYMB 2NQBC 3LZ1D 3KUYD 3X1UD 5CPIA 4M6BA 1U35B 4DQYB 5CPIC 5AY8A 1M19D 1WWSA 5CP6D 5AY8C 3B6GA 3AZIB 3NQJA 3W99D 4XUJD 5AVBB 4Z2MH 2NQBB 2ZY5A 3REHD 3B6GC 5GT0D 1BH8A 3WAAD 3AZJD 3R45A 3C1BA 5CPIB 1M1AA 3AZLA 4KGCC 4ZUXA 3MGSA 1P34D 1S32A 3A1KA 5BNVA 3MGRA 2CWEA 1M1AC 3AZLC 1P3ID 4ZUXC 3MGSC 4H9QA 1S32C 1BH9B 3VH6A 2CV5D 3MGRC 3AZHA 3REJD 3W98A 3B6GB 3W96D 4JJNA 5B2JD 3W98C 4YM6D 3X1SD 3REKB 5CPKD 5B31D 3WTPD 4JJNC 5BT1D 3KFUG 1KU5A 3RELD 4ZBJC 4H9OB 5GXQD 3C1BB 1AOID 3WTPE 3X1VD 2AROD 4QLCD 5GT3A 5BNVB 3MGRB 2YFWA 5AV8D 5B0ZD 4J8VA 5AV9D 5GT3C 4CAYA 3MGPD 3LZ1A 2Y2GA 3X1UA 3AZHB 3AZGA 4AWLB 3W98B 5B2ID 2JE5A 3O62D 3LZ1C 4JJNB 3X1UC 3AZGC 5CHLB 4ZBJB 2HIOD 5CP6A 1B6WA 5B1MD 1TZYD 3F6TA 5JA4A 3TU4B 3X1TB 5CP6C 1M19C 3B6FD 3W99A 5GT3B 4KUDB 3REHA 2YFWB 3W99C 4J8VB 1TAFA 3WAAA 3AZJA 3B0CT 1U35D 3REHC 3AZGB 5GT0C 3AV2A 3WAAC 1P34A 3AZJC 1F1EA 3AV2C 1P3IA 1P34C 2PYOB 1A7WA 2CV5A 3AZID 1W2EA 3REJA 4CSRA 5AVBD 3LJAB 1P3IC 1P3FD 2NQBD 3WA9B 4LD9B 2CV5C 4E45A 5B2JA 3VH5T 3REJC 4J8UA 4YM6A 5CPKA 5B31A 4XZQB 5B2JC 1TAFB 3RELA 4NFTA 4J8UC 4YM6C 2L5AA 5GXQA 3AZJB 5B31C 5CPKC 1AOIA 5BT1C 4G92B 3AV2B 1P34B 3RELC 5GXQC 2Y2KA 1AOIC 5AV8A 5B0YD 3X1VC 5B0ZA 2AROC 3MGPA 5AV8C 5B32G 5B0ZC 5B2IA 3MGPC 3REKD 1P3KD 3O62A 2RVQD 4J8UB 5CPKB 5B2IC 2HIOA 3O62C 3C1BD 5B1MA 3MNNB 3AZKB 1PZRA 1TZYA 2BYKA 3RELB 1HQ3B 2Y2OA 5GXQB 2HIOC 3B6FA 1AOIB 5B1MC 3A1IA 5B33B 1TZYC 3AFAB 3MVDD 2F2AC 3B6FC 3AZHD 5JRGB 3MGPB 1U35A 5BS7A 4Z2MG 1U35C 2FFFB 5BS7C 3AYWA 5DNNB 3UTBB 2FJ7B 2HIOB 3X1TD 3TU4D 3REID 2BYKB 1N1JB 5AVBA 1P3FA 4KUDD 2Y2IA 3B0DB 3C1CA 5AVBC 4J8VD 1P3FC 1Q9CA 3AZGD 3C1CC 2UWXA 3B0CW 3H0LC 5AV6B 2PYOD 1BH9A 3EPHA 3AYWB 5B0YA 4EO5B 4LD9D 3LJAD 3WA9D 5B31G 1JFIA 5B0YC 1P3FB 2Y2QA 3REKA 1P3KA 4XZQD 3C1CB 4H9OA 3VH5W 3REKC 1P3KC 2RVQC 3AV2D 3C1BC 4X23A 4R8PB 3MVDA 2ZY4A 1KX3B 4X23C 2YFVB 5B0YB 3AV1B 3AZEB 3MVDC 4YS3B 4G91B 3AZHC 3AZMD 1JFIB 4AWLC 4J8UD 1P3KB 4WV4B 5CPJD 5AVCB 3AZKD 3MNND 2F8NG 1HQ3D 3X1TA 3TU4A 1P3LD 3EPJA 3REIA 5B33D 3AFAD 4KUDA 3AL0C 3X1TC 2Y2JA 3TU4C 4X23B 3REIC 5JRGD 3MVDB 4J8XB 4Z5TA 4KUDC 4J8VC 4Z5TC 4H9SA 5DNND 3UTBD 2FJ7D 2PYOA 4H9SC 1ID3A 5E5AB 4LD9A 3LJAA 3WA9A 2PYOC 1ID3C 3REIB 4LD9C 3LJAC 4WZSB 3WKJB 3WA9C 4XZQA 1P3AD 4Z5TB 4XZQC 5AV6D 5AV5D 4G92C 3AYWD 5B24A 3H0RC 5GSUB 1ID3B 4WU9B 1P3OB 5B24C 5B32B 5DNMA 3W97D 3AZMA 3C1CD 1EQZB 1WWIA 5CPJA 3AZKA 3MNNA 3AZMC 1HQ3A 5CPJC 1KX5A 1P3LA 3AZKC 4R8PD 5F99A 3MNNC 5KDMB 5B33A 3AFAA 1HQ3C 1KX3D 2W8SA 3VH5A 1P3LC 5B24B 5F99C 5JRGA 5B33C 3AV1D 3AFAC 3AZED 4YS3D 2ZY2A 5JRGC 1P3BD 5DNMB 5BO0B 5AVCD 3AZMB 5G49A 2Y2NA 5DNNA 3UTBA 2FJ7A 5CPJB 5DNNC 1N1JA 3EG5B 4J8WB 3UTBC 2FJ7C 1KX5B 1P3LB 4X23D 4HGAB 5F99B 5B40D 4J8XD 1P3GB 3KXBB 3B0DC 1P3AA 3A6NB 5AV6A 5AV5A 1P3AC 5E5AD 5G49B 5AV6C 5AV5C 1R4VA 4H9PB 3IP4C 3AYWC 4EO5C 3WKJD 2NZDD 4H9NB 3W97A 3KWQD 3P5JB 4Z5TD 3MGQA 4WJ3C 4NE6A 3W97C 1P3AB 1M18A 4WNNA 4DRAA 4R8PA 5AV5B 5GSUD 1M18C 1ID3D 1KX3A 3AZND 4WU9D 2YFVA 3UT9B 4R8PC 1P3OD 3NQUB 3AV1A 3AZEA 1F66A 5B1LB 5B32D 4YS3A 5BNXB 1KX3C 3AV1C 1EQZD 1P3BA 3AZEC 1F66C 1P3MB 4YS3C 5AVCA 4G91C 3W97B 2Y2MA 1P3BC 3MGQB 2F8NB 5AVCC 3LZ0A 2Y2HA 1M18B 1ULYA 4WNNB 4NE5A 5B24D 2BG1A 3LZ0C 5B40A 4J8XA 4E44A 1HTAA 2HUEB 5B40C 1F66B 4J8XC 5DNMD 3AZFB 4WU8B 2JSSA 1P3BB 3AN2A 4Z66B 2XD5A 3FDDA 1ZLAD 1P3PA 5E5AA 4J8WD 3VH6T 3AN2C 4KGCA 1KX5D 1P3PC 5E5AC 3LZ0B 5C3IC 5F99D 5FUGA
chains in the Genus database with same CATH topology
3WKJA 2NZDA 3KSYA 1P3GD 3KXBD 5B40B 3KWQA 2VQRA 3WKJC 2J8PA 3UTAA 2NZDC 2DF4C 5AY8B 3A6ND 3KWQC 3LELD 3UTAC 3NQJB 5GSUA 3AN2B 1P3PB 3AZNA 5C3IB 4WU9A 1P3OA 1BH8B 5GSUC 5B32A 4KGCB 3H0MC 3AZNC 4WU9C 5FUGB 1P3OC 3R45B 1EQZA 1M1AB 3AZLB 5B32C 2NZDB 4ZUXB 2G5HC 3MGSB 1S32B 3KWQB 1EQZC 3EPLA 3UTAB 2F8NK 4H9QB 3KUYA 2DQNC 5KDMA 2ZY3A 2RIQA 3UT9D 3KUYC 5B1LD 3AZNB 1KX4D 1M19A 2G5IC 1P3MD 5BO0A 4NE3A 1ZLAA 5DNMC 4XUJA 3MGQD 2F8ND 4UPKA 1BFMA 5GT0A 4J8WA 1M18D 3V9RA 1ZLAC 4XUJC 2F8NH 4CAYB 3LZ1B 3KUYB 1H3OA 3X1UB 4J8WC 3B0BA 1KX5C 1P3GA 4HGAC 3KXBA 2JCHA 1T3UA 1F66D 3AZFD 1P3GC 1M19B 3KXBC 5CP6B 3A6NA 4WU8D 3LELA 4Z66D 5JA4B 3W96A 3A6NC 3W99B 3LELC 1ZLAB 4XUJB 3X1SA 4H9PA 3LZ0D 3REHB 3W96C 3WTPA 5GT0B 5CPID 3V9RB 4H9NA 3WAAB 3VH6W 3X1SC 1H3OB 2Y2PA 4H9RA 3WTPC 3X1VA 2AROA 4QLCA 5AY8D 1P3IB 2Y2LA 4QLCC 5AV9A 4DRBA 2CV5B 3B6GD 3LELB 3AN2D 3REJB 4CSRB 1P3PD 2LY8A 5AV9C 3UT9A 3W96B 3NQUA 4UUZA 5B2JB 4KGCD 5B1LA 5BNXA 4YM6B 3X1SB 1KX4A 5B31B 4KHAA 3WTPB 3UT9C 1M1AD 3AZLD 5B1LC 1P3MA 4ZUXD 3MGSD 1S32D 2IO5C 1KX4C 1B67A 4H9RB 3MGRD 3X1VB 3UTAD 2AROB 4QLCB 2BYMA 1P3MC 2F8NA 5AV8B 5B0ZB 3MGQC 3W98D 5AV9B 4JJND 5B2IB 1Z2CB 3O62B 4UUZB 2XD1A 3EPKA 2IO5B 3AZFA 1KX4B 4KHAB 4WU8A 2HUEC 5B1MB 3AZIA 1TZYB 4Z66A 2NQBA 5GT3D 3AZFC 2ZM5A 3B6FB 4WU8C 3AZIC 4Z66C 2BYMB 2NQBC 3LZ1D 3KUYD 3X1UD 5CPIA 4M6BA 1U35B 4DQYB 5CPIC 5AY8A 1M19D 1WWSA 5CP6D 5AY8C 3B6GA 3AZIB 3NQJA 3W99D 4XUJD 5AVBB 4Z2MH 2NQBB 2ZY5A 3REHD 3B6GC 5GT0D 1BH8A 3WAAD 3AZJD 3R45A 3C1BA 5CPIB 1M1AA 3AZLA 4KGCC 4ZUXA 3MGSA 1P34D 1S32A 3A1KA 5BNVA 3MGRA 2CWEA 1M1AC 3AZLC 1P3ID 4ZUXC 3MGSC 4H9QA 1S32C 1BH9B 3VH6A 2CV5D 3MGRC 3AZHA 3REJD 3W98A 3B6GB 3W96D 4JJNA 5B2JD 3W98C 4YM6D 3X1SD 3REKB 5CPKD 5B31D 3WTPD 4JJNC 5BT1D 3KFUG 1KU5A 3RELD 4ZBJC 4H9OB 5GXQD 3C1BB 1AOID 3WTPE 3X1VD 2AROD 4QLCD 5GT3A 5BNVB 3MGRB 2YFWA 5AV8D 5B0ZD 4J8VA 5AV9D 5GT3C 4CAYA 3MGPD 3LZ1A 2Y2GA 3X1UA 3AZHB 3AZGA 4AWLB 3W98B 5B2ID 2JE5A 3O62D 3LZ1C 4JJNB 3X1UC 3AZGC 5CHLB 4ZBJB 2HIOD 5CP6A 1B6WA 5B1MD 1TZYD 3F6TA 5JA4A 3TU4B 3X1TB 5CP6C 1M19C 3B6FD 3W99A 5GT3B 4KUDB 3REHA 2YFWB 3W99C 4J8VB 1TAFA 3WAAA 3AZJA 3B0CT 1U35D 3REHC 3AZGB 5GT0C 3AV2A 3WAAC 1P34A 3AZJC 1F1EA 3AV2C 1P3IA 1P34C 2PYOB 1A7WA 2CV5A 3AZID 1W2EA 3REJA 4CSRA 5AVBD 3LJAB 1P3IC 1P3FD 2NQBD 3WA9B 4LD9B 2CV5C 4E45A 5B2JA 3VH5T 3REJC 4J8UA 4YM6A 5CPKA 5B31A 4XZQB 5B2JC 1TAFB 3RELA 4NFTA 4J8UC 4YM6C 2L5AA 5GXQA 3AZJB 5B31C 5CPKC 1AOIA 5BT1C 4G92B 3AV2B 1P34B 3RELC 5GXQC 2Y2KA 1AOIC 5AV8A 5B0YD 3X1VC 5B0ZA 2AROC 3MGPA 5AV8C 5B32G 5B0ZC 5B2IA 3MGPC 3REKD 1P3KD 3O62A 2RVQD 4J8UB 5CPKB 5B2IC 2HIOA 3O62C 3C1BD 5B1MA 3MNNB 3AZKB 1PZRA 1TZYA 2BYKA 3RELB 1HQ3B 2Y2OA 5GXQB 2HIOC 3B6FA 1AOIB 5B1MC 3A1IA 5B33B 1TZYC 3AFAB 3MVDD 2F2AC 3B6FC 3AZHD 5JRGB 3MGPB 1U35A 5BS7A 4Z2MG 1U35C 2FFFB 5BS7C 3AYWA 5DNNB 3UTBB 2FJ7B 2HIOB 3X1TD 3TU4D 3REID 2BYKB 1N1JB 5AVBA 1P3FA 4KUDD 2Y2IA 3B0DB 3C1CA 5AVBC 4J8VD 1P3FC 1Q9CA 3AZGD 3C1CC 2UWXA 3B0CW 3H0LC 5AV6B 2PYOD 1BH9A 3EPHA 3AYWB 5B0YA 4EO5B 4LD9D 3LJAD 3WA9D 5B31G 1JFIA 5B0YC 1P3FB 2Y2QA 3REKA 1P3KA 4XZQD 3C1CB 4H9OA 3VH5W 3REKC 1P3KC 2RVQC 3AV2D 3C1BC 4X23A 4R8PB 3MVDA 2ZY4A 1KX3B 4X23C 2YFVB 5B0YB 3AV1B 3AZEB 3MVDC 4YS3B 4G91B 3AZHC 3AZMD 1JFIB 4AWLC 4J8UD 1P3KB 4WV4B 5CPJD 5AVCB 3AZKD 3MNND 2F8NG 1HQ3D 3X1TA 3TU4A 1P3LD 3EPJA 3REIA 5B33D 3AFAD 4KUDA 3AL0C 3X1TC 2Y2JA 3TU4C 4X23B 3REIC 5JRGD 3MVDB 4J8XB 4Z5TA 4KUDC 4J8VC 4Z5TC 4H9SA 5DNND 3UTBD 2FJ7D 2PYOA 4H9SC 1ID3A 5E5AB 4LD9A 3LJAA 3WA9A 2PYOC 1ID3C 3REIB 4LD9C 3LJAC 4WZSB 3WKJB 3WA9C 4XZQA 1P3AD 4Z5TB 4XZQC 5AV6D 5AV5D 4G92C 3AYWD 5B24A 3H0RC 5GSUB 1ID3B 4WU9B 1P3OB 5B24C 5B32B 5DNMA 3W97D 3AZMA 3C1CD 1EQZB 1WWIA 5CPJA 3AZKA 3MNNA 3AZMC 1HQ3A 5CPJC 1KX5A 1P3LA 3AZKC 4R8PD 5F99A 3MNNC 5KDMB 5B33A 3AFAA 1HQ3C 1KX3D 2W8SA 3VH5A 1P3LC 5B24B 5F99C 5JRGA 5B33C 3AV1D 3AFAC 3AZED 4YS3D 2ZY2A 5JRGC 1P3BD 5DNMB 5BO0B 5AVCD 3AZMB 5G49A 2Y2NA 5DNNA 3UTBA 2FJ7A 5CPJB 5DNNC 1N1JA 3EG5B 4J8WB 3UTBC 2FJ7C 1KX5B 1P3LB 4X23D 4HGAB 5F99B 5B40D 4J8XD 1P3GB 3KXBB 3B0DC 1P3AA 3A6NB 5AV6A 5AV5A 1P3AC 5E5AD 5G49B 5AV6C 5AV5C 1R4VA 4H9PB 3IP4C 3AYWC 4EO5C 3WKJD 2NZDD 4H9NB 3W97A 3KWQD 3P5JB 4Z5TD 3MGQA 4WJ3C 4NE6A 3W97C 1P3AB 1M18A 4WNNA 4DRAA 4R8PA 5AV5B 5GSUD 1M18C 1ID3D 1KX3A 3AZND 4WU9D 2YFVA 3UT9B 4R8PC 1P3OD 3NQUB 3AV1A 3AZEA 1F66A 5B1LB 5B32D 4YS3A 5BNXB 1KX3C 3AV1C 1EQZD 1P3BA 3AZEC 1F66C 1P3MB 4YS3C 5AVCA 4G91C 3W97B 2Y2MA 1P3BC 3MGQB 2F8NB 5AVCC 3LZ0A 2Y2HA 1M18B 1ULYA 4WNNB 4NE5A 5B24D 2BG1A 3LZ0C 5B40A 4J8XA 4E44A 1HTAA 2HUEB 5B40C 1F66B 4J8XC 5DNMD 3AZFB 4WU8B 2JSSA 1P3BB 3AN2A 4Z66B 2XD5A 3FDDA 1ZLAD 1P3PA 5E5AA 4J8WD 3VH6T 3AN2C 4KGCA 1KX5D 1P3PC 5E5AC 3LZ0B 5C3IC 5F99D 5FUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WKJ A;  2NZD A;  3KSY A;  1P3G D;  3KXB D;  5B40 B;  3KWQ A;  3WKJ C;  3UTA A;  2NZD C;  5AY8 B;  3A6N D;  3KWQ C;  3LEL D;  3UTA C;  3NQJ B;  5GSU A;  3AN2 B;  1P3P B;  3AZN A;  5C3I B;  4WU9 A;  1P3O A;  1BH8 B;  5GSU C;  5B32 A;  4KGC B;  3AZN C;  4WU9 C;  5FUG B;  1P3O C;  3R45 B;  1EQZ A;  1M1A B;  3AZL B;  5B32 C;  2NZD B;  4ZUX B;  3MGS B;  1S32 B;  3KWQ B;  1EQZ C;  3UTA B;  2F8N K;  4H9Q B;  3KUY A;  5KDM A;  3UT9 D;  3KUY C;  5B1L D;  3AZN B;  1KX4 D;  1M19 A;  1P3M D;  5BO0 A;  4NE3 A;  1ZLA A;  5DNM C;  4XUJ A;  3MGQ D;  2F8N D;  1BFM A;  5GT0 A;  4J8W A;  1M18 D;  3V9R A;  1ZLA C;  4XUJ C;  2F8N H;  4CAY B;  3LZ1 B;  3KUY B;  1H3O A;  3X1U B;  4J8W C;  3B0B A;  1KX5 C;  1P3G A;  4HGA C;  3KXB A;  1F66 D;  3AZF D;  1P3G C;  1M19 B;  3KXB C;  5CP6 B;  3A6N A;  4WU8 D;  3LEL A;  4Z66 D;  5JA4 B;  3W96 A;  3A6N C;  3W99 B;  3LEL C;  1ZLA B;  4XUJ B;  3X1S A;  4H9P A;  3LZ0 D;  3REH B;  3W96 C;  3WTP A;  5GT0 B;  5CPI D;  3V9R B;  4H9N A;  3WAA B;  3VH6 W;  3X1S C;  1H3O B;  4H9R A;  3WTP C;  3X1V A;  2ARO A;  4QLC A;  5AY8 D;  1P3I B;  4QLC C;  5AV9 A;  4DRB A;  2CV5 B;  3B6G D;  3LEL B;  3AN2 D;  3REJ B;  4CSR B;  1P3P D;  2LY8 A;  5AV9 C;  3UT9 A;  3W96 B;  3NQU A;  4UUZ A;  5B2J B;  4KGC D;  5B1L A;  5BNX A;  4YM6 B;  3X1S B;  1KX4 A;  5B31 B;  4KHA A;  3WTP B;  3UT9 C;  1M1A D;  3AZL D;  5B1L C;  1P3M A;  4ZUX D;  3MGS D;  1S32 D;  2IO5 C;  1KX4 C;  1B67 A;  4H9R B;  3MGR D;  3X1V B;  3UTA D;  2ARO B;  4QLC B;  2BYM A;  1P3M C;  2F8N A;  5AV8 B;  5B0Z B;  3MGQ C;  3W98 D;  5AV9 B;  4JJN D;  5B2I B;  3O62 B;  4UUZ B;  2IO5 B;  3AZF A;  1KX4 B;  4KHA B;  4WU8 A;  2HUE C;  5B1M B;  3AZI A;  1TZY B;  4Z66 A;  2NQB A;  5GT3 D;  3AZF C;  3B6F B;  4WU8 C;  3AZI C;  4Z66 C;  2BYM B;  2NQB C;  3LZ1 D;  3KUY D;  3X1U D;  5CPI A;  4M6B A;  1U35 B;  5CPI C;  5AY8 A;  1M19 D;  1WWS A;  5CP6 D;  5AY8 C;  3B6G A;  3AZI B;  3NQJ A;  3W99 D;  4XUJ D;  5AVB B;  4Z2M H;  2NQB B;  3REH D;  3B6G C;  5GT0 D;  1BH8 A;  3WAA D;  3AZJ D;  3R45 A;  3C1B A;  5CPI B;  1M1A A;  3AZL A;  4KGC C;  4ZUX A;  3MGS A;  1P34 D;  1S32 A;  5BNV A;  3MGR A;  2CWE A;  1M1A C;  3AZL C;  1P3I D;  4ZUX C;  3MGS C;  4H9Q A;  1S32 C;  1BH9 B;  3VH6 A;  2CV5 D;  3MGR C;  3AZH A;  3REJ D;  3W98 A;  3B6G B;  3W96 D;  4JJN A;  5B2J D;  3W98 C;  4YM6 D;  3X1S D;  3REK B;  5CPK D;  5B31 D;  3WTP D;  4JJN C;  5BT1 D;  1KU5 A;  3REL D;  4ZBJ C;  4H9O B;  5GXQ D;  3C1B B;  1AOI D;  3WTP E;  3X1V D;  2ARO D;  4QLC D;  5GT3 A;  5BNV B;  3MGR B;  2YFW A;  5AV8 D;  5B0Z D;  4J8V A;  5AV9 D;  5GT3 C;  4CAY A;  3MGP D;  3LZ1 A;  3X1U A;  3AZH B;  3AZG A;  4AWL B;  3W98 B;  5B2I D;  3LZ1 C;  3O62 D;  4JJN B;  3X1U C;  3AZG C;  5CHL B;  4ZBJ B;  2HIO D;  5CP6 A;  1B6W A;  5B1M D;  1TZY D;  3X1T B;  5JA4 A;  3TU4 B;  1M19 C;  5CP6 C;  3B6F D;  3W99 A;  5GT3 B;  4KUD B;  3REH A;  2YFW B;  3W99 C;  4J8V B;  1TAF A;  3WAA A;  3AZJ A;  3B0C T;  1U35 D;  3REH C;  3AZG B;  5GT0 C;  3AV2 A;  3WAA C;  1P34 A;  3AZJ C;  1F1E A;  3AV2 C;  1P3I A;  1P34 C;  2PYO B;  1A7W A;  2CV5 A;  3AZI D;  3REJ A;  4CSR A;  5AVB D;  3LJA B;  1P3I C;  1P3F D;  2NQB D;  3WA9 B;  4LD9 B;  2CV5 C;  4E45 A;  5B2J A;  3VH5 T;  3REJ C;  4J8U A;  4YM6 A;  5CPK A;  5B31 A;  4XZQ B;  5B2J C;  1TAF B;  3REL A;  4NFT A;  4J8U C;  4YM6 C;  2L5A A;  5GXQ A;  3AZJ B;  5B31 C;  5CPK C;  1AOI A;  5BT1 C;  4G92 B;  3AV2 B;  1P34 B;  3REL C;  5GXQ C;  1AOI C;  5AV8 A;  5B0Y D;  3X1V C;  5B0Z A;  2ARO C;  3MGP A;  5AV8 C;  5B32 G;  5B0Z C;  5B2I A;  3MGP C;  3REK D;  1P3K D;  3O62 A;  2RVQ D;  4J8U B;  5CPK B;  5B2I C;  2HIO A;  3O62 C;  3C1B D;  5B1M A;  3MNN B;  3AZK B;  2BYK A;  1TZY A;  3REL B;  1HQ3 B;  5GXQ B;  2HIO C;  3B6F A;  1AOI B;  5B1M C;  5B33 B;  1TZY C;  3AFA B;  3MVD D;  3B6F C;  3AZH D;  5JRG B;  3MGP B;  1U35 A;  5BS7 A;  4Z2M G;  1U35 C;  5BS7 C;  3AYW A;  5DNN B;  3UTB B;  2FJ7 B;  2HIO B;  3X1T D;  3TU4 D;  3REI D;  2BYK B;  1N1J B;  5AVB A;  1P3F A;  4KUD D;  3B0D B;  3C1C A;  5AVB C;  4J8V D;  1P3F C;  1Q9C A;  3AZG D;  3C1C C;  3B0C W;  5AV6 B;  2PYO D;  1BH9 A;  3AYW B;  5B0Y A;  4EO5 B;  4LD9 D;  3LJA D;  3WA9 D;  5B31 G;  1JFI A;  5B0Y C;  1P3F B;  3REK A;  1P3K A;  4XZQ D;  3C1C B;  4H9O A;  3VH5 W;  3REK C;  1P3K C;  2RVQ C;  3AV2 D;  3C1B C;  4X23 A;  4R8P B;  3MVD A;  1KX3 B;  4X23 C;  2YFV B;  5B0Y B;  3AV1 B;  3AZE B;  3MVD C;  4YS3 B;  4G91 B;  3AZH C;  3AZM D;  1JFI B;  4AWL C;  4J8U D;  1P3K B;  4WV4 B;  5CPJ D;  5AVC B;  3AZK D;  3MNN D;  2F8N G;  1HQ3 D;  3X1T A;  3TU4 A;  1P3L D;  3REI A;  5B33 D;  3AFA D;  4KUD A;  3X1T C;  3TU4 C;  4X23 B;  3REI C;  5JRG D;  3MVD B;  4J8X B;  4Z5T A;  4KUD C;  4J8V C;  4Z5T C;  4H9S A;  5DNN D;  3UTB D;  2FJ7 D;  2PYO A;  4H9S C;  1ID3 A;  5E5A B;  4LD9 A;  3LJA A;  3WA9 A;  2PYO C;  1ID3 C;  3REI B;  4LD9 C;  3LJA C;  4WZS B;  3WKJ B;  3WA9 C;  4XZQ A;  1P3A D;  4Z5T B;  4XZQ C;  5AV6 D;  5AV5 D;  4G92 C;  3AYW D;  5B24 A;  5GSU B;  1ID3 B;  4WU9 B;  1P3O B;  5B24 C;  5B32 B;  5DNM A;  3W97 D;  3AZM A;  3C1C D;  1EQZ B;  1WWI A;  5CPJ A;  3AZK A;  3MNN A;  3AZM C;  1HQ3 A;  5CPJ C;  1KX5 A;  1P3L A;  3AZK C;  4R8P D;  5F99 A;  3MNN C;  5KDM B;  5B33 A;  3AFA A;  1HQ3 C;  1KX3 D;  3VH5 A;  1P3L C;  5B24 B;  5F99 C;  5JRG A;  5B33 C;  3AV1 D;  3AFA C;  3AZE D;  4YS3 D;  5JRG C;  1P3B D;  5DNM B;  5BO0 B;  5AVC D;  3AZM B;  5G49 A;  5DNN A;  3UTB A;  2FJ7 A;  5CPJ B;  5DNN C;  1N1J A;  3UTB C;  4J8W B;  2FJ7 C;  1KX5 B;  1P3L B;  4X23 D;  4HGA B;  5F99 B;  5B40 D;  4J8X D;  1P3G B;  3KXB B;  3B0D C;  1P3A A;  3A6N B;  5AV6 A;  5AV5 A;  1P3A C;  5E5A D;  5G49 B;  5AV6 C;  5AV5 C;  1R4V A;  4H9P B;  3AYW C;  4EO5 C;  3WKJ D;  2NZD D;  4H9N B;  3W97 A;  3KWQ D;  4Z5T D;  3MGQ A;  4NE6 A;  3W97 C;  1P3A B;  1M18 A;  4WNN A;  4DRA A;  4R8P A;  5AV5 B;  5GSU D;  1M18 C;  1ID3 D;  1KX3 A;  3AZN D;  4WU9 D;  2YFV A;  3UT9 B;  4R8P C;  1P3O D;  3NQU B;  3AV1 A;  3AZE A;  1F66 A;  5B1L B;  5B32 D;  4YS3 A;  5BNX B;  1KX3 C;  3AV1 C;  1EQZ D;  1P3B A;  3AZE C;  1F66 C;  1P3M B;  4YS3 C;  5AVC A;  4G91 C;  3W97 B;  1P3B C;  3MGQ B;  2F8N B;  5AVC C;  3LZ0 A;  1M18 B;  1ULY A;  4WNN B;  4NE5 A;  5B24 D;  3LZ0 C;  5B40 A;  4J8X A;  4E44 A;  1HTA A;  2HUE B;  5B40 C;  1F66 B;  4J8X C;  5DNM D;  3AZF B;  4WU8 B;  2JSS A;  1P3B B;  3AN2 A;  4Z66 B;  1ZLA D;  1P3P A;  5E5A A;  4J8W D;  3VH6 T;  3AN2 C;  4KGC A;  1KX5 D;  1P3P C;  5E5A C;  3LZ0 B;  5C3I C;  5F99 D;  5FUG A; 
#chains in the Genus database with same CATH topology
 3WKJ A;  2NZD A;  3KSY A;  1P3G D;  3KXB D;  5B40 B;  3KWQ A;  2VQR A;  3WKJ C;  2J8P A;  3UTA A;  2NZD C;  2DF4 C;  5AY8 B;  3A6N D;  3KWQ C;  3LEL D;  3UTA C;  3NQJ B;  5GSU A;  3AN2 B;  1P3P B;  3AZN A;  5C3I B;  4WU9 A;  1P3O A;  1BH8 B;  5GSU C;  5B32 A;  4KGC B;  3H0M C;  3AZN C;  4WU9 C;  5FUG B;  1P3O C;  3R45 B;  1EQZ A;  1M1A B;  3AZL B;  5B32 C;  2NZD B;  4ZUX B;  2G5H C;  3MGS B;  1S32 B;  3KWQ B;  1EQZ C;  3EPL A;  3UTA B;  2F8N K;  4H9Q B;  3KUY A;  2DQN C;  5KDM A;  2ZY3 A;  2RIQ A;  3UT9 D;  3KUY C;  5B1L D;  3AZN B;  1KX4 D;  1M19 A;  2G5I C;  1P3M D;  5BO0 A;  4NE3 A;  1ZLA A;  5DNM C;  4XUJ A;  3MGQ D;  2F8N D;  4UPK A;  1BFM A;  5GT0 A;  4J8W A;  1M18 D;  3V9R A;  1ZLA C;  4XUJ C;  2F8N H;  4CAY B;  3LZ1 B;  3KUY B;  1H3O A;  3X1U B;  4J8W C;  3B0B A;  1KX5 C;  1P3G A;  4HGA C;  3KXB A;  2JCH A;  1T3U A;  1F66 D;  3AZF D;  1P3G C;  1M19 B;  3KXB C;  5CP6 B;  3A6N A;  4WU8 D;  3LEL A;  4Z66 D;  5JA4 B;  3W96 A;  3A6N C;  3W99 B;  3LEL C;  1ZLA B;  4XUJ B;  3X1S A;  4H9P A;  3LZ0 D;  3REH B;  3W96 C;  3WTP A;  5GT0 B;  5CPI D;  3V9R B;  4H9N A;  3WAA B;  3VH6 W;  3X1S C;  1H3O B;  2Y2P A;  4H9R A;  3WTP C;  3X1V A;  2ARO A;  4QLC A;  5AY8 D;  1P3I B;  2Y2L A;  4QLC C;  5AV9 A;  4DRB A;  2CV5 B;  3B6G D;  3LEL B;  3AN2 D;  3REJ B;  4CSR B;  1P3P D;  2LY8 A;  5AV9 C;  3UT9 A;  3W96 B;  3NQU A;  4UUZ A;  5B2J B;  4KGC D;  5B1L A;  5BNX A;  4YM6 B;  3X1S B;  1KX4 A;  5B31 B;  4KHA A;  3WTP B;  3UT9 C;  1M1A D;  3AZL D;  5B1L C;  1P3M A;  4ZUX D;  3MGS D;  1S32 D;  2IO5 C;  1KX4 C;  1B67 A;  4H9R B;  3MGR D;  3X1V B;  3UTA D;  2ARO B;  4QLC B;  2BYM A;  1P3M C;  2F8N A;  5AV8 B;  5B0Z B;  3MGQ C;  3W98 D;  5AV9 B;  4JJN D;  5B2I B;  1Z2C B;  3O62 B;  4UUZ B;  2XD1 A;  3EPK A;  2IO5 B;  3AZF A;  1KX4 B;  4KHA B;  4WU8 A;  2HUE C;  5B1M B;  3AZI A;  1TZY B;  4Z66 A;  2NQB A;  5GT3 D;  3AZF C;  2ZM5 A;  3B6F B;  4WU8 C;  3AZI C;  4Z66 C;  2BYM B;  2NQB C;  3LZ1 D;  3KUY D;  3X1U D;  5CPI A;  4M6B A;  1U35 B;  4DQY B;  5CPI C;  5AY8 A;  1M19 D;  1WWS A;  5CP6 D;  5AY8 C;  3B6G A;  3AZI B;  3NQJ A;  3W99 D;  4XUJ D;  5AVB B;  4Z2M H;  2NQB B;  2ZY5 A;  3REH D;  3B6G C;  5GT0 D;  1BH8 A;  3WAA D;  3AZJ D;  3R45 A;  3C1B A;  5CPI B;  1M1A A;  3AZL A;  4KGC C;  4ZUX A;  3MGS A;  1P34 D;  1S32 A;  3A1K A;  5BNV A;  3MGR A;  2CWE A;  1M1A C;  3AZL C;  1P3I D;  4ZUX C;  3MGS C;  4H9Q A;  1S32 C;  1BH9 B;  3VH6 A;  2CV5 D;  3MGR C;  3AZH A;  3REJ D;  3W98 A;  3B6G B;  3W96 D;  4JJN A;  5B2J D;  3W98 C;  4YM6 D;  3X1S D;  3REK B;  5CPK D;  5B31 D;  3WTP D;  4JJN C;  5BT1 D;  3KFU G;  1KU5 A;  3REL D;  4ZBJ C;  4H9O B;  5GXQ D;  3C1B B;  1AOI D;  3WTP E;  3X1V D;  2ARO D;  4QLC D;  5GT3 A;  5BNV B;  3MGR B;  2YFW A;  5AV8 D;  5B0Z D;  4J8V A;  5AV9 D;  5GT3 C;  4CAY A;  3MGP D;  3LZ1 A;  2Y2G A;  3X1U A;  3AZH B;  3AZG A;  4AWL B;  3W98 B;  5B2I D;  2JE5 A;  3O62 D;  3LZ1 C;  4JJN B;  3X1U C;  3AZG C;  5CHL B;  4ZBJ B;  2HIO D;  5CP6 A;  1B6W A;  5B1M D;  1TZY D;  3F6T A;  5JA4 A;  3TU4 B;  3X1T B;  5CP6 C;  1M19 C;  3B6F D;  3W99 A;  5GT3 B;  4KUD B;  3REH A;  2YFW B;  3W99 C;  4J8V B;  1TAF A;  3WAA A;  3AZJ A;  3B0C T;  1U35 D;  3REH C;  3AZG B;  5GT0 C;  3AV2 A;  3WAA C;  1P34 A;  3AZJ C;  1F1E A;  3AV2 C;  1P3I A;  1P34 C;  2PYO B;  1A7W A;  2CV5 A;  3AZI D;  1W2E A;  3REJ A;  4CSR A;  5AVB D;  3LJA B;  1P3I C;  1P3F D;  2NQB D;  3WA9 B;  4LD9 B;  2CV5 C;  4E45 A;  5B2J A;  3VH5 T;  3REJ C;  4J8U A;  4YM6 A;  5CPK A;  5B31 A;  4XZQ B;  5B2J C;  1TAF B;  3REL A;  4NFT A;  4J8U C;  4YM6 C;  2L5A A;  5GXQ A;  3AZJ B;  5B31 C;  5CPK C;  1AOI A;  5BT1 C;  4G92 B;  3AV2 B;  1P34 B;  3REL C;  5GXQ C;  2Y2K A;  1AOI C;  5AV8 A;  5B0Y D;  3X1V C;  5B0Z A;  2ARO C;  3MGP A;  5AV8 C;  5B32 G;  5B0Z C;  5B2I A;  3MGP C;  3REK D;  1P3K D;  3O62 A;  2RVQ D;  4J8U B;  5CPK B;  5B2I C;  2HIO A;  3O62 C;  3C1B D;  5B1M A;  3MNN B;  3AZK B;  1PZR A;  1TZY A;  2BYK A;  3REL B;  1HQ3 B;  2Y2O A;  5GXQ B;  2HIO C;  3B6F A;  1AOI B;  5B1M C;  3A1I A;  5B33 B;  1TZY C;  3AFA B;  3MVD D;  2F2A C;  3B6F C;  3AZH D;  5JRG B;  3MGP B;  1U35 A;  5BS7 A;  4Z2M G;  1U35 C;  2FFF B;  5BS7 C;  3AYW A;  5DNN B;  3UTB B;  2FJ7 B;  2HIO B;  3X1T D;  3TU4 D;  3REI D;  2BYK B;  1N1J B;  5AVB A;  1P3F A;  4KUD D;  2Y2I A;  3B0D B;  3C1C A;  5AVB C;  4J8V D;  1P3F C;  1Q9C A;  3AZG D;  3C1C C;  2UWX A;  3B0C W;  3H0L C;  5AV6 B;  2PYO D;  1BH9 A;  3EPH A;  3AYW B;  5B0Y A;  4EO5 B;  4LD9 D;  3LJA D;  3WA9 D;  5B31 G;  1JFI A;  5B0Y C;  1P3F B;  2Y2Q A;  3REK A;  1P3K A;  4XZQ D;  3C1C B;  4H9O A;  3VH5 W;  3REK C;  1P3K C;  2RVQ C;  3AV2 D;  3C1B C;  4X23 A;  4R8P B;  3MVD A;  2ZY4 A;  1KX3 B;  4X23 C;  2YFV B;  5B0Y B;  3AV1 B;  3AZE B;  3MVD C;  4YS3 B;  4G91 B;  3AZH C;  3AZM D;  1JFI B;  4AWL C;  4J8U D;  1P3K B;  4WV4 B;  5CPJ D;  5AVC B;  3AZK D;  3MNN D;  2F8N G;  1HQ3 D;  3X1T A;  3TU4 A;  1P3L D;  3EPJ A;  3REI A;  5B33 D;  3AFA D;  4KUD A;  3AL0 C;  3X1T C;  2Y2J A;  3TU4 C;  4X23 B;  3REI C;  5JRG D;  3MVD B;  4J8X B;  4Z5T A;  4KUD C;  4J8V C;  4Z5T C;  4H9S A;  5DNN D;  3UTB D;  2FJ7 D;  2PYO A;  4H9S C;  1ID3 A;  5E5A B;  4LD9 A;  3LJA A;  3WA9 A;  2PYO C;  1ID3 C;  3REI B;  4LD9 C;  3LJA C;  4WZS B;  3WKJ B;  3WA9 C;  4XZQ A;  1P3A D;  4Z5T B;  4XZQ C;  5AV6 D;  5AV5 D;  4G92 C;  3AYW D;  5B24 A;  3H0R C;  5GSU B;  1ID3 B;  4WU9 B;  1P3O B;  5B24 C;  5B32 B;  5DNM A;  3W97 D;  3AZM A;  3C1C D;  1EQZ B;  1WWI A;  5CPJ A;  3AZK A;  3MNN A;  3AZM C;  1HQ3 A;  5CPJ C;  1KX5 A;  1P3L A;  3AZK C;  4R8P D;  5F99 A;  3MNN C;  5KDM B;  5B33 A;  3AFA A;  1HQ3 C;  1KX3 D;  2W8S A;  3VH5 A;  1P3L C;  5B24 B;  5F99 C;  5JRG A;  5B33 C;  3AV1 D;  3AFA C;  3AZE D;  4YS3 D;  2ZY2 A;  5JRG C;  1P3B D;  5DNM B;  5BO0 B;  5AVC D;  3AZM B;  5G49 A;  2Y2N A;  5DNN A;  3UTB A;  2FJ7 A;  5CPJ B;  5DNN C;  1N1J A;  3EG5 B;  4J8W B;  3UTB C;  2FJ7 C;  1KX5 B;  1P3L B;  4X23 D;  4HGA B;  5F99 B;  5B40 D;  4J8X D;  1P3G B;  3KXB B;  3B0D C;  1P3A A;  3A6N B;  5AV6 A;  5AV5 A;  1P3A C;  5E5A D;  5G49 B;  5AV6 C;  5AV5 C;  1R4V A;  4H9P B;  3IP4 C;  3AYW C;  4EO5 C;  3WKJ D;  2NZD D;  4H9N B;  3W97 A;  3KWQ D;  3P5J B;  4Z5T D;  3MGQ A;  4WJ3 C;  4NE6 A;  3W97 C;  1P3A B;  1M18 A;  4WNN A;  4DRA A;  4R8P A;  5AV5 B;  5GSU D;  1M18 C;  1ID3 D;  1KX3 A;  3AZN D;  4WU9 D;  2YFV A;  3UT9 B;  4R8P C;  1P3O D;  3NQU B;  3AV1 A;  3AZE A;  1F66 A;  5B1L B;  5B32 D;  4YS3 A;  5BNX B;  1KX3 C;  3AV1 C;  1EQZ D;  1P3B A;  3AZE C;  1F66 C;  1P3M B;  4YS3 C;  5AVC A;  4G91 C;  3W97 B;  2Y2M A;  1P3B C;  3MGQ B;  2F8N B;  5AVC C;  3LZ0 A;  2Y2H A;  1M18 B;  1ULY A;  4WNN B;  4NE5 A;  5B24 D;  2BG1 A;  3LZ0 C;  5B40 A;  4J8X A;  4E44 A;  1HTA A;  2HUE B;  5B40 C;  1F66 B;  4J8X C;  5DNM D;  3AZF B;  4WU8 B;  2JSS A;  1P3B B;  3AN2 A;  4Z66 B;  2XD5 A;  3FDD A;  1ZLA D;  1P3P A;  5E5A A;  4J8W D;  3VH6 T;  3AN2 C;  4KGC A;  1KX5 D;  1P3P C;  5E5A C;  3LZ0 B;  5C3I C;  5F99 D;  5FUG A; 
#chains in the Genus database with same CATH homology
 3WKJ A;  2NZD A;  3KSY A;  1P3G D;  3KXB D;  5B40 B;  3KWQ A;  2VQR A;  3WKJ C;  2J8P A;  3UTA A;  2NZD C;  2DF4 C;  5AY8 B;  3A6N D;  3KWQ C;  3LEL D;  3UTA C;  3NQJ B;  5GSU A;  3AN2 B;  1P3P B;  3AZN A;  5C3I B;  4WU9 A;  1P3O A;  1BH8 B;  5GSU C;  5B32 A;  4KGC B;  3H0M C;  3AZN C;  4WU9 C;  5FUG B;  1P3O C;  3R45 B;  1EQZ A;  1M1A B;  3AZL B;  5B32 C;  2NZD B;  4ZUX B;  2G5H C;  3MGS B;  1S32 B;  3KWQ B;  1EQZ C;  3EPL A;  3UTA B;  2F8N K;  4H9Q B;  3KUY A;  2DQN C;  5KDM A;  2ZY3 A;  2RIQ A;  3UT9 D;  3KUY C;  5B1L D;  3AZN B;  1KX4 D;  1M19 A;  2G5I C;  1P3M D;  5BO0 A;  4NE3 A;  1ZLA A;  5DNM C;  4XUJ A;  3MGQ D;  2F8N D;  4UPK A;  1BFM A;  5GT0 A;  4J8W A;  1M18 D;  3V9R A;  1ZLA C;  4XUJ C;  2F8N H;  4CAY B;  3LZ1 B;  3KUY B;  1H3O A;  3X1U B;  4J8W C;  3B0B A;  1KX5 C;  1P3G A;  4HGA C;  3KXB A;  2JCH A;  1T3U A;  1F66 D;  3AZF D;  1P3G C;  1M19 B;  3KXB C;  5CP6 B;  3A6N A;  4WU8 D;  3LEL A;  4Z66 D;  5JA4 B;  3W96 A;  3A6N C;  3W99 B;  3LEL C;  1ZLA B;  4XUJ B;  3X1S A;  4H9P A;  3LZ0 D;  3REH B;  3W96 C;  3WTP A;  5GT0 B;  5CPI D;  3V9R B;  4H9N A;  3WAA B;  3VH6 W;  3X1S C;  1H3O B;  2Y2P A;  4H9R A;  3WTP C;  3X1V A;  2ARO A;  4QLC A;  5AY8 D;  1P3I B;  2Y2L A;  4QLC C;  5AV9 A;  4DRB A;  2CV5 B;  3B6G D;  3LEL B;  3AN2 D;  3REJ B;  4CSR B;  1P3P D;  2LY8 A;  5AV9 C;  3UT9 A;  3W96 B;  3NQU A;  4UUZ A;  5B2J B;  4KGC D;  5B1L A;  5BNX A;  4YM6 B;  3X1S B;  1KX4 A;  5B31 B;  4KHA A;  3WTP B;  3UT9 C;  1M1A D;  3AZL D;  5B1L C;  1P3M A;  4ZUX D;  3MGS D;  1S32 D;  2IO5 C;  1KX4 C;  1B67 A;  4H9R B;  3MGR D;  3X1V B;  3UTA D;  2ARO B;  4QLC B;  2BYM A;  1P3M C;  2F8N A;  5AV8 B;  5B0Z B;  3MGQ C;  3W98 D;  5AV9 B;  4JJN D;  5B2I B;  1Z2C B;  3O62 B;  4UUZ B;  2XD1 A;  3EPK A;  2IO5 B;  3AZF A;  1KX4 B;  4KHA B;  4WU8 A;  2HUE C;  5B1M B;  3AZI A;  1TZY B;  4Z66 A;  2NQB A;  5GT3 D;  3AZF C;  2ZM5 A;  3B6F B;  4WU8 C;  3AZI C;  4Z66 C;  2BYM B;  2NQB C;  3LZ1 D;  3KUY D;  3X1U D;  5CPI A;  4M6B A;  1U35 B;  4DQY B;  5CPI C;  5AY8 A;  1M19 D;  1WWS A;  5CP6 D;  5AY8 C;  3B6G A;  3AZI B;  3NQJ A;  3W99 D;  4XUJ D;  5AVB B;  4Z2M H;  2NQB B;  2ZY5 A;  3REH D;  3B6G C;  5GT0 D;  1BH8 A;  3WAA D;  3AZJ D;  3R45 A;  3C1B A;  5CPI B;  1M1A A;  3AZL A;  4KGC C;  4ZUX A;  3MGS A;  1P34 D;  1S32 A;  3A1K A;  5BNV A;  3MGR A;  2CWE A;  1M1A C;  3AZL C;  1P3I D;  4ZUX C;  3MGS C;  4H9Q A;  1S32 C;  1BH9 B;  3VH6 A;  2CV5 D;  3MGR C;  3AZH A;  3REJ D;  3W98 A;  3B6G B;  3W96 D;  4JJN A;  5B2J D;  3W98 C;  4YM6 D;  3X1S D;  3REK B;  5CPK D;  5B31 D;  3WTP D;  4JJN C;  5BT1 D;  3KFU G;  1KU5 A;  3REL D;  4ZBJ C;  4H9O B;  5GXQ D;  3C1B B;  1AOI D;  3WTP E;  3X1V D;  2ARO D;  4QLC D;  5GT3 A;  5BNV B;  3MGR B;  2YFW A;  5AV8 D;  5B0Z D;  4J8V A;  5AV9 D;  5GT3 C;  4CAY A;  3MGP D;  3LZ1 A;  2Y2G A;  3X1U A;  3AZH B;  3AZG A;  4AWL B;  3W98 B;  5B2I D;  2JE5 A;  3O62 D;  3LZ1 C;  4JJN B;  3X1U C;  3AZG C;  5CHL B;  4ZBJ B;  2HIO D;  5CP6 A;  1B6W A;  5B1M D;  1TZY D;  3F6T A;  5JA4 A;  3TU4 B;  3X1T B;  5CP6 C;  1M19 C;  3B6F D;  3W99 A;  5GT3 B;  4KUD B;  3REH A;  2YFW B;  3W99 C;  4J8V B;  1TAF A;  3WAA A;  3AZJ A;  3B0C T;  1U35 D;  3REH C;  3AZG B;  5GT0 C;  3AV2 A;  3WAA C;  1P34 A;  3AZJ C;  1F1E A;  3AV2 C;  1P3I A;  1P34 C;  2PYO B;  1A7W A;  2CV5 A;  3AZI D;  1W2E A;  3REJ A;  4CSR A;  5AVB D;  3LJA B;  1P3I C;  1P3F D;  2NQB D;  3WA9 B;  4LD9 B;  2CV5 C;  4E45 A;  5B2J A;  3VH5 T;  3REJ C;  4J8U A;  4YM6 A;  5CPK A;  5B31 A;  4XZQ B;  5B2J C;  1TAF B;  3REL A;  4NFT A;  4J8U C;  4YM6 C;  2L5A A;  5GXQ A;  3AZJ B;  5B31 C;  5CPK C;  1AOI A;  5BT1 C;  4G92 B;  3AV2 B;  1P34 B;  3REL C;  5GXQ C;  2Y2K A;  1AOI C;  5AV8 A;  5B0Y D;  3X1V C;  5B0Z A;  2ARO C;  3MGP A;  5AV8 C;  5B32 G;  5B0Z C;  5B2I A;  3MGP C;  3REK D;  1P3K D;  3O62 A;  2RVQ D;  4J8U B;  5CPK B;  5B2I C;  2HIO A;  3O62 C;  3C1B D;  5B1M A;  3MNN B;  3AZK B;  1PZR A;  1TZY A;  2BYK A;  3REL B;  1HQ3 B;  2Y2O A;  5GXQ B;  2HIO C;  3B6F A;  1AOI B;  5B1M C;  3A1I A;  5B33 B;  1TZY C;  3AFA B;  3MVD D;  2F2A C;  3B6F C;  3AZH D;  5JRG B;  3MGP B;  1U35 A;  5BS7 A;  4Z2M G;  1U35 C;  2FFF B;  5BS7 C;  3AYW A;  5DNN B;  3UTB B;  2FJ7 B;  2HIO B;  3X1T D;  3TU4 D;  3REI D;  2BYK B;  1N1J B;  5AVB A;  1P3F A;  4KUD D;  2Y2I A;  3B0D B;  3C1C A;  5AVB C;  4J8V D;  1P3F C;  1Q9C A;  3AZG D;  3C1C C;  2UWX A;  3B0C W;  3H0L C;  5AV6 B;  2PYO D;  1BH9 A;  3EPH A;  3AYW B;  5B0Y A;  4EO5 B;  4LD9 D;  3LJA D;  3WA9 D;  5B31 G;  1JFI A;  5B0Y C;  1P3F B;  2Y2Q A;  3REK A;  1P3K A;  4XZQ D;  3C1C B;  4H9O A;  3VH5 W;  3REK C;  1P3K C;  2RVQ C;  3AV2 D;  3C1B C;  4X23 A;  4R8P B;  3MVD A;  2ZY4 A;  1KX3 B;  4X23 C;  2YFV B;  5B0Y B;  3AV1 B;  3AZE B;  3MVD C;  4YS3 B;  4G91 B;  3AZH C;  3AZM D;  1JFI B;  4AWL C;  4J8U D;  1P3K B;  4WV4 B;  5CPJ D;  5AVC B;  3AZK D;  3MNN D;  2F8N G;  1HQ3 D;  3X1T A;  3TU4 A;  1P3L D;  3EPJ A;  3REI A;  5B33 D;  3AFA D;  4KUD A;  3AL0 C;  3X1T C;  2Y2J A;  3TU4 C;  4X23 B;  3REI C;  5JRG D;  3MVD B;  4J8X B;  4Z5T A;  4KUD C;  4J8V C;  4Z5T C;  4H9S A;  5DNN D;  3UTB D;  2FJ7 D;  2PYO A;  4H9S C;  1ID3 A;  5E5A B;  4LD9 A;  3LJA A;  3WA9 A;  2PYO C;  1ID3 C;  3REI B;  4LD9 C;  3LJA C;  4WZS B;  3WKJ B;  3WA9 C;  4XZQ A;  1P3A D;  4Z5T B;  4XZQ C;  5AV6 D;  5AV5 D;  4G92 C;  3AYW D;  5B24 A;  3H0R C;  5GSU B;  1ID3 B;  4WU9 B;  1P3O B;  5B24 C;  5B32 B;  5DNM A;  3W97 D;  3AZM A;  3C1C D;  1EQZ B;  1WWI A;  5CPJ A;  3AZK A;  3MNN A;  3AZM C;  1HQ3 A;  5CPJ C;  1KX5 A;  1P3L A;  3AZK C;  4R8P D;  5F99 A;  3MNN C;  5KDM B;  5B33 A;  3AFA A;  1HQ3 C;  1KX3 D;  2W8S A;  3VH5 A;  1P3L C;  5B24 B;  5F99 C;  5JRG A;  5B33 C;  3AV1 D;  3AFA C;  3AZE D;  4YS3 D;  2ZY2 A;  5JRG C;  1P3B D;  5DNM B;  5BO0 B;  5AVC D;  3AZM B;  5G49 A;  2Y2N A;  5DNN A;  3UTB A;  2FJ7 A;  5CPJ B;  5DNN C;  1N1J A;  3EG5 B;  4J8W B;  3UTB C;  2FJ7 C;  1KX5 B;  1P3L B;  4X23 D;  4HGA B;  5F99 B;  5B40 D;  4J8X D;  1P3G B;  3KXB B;  3B0D C;  1P3A A;  3A6N B;  5AV6 A;  5AV5 A;  1P3A C;  5E5A D;  5G49 B;  5AV6 C;  5AV5 C;  1R4V A;  4H9P B;  3IP4 C;  3AYW C;  4EO5 C;  3WKJ D;  2NZD D;  4H9N B;  3W97 A;  3KWQ D;  3P5J B;  4Z5T D;  3MGQ A;  4WJ3 C;  4NE6 A;  3W97 C;  1P3A B;  1M18 A;  4WNN A;  4DRA A;  4R8P A;  5AV5 B;  5GSU D;  1M18 C;  1ID3 D;  1KX3 A;  3AZN D;  4WU9 D;  2YFV A;  3UT9 B;  4R8P C;  1P3O D;  3NQU B;  3AV1 A;  3AZE A;  1F66 A;  5B1L B;  5B32 D;  4YS3 A;  5BNX B;  1KX3 C;  3AV1 C;  1EQZ D;  1P3B A;  3AZE C;  1F66 C;  1P3M B;  4YS3 C;  5AVC A;  4G91 C;  3W97 B;  2Y2M A;  1P3B C;  3MGQ B;  2F8N B;  5AVC C;  3LZ0 A;  2Y2H A;  1M18 B;  1ULY A;  4WNN B;  4NE5 A;  5B24 D;  2BG1 A;  3LZ0 C;  5B40 A;  4J8X A;  4E44 A;  1HTA A;  2HUE B;  5B40 C;  1F66 B;  4J8X C;  5DNM D;  3AZF B;  4WU8 B;  2JSS A;  1P3B B;  3AN2 A;  4Z66 B;  2XD5 A;  3FDD A;  1ZLA D;  1P3P A;  5E5A A;  4J8W D;  3VH6 T;  3AN2 C;  4KGC A;  1KX5 D;  1P3P C;  5E5A C;  3LZ0 B;  5C3I C;  5F99 D;  5FUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...