3TU4C

Crystal structure of the sir3 bah domain in complex with a nucleosome core particle.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural basis of silencing: Sir3 BAH domain in complex with a nucleosome at 3.0 A resolution.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Signaling protein/structural protein/dna
total genus 32
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3tu4C00
4ZUXC 3W98A 1P3BB 3UT9B 4Z66C 5F99A 3MGQC 3AZJA 4H9NB 4KHAA 3LZ1C 3AFAD 1P3MC 5G49A 4R8PB 4ZBJB 1S32A 1F66C 3B6GC 3WKJB 2NZDC 3MGPA 3W96B 3REKB 3AV2D 1Q9CA 5CP6A 4QLCD 3VH5T 4XUJC 4J8VC 1HQ3D 1P3GC 1P3AC 4CSRB 5B24B 1N1JA 3AZHC 3AYWD 3C1BB 4WU9D 1AOIC 4WZSB 3AZGC 4WU8D 1P3KA 5BNVB 3AZKC 1KX3D 5AV8B 3LZ0D 3KXBC 3MNNC 1KX5B 3X1TA 1P3ID 3C1CA 4ZUXB 4J8XC 3R45A 5BS7C 3NQJB 4LD9D 4H9RB 1JFIB 4NFTA 5GT3D 3X1SB 1M18C 1P3BA 3A6ND 3UT9A 5B1MD 3W97D 2RVQC 2IO5C 4H9NA 5DNMB 4CAYB 5B2IB 5B32B 4H9SC 4R8PA 2CV5D 3C1BD 3RELD 3WKJA 5CPJD 1P3PC 3O62D 4J8VB 3W96A 3REKA 4KGCC 1KX5D 1HTAA 2F8ND 4CSRA 4XZQD 5JRGB 5GXQD 3AZGB 5B24A 5B2JC 3C1BA 1B67A 5CPID 3UTAC 2F8NK 1BH9B 5GSUC 3W98C 4J8UB 5F99C 3REHB 5BNVA 3AZJC 5AV8A 1TZYD 5BO0B 3AZFD 1KX5A 4ZUXA 1S32C 4NE6A 1M18B 5B0ZD 3MVDC 3NQJA 4H9RA 3REJD 4X23D 1TAFB 3X1SA 3MGPC 1M1AB 2IO5B 5CP6C 1EQZD 1P3MA 5DNMA 4CAYA 3VH6W 3WAAD 4YS3B 5B2IA 3KUYB 5B32A 1P3PB 3UTBB 3AZLD 1U35D 4J8VA 3TU4B 1P3KC 5GT0D 4J8WD 5AVBB 5B2JB 4AWLB 3W99B 3C1CC 5JRGA 2HIOB 5GSUB 3AZGA 5AV6D 3AZND 1M1AD 3AYWC 1BH9A 4J8UA 1P3BC 3UT9C 3X1UB 2NQBB 5DNNB 3REHA 2F8NG 1P34D 3LZ0C 5BS7A 5BO0A 3MVDB 3WA9B 5BNXB 4R8PC 4ZBJC 3WKJC 1M18A 4LD9C 1TAFA 3W96C 3REKC 5KDMB 3AFAB 3B0CW 3A6NC 4H9SA 3AN2D 3W99D 3W97C 2CWEA 3KUYA 4YS3A 4Z5TD 1P3PA 3UTBA 3REID 1BH8B 3MGRD 3C1BC 1ZLAD 3AV2B 5B1LD 4YM6D 4QLCB 3O62C 3B0DB 4H9QB 3TU4A 1HQ3B 4DRBA 4H9PB 4E44A 5AV8C 5AVBA 1KX5C 2AROD 5B2JA 5B0YD 2HIOA 3UTAA 3AYWB 4E45A 5GSUA 4WU9B 4WU8B 3X1SC 2PYOD 3LJAD 3X1UA 3LZ0B 1KX3B 2NQBA 5BT1C 5DNNA 1BFMA 3X1VD 4HGAB 5DNMC 1P3IB 5B2IC 1TZYC 5B32C 3MVDA 3KWQD 3AV1B 3WA9A 5BNXA 3AZFC 4LD9B 5GT3B 3A6NB 2JSSA 5KDMA 1P3OB 5B1MB 3W97B 3AFAA 2LY8A 3AZED 2CV5B 3RELB 5JRGC 3WTPD 5CPJB 4KUDD 2FJ7D 3O62B 1BH8A 4G92B 3AV2A 4QLCA 4J8UC 4H9QA 5FUGB 3REHC 1HQ3A 1P3FD 4H9PA 4J8WC 1M19D 2F8NB 3AV1D 4XZQB 2YFWB 5GXQB 3AYWA 4JJND 4WU9A 5CPIB 1B6WA 4WU8A 5E5AD 1P3OD 3AZID 1M1AC 1KX3A 3LZ0A 1TZYB 3AZFB 3MGSD 1P3IA 4YS3C 3KUYC 5AVCB 1KX4D 3UTBC 5B0ZB 4WNNB 4LD9A 3REJB 4X23B 5GT3A 3A6NA 3TU4C 1EQZB 3VH6A 5B1MA 3W97A 5B40D 3LELD 3WAAB 4NE5A 5AVBC 3AZLB 2CV5A 3W99C 4AWLC 3RELA 5CPJA 2HIOC 1U35B 3O62A 5JA4B 5B31D 5GT0B 1ZLAC 4J8WB 3X1UC 5B33D 5AV9B 5DNNC 5AY8D 5FUGA 5CPKD 2NQBC 1WWIA 2F8NA 5AVCD 4XZQA 2YFWA 5GXQA 1JFIA 5AV6B 3WA9C 3AZNB 2AROC 3B0BA 5CPIA 3VH6T 1AOID 2PYOC 1P34B 3AFAC 1TZYA 5CHLB 4Z66D 3LJAC 3MGQD 3AZFA 3LZ1D 5AVCA 5B0ZA 4WNNA 3REJA 4X23A 1F66D 3B6GD 5AV5B 3AV2C 4QLCC 2NZDD 3B0DC 5AV9D 1EQZA 3AN2B 2BYMB 1HQ3C 4XUJD 3WAAA 3V9RB 1KU5A 3NQUB 4Z5TB 3REIB 1P3GD 3AZLA 1P3AD 3MGRB 1U35A 4WU9C 1ZLAB 5B1LB 4YM6B 2YFVB 5JA4A 3AZHD 4WU8C 2FJ7C 5GT0A 4J8WA 1KX3C 5AV9A 3AZKD 4HGAC 2AROB 5B0YB 1P3IC 3KXBD 4WV4B 3AV1C 3MNND 5B31G 5AV6A 3B0CT 4G91B 3AZNA 3B6FD 5GT3C 1M1AA 5AV5D 4J8XD 4JJNC 2PYOB 2BYKB 3LJAB 1P3OC 5B1MC 3X1VB 1P34A 3KWQB 2CV5C 4Z2MG 3RELC 5CPJC 1ID3D 4G92C 5C3IB 1F1EA 3AN2A 2BYMA 3LELC 3AZEB 3W99A 4KGCD 3V9RA 4XZQC 3WTPB 3NQUA 4Z5TA 3REIA 5GXQC 4KUDB 2FJ7B 2HUEB 3MGRA 1ZLAA 5CPIC 1R4VA 5B1LA 4YM6A 2YFVA 5B31C 3W98D 3KSYA 1P3FB 1M19B 5F99D 1ULYA 3AZJD 2AROA 5B0YA 4DRAA 5AVCC 4JJNB 3AZMB 5B0ZC 3REJC 4X23C 5E5AB 1S32D 3AZIB 2PYOA 2BYKA 3LJAA 1EQZC 3MGPD 5CP6D 3X1VA 3MGSB 3WAAC 1KX4B 3KWQA 3AZLC 1U35C 4H9OB 5B40B 5GT0C 3LELB 1P3KD 5AV9C 3AZEA 3AZMD 3WTPA 4KUDA 2FJ7A 4M6BA 5AV6C 3X1TD 3AZNC 3VH5W 5B31B 3C1CD 5B33B 5CPKB 5AY8B 1P3BD 3UT9D 1P34C 1P3FA 1M19A 3AV1A 4JJNA 3AZMA 4R8PD 3B6FC 5E5AA 1P3OA 3AZIA 1P3LB 1AOIB 3WKJD 5AV5C 3W96D 4Z66B 3REKD 3AN2C 3MGQB 3MGSA 3LZ1B 1KX4A 1P3MB 4Z5TC 3REIC 2L5AA 3MGRC 1F66B 3B6GB 1ID3C 5B24D 5B1LC 4YM6C 2NZDB 4H9OA 5B40A 3LELA 4XUJB 1P3GB 1P3AB 5AV8D 5B0YC 4G91C 4UUZB 5B31A 3AZHB 1P3LD 4ZUXD 1H3OB 1A7WA 5B33A 3X1SD 5CPKA 5AY8A 3X1VC 3AZKB 3KXBB 5BT1D 1P3MD 3KWQC 3MNNB 5DNMD 3B6FB 4NE3A 4EO5C 5B2ID 5B32D 4J8XB 1P3LA 1AOIA 5C3IC 4J8VD 4Z66A 3MGQA 1WWSA 3LZ1A 3AZEC 3WTPC 1ID3B 3WTPE 4KUDC 2HUEC 5JRGD 1F66A 3B6GA 3AZGD 2NZDA 4XUJA 4J8UD 1P3FC 4KGCB 1M19C 3REHD 1P3GA 1P3AA 3AZMC 4UUZA 3AZHA 3X1TC 2F8NH 1H3OA 5E5AC 3AZIC 1M18D 3UTAB 3W98B 2RVQD 5F99B 3AZJB 3AZKA 3MGSC 4KHAB 4EO5B 3KXBA 1KX4C 3MNNA 5G49B 3B6FA 4YS3D 3KUYD 5AV5A 1S32B 4J8XA 3UTBD 1P3PD 3MGPB 5B40C 5CP6B 3TU4D 4Z2MH 5B32G 5AVBD 1ID3A 5B2JD 1N1JB 2HIOD 3UTAD 5GSUD 5B24C 1P3KB 5B33C 5CPKC 5AY8C 4KGCA 3X1UD 2NQBD 5DNND 3VH5A 3X1TB 3C1CB 3MVDD 3R45B 3WA9D 1P3LC
chains in the Genus database with same CATH superfamily
4ZUXC 3W98A 1P3BB 3UT9B 4Z66C 5F99A 3MGQC 3AZJA 4H9NB 4KHAA 3LZ1C 3AFAD 1P3MC 5G49A 4R8PB 4ZBJB 1S32A 1F66C 3B6GC 3WKJB 2NZDC 3MGPA 3W96B 3REKB 3AV2D 1Q9CA 5CP6A 4QLCD 3VH5T 4XUJC 2G5IC 4J8VC 1HQ3D 1P3GC 1P3AC 4CSRB 5B24B 1N1JA 3AZHC 3AYWD 3C1BB 4WU9D 1AOIC 4WZSB 3AZGC 4WU8D 1P3KA 5BNVB 3AZKC 1KX3D 5AV8B 3LZ0D 3KXBC 3MNNC 1KX5B 3X1TA 1P3ID 3C1CA 4ZUXB 4J8XC 3R45A 5BS7C 3NQJB 4LD9D 4H9RB 1JFIB 4NFTA 5GT3D 3X1SB 1M18C 1P3BA 3A6ND 3UT9A 2Y2QA 5B1MD 3W97D 2RVQC 2IO5C 4H9NA 5DNMB 4CAYB 3F6TA 5B2IB 5B32B 4H9SC 4R8PA 2CV5D 3C1BD 3RELD 3WKJA 5CPJD 1P3PC 3O62D 4J8VB 3W96A 3REKA 4KGCC 1KX5D 3IP4C 1HTAA 2F8ND 4CSRA 4XZQD 5JRGB 2ZY3A 5GXQD 3AZGB 5B24A 5B2JC 3C1BA 1B67A 5CPID 3UTAC 2F8NK 1BH9B 5GSUC 3W98C 4J8UB 5F99C 3REHB 5BNVA 3AZJC 5AV8A 1TZYD 5BO0B 3AZFD 1KX5A 1W2EA 4ZUXA 1S32C 4NE6A 1M18B 5B0ZD 3MVDC 3NQJA 4H9RA 3REJD 4X23D 1TAFB 3X1SA 3MGPC 1M1AB 2IO5B 5CP6C 2J8PA 1EQZD 1P3MA 5DNMA 4CAYA 3VH6W 3WAAD 4YS3B 5B2IA 3KUYB 5B32A 1P3PB 3UTBB 3AZLD 2FFFB 1U35D 4J8VA 3TU4B 1P3KC 5GT0D 4J8WD 5AVBB 3KFUG 5B2JB 4AWLB 3W99B 3C1CC 5JRGA 2HIOB 5GSUB 3AZGA 5AV6D 3AZND 1M1AD 3AYWC 1BH9A 2Y2NA 2RIQA 3EPJA 4J8UA 3UT9C 1P3BC 3X1UB 2NQBB 5DNNB 3REHA 2F8NG 1P34D 3LZ0C 5BS7A 5BO0A 3MVDB 3WA9B 5BNXB 4R8PC 4ZBJC 2JE5A 3WKJC 1M18A 4LD9C 1TAFA 3W96C 3REKC 5KDMB 3AFAB 3B0CW 3A6NC 4H9SA 3AN2D 2Y2GA 3W99D 3W97C 2CWEA 3KUYA 4YS3A 4Z5TD 1P3PA 3UTBA 3REID 1BH8B 3MGRD 3C1BC 1ZLAD 3AV2B 2F2AC 5B1LD 4YM6D 4QLCB 3O62C 3B0DB 4H9QB 3TU4A 1HQ3B 4DRBA 4H9PB 4E44A 5AV8C 5AVBA 1KX5C 2AROD 5B2JA 5B0YD 2HIOA 3UTAA 3AYWB 4E45A 5GSUA 4WU9B 4WU8B 3X1SC 2PYOD 4UPKA 3LJAD 3X1UA 3LZ0B 1KX3B 2NQBA 5BT1C 5DNNA 1BFMA 3X1VD 4HGAB 5DNMC 1P3IB 5B2IC 1TZYC 5B32C 3MVDA 3KWQD 3AV1B 3WA9A 5BNXA 3AZFC 4LD9B 4WJ3C 5GT3B 3A6NB 2JSSA 5KDMA 1P3OB 3AL0C 5B1MB 3W97B 3AFAA 2LY8A 2G5HC 3AZED 2CV5B 3RELB 5JRGC 3WTPD 5CPJB 4KUDD 2FJ7D 3O62B 1BH8A 4G92B 3AV2A 3A1IA 4QLCA 2Y2MA 4J8UC 4H9QA 5FUGB 3REHC 1HQ3A 1P3FD 4H9PA 4J8WC 1M19D 2F8NB 3AV1D 4XZQB 2YFWB 5GXQB 3EPLA 3AYWA 4JJND 4WU9A 5CPIB 1B6WA 4WU8A 5E5AD 1P3OD 3AZID 1M1AC 2XD5A 1KX3A 3LZ0A 1TZYB 2BG1A 3AZFB 3MGSD 1P3IA 4YS3C 3KUYC 5AVCB 1KX4D 3UTBC 5B0ZB 4WNNB 4LD9A 3REJB 4X23B 5GT3A 3A6NA 3TU4C 1EQZB 3VH6A 5B1MA 2Y2IA 3W97A 5B40D 3LELD 3WAAB 4NE5A 5AVBC 3AZLB 2CV5A 3W99C 4AWLC 3RELA 5CPJA 2HIOC 1U35B 3O62A 5JA4B 5B31D 5GT0B 1ZLAC 2XD1A 4J8WB 3X1UC 5B33D 5AV9B 5DNNC 5AY8D 5FUGA 5CPKD 2NQBC 1WWIA 2F8NA 5AVCD 4XZQA 2YFWA 5GXQA 1JFIA 5AV6B 3WA9C 3AZNB 2AROC 3B0BA 5CPIA 3VH6T 2ZY5A 1AOID 2PYOC 1P34B 3AFAC 1TZYA 5CHLB 4Z66D 3LJAC 3P5JB 3MGQD 3AZFA 3LZ1D 5AVCA 5B0ZA 4WNNA 2ZY4A 3REJA 4X23A 1F66D 3B6GD 5AV5B 3AV2C 4QLCC 2NZDD 3FDDA 3B0DC 5AV9D 1EQZA 3AN2B 2BYMB 1HQ3C 4XUJD 2Y2KA 3WAAA 3V9RB 1KU5A 3NQUB 4Z5TB 1T3UA 3REIB 1P3GD 3AZLA 1P3AD 3MGRB 1U35A 3EPKA 4WU9C 1ZLAB 5B1LB 4YM6B 2YFVB 5JA4A 3AZHD 4WU8C 2FJ7C 5GT0A 4J8WA 2JCHA 1KX3C 5AV9A 2Y2JA 2ZY2A 3AZKD 4HGAC 2AROB 5B0YB 1P3IC 3KXBD 4WV4B 3AV1C 3MNND 5B31G 5AV6A 3B0CT 4G91B 3AZNA 3B6FD 5GT3C 1M1AA 5AV5D 4J8XD 4JJNC 2PYOB 2BYKB 3LJAB 1P3OC 5B1MC 3X1VB 1P34A 3KWQB 2CV5C 4Z2MG 3RELC 5CPJC 1ID3D 2Y2LA 4G92C 5C3IB 1F1EA 3AN2A 2BYMA 3LELC 3AZEB 3W99A 4KGCD 3V9RA 4XZQC 3WTPB 3NQUA 4Z5TA 3REIA 5GXQC 4KUDB 2FJ7B 2HUEB 3MGRA 1ZLAA 5CPIC 1R4VA 5B1LA 4YM6A 2YFVA 2ZM5A 5B31C 3W98D 3KSYA 1P3FB 1M19B 5F99D 1ULYA 3AZJD 2AROA 5B0YA 4DRAA 5AVCC 4JJNB 3AZMB 5B0ZC 3REJC 4X23C 5E5AB 1S32D 3AZIB 2PYOA 2BYKA 2Y2PA 3LJAA 1EQZC 3MGPD 5CP6D 3X1VA 3MGSB 3WAAC 1KX4B 3KWQA 3AZLC 1U35C 2DQNC 4H9OB 5B40B 5GT0C 3LELB 1P3KD 5AV9C 3AZEA 3AZMD 3WTPA 4KUDA 2FJ7A 4M6BA 5AV6C 3X1TD 3AZNC 3VH5W 5B31B 3C1CD 2Y2HA 5B33B 5CPKB 5AY8B 1P3BD 3UT9D 1P34C 1P3FA 1M19A 3AV1A 2W8SA 4JJNA 3AZMA 4R8PD 3B6FC 5E5AA 1P3OA 3AZIA 1P3LB 1AOIB 3WKJD 5AV5C 3W96D 4Z66B 3REKD 3AN2C 3MGQB 3MGSA 3LZ1B 1KX4A 4DQYB 1P3MB 4Z5TC 3REIC 2L5AA 3MGRC 1F66B 3B6GB 1ID3C 3H0RC 5B24D 5B1LC 4YM6C 2NZDB 4H9OA 5B40A 3LELA 4XUJB 1P3GB 1P3AB 5AV8D 5B0YC 4G91C 4UUZB 5B31A 3AZHB 1P3LD 4ZUXD 1H3OB 1A7WA 5B33A 3X1SD 5CPKA 5AY8A 3X1VC 3AZKB 3EPHA 3KXBB 5BT1D 1P3MD 3KWQC 3MNNB 5DNMD 3B6FB 4NE3A 1PZRA 4EO5C 5B2ID 5B32D 4J8XB 1P3LA 1AOIA 5C3IC 4J8VD 4Z66A 3MGQA 1WWSA 3LZ1A 3AZEC 3EG5B 3WTPC 1ID3B 3WTPE 4KUDC 2HUEC 5JRGD 1F66A 3B6GA 3AZGD 2NZDA 4XUJA 4J8UD 1P3FC 4KGCB 1M19C 3REHD 1P3GA 1P3AA 3AZMC 4UUZA 3AZHA 3X1TC 2F8NH 1H3OA 5E5AC 3AZIC 1M18D 3UTAB 3W98B 2RVQD 5F99B 2Y2OA 3AZJB 3H0MC 3MGSC 3AZKA 4KHAB 4EO5B 3KXBA 3A1KA 1Z2CB 1KX4C 3MNNA 5G49B 3B6FA 4YS3D 3KUYD 5AV5A 1S32B 4J8XA 3UTBD 1P3PD 3MGPB 5B40C 5CP6B 3TU4D 4Z2MH 5B32G 5AVBD 1ID3A 5B2JD 1N1JB 2HIOD 3UTAD 5GSUD 2UWXA 5B24C 2DF4C 1P3KB 5B33C 5CPKC 5AY8C 4KGCA 3X1UD 2NQBD 5DNND 3H0LC 3VH5A 3X1TB 3C1CB 3MVDD 3R45B 3WA9D 2VQRA 1P3LC
chains in the Genus database with same CATH topology
4ZUXC 3W98A 1P3BB 3UT9B 4Z66C 5F99A 3MGQC 3AZJA 4H9NB 4KHAA 3LZ1C 3AFAD 1P3MC 5G49A 4R8PB 4ZBJB 1S32A 1F66C 3B6GC 3WKJB 2NZDC 3MGPA 3W96B 3REKB 3AV2D 1Q9CA 5CP6A 4QLCD 3VH5T 4XUJC 2G5IC 4J8VC 1HQ3D 1P3GC 1P3AC 4CSRB 5B24B 1N1JA 3AZHC 3AYWD 3C1BB 4WU9D 1AOIC 4WZSB 3AZGC 4WU8D 1P3KA 5BNVB 3AZKC 1KX3D 5AV8B 3LZ0D 3KXBC 3MNNC 1KX5B 3X1TA 1P3ID 3C1CA 4ZUXB 4J8XC 3R45A 5BS7C 3NQJB 4LD9D 4H9RB 1JFIB 4NFTA 5GT3D 3X1SB 1M18C 1P3BA 3A6ND 3UT9A 2Y2QA 5B1MD 3W97D 2RVQC 2IO5C 4H9NA 5DNMB 4CAYB 3F6TA 5B2IB 5B32B 4H9SC 4R8PA 2CV5D 3C1BD 3RELD 3WKJA 5CPJD 1P3PC 3O62D 4J8VB 3W96A 3REKA 4KGCC 1KX5D 3IP4C 1HTAA 2F8ND 4CSRA 4XZQD 5JRGB 2ZY3A 5GXQD 3AZGB 5B24A 5B2JC 3C1BA 1B67A 5CPID 3UTAC 2F8NK 1BH9B 5GSUC 3W98C 4J8UB 5F99C 3REHB 5BNVA 3AZJC 5AV8A 1TZYD 5BO0B 3AZFD 1KX5A 1W2EA 4ZUXA 1S32C 4NE6A 1M18B 5B0ZD 3MVDC 3NQJA 4H9RA 3REJD 4X23D 1TAFB 3X1SA 3MGPC 1M1AB 2IO5B 5CP6C 2J8PA 1EQZD 1P3MA 5DNMA 4CAYA 3VH6W 3WAAD 4YS3B 5B2IA 3KUYB 5B32A 1P3PB 3UTBB 3AZLD 2FFFB 1U35D 4J8VA 3TU4B 1P3KC 5GT0D 4J8WD 5AVBB 3KFUG 5B2JB 4AWLB 3W99B 3C1CC 5JRGA 2HIOB 5GSUB 3AZGA 5AV6D 3AZND 1M1AD 3AYWC 1BH9A 2Y2NA 2RIQA 3EPJA 4J8UA 3UT9C 1P3BC 3X1UB 2NQBB 5DNNB 3REHA 2F8NG 1P34D 3LZ0C 5BS7A 5BO0A 3MVDB 3WA9B 5BNXB 4R8PC 4ZBJC 2JE5A 3WKJC 1M18A 4LD9C 1TAFA 3W96C 3REKC 5KDMB 3AFAB 3B0CW 3A6NC 4H9SA 3AN2D 2Y2GA 3W99D 3W97C 2CWEA 3KUYA 4YS3A 4Z5TD 1P3PA 3UTBA 3REID 1BH8B 3MGRD 3C1BC 1ZLAD 3AV2B 2F2AC 5B1LD 4YM6D 4QLCB 3O62C 3B0DB 4H9QB 3TU4A 1HQ3B 4DRBA 4H9PB 4E44A 5AV8C 5AVBA 1KX5C 2AROD 5B2JA 5B0YD 2HIOA 3UTAA 3AYWB 4E45A 5GSUA 4WU9B 4WU8B 3X1SC 2PYOD 4UPKA 3LJAD 3X1UA 3LZ0B 1KX3B 2NQBA 5BT1C 5DNNA 1BFMA 3X1VD 4HGAB 5DNMC 1P3IB 5B2IC 1TZYC 5B32C 3MVDA 3KWQD 3AV1B 3WA9A 5BNXA 3AZFC 4LD9B 4WJ3C 5GT3B 3A6NB 2JSSA 5KDMA 1P3OB 3AL0C 5B1MB 3W97B 3AFAA 2LY8A 2G5HC 3AZED 2CV5B 3RELB 5JRGC 3WTPD 5CPJB 4KUDD 2FJ7D 3O62B 1BH8A 4G92B 3AV2A 3A1IA 4QLCA 2Y2MA 4J8UC 4H9QA 5FUGB 3REHC 1HQ3A 1P3FD 4H9PA 4J8WC 1M19D 2F8NB 3AV1D 4XZQB 2YFWB 5GXQB 3EPLA 3AYWA 4JJND 4WU9A 5CPIB 1B6WA 4WU8A 5E5AD 1P3OD 3AZID 1M1AC 2XD5A 1KX3A 3LZ0A 1TZYB 2BG1A 3AZFB 3MGSD 1P3IA 4YS3C 3KUYC 5AVCB 1KX4D 3UTBC 5B0ZB 4WNNB 4LD9A 3REJB 4X23B 5GT3A 3A6NA 3TU4C 1EQZB 3VH6A 5B1MA 2Y2IA 3W97A 5B40D 3LELD 3WAAB 4NE5A 5AVBC 3AZLB 2CV5A 3W99C 4AWLC 3RELA 5CPJA 2HIOC 1U35B 3O62A 5JA4B 5B31D 5GT0B 1ZLAC 2XD1A 4J8WB 3X1UC 5B33D 5AV9B 5DNNC 5AY8D 5FUGA 5CPKD 2NQBC 1WWIA 2F8NA 5AVCD 4XZQA 2YFWA 5GXQA 1JFIA 5AV6B 3WA9C 3AZNB 2AROC 3B0BA 5CPIA 3VH6T 2ZY5A 1AOID 2PYOC 1P34B 3AFAC 1TZYA 5CHLB 4Z66D 3LJAC 3P5JB 3MGQD 3AZFA 3LZ1D 5AVCA 5B0ZA 4WNNA 2ZY4A 3REJA 4X23A 1F66D 3B6GD 5AV5B 3AV2C 4QLCC 2NZDD 3FDDA 3B0DC 5AV9D 1EQZA 3AN2B 2BYMB 1HQ3C 4XUJD 2Y2KA 3WAAA 3V9RB 1KU5A 3NQUB 4Z5TB 1T3UA 3REIB 1P3GD 3AZLA 1P3AD 3MGRB 1U35A 3EPKA 4WU9C 1ZLAB 5B1LB 4YM6B 2YFVB 5JA4A 3AZHD 4WU8C 2FJ7C 5GT0A 4J8WA 2JCHA 1KX3C 5AV9A 2Y2JA 2ZY2A 3AZKD 4HGAC 2AROB 5B0YB 1P3IC 3KXBD 4WV4B 3AV1C 3MNND 5B31G 5AV6A 3B0CT 4G91B 3AZNA 3B6FD 5GT3C 1M1AA 5AV5D 4J8XD 4JJNC 2PYOB 2BYKB 3LJAB 1P3OC 5B1MC 3X1VB 1P34A 3KWQB 2CV5C 4Z2MG 3RELC 5CPJC 1ID3D 2Y2LA 4G92C 5C3IB 1F1EA 3AN2A 2BYMA 3LELC 3AZEB 3W99A 4KGCD 3V9RA 4XZQC 3WTPB 3NQUA 4Z5TA 3REIA 5GXQC 4KUDB 2FJ7B 2HUEB 3MGRA 1ZLAA 5CPIC 1R4VA 5B1LA 4YM6A 2YFVA 2ZM5A 5B31C 3W98D 3KSYA 1P3FB 1M19B 5F99D 1ULYA 3AZJD 2AROA 5B0YA 4DRAA 5AVCC 4JJNB 3AZMB 5B0ZC 3REJC 4X23C 5E5AB 1S32D 3AZIB 2PYOA 2BYKA 2Y2PA 3LJAA 1EQZC 3MGPD 5CP6D 3X1VA 3MGSB 3WAAC 1KX4B 3KWQA 3AZLC 1U35C 2DQNC 4H9OB 5B40B 5GT0C 3LELB 1P3KD 5AV9C 3AZEA 3AZMD 3WTPA 4KUDA 2FJ7A 4M6BA 5AV6C 3X1TD 3AZNC 3VH5W 5B31B 3C1CD 2Y2HA 5B33B 5CPKB 5AY8B 1P3BD 3UT9D 1P34C 1P3FA 1M19A 3AV1A 2W8SA 4JJNA 3AZMA 4R8PD 3B6FC 5E5AA 1P3OA 3AZIA 1P3LB 1AOIB 3WKJD 5AV5C 3W96D 4Z66B 3REKD 3AN2C 3MGQB 3MGSA 3LZ1B 1KX4A 4DQYB 1P3MB 4Z5TC 3REIC 2L5AA 3MGRC 1F66B 3B6GB 1ID3C 3H0RC 5B24D 5B1LC 4YM6C 2NZDB 4H9OA 5B40A 3LELA 4XUJB 1P3GB 1P3AB 5AV8D 5B0YC 4G91C 4UUZB 5B31A 3AZHB 1P3LD 4ZUXD 1H3OB 1A7WA 5B33A 3X1SD 5CPKA 5AY8A 3X1VC 3AZKB 3EPHA 3KXBB 5BT1D 1P3MD 3KWQC 3MNNB 5DNMD 3B6FB 4NE3A 1PZRA 4EO5C 5B2ID 5B32D 4J8XB 1P3LA 1AOIA 5C3IC 4J8VD 4Z66A 3MGQA 1WWSA 3LZ1A 3AZEC 3EG5B 3WTPC 1ID3B 3WTPE 4KUDC 2HUEC 5JRGD 1F66A 3B6GA 3AZGD 2NZDA 4XUJA 4J8UD 1P3FC 4KGCB 1M19C 3REHD 1P3GA 1P3AA 3AZMC 4UUZA 3AZHA 3X1TC 2F8NH 1H3OA 5E5AC 3AZIC 1M18D 3UTAB 3W98B 2RVQD 5F99B 2Y2OA 3AZJB 3H0MC 3MGSC 3AZKA 4KHAB 4EO5B 3KXBA 3A1KA 1Z2CB 1KX4C 3MNNA 5G49B 3B6FA 4YS3D 3KUYD 5AV5A 1S32B 4J8XA 3UTBD 1P3PD 3MGPB 5B40C 5CP6B 3TU4D 4Z2MH 5B32G 5AVBD 1ID3A 5B2JD 1N1JB 2HIOD 3UTAD 5GSUD 2UWXA 5B24C 2DF4C 1P3KB 5B33C 5CPKC 5AY8C 4KGCA 3X1UD 2NQBD 5DNND 3H0LC 3VH5A 3X1TB 3C1CB 3MVDD 3R45B 3WA9D 2VQRA 1P3LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZUX C;  3W98 A;  1P3B B;  3UT9 B;  4Z66 C;  5F99 A;  3MGQ C;  3AZJ A;  4H9N B;  4KHA A;  3LZ1 C;  3AFA D;  1P3M C;  5G49 A;  4R8P B;  4ZBJ B;  1S32 A;  1F66 C;  3B6G C;  3WKJ B;  2NZD C;  3MGP A;  3W96 B;  3REK B;  3AV2 D;  1Q9C A;  5CP6 A;  4QLC D;  3VH5 T;  4XUJ C;  4J8V C;  1HQ3 D;  1P3G C;  1P3A C;  4CSR B;  5B24 B;  1N1J A;  3AZH C;  3AYW D;  3C1B B;  4WU9 D;  1AOI C;  4WZS B;  3AZG C;  4WU8 D;  1P3K A;  5BNV B;  3AZK C;  1KX3 D;  5AV8 B;  3LZ0 D;  3KXB C;  3MNN C;  1KX5 B;  3X1T A;  1P3I D;  3C1C A;  4ZUX B;  4J8X C;  3R45 A;  5BS7 C;  3NQJ B;  4LD9 D;  4H9R B;  1JFI B;  4NFT A;  5GT3 D;  3X1S B;  1M18 C;  1P3B A;  3A6N D;  3UT9 A;  5B1M D;  3W97 D;  2RVQ C;  2IO5 C;  4H9N A;  5DNM B;  4CAY B;  5B2I B;  5B32 B;  4H9S C;  4R8P A;  2CV5 D;  3C1B D;  3REL D;  3WKJ A;  5CPJ D;  1P3P C;  3O62 D;  4J8V B;  3W96 A;  3REK A;  4KGC C;  1KX5 D;  1HTA A;  2F8N D;  4CSR A;  4XZQ D;  5JRG B;  5GXQ D;  3AZG B;  5B24 A;  5B2J C;  3C1B A;  1B67 A;  5CPI D;  3UTA C;  2F8N K;  1BH9 B;  5GSU C;  3W98 C;  4J8U B;  5F99 C;  3REH B;  5BNV A;  3AZJ C;  5AV8 A;  1TZY D;  5BO0 B;  3AZF D;  1KX5 A;  4ZUX A;  1S32 C;  4NE6 A;  1M18 B;  5B0Z D;  3MVD C;  3NQJ A;  4H9R A;  3REJ D;  4X23 D;  1TAF B;  3X1S A;  3MGP C;  1M1A B;  2IO5 B;  5CP6 C;  1EQZ D;  1P3M A;  5DNM A;  4CAY A;  3VH6 W;  3WAA D;  4YS3 B;  5B2I A;  3KUY B;  5B32 A;  1P3P B;  3UTB B;  3AZL D;  1U35 D;  4J8V A;  3TU4 B;  1P3K C;  5GT0 D;  4J8W D;  5AVB B;  5B2J B;  4AWL B;  3W99 B;  3C1C C;  5JRG A;  2HIO B;  5GSU B;  3AZG A;  5AV6 D;  3AZN D;  1M1A D;  3AYW C;  1BH9 A;  4J8U A;  1P3B C;  3UT9 C;  3X1U B;  2NQB B;  5DNN B;  3REH A;  2F8N G;  1P34 D;  3LZ0 C;  5BS7 A;  5BO0 A;  3MVD B;  3WA9 B;  5BNX B;  4R8P C;  4ZBJ C;  3WKJ C;  1M18 A;  4LD9 C;  1TAF A;  3W96 C;  3REK C;  5KDM B;  3AFA B;  3B0C W;  3A6N C;  4H9S A;  3AN2 D;  3W99 D;  3W97 C;  2CWE A;  3KUY A;  4YS3 A;  4Z5T D;  1P3P A;  3UTB A;  3REI D;  1BH8 B;  3MGR D;  3C1B C;  1ZLA D;  3AV2 B;  5B1L D;  4YM6 D;  4QLC B;  3O62 C;  3B0D B;  4H9Q B;  3TU4 A;  1HQ3 B;  4DRB A;  4H9P B;  4E44 A;  5AV8 C;  5AVB A;  1KX5 C;  2ARO D;  5B2J A;  5B0Y D;  2HIO A;  3UTA A;  3AYW B;  4E45 A;  5GSU A;  4WU9 B;  4WU8 B;  3X1S C;  2PYO D;  3LJA D;  3X1U A;  3LZ0 B;  1KX3 B;  2NQB A;  5BT1 C;  5DNN A;  1BFM A;  3X1V D;  4HGA B;  5DNM C;  1P3I B;  5B2I C;  1TZY C;  5B32 C;  3MVD A;  3KWQ D;  3AV1 B;  3WA9 A;  5BNX A;  3AZF C;  4LD9 B;  5GT3 B;  3A6N B;  2JSS A;  5KDM A;  1P3O B;  5B1M B;  3W97 B;  3AFA A;  2LY8 A;  3AZE D;  2CV5 B;  3REL B;  5JRG C;  3WTP D;  5CPJ B;  4KUD D;  2FJ7 D;  3O62 B;  1BH8 A;  4G92 B;  3AV2 A;  4QLC A;  4J8U C;  4H9Q A;  5FUG B;  3REH C;  1HQ3 A;  1P3F D;  4H9P A;  4J8W C;  1M19 D;  2F8N B;  3AV1 D;  4XZQ B;  2YFW B;  5GXQ B;  3AYW A;  4JJN D;  4WU9 A;  5CPI B;  1B6W A;  4WU8 A;  5E5A D;  1P3O D;  3AZI D;  1M1A C;  1KX3 A;  3LZ0 A;  1TZY B;  3AZF B;  3MGS D;  1P3I A;  4YS3 C;  3KUY C;  5AVC B;  1KX4 D;  3UTB C;  5B0Z B;  4WNN B;  4LD9 A;  3REJ B;  4X23 B;  5GT3 A;  3A6N A;  3TU4 C;  1EQZ B;  3VH6 A;  5B1M A;  3W97 A;  5B40 D;  3LEL D;  3WAA B;  4NE5 A;  5AVB C;  3AZL B;  2CV5 A;  3W99 C;  4AWL C;  3REL A;  5CPJ A;  2HIO C;  1U35 B;  3O62 A;  5JA4 B;  5B31 D;  5GT0 B;  1ZLA C;  4J8W B;  3X1U C;  5B33 D;  5AV9 B;  5DNN C;  5AY8 D;  5FUG A;  5CPK D;  2NQB C;  1WWI A;  2F8N A;  5AVC D;  4XZQ A;  2YFW A;  5GXQ A;  1JFI A;  5AV6 B;  3WA9 C;  3AZN B;  2ARO C;  3B0B A;  5CPI A;  3VH6 T;  1AOI D;  2PYO C;  1P34 B;  3AFA C;  1TZY A;  5CHL B;  4Z66 D;  3LJA C;  3MGQ D;  3AZF A;  3LZ1 D;  5AVC A;  5B0Z A;  4WNN A;  3REJ A;  4X23 A;  1F66 D;  3B6G D;  5AV5 B;  3AV2 C;  4QLC C;  2NZD D;  3B0D C;  5AV9 D;  1EQZ A;  3AN2 B;  2BYM B;  1HQ3 C;  4XUJ D;  3WAA A;  3V9R B;  1KU5 A;  3NQU B;  4Z5T B;  3REI B;  1P3G D;  3AZL A;  1P3A D;  3MGR B;  1U35 A;  4WU9 C;  1ZLA B;  5B1L B;  4YM6 B;  2YFV B;  5JA4 A;  3AZH D;  4WU8 C;  2FJ7 C;  5GT0 A;  4J8W A;  1KX3 C;  5AV9 A;  3AZK D;  4HGA C;  2ARO B;  5B0Y B;  1P3I C;  3KXB D;  4WV4 B;  3AV1 C;  3MNN D;  5B31 G;  5AV6 A;  3B0C T;  4G91 B;  3AZN A;  3B6F D;  5GT3 C;  1M1A A;  5AV5 D;  4J8X D;  4JJN C;  2PYO B;  2BYK B;  3LJA B;  1P3O C;  5B1M C;  3X1V B;  1P34 A;  3KWQ B;  2CV5 C;  4Z2M G;  3REL C;  5CPJ C;  1ID3 D;  4G92 C;  5C3I B;  1F1E A;  3AN2 A;  2BYM A;  3LEL C;  3AZE B;  3W99 A;  4KGC D;  3V9R A;  4XZQ C;  3WTP B;  3NQU A;  4Z5T A;  3REI A;  5GXQ C;  4KUD B;  2FJ7 B;  2HUE B;  3MGR A;  1ZLA A;  5CPI C;  1R4V A;  5B1L A;  4YM6 A;  2YFV A;  5B31 C;  3W98 D;  3KSY A;  1P3F B;  1M19 B;  5F99 D;  1ULY A;  3AZJ D;  2ARO A;  5B0Y A;  4DRA A;  5AVC C;  4JJN B;  3AZM B;  5B0Z C;  3REJ C;  4X23 C;  5E5A B;  1S32 D;  3AZI B;  2PYO A;  2BYK A;  3LJA A;  1EQZ C;  3MGP D;  5CP6 D;  3X1V A;  3MGS B;  3WAA C;  1KX4 B;  3KWQ A;  3AZL C;  1U35 C;  4H9O B;  5B40 B;  5GT0 C;  3LEL B;  1P3K D;  5AV9 C;  3AZE A;  3AZM D;  3WTP A;  4KUD A;  2FJ7 A;  4M6B A;  5AV6 C;  3X1T D;  3AZN C;  3VH5 W;  5B31 B;  3C1C D;  5B33 B;  5CPK B;  5AY8 B;  1P3B D;  3UT9 D;  1P34 C;  1P3F A;  1M19 A;  3AV1 A;  4JJN A;  3AZM A;  4R8P D;  3B6F C;  5E5A A;  1P3O A;  3AZI A;  1P3L B;  1AOI B;  3WKJ D;  5AV5 C;  3W96 D;  4Z66 B;  3REK D;  3AN2 C;  3MGQ B;  3MGS A;  3LZ1 B;  1KX4 A;  1P3M B;  4Z5T C;  3REI C;  2L5A A;  3MGR C;  1F66 B;  3B6G B;  1ID3 C;  5B24 D;  5B1L C;  4YM6 C;  2NZD B;  4H9O A;  5B40 A;  3LEL A;  4XUJ B;  1P3G B;  1P3A B;  5AV8 D;  5B0Y C;  4G91 C;  4UUZ B;  5B31 A;  3AZH B;  1P3L D;  4ZUX D;  1H3O B;  1A7W A;  5B33 A;  3X1S D;  5CPK A;  5AY8 A;  3X1V C;  3AZK B;  3KXB B;  5BT1 D;  1P3M D;  3KWQ C;  3MNN B;  5DNM D;  3B6F B;  4NE3 A;  4EO5 C;  5B2I D;  5B32 D;  4J8X B;  1P3L A;  1AOI A;  5C3I C;  4J8V D;  4Z66 A;  3MGQ A;  1WWS A;  3LZ1 A;  3AZE C;  3WTP C;  1ID3 B;  3WTP E;  4KUD C;  2HUE C;  5JRG D;  1F66 A;  3B6G A;  3AZG D;  2NZD A;  4XUJ A;  4J8U D;  1P3F C;  4KGC B;  1M19 C;  3REH D;  1P3G A;  1P3A A;  3AZM C;  4UUZ A;  3AZH A;  3X1T C;  2F8N H;  1H3O A;  5E5A C;  3AZI C;  1M18 D;  3UTA B;  3W98 B;  2RVQ D;  5F99 B;  3AZJ B;  3AZK A;  3MGS C;  4KHA B;  4EO5 B;  3KXB A;  1KX4 C;  3MNN A;  5G49 B;  3B6F A;  4YS3 D;  3KUY D;  5AV5 A;  1S32 B;  4J8X A;  3UTB D;  1P3P D;  3MGP B;  5B40 C;  5CP6 B;  3TU4 D;  4Z2M H;  5B32 G;  5AVB D;  1ID3 A;  5B2J D;  1N1J B;  2HIO D;  3UTA D;  5GSU D;  5B24 C;  1P3K B;  5B33 C;  5CPK C;  5AY8 C;  4KGC A;  3X1U D;  2NQB D;  5DNN D;  3VH5 A;  3X1T B;  3C1C B;  3MVD D;  3R45 B;  3WA9 D;  1P3L C; 
#chains in the Genus database with same CATH topology
 4ZUX C;  3W98 A;  1P3B B;  3UT9 B;  4Z66 C;  5F99 A;  3MGQ C;  3AZJ A;  4H9N B;  4KHA A;  3LZ1 C;  3AFA D;  1P3M C;  5G49 A;  4R8P B;  4ZBJ B;  1S32 A;  1F66 C;  3B6G C;  3WKJ B;  2NZD C;  3MGP A;  3W96 B;  3REK B;  3AV2 D;  1Q9C A;  5CP6 A;  4QLC D;  3VH5 T;  4XUJ C;  2G5I C;  4J8V C;  1HQ3 D;  1P3G C;  1P3A C;  4CSR B;  5B24 B;  1N1J A;  3AZH C;  3AYW D;  3C1B B;  4WU9 D;  1AOI C;  4WZS B;  3AZG C;  4WU8 D;  1P3K A;  5BNV B;  3AZK C;  1KX3 D;  5AV8 B;  3LZ0 D;  3KXB C;  3MNN C;  1KX5 B;  3X1T A;  1P3I D;  3C1C A;  4ZUX B;  4J8X C;  3R45 A;  5BS7 C;  3NQJ B;  4LD9 D;  4H9R B;  1JFI B;  4NFT A;  5GT3 D;  3X1S B;  1M18 C;  1P3B A;  3A6N D;  3UT9 A;  2Y2Q A;  5B1M D;  3W97 D;  2RVQ C;  2IO5 C;  4H9N A;  5DNM B;  4CAY B;  3F6T A;  5B2I B;  5B32 B;  4H9S C;  4R8P A;  2CV5 D;  3C1B D;  3REL D;  3WKJ A;  5CPJ D;  1P3P C;  3O62 D;  4J8V B;  3W96 A;  3REK A;  4KGC C;  1KX5 D;  3IP4 C;  1HTA A;  2F8N D;  4CSR A;  4XZQ D;  5JRG B;  2ZY3 A;  5GXQ D;  3AZG B;  5B24 A;  5B2J C;  3C1B A;  1B67 A;  5CPI D;  3UTA C;  2F8N K;  1BH9 B;  5GSU C;  3W98 C;  4J8U B;  5F99 C;  3REH B;  5BNV A;  3AZJ C;  5AV8 A;  1TZY D;  5BO0 B;  3AZF D;  1KX5 A;  1W2E A;  4ZUX A;  1S32 C;  4NE6 A;  1M18 B;  5B0Z D;  3MVD C;  3NQJ A;  4H9R A;  3REJ D;  4X23 D;  1TAF B;  3X1S A;  3MGP C;  1M1A B;  2IO5 B;  5CP6 C;  2J8P A;  1EQZ D;  1P3M A;  5DNM A;  4CAY A;  3VH6 W;  3WAA D;  4YS3 B;  5B2I A;  3KUY B;  5B32 A;  1P3P B;  3UTB B;  3AZL D;  2FFF B;  1U35 D;  4J8V A;  3TU4 B;  1P3K C;  5GT0 D;  4J8W D;  5AVB B;  3KFU G;  5B2J B;  4AWL B;  3W99 B;  3C1C C;  5JRG A;  2HIO B;  5GSU B;  3AZG A;  5AV6 D;  3AZN D;  1M1A D;  3AYW C;  1BH9 A;  2Y2N A;  2RIQ A;  3EPJ A;  4J8U A;  3UT9 C;  1P3B C;  3X1U B;  2NQB B;  5DNN B;  3REH A;  2F8N G;  1P34 D;  3LZ0 C;  5BS7 A;  5BO0 A;  3MVD B;  3WA9 B;  5BNX B;  4R8P C;  4ZBJ C;  2JE5 A;  3WKJ C;  1M18 A;  4LD9 C;  1TAF A;  3W96 C;  3REK C;  5KDM B;  3AFA B;  3B0C W;  3A6N C;  4H9S A;  3AN2 D;  2Y2G A;  3W99 D;  3W97 C;  2CWE A;  3KUY A;  4YS3 A;  4Z5T D;  1P3P A;  3UTB A;  3REI D;  1BH8 B;  3MGR D;  3C1B C;  1ZLA D;  3AV2 B;  2F2A C;  5B1L D;  4YM6 D;  4QLC B;  3O62 C;  3B0D B;  4H9Q B;  3TU4 A;  1HQ3 B;  4DRB A;  4H9P B;  4E44 A;  5AV8 C;  5AVB A;  1KX5 C;  2ARO D;  5B2J A;  5B0Y D;  2HIO A;  3UTA A;  3AYW B;  4E45 A;  5GSU A;  4WU9 B;  4WU8 B;  3X1S C;  2PYO D;  4UPK A;  3LJA D;  3X1U A;  3LZ0 B;  1KX3 B;  2NQB A;  5BT1 C;  5DNN A;  1BFM A;  3X1V D;  4HGA B;  5DNM C;  1P3I B;  5B2I C;  1TZY C;  5B32 C;  3MVD A;  3KWQ D;  3AV1 B;  3WA9 A;  5BNX A;  3AZF C;  4LD9 B;  4WJ3 C;  5GT3 B;  3A6N B;  2JSS A;  5KDM A;  1P3O B;  3AL0 C;  5B1M B;  3W97 B;  3AFA A;  2LY8 A;  2G5H C;  3AZE D;  2CV5 B;  3REL B;  5JRG C;  3WTP D;  5CPJ B;  4KUD D;  2FJ7 D;  3O62 B;  1BH8 A;  4G92 B;  3AV2 A;  3A1I A;  4QLC A;  2Y2M A;  4J8U C;  4H9Q A;  5FUG B;  3REH C;  1HQ3 A;  1P3F D;  4H9P A;  4J8W C;  1M19 D;  2F8N B;  3AV1 D;  4XZQ B;  2YFW B;  5GXQ B;  3EPL A;  3AYW A;  4JJN D;  4WU9 A;  5CPI B;  1B6W A;  4WU8 A;  5E5A D;  1P3O D;  3AZI D;  1M1A C;  2XD5 A;  1KX3 A;  3LZ0 A;  1TZY B;  2BG1 A;  3AZF B;  3MGS D;  1P3I A;  4YS3 C;  3KUY C;  5AVC B;  1KX4 D;  3UTB C;  5B0Z B;  4WNN B;  4LD9 A;  3REJ B;  4X23 B;  5GT3 A;  3A6N A;  3TU4 C;  1EQZ B;  3VH6 A;  5B1M A;  2Y2I A;  3W97 A;  5B40 D;  3LEL D;  3WAA B;  4NE5 A;  5AVB C;  3AZL B;  2CV5 A;  3W99 C;  4AWL C;  3REL A;  5CPJ A;  2HIO C;  1U35 B;  3O62 A;  5JA4 B;  5B31 D;  5GT0 B;  1ZLA C;  2XD1 A;  4J8W B;  3X1U C;  5B33 D;  5AV9 B;  5DNN C;  5AY8 D;  5FUG A;  5CPK D;  2NQB C;  1WWI A;  2F8N A;  5AVC D;  4XZQ A;  2YFW A;  5GXQ A;  1JFI A;  5AV6 B;  3WA9 C;  3AZN B;  2ARO C;  3B0B A;  5CPI A;  3VH6 T;  2ZY5 A;  1AOI D;  2PYO C;  1P34 B;  3AFA C;  1TZY A;  5CHL B;  4Z66 D;  3LJA C;  3P5J B;  3MGQ D;  3AZF A;  3LZ1 D;  5AVC A;  5B0Z A;  4WNN A;  2ZY4 A;  3REJ A;  4X23 A;  1F66 D;  3B6G D;  5AV5 B;  3AV2 C;  4QLC C;  2NZD D;  3FDD A;  3B0D C;  5AV9 D;  1EQZ A;  3AN2 B;  2BYM B;  1HQ3 C;  4XUJ D;  2Y2K A;  3WAA A;  3V9R B;  1KU5 A;  3NQU B;  4Z5T B;  1T3U A;  3REI B;  1P3G D;  3AZL A;  1P3A D;  3MGR B;  1U35 A;  3EPK A;  4WU9 C;  1ZLA B;  5B1L B;  4YM6 B;  2YFV B;  5JA4 A;  3AZH D;  4WU8 C;  2FJ7 C;  5GT0 A;  4J8W A;  2JCH A;  1KX3 C;  5AV9 A;  2Y2J A;  2ZY2 A;  3AZK D;  4HGA C;  2ARO B;  5B0Y B;  1P3I C;  3KXB D;  4WV4 B;  3AV1 C;  3MNN D;  5B31 G;  5AV6 A;  3B0C T;  4G91 B;  3AZN A;  3B6F D;  5GT3 C;  1M1A A;  5AV5 D;  4J8X D;  4JJN C;  2PYO B;  2BYK B;  3LJA B;  1P3O C;  5B1M C;  3X1V B;  1P34 A;  3KWQ B;  2CV5 C;  4Z2M G;  3REL C;  5CPJ C;  1ID3 D;  2Y2L A;  4G92 C;  5C3I B;  1F1E A;  3AN2 A;  2BYM A;  3LEL C;  3AZE B;  3W99 A;  4KGC D;  3V9R A;  4XZQ C;  3WTP B;  3NQU A;  4Z5T A;  3REI A;  5GXQ C;  4KUD B;  2FJ7 B;  2HUE B;  3MGR A;  1ZLA A;  5CPI C;  1R4V A;  5B1L A;  4YM6 A;  2YFV A;  2ZM5 A;  5B31 C;  3W98 D;  3KSY A;  1P3F B;  1M19 B;  5F99 D;  1ULY A;  3AZJ D;  2ARO A;  5B0Y A;  4DRA A;  5AVC C;  4JJN B;  3AZM B;  5B0Z C;  3REJ C;  4X23 C;  5E5A B;  1S32 D;  3AZI B;  2PYO A;  2BYK A;  2Y2P A;  3LJA A;  1EQZ C;  3MGP D;  5CP6 D;  3X1V A;  3MGS B;  3WAA C;  1KX4 B;  3KWQ A;  3AZL C;  1U35 C;  2DQN C;  4H9O B;  5B40 B;  5GT0 C;  3LEL B;  1P3K D;  5AV9 C;  3AZE A;  3AZM D;  3WTP A;  4KUD A;  2FJ7 A;  4M6B A;  5AV6 C;  3X1T D;  3AZN C;  3VH5 W;  5B31 B;  3C1C D;  2Y2H A;  5B33 B;  5CPK B;  5AY8 B;  1P3B D;  3UT9 D;  1P34 C;  1P3F A;  1M19 A;  3AV1 A;  2W8S A;  4JJN A;  3AZM A;  4R8P D;  3B6F C;  5E5A A;  1P3O A;  3AZI A;  1P3L B;  1AOI B;  3WKJ D;  5AV5 C;  3W96 D;  4Z66 B;  3REK D;  3AN2 C;  3MGQ B;  3MGS A;  3LZ1 B;  1KX4 A;  4DQY B;  1P3M B;  4Z5T C;  3REI C;  2L5A A;  3MGR C;  1F66 B;  3B6G B;  1ID3 C;  3H0R C;  5B24 D;  5B1L C;  4YM6 C;  2NZD B;  4H9O A;  5B40 A;  3LEL A;  4XUJ B;  1P3G B;  1P3A B;  5AV8 D;  5B0Y C;  4G91 C;  4UUZ B;  5B31 A;  3AZH B;  1P3L D;  4ZUX D;  1H3O B;  1A7W A;  5B33 A;  3X1S D;  5CPK A;  5AY8 A;  3X1V C;  3AZK B;  3EPH A;  3KXB B;  5BT1 D;  1P3M D;  3KWQ C;  3MNN B;  5DNM D;  3B6F B;  4NE3 A;  1PZR A;  4EO5 C;  5B2I D;  5B32 D;  4J8X B;  1P3L A;  1AOI A;  5C3I C;  4J8V D;  4Z66 A;  3MGQ A;  1WWS A;  3LZ1 A;  3AZE C;  3EG5 B;  3WTP C;  1ID3 B;  3WTP E;  4KUD C;  2HUE C;  5JRG D;  1F66 A;  3B6G A;  3AZG D;  2NZD A;  4XUJ A;  4J8U D;  1P3F C;  4KGC B;  1M19 C;  3REH D;  1P3G A;  1P3A A;  3AZM C;  4UUZ A;  3AZH A;  3X1T C;  2F8N H;  1H3O A;  5E5A C;  3AZI C;  1M18 D;  3UTA B;  3W98 B;  2RVQ D;  5F99 B;  2Y2O A;  3AZJ B;  3H0M C;  3MGS C;  3AZK A;  4KHA B;  4EO5 B;  3KXB A;  3A1K A;  1Z2C B;  1KX4 C;  3MNN A;  5G49 B;  3B6F A;  4YS3 D;  3KUY D;  5AV5 A;  1S32 B;  4J8X A;  3UTB D;  1P3P D;  3MGP B;  5B40 C;  5CP6 B;  3TU4 D;  4Z2M H;  5B32 G;  5AVB D;  1ID3 A;  5B2J D;  1N1J B;  2HIO D;  3UTA D;  5GSU D;  2UWX A;  5B24 C;  2DF4 C;  1P3K B;  5B33 C;  5CPK C;  5AY8 C;  4KGC A;  3X1U D;  2NQB D;  5DNN D;  3H0L C;  3VH5 A;  3X1T B;  3C1C B;  3MVD D;  3R45 B;  3WA9 D;  2VQR A;  1P3L C; 
#chains in the Genus database with same CATH homology
 4ZUX C;  3W98 A;  1P3B B;  3UT9 B;  4Z66 C;  5F99 A;  3MGQ C;  3AZJ A;  4H9N B;  4KHA A;  3LZ1 C;  3AFA D;  1P3M C;  5G49 A;  4R8P B;  4ZBJ B;  1S32 A;  1F66 C;  3B6G C;  3WKJ B;  2NZD C;  3MGP A;  3W96 B;  3REK B;  3AV2 D;  1Q9C A;  5CP6 A;  4QLC D;  3VH5 T;  4XUJ C;  2G5I C;  4J8V C;  1HQ3 D;  1P3G C;  1P3A C;  4CSR B;  5B24 B;  1N1J A;  3AZH C;  3AYW D;  3C1B B;  4WU9 D;  1AOI C;  4WZS B;  3AZG C;  4WU8 D;  1P3K A;  5BNV B;  3AZK C;  1KX3 D;  5AV8 B;  3LZ0 D;  3KXB C;  3MNN C;  1KX5 B;  3X1T A;  1P3I D;  3C1C A;  4ZUX B;  4J8X C;  3R45 A;  5BS7 C;  3NQJ B;  4LD9 D;  4H9R B;  1JFI B;  4NFT A;  5GT3 D;  3X1S B;  1M18 C;  1P3B A;  3A6N D;  3UT9 A;  2Y2Q A;  5B1M D;  3W97 D;  2RVQ C;  2IO5 C;  4H9N A;  5DNM B;  4CAY B;  3F6T A;  5B2I B;  5B32 B;  4H9S C;  4R8P A;  2CV5 D;  3C1B D;  3REL D;  3WKJ A;  5CPJ D;  1P3P C;  3O62 D;  4J8V B;  3W96 A;  3REK A;  4KGC C;  1KX5 D;  3IP4 C;  1HTA A;  2F8N D;  4CSR A;  4XZQ D;  5JRG B;  2ZY3 A;  5GXQ D;  3AZG B;  5B24 A;  5B2J C;  3C1B A;  1B67 A;  5CPI D;  3UTA C;  2F8N K;  1BH9 B;  5GSU C;  3W98 C;  4J8U B;  5F99 C;  3REH B;  5BNV A;  3AZJ C;  5AV8 A;  1TZY D;  5BO0 B;  3AZF D;  1KX5 A;  1W2E A;  4ZUX A;  1S32 C;  4NE6 A;  1M18 B;  5B0Z D;  3MVD C;  3NQJ A;  4H9R A;  3REJ D;  4X23 D;  1TAF B;  3X1S A;  3MGP C;  1M1A B;  2IO5 B;  5CP6 C;  2J8P A;  1EQZ D;  1P3M A;  5DNM A;  4CAY A;  3VH6 W;  3WAA D;  4YS3 B;  5B2I A;  3KUY B;  5B32 A;  1P3P B;  3UTB B;  3AZL D;  2FFF B;  1U35 D;  4J8V A;  3TU4 B;  1P3K C;  5GT0 D;  4J8W D;  5AVB B;  3KFU G;  5B2J B;  4AWL B;  3W99 B;  3C1C C;  5JRG A;  2HIO B;  5GSU B;  3AZG A;  5AV6 D;  3AZN D;  1M1A D;  3AYW C;  1BH9 A;  2Y2N A;  2RIQ A;  3EPJ A;  4J8U A;  3UT9 C;  1P3B C;  3X1U B;  2NQB B;  5DNN B;  3REH A;  2F8N G;  1P34 D;  3LZ0 C;  5BS7 A;  5BO0 A;  3MVD B;  3WA9 B;  5BNX B;  4R8P C;  4ZBJ C;  2JE5 A;  3WKJ C;  1M18 A;  4LD9 C;  1TAF A;  3W96 C;  3REK C;  5KDM B;  3AFA B;  3B0C W;  3A6N C;  4H9S A;  3AN2 D;  2Y2G A;  3W99 D;  3W97 C;  2CWE A;  3KUY A;  4YS3 A;  4Z5T D;  1P3P A;  3UTB A;  3REI D;  1BH8 B;  3MGR D;  3C1B C;  1ZLA D;  3AV2 B;  2F2A C;  5B1L D;  4YM6 D;  4QLC B;  3O62 C;  3B0D B;  4H9Q B;  3TU4 A;  1HQ3 B;  4DRB A;  4H9P B;  4E44 A;  5AV8 C;  5AVB A;  1KX5 C;  2ARO D;  5B2J A;  5B0Y D;  2HIO A;  3UTA A;  3AYW B;  4E45 A;  5GSU A;  4WU9 B;  4WU8 B;  3X1S C;  2PYO D;  4UPK A;  3LJA D;  3X1U A;  3LZ0 B;  1KX3 B;  2NQB A;  5BT1 C;  5DNN A;  1BFM A;  3X1V D;  4HGA B;  5DNM C;  1P3I B;  5B2I C;  1TZY C;  5B32 C;  3MVD A;  3KWQ D;  3AV1 B;  3WA9 A;  5BNX A;  3AZF C;  4LD9 B;  4WJ3 C;  5GT3 B;  3A6N B;  2JSS A;  5KDM A;  1P3O B;  3AL0 C;  5B1M B;  3W97 B;  3AFA A;  2LY8 A;  2G5H C;  3AZE D;  2CV5 B;  3REL B;  5JRG C;  3WTP D;  5CPJ B;  4KUD D;  2FJ7 D;  3O62 B;  1BH8 A;  4G92 B;  3AV2 A;  3A1I A;  4QLC A;  2Y2M A;  4J8U C;  4H9Q A;  5FUG B;  3REH C;  1HQ3 A;  1P3F D;  4H9P A;  4J8W C;  1M19 D;  2F8N B;  3AV1 D;  4XZQ B;  2YFW B;  5GXQ B;  3EPL A;  3AYW A;  4JJN D;  4WU9 A;  5CPI B;  1B6W A;  4WU8 A;  5E5A D;  1P3O D;  3AZI D;  1M1A C;  2XD5 A;  1KX3 A;  3LZ0 A;  1TZY B;  2BG1 A;  3AZF B;  3MGS D;  1P3I A;  4YS3 C;  3KUY C;  5AVC B;  1KX4 D;  3UTB C;  5B0Z B;  4WNN B;  4LD9 A;  3REJ B;  4X23 B;  5GT3 A;  3A6N A;  3TU4 C;  1EQZ B;  3VH6 A;  5B1M A;  2Y2I A;  3W97 A;  5B40 D;  3LEL D;  3WAA B;  4NE5 A;  5AVB C;  3AZL B;  2CV5 A;  3W99 C;  4AWL C;  3REL A;  5CPJ A;  2HIO C;  1U35 B;  3O62 A;  5JA4 B;  5B31 D;  5GT0 B;  1ZLA C;  2XD1 A;  4J8W B;  3X1U C;  5B33 D;  5AV9 B;  5DNN C;  5AY8 D;  5FUG A;  5CPK D;  2NQB C;  1WWI A;  2F8N A;  5AVC D;  4XZQ A;  2YFW A;  5GXQ A;  1JFI A;  5AV6 B;  3WA9 C;  3AZN B;  2ARO C;  3B0B A;  5CPI A;  3VH6 T;  2ZY5 A;  1AOI D;  2PYO C;  1P34 B;  3AFA C;  1TZY A;  5CHL B;  4Z66 D;  3LJA C;  3P5J B;  3MGQ D;  3AZF A;  3LZ1 D;  5AVC A;  5B0Z A;  4WNN A;  2ZY4 A;  3REJ A;  4X23 A;  1F66 D;  3B6G D;  5AV5 B;  3AV2 C;  4QLC C;  2NZD D;  3FDD A;  3B0D C;  5AV9 D;  1EQZ A;  3AN2 B;  2BYM B;  1HQ3 C;  4XUJ D;  2Y2K A;  3WAA A;  3V9R B;  1KU5 A;  3NQU B;  4Z5T B;  1T3U A;  3REI B;  1P3G D;  3AZL A;  1P3A D;  3MGR B;  1U35 A;  3EPK A;  4WU9 C;  1ZLA B;  5B1L B;  4YM6 B;  2YFV B;  5JA4 A;  3AZH D;  4WU8 C;  2FJ7 C;  5GT0 A;  4J8W A;  2JCH A;  1KX3 C;  5AV9 A;  2Y2J A;  2ZY2 A;  3AZK D;  4HGA C;  2ARO B;  5B0Y B;  1P3I C;  3KXB D;  4WV4 B;  3AV1 C;  3MNN D;  5B31 G;  5AV6 A;  3B0C T;  4G91 B;  3AZN A;  3B6F D;  5GT3 C;  1M1A A;  5AV5 D;  4J8X D;  4JJN C;  2PYO B;  2BYK B;  3LJA B;  1P3O C;  5B1M C;  3X1V B;  1P34 A;  3KWQ B;  2CV5 C;  4Z2M G;  3REL C;  5CPJ C;  1ID3 D;  2Y2L A;  4G92 C;  5C3I B;  1F1E A;  3AN2 A;  2BYM A;  3LEL C;  3AZE B;  3W99 A;  4KGC D;  3V9R A;  4XZQ C;  3WTP B;  3NQU A;  4Z5T A;  3REI A;  5GXQ C;  4KUD B;  2FJ7 B;  2HUE B;  3MGR A;  1ZLA A;  5CPI C;  1R4V A;  5B1L A;  4YM6 A;  2YFV A;  2ZM5 A;  5B31 C;  3W98 D;  3KSY A;  1P3F B;  1M19 B;  5F99 D;  1ULY A;  3AZJ D;  2ARO A;  5B0Y A;  4DRA A;  5AVC C;  4JJN B;  3AZM B;  5B0Z C;  3REJ C;  4X23 C;  5E5A B;  1S32 D;  3AZI B;  2PYO A;  2BYK A;  2Y2P A;  3LJA A;  1EQZ C;  3MGP D;  5CP6 D;  3X1V A;  3MGS B;  3WAA C;  1KX4 B;  3KWQ A;  3AZL C;  1U35 C;  2DQN C;  4H9O B;  5B40 B;  5GT0 C;  3LEL B;  1P3K D;  5AV9 C;  3AZE A;  3AZM D;  3WTP A;  4KUD A;  2FJ7 A;  4M6B A;  5AV6 C;  3X1T D;  3AZN C;  3VH5 W;  5B31 B;  3C1C D;  2Y2H A;  5B33 B;  5CPK B;  5AY8 B;  1P3B D;  3UT9 D;  1P34 C;  1P3F A;  1M19 A;  3AV1 A;  2W8S A;  4JJN A;  3AZM A;  4R8P D;  3B6F C;  5E5A A;  1P3O A;  3AZI A;  1P3L B;  1AOI B;  3WKJ D;  5AV5 C;  3W96 D;  4Z66 B;  3REK D;  3AN2 C;  3MGQ B;  3MGS A;  3LZ1 B;  1KX4 A;  4DQY B;  1P3M B;  4Z5T C;  3REI C;  2L5A A;  3MGR C;  1F66 B;  3B6G B;  1ID3 C;  3H0R C;  5B24 D;  5B1L C;  4YM6 C;  2NZD B;  4H9O A;  5B40 A;  3LEL A;  4XUJ B;  1P3G B;  1P3A B;  5AV8 D;  5B0Y C;  4G91 C;  4UUZ B;  5B31 A;  3AZH B;  1P3L D;  4ZUX D;  1H3O B;  1A7W A;  5B33 A;  3X1S D;  5CPK A;  5AY8 A;  3X1V C;  3AZK B;  3EPH A;  3KXB B;  5BT1 D;  1P3M D;  3KWQ C;  3MNN B;  5DNM D;  3B6F B;  4NE3 A;  1PZR A;  4EO5 C;  5B2I D;  5B32 D;  4J8X B;  1P3L A;  1AOI A;  5C3I C;  4J8V D;  4Z66 A;  3MGQ A;  1WWS A;  3LZ1 A;  3AZE C;  3EG5 B;  3WTP C;  1ID3 B;  3WTP E;  4KUD C;  2HUE C;  5JRG D;  1F66 A;  3B6G A;  3AZG D;  2NZD A;  4XUJ A;  4J8U D;  1P3F C;  4KGC B;  1M19 C;  3REH D;  1P3G A;  1P3A A;  3AZM C;  4UUZ A;  3AZH A;  3X1T C;  2F8N H;  1H3O A;  5E5A C;  3AZI C;  1M18 D;  3UTA B;  3W98 B;  2RVQ D;  5F99 B;  2Y2O A;  3AZJ B;  3H0M C;  3MGS C;  3AZK A;  4KHA B;  4EO5 B;  3KXB A;  3A1K A;  1Z2C B;  1KX4 C;  3MNN A;  5G49 B;  3B6F A;  4YS3 D;  3KUY D;  5AV5 A;  1S32 B;  4J8X A;  3UTB D;  1P3P D;  3MGP B;  5B40 C;  5CP6 B;  3TU4 D;  4Z2M H;  5B32 G;  5AVB D;  1ID3 A;  5B2J D;  1N1J B;  2HIO D;  3UTA D;  5GSU D;  2UWX A;  5B24 C;  2DF4 C;  1P3K B;  5B33 C;  5CPK C;  5AY8 C;  4KGC A;  3X1U D;  2NQB D;  5DNN D;  3H0L C;  3VH5 A;  3X1T B;  3C1C B;  3MVD D;  3R45 B;  3WA9 D;  2VQR A;  1P3L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...