3TU4C

Crystal structure of the sir3 bah domain in complex with a nucleosome core particle.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural basis of silencing: Sir3 BAH domain in complex with a nucleosome at 3.0 A resolution.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Signaling protein/structural protein/dna
total genus 32
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3tu4C00
5AVBD 1HQ3C 4J8XA 3REIB 5BNXA 3LZ1B 5B2IA 3MGQC 5GT0C 3MGPA 4J8WA 4J8UC 3AV1D 1P3PC 4J8VC 1TZYB 5AVCD 3UTAB 5B31A 3MVDA 1P3LB 3MGRD 3O62B 1ID3D 4LD9B 5B2JD 5B24D 3AZKD 3KWQA 3AZFA 4Z2MH 2CWEA 5GXQD 3B0DB 1KX4B 4H9PB 4E44A 5BO0A 1EQZC 2BYKA 3AV2A 4YS3B 1P3IA 1U35D 2NZDD 1M19D 3UTBA 3LELD 3W97A 3B6GD 3W99B 5B0ZA 1HTAA 5G49A 5C3IC 5AV8C 3REID 4QLCA 5B1MB 3WKJB 1Q9CA 1F66C 3MNNA 1KX3A 3A6NB 4Z5TC 1WWIA 1B67A 3UTAD 3AV1A 1P3OB 5DNNB 1P3BD 1M1AA 1P3KA 2CV5B 3B0CT 3AN2C 3AZND 4WU8B 5GT3D 1ZLAC 1M18B 3RELA 5FUGB 1AOID 3NQUA 4ZUXA 3AZGB 1N1JB 2HIOD 1P3MB 4H9QA 4WU9A 3X1UC 4JJNB 4XZQC 5F99A 1P3AB 3KSYA 3REJD 5E5AC 1H3OB 3B6FC 3X1VC 3AFAB 1TAFB 5AV5D 3REIA 4G91B 1P34B 4YM6C 3LZ1A 3UT9B 2PYOD 2NQBD 5B0YB 5B32D 3REHB 2LY8A 3W96D 1TZYA 3UTAA 5DNND 2IO5C 1KX5C 3AZIB 1HQ3D 2CV5D 1P3LA 3O62A 3MGQD 4LD9A 4XUJB 4NE3A 1KX4A 4H9PA 3LJAB 4J8UD 4J8VD 4JJND 4Z66B 4YS3A 5BT1C 4R8PB 3AZJC 3X1SB 5AY8C 3KXBB 5AVBB 3W99A 1EQZD 3VH6T 2F8ND 1P3FC 5B40C 3UT9D 5B1MA 3WKJA 3WTPC 5B0YD 3MGSC 3A6NA 5AVCB 3VH6A 3AYWC 3MGRB 1P3OA 1ID3B 5DNNA 5B2JB 5AV8D 5B24B 1P3GC 3AZKB 5CPKC 2CV5A 4UUZB 5GXQB 4KUDC 4WU8A 3W98C 1F66D 4XUJD 5BS7A 1M18A 3LJAD 5FUGA 2NZDB 1U35B 3AZGA 4Z5TD 1A7WA 3C1BB 1M19B 1N1JA 1P3MA 5AV6B 3LELB 4JJNA 2FJ7C 1P3AA 1BH9B 3B6GB 5AV9C 3AZMC 3AN2D 4AWLB 5B33C 1ZLAD 1H3OA 3C1CB 3X1TC 5DNMC 3AFAA 1TAFA 5CPIC 3KUYC 1P34A 3UT9A 3LZ0C 5B0YA 3WTPE 3REHA 5CPJC 5JRGC 3AZEC 5GSUC 5B1LD 4X23C 3AZLC 1P3BB 3B6FD 3X1VD 3AZHC 3AZNB 3AZIA 5GT3B 5CP6C 1S32C 3WA9C 2AROC 4H9SA 4KGCC 4YM6D 5B31G 1AOIB 1R4VA 4EO5B 2HIOB 4XUJA 3C1BD 3LJAA 5AV6D 3REJB 4Z66A 3TU4C 4R8PA 1KX5D 3REKB 4HGAB 3X1SA 4WZSB 3C1CD 5AV5B 3KXBA 5AVBA 4J8XC 2PYOB 2NQBB 5B32B 5B2IC 3AZJD 4E45A 2HUEB 3W96B 3MGPC 4J8WC 3WAAB 5AVCA 5AY8D 5B1LA 1HQ3B 4G92C 5B31C 4H9NB 3MVDC 3MGRA 1ID3A 3MGQB 5B2JA 5B24A 5GT0B 1P3FD 3AZKA 4UUZA 5GXQA 3KWQC 4J8UB 3AZFC 3MGSD 1P3PB 4J8VB 2NZDA 1U35A 3C1BA 1M19A 3AV2C 1P3IC 5AV6A 3LELA 3REKD 3AYWD 1BH9A 1P3GD 3UTBC 3B6GA 3W97C 5CPKD 4KUDD 3W98D 1EQZB 2F8NB 3C1CA 4H9RB 5B0ZC 4Z2MG 4QLCC 4ZBJC 2FJ7D 4WNNB 5AV9D 3MNNC 3AZMD 1KX3C 3WAAD 5B33D 5C3IB 3X1TD 5AV8B 3AV1C 1P3BA 3NQJB 5DNMD 5GT0D 3AZNA 1M1AC 5GT3A 1P3KC 1F66B 3KUYD 1WWSA 3B0BA 1AOIA 3LZ0D 5CPJD 4Z5TB 3RELC 1P3PD 2HIOA 5JRGD 4ZUXC 3AZED 2F8NH 5GSUD 4X23D 1B6WA 1BH8B 2YFVB 3AZLD 4WU9C 3REJA 5F99C 3AZHD 3AN2B 3WA9D 3REKA 5CP6D 1S32D 2AROD 1ZLAB 5JA4B 5CPKA 5AV5A 3X1UB 4XZQB 2PYOA 4NE5A 4H9OB 3REIC 2NQBA 5B32A 3TU4D 5E5AB 3LZ1C 5B1LB 3W96A 1ULYA 3B6FB 3WAAA 3X1VB 1HQ3A 1TZYC 3UTAC 4H9NA 4YM6B 3MGQA 1P3LC 5GT0A 3O62C 4NFTA 4CSRB 5B2ID 4LD9C 4J8UA 3B0DC 3MGPD 4J8WD 4J8VA 1P3PA 1KX4C 4DRBA 2IO5B 4M6BA 1KX5B 4YS3C 3VH5W 5B31D 3MVDD 3KWQD 3AZFD 1EQZA 2F8NA 3W99C 4H9RA 3X1UD 4XZQD 3AZJB 3AV2D 5E5AD 1P3ID 5B1MC 3WKJC 3UTBD 5AY8B 4WNNA 3W97D 3R45B 3A6NC 5KDMB 4WV4B 5AV8A 5B0ZD 1P3FB 5B40B 3NQJA 1P3OC 5DNNC 3WTPB 2CV5C 1F66A 4QLCD 3MGSB 4WU8C 2YFWB 5BS7C 3MNND 1M18C 4Z5TA 1KX3D 3AZGC 2JSSA 3AYWB 1P3MC 1BH8A 2YFVA 1P3GB 4JJNC 5CPKB 1P3AC 3AN2A 2BYMB 4KUDB 1M1AD 3W98B 1P3KD 1ZLAA 5JA4A 2F8NK 4KHAB 5BNVB 3RELD 4ZUXD 3AFAC 5BT1D 3X1UA 4XZQA 2FJ7B 4H9OA 4WU9D 4G91C 5AV9B 3AZMB 5F99D 1P34C 5E5AA 3UT9C 5B33B 5B0YC 3REHC 3X1TB 3B6FA 5DNMB 3X1VA 5B40D 5CPIB 3KUYB 3WTPD 3AZIC 4YM6A 4H9SC 3LZ0B 5CPJB 4CSRA 3LZ1D 5JRGB 3AZEB 5GSUB 4X23B 2RVQC 4XUJC 3AZLB 3LJAC 3AZHB 1KX5A 3WA9B 5CP6B 1S32B 1TZYD 4Z66C 2AROB 4KGCB 4R8PC 3X1SC 1P3LD 3O62D 4LD9D 3KXBC 5AVBC 1KX4D 3TU4B 3AZJA 4YS3D 3V9RB 1JFIB 4CAYB 5AY8A 3B0CW 3R45A 5KDMA 5AVCC 5CPID 3W99D 5B1LC 4J8XB 1P3FA 5B40A 3MGRC 5BNXB 5B2IB 1ID3C 5B2JC 5B24C 3WTPA 3AZKC 5B1MD 5GXQC 3MGSA 3WKJD 2YFWA 3MGPB 4J8WB 3A6ND 4G92B 2NZDC 1U35C 5B31B 3MVDB 3C1BC 3AYWA 1M19C 2L5AA 4KGCD 1P3GA 5AV6C 3LELC 1P3OD 2BYMA 4DRAA 4KUDA 3B6GC 3W98A 3KWQB 3AZFB 4AWLC 4NE6A 4WU8D 4KHAA 5BO0B 5BNVA 2BYKB 3C1CC 1M18D 3AV2B 1P3IB 3AZGD 2FJ7A 1P3MD 3UTBB 5AV9A 3AZMA 3W97B 1P3AD 5B33A 3X1TA 3VH5T 5B32G 5B0ZB 5G49B 5DNMA 4J8XD 1P3BC 1BFMA 5CPIA 3AFAD 4QLCB 3KUYA 3AZNC 4ZBJB 5GT3C 3LZ0A 3MNNB 5CPJA 1P34D 1KX3B 5JRGA 1AOIC 3AZEA 4EO5C 3REHD 5GSUA 3VH5A 2HIOC 4X23A 3AZLA 3AV1B 3AZHA 1M1AB 3REJC 3WA9A 5CP6A 1S32A 1P3KB 2AROA 4KGCA 3AZID 3VH6W 4HGAC 3REKC 5CHLB 3RELB 3NQUB 4ZUXB 5AV5C 2RVQD 4H9QB 4WU9B 5F99B 3TU4A 2PYOC 2F8NG 2NQBC 5B32C 4Z66D 1F1EA 1KU5A 3V9RA 4R8PD 1JFIA 4CAYA 3X1SD 2HUEC 3W96C 3WAAC 3KXBD
chains in the Genus database with same CATH superfamily
5AVBD 1HQ3C 4J8XA 2ZY4A 3REIB 5BNXA 3LZ1B 5B2IA 3MGQC 2Y2NA 5GT0C 3MGPA 4J8WA 4J8UC 3AV1D 1P3PC 4J8VC 1TZYB 5AVCD 3UTAB 5B31A 3MVDA 1P3LB 3MGRD 3O62B 1ID3D 4LD9B 5B2JD 5B24D 3AZKD 3KWQA 3AZFA 4Z2MH 2CWEA 5GXQD 3B0DB 1KX4B 4H9PB 4E44A 5BO0A 1EQZC 2BYKA 3AV2A 4YS3B 1P3IA 1U35D 2NZDD 1M19D 3UTBA 3LELD 3W97A 3B6GD 3W99B 5B0ZA 1HTAA 5G49A 5C3IC 5AV8C 3REID 4QLCA 5B1MB 3WKJB 1Q9CA 1F66C 3MNNA 1KX3A 3A6NB 3IP4C 4Z5TC 1WWIA 1B67A 3UTAD 3AV1A 2JE5A 1P3OB 5DNNB 1P3BD 1M1AA 1P3KA 2CV5B 3B0CT 3AN2C 3AZND 4WU8B 5GT3D 1W2EA 1ZLAC 1M18B 3RELA 5FUGB 1AOID 3NQUA 4ZUXA 3AZGB 4UPKA 1N1JB 2HIOD 1P3MB 4H9QA 4WU9A 3X1UC 4JJNB 4XZQC 5F99A 1P3AB 3KSYA 3REJD 5E5AC 2G5HC 1H3OB 3B6FC 3X1VC 3AFAB 1TAFB 2G5IC 5AV5D 3REIA 4G91B 1P34B 4YM6C 3LZ1A 3UT9B 2PYOD 2NQBD 5B32D 5B0YB 3REHB 2LY8A 3W96D 1TZYA 3A1IA 5DNND 3UTAA 2IO5C 1KX5C 3AZIB 1HQ3D 2CV5D 1P3LA 3O62A 4WJ3C 2ZY5A 3MGQD 4LD9A 3F6TA 4XUJB 4NE3A 1KX4A 4H9PA 3LJAB 2F2AC 4J8UD 4J8VD 4JJND 2Y2QA 4Z66B 4YS3A 5BT1C 4R8PB 3AZJC 3X1SB 2Y2MA 5AY8C 3H0MC 3KXBB 5AVBB 3W99A 1EQZD 3VH6T 2F8ND 3A1KA 1P3FC 5B40C 3UT9D 5B1MA 3WKJA 3WTPC 5B0YD 2ZM5A 3MGSC 3A6NA 2BG1A 5AVCB 3VH6A 3AYWC 3MGRB 1P3OA 1ID3B 5DNNA 5B2JB 5AV8D 5B24B 1P3GC 3AZKB 5CPKC 2CV5A 4UUZB 5GXQB 4KUDC 2UWXA 4WU8A 3W98C 1F66D 2Y2JA 4XUJD 5BS7A 1M18A 3LJAD 5FUGA 2NZDB 1U35B 3AZGA 4Z5TD 1A7WA 3C1BB 1M19B 1N1JA 3H0LC 1P3MA 5AV6B 3LELB 4JJNA 2FJ7C 1P3AA 1BH9B 3B6GB 5AV9C 3AZMC 2RIQA 3AN2D 4AWLB 5B33C 1ZLAD 1H3OA 3C1CB 3X1TC 5DNMC 3AFAA 1TAFA 5CPIC 3KUYC 1P34A 3UT9A 3LZ0C 5B0YA 3WTPE 3REHA 5CPJC 5JRGC 3AZEC 5GSUC 5B1LD 4X23C 3AZLC 1P3BB 2Y2KA 3B6FD 3X1VD 3AZHC 3AZNB 3AZIA 5GT3B 1T3UA 5CP6C 1S32C 3WA9C 2AROC 4H9SA 4KGCC 4YM6D 5B31G 1AOIB 1R4VA 4EO5B 2HIOB 4XUJA 3C1BD 3LJAA 2ZY3A 5AV6D 3REJB 4Z66A 3TU4C 4R8PA 1KX5D 3REKB 4HGAB 3X1SA 4WZSB 3C1CD 5AV5B 3KXBA 5AVBA 4J8XC 2PYOB 2NQBB 5B32B 5B2IC 3AZJD 4E45A 2HUEB 3W96B 3MGPC 4J8WC 3WAAB 5AVCA 5AY8D 2Y2LA 5B1LA 1HQ3B 4G92C 5B31C 4H9NB 3MVDC 3MGRA 1ID3A 3MGQB 5B2JA 5B24A 5GT0B 1P3FD 3AZKA 4UUZA 5GXQA 3KWQC 4J8UB 3AZFC 3MGSD 1P3PB 4J8VB 2NZDA 1U35A 3C1BA 1M19A 3AV2C 1P3IC 5AV6A 3LELA 3REKD 3AYWD 1BH9A 1P3GD 3UTBC 3B6GA 3W97C 5CPKD 3P5JB 4KUDD 3W98D 1EQZB 2F8NB 3C1CA 2FFFB 4H9RB 5B0ZC 3H0RC 4Z2MG 4QLCC 4ZBJC 2FJ7D 3EPKA 4WNNB 5AV9D 3MNNC 3AZMD 1KX3C 3WAAD 5B33D 5C3IB 3X1TD 5AV8B 3AV1C 1P3BA 2Y2OA 3NQJB 5DNMD 5GT0D 3AZNA 1M1AC 5GT3A 1P3KC 1F66B 3KUYD 1WWSA 3B0BA 1AOIA 3LZ0D 5CPJD 4Z5TB 3RELC 1P3PD 2HIOA 5JRGD 4ZUXC 3AZED 2F8NH 5GSUD 4X23D 1B6WA 1BH8B 2YFVB 4DQYB 3AZLD 4WU9C 3REJA 2VQRA 5F99C 3AZHD 3AN2B 3WA9D 3REKA 5CP6D 1S32D 2AROD 1ZLAB 5JA4B 5CPKA 5AV5A 3X1UB 4XZQB 2PYOA 4NE5A 4H9OB 2DQNC 3REIC 2NQBA 5B32A 3TU4D 5E5AB 3LZ1C 5B1LB 3W96A 1ULYA 3B6FB 3WAAA 3X1VB 1HQ3A 1TZYC 3UTAC 4H9NA 4YM6B 3MGQA 1P3LC 5GT0A 3O62C 4NFTA 4CSRB 5B2ID 4LD9C 4J8UA 3B0DC 3MGPD 4J8WD 4J8VA 1P3PA 1KX4C 4DRBA 2IO5B 4M6BA 1KX5B 4YS3C 3VH5W 5B31D 3MVDD 3KWQD 3AZFD 1EQZA 2F8NA 3W99C 4H9RA 3X1UD 2J8PA 4XZQD 2XD1A 3AZJB 3AV2D 5E5AD 1P3ID 5B1MC 3WKJC 3UTBD 5AY8B 4WNNA 3W97D 3R45B 3A6NC 5KDMB 4WV4B 5AV8A 5B0ZD 1P3FB 5B40B 3NQJA 1P3OC 5DNNC 3WTPB 2CV5C 1F66A 4QLCD 3MGSB 4WU8C 2YFWB 5BS7C 3MNND 1M18C 4Z5TA 1KX3D 3EPLA 3AZGC 2JSSA 3AYWB 1P3MC 1BH8A 2YFVA 1P3GB 4JJNC 5CPKB 1P3AC 3AN2A 2BYMB 4KUDB 1M1AD 1PZRA 1P3KD 3W98B 1ZLAA 5JA4A 2F8NK 4KHAB 5BNVB 2ZY2A 3RELD 2Y2HA 4ZUXD 3AFAC 5BT1D 3X1UA 4XZQA 2Y2IA 2FJ7B 4H9OA 4WU9D 4G91C 5AV9B 3EPJA 5F99D 3AZMB 1P34C 5E5AA 3UT9C 5B33B 5B0YC 3REHC 3X1TB 3B6FA 5DNMB 3X1VA 5B40D 5CPIB 3KUYB 3WTPD 3AZIC 4YM6A 4H9SC 3LZ0B 5CPJB 4CSRA 3LZ1D 5JRGB 3AZEB 5GSUB 4X23B 2RVQC 4XUJC 3AZLB 3EG5B 3LJAC 3AZHB 1KX5A 3WA9B 5CP6B 1S32B 1TZYD 4Z66C 2AROB 4KGCB 4R8PC 3X1SC 1P3LD 3O62D 4LD9D 2JCHA 3KXBC 5AVBC 1KX4D 3TU4B 2Y2GA 3AZJA 4YS3D 3V9RB 1JFIB 4CAYB 5AY8A 3B0CW 3R45A 5KDMA 5AVCC 5CPID 3W99D 5B1LC 4J8XB 1P3FA 5B40A 3MGRC 5BNXB 5B2IB 1ID3C 5B2JC 5B24C 3WTPA 3AZKC 5B1MD 5GXQC 3MGSA 3WKJD 2YFWA 3MGPB 4J8WB 3FDDA 3A6ND 4G92B 2NZDC 1U35C 5B31B 3MVDB 3C1BC 3AYWA 1M19C 2L5AA 3KFUG 1Z2CB 4KGCD 1P3GA 5AV6C 3LELC 1P3OD 2BYMA 4DRAA 4KUDA 3B6GC 3W98A 3KWQB 3AZFB 4AWLC 4NE6A 4WU8D 4KHAA 5BO0B 5BNVA 3EPHA 2BYKB 3C1CC 1M18D 3AV2B 1P3IB 3AZGD 2FJ7A 1P3MD 3UTBB 5AV9A 3AZMA 3W97B 1P3AD 5B33A 3X1TA 3VH5T 5B32G 5B0ZB 5G49B 5DNMA 4J8XD 1P3BC 1BFMA 5CPIA 3AFAD 4QLCB 3KUYA 3AZNC 4ZBJB 5GT3C 3LZ0A 3MNNB 5CPJA 1P34D 1KX3B 5JRGA 1AOIC 3AZEA 4EO5C 3REHD 5GSUA 3VH5A 2HIOC 4X23A 3AZLA 3AV1B 3AZHA 2DF4C 1M1AB 3REJC 3WA9A 5CP6A 1S32A 1P3KB 2AROA 2Y2PA 4KGCA 3AL0C 3AZID 3VH6W 4HGAC 2XD5A 5CHLB 3REKC 3RELB 3NQUB 4ZUXB 5AV5C 2RVQD 4H9QB 4WU9B 5F99B 3TU4A 2PYOC 2F8NG 2NQBC 5B32C 4Z66D 1F1EA 1KU5A 2W8SA 3V9RA 4R8PD 1JFIA 4CAYA 3X1SD 2HUEC 3W96C 3WAAC 3KXBD
chains in the Genus database with same CATH topology
5AVBD 1HQ3C 4J8XA 2ZY4A 3REIB 5BNXA 3LZ1B 5B2IA 3MGQC 2Y2NA 5GT0C 3MGPA 4J8WA 4J8UC 3AV1D 1P3PC 4J8VC 1TZYB 5AVCD 3UTAB 5B31A 3MVDA 1P3LB 3MGRD 3O62B 1ID3D 4LD9B 5B2JD 5B24D 3AZKD 3KWQA 3AZFA 4Z2MH 2CWEA 5GXQD 3B0DB 1KX4B 4H9PB 4E44A 5BO0A 1EQZC 2BYKA 3AV2A 4YS3B 1P3IA 1U35D 2NZDD 1M19D 3UTBA 3LELD 3W97A 3B6GD 3W99B 5B0ZA 1HTAA 5G49A 5C3IC 5AV8C 3REID 4QLCA 5B1MB 3WKJB 1Q9CA 1F66C 3MNNA 1KX3A 3A6NB 3IP4C 4Z5TC 1WWIA 1B67A 3UTAD 3AV1A 2JE5A 1P3OB 5DNNB 1P3BD 1M1AA 1P3KA 2CV5B 3B0CT 3AN2C 3AZND 4WU8B 5GT3D 1W2EA 1ZLAC 1M18B 3RELA 5FUGB 1AOID 3NQUA 4ZUXA 3AZGB 4UPKA 1N1JB 2HIOD 1P3MB 4H9QA 4WU9A 3X1UC 4JJNB 4XZQC 5F99A 1P3AB 3KSYA 3REJD 5E5AC 2G5HC 1H3OB 3B6FC 3X1VC 3AFAB 1TAFB 2G5IC 5AV5D 3REIA 4G91B 1P34B 4YM6C 3LZ1A 3UT9B 2PYOD 2NQBD 5B32D 5B0YB 3REHB 2LY8A 3W96D 1TZYA 3A1IA 5DNND 3UTAA 2IO5C 1KX5C 3AZIB 1HQ3D 2CV5D 1P3LA 3O62A 4WJ3C 2ZY5A 3MGQD 4LD9A 3F6TA 4XUJB 4NE3A 1KX4A 4H9PA 3LJAB 2F2AC 4J8UD 4J8VD 4JJND 2Y2QA 4Z66B 4YS3A 5BT1C 4R8PB 3AZJC 3X1SB 2Y2MA 5AY8C 3H0MC 3KXBB 5AVBB 3W99A 1EQZD 3VH6T 2F8ND 3A1KA 1P3FC 5B40C 3UT9D 5B1MA 3WKJA 3WTPC 5B0YD 2ZM5A 3MGSC 3A6NA 2BG1A 5AVCB 3VH6A 3AYWC 3MGRB 1P3OA 1ID3B 5DNNA 5B2JB 5AV8D 5B24B 1P3GC 3AZKB 5CPKC 2CV5A 4UUZB 5GXQB 4KUDC 2UWXA 4WU8A 3W98C 1F66D 2Y2JA 4XUJD 5BS7A 1M18A 3LJAD 5FUGA 2NZDB 1U35B 3AZGA 4Z5TD 1A7WA 3C1BB 1M19B 1N1JA 3H0LC 1P3MA 5AV6B 3LELB 4JJNA 2FJ7C 1P3AA 1BH9B 3B6GB 5AV9C 3AZMC 2RIQA 3AN2D 4AWLB 5B33C 1ZLAD 1H3OA 3C1CB 3X1TC 5DNMC 3AFAA 1TAFA 5CPIC 3KUYC 1P34A 3UT9A 3LZ0C 5B0YA 3WTPE 3REHA 5CPJC 5JRGC 3AZEC 5GSUC 5B1LD 4X23C 3AZLC 1P3BB 2Y2KA 3B6FD 3X1VD 3AZHC 3AZNB 3AZIA 5GT3B 1T3UA 5CP6C 1S32C 3WA9C 2AROC 4H9SA 4KGCC 4YM6D 5B31G 1AOIB 1R4VA 4EO5B 2HIOB 4XUJA 3C1BD 3LJAA 2ZY3A 5AV6D 3REJB 4Z66A 3TU4C 4R8PA 1KX5D 3REKB 4HGAB 3X1SA 4WZSB 3C1CD 5AV5B 3KXBA 5AVBA 4J8XC 2PYOB 2NQBB 5B32B 5B2IC 3AZJD 4E45A 2HUEB 3W96B 3MGPC 4J8WC 3WAAB 5AVCA 5AY8D 2Y2LA 5B1LA 1HQ3B 4G92C 5B31C 4H9NB 3MVDC 3MGRA 1ID3A 3MGQB 5B2JA 5B24A 5GT0B 1P3FD 3AZKA 4UUZA 5GXQA 3KWQC 4J8UB 3AZFC 3MGSD 1P3PB 4J8VB 2NZDA 1U35A 3C1BA 1M19A 3AV2C 1P3IC 5AV6A 3LELA 3REKD 3AYWD 1BH9A 1P3GD 3UTBC 3B6GA 3W97C 5CPKD 3P5JB 4KUDD 3W98D 1EQZB 2F8NB 3C1CA 2FFFB 4H9RB 5B0ZC 3H0RC 4Z2MG 4QLCC 4ZBJC 2FJ7D 3EPKA 4WNNB 5AV9D 3MNNC 3AZMD 1KX3C 3WAAD 5B33D 5C3IB 3X1TD 5AV8B 3AV1C 1P3BA 2Y2OA 3NQJB 5DNMD 5GT0D 3AZNA 1M1AC 5GT3A 1P3KC 1F66B 3KUYD 1WWSA 3B0BA 1AOIA 3LZ0D 5CPJD 4Z5TB 3RELC 1P3PD 2HIOA 5JRGD 4ZUXC 3AZED 2F8NH 5GSUD 4X23D 1B6WA 1BH8B 2YFVB 4DQYB 3AZLD 4WU9C 3REJA 2VQRA 5F99C 3AZHD 3AN2B 3WA9D 3REKA 5CP6D 1S32D 2AROD 1ZLAB 5JA4B 5CPKA 5AV5A 3X1UB 4XZQB 2PYOA 4NE5A 4H9OB 2DQNC 3REIC 2NQBA 5B32A 3TU4D 5E5AB 3LZ1C 5B1LB 3W96A 1ULYA 3B6FB 3WAAA 3X1VB 1HQ3A 1TZYC 3UTAC 4H9NA 4YM6B 3MGQA 1P3LC 5GT0A 3O62C 4NFTA 4CSRB 5B2ID 4LD9C 4J8UA 3B0DC 3MGPD 4J8WD 4J8VA 1P3PA 1KX4C 4DRBA 2IO5B 4M6BA 1KX5B 4YS3C 3VH5W 5B31D 3MVDD 3KWQD 3AZFD 1EQZA 2F8NA 3W99C 4H9RA 3X1UD 2J8PA 4XZQD 2XD1A 3AZJB 3AV2D 5E5AD 1P3ID 5B1MC 3WKJC 3UTBD 5AY8B 4WNNA 3W97D 3R45B 3A6NC 5KDMB 4WV4B 5AV8A 5B0ZD 1P3FB 5B40B 3NQJA 1P3OC 5DNNC 3WTPB 2CV5C 1F66A 4QLCD 3MGSB 4WU8C 2YFWB 5BS7C 3MNND 1M18C 4Z5TA 1KX3D 3EPLA 3AZGC 2JSSA 3AYWB 1P3MC 1BH8A 2YFVA 1P3GB 4JJNC 5CPKB 1P3AC 3AN2A 2BYMB 4KUDB 1M1AD 1PZRA 1P3KD 3W98B 1ZLAA 5JA4A 2F8NK 4KHAB 5BNVB 2ZY2A 3RELD 2Y2HA 4ZUXD 3AFAC 5BT1D 3X1UA 4XZQA 2Y2IA 2FJ7B 4H9OA 4WU9D 4G91C 5AV9B 3EPJA 5F99D 3AZMB 1P34C 5E5AA 3UT9C 5B33B 5B0YC 3REHC 3X1TB 3B6FA 5DNMB 3X1VA 5B40D 5CPIB 3KUYB 3WTPD 3AZIC 4YM6A 4H9SC 3LZ0B 5CPJB 4CSRA 3LZ1D 5JRGB 3AZEB 5GSUB 4X23B 2RVQC 4XUJC 3AZLB 3EG5B 3LJAC 3AZHB 1KX5A 3WA9B 5CP6B 1S32B 1TZYD 4Z66C 2AROB 4KGCB 4R8PC 3X1SC 1P3LD 3O62D 4LD9D 2JCHA 3KXBC 5AVBC 1KX4D 3TU4B 2Y2GA 3AZJA 4YS3D 3V9RB 1JFIB 4CAYB 5AY8A 3B0CW 3R45A 5KDMA 5AVCC 5CPID 3W99D 5B1LC 4J8XB 1P3FA 5B40A 3MGRC 5BNXB 5B2IB 1ID3C 5B2JC 5B24C 3WTPA 3AZKC 5B1MD 5GXQC 3MGSA 3WKJD 2YFWA 3MGPB 4J8WB 3FDDA 3A6ND 4G92B 2NZDC 1U35C 5B31B 3MVDB 3C1BC 3AYWA 1M19C 2L5AA 3KFUG 1Z2CB 4KGCD 1P3GA 5AV6C 3LELC 1P3OD 2BYMA 4DRAA 4KUDA 3B6GC 3W98A 3KWQB 3AZFB 4AWLC 4NE6A 4WU8D 4KHAA 5BO0B 5BNVA 3EPHA 2BYKB 3C1CC 1M18D 3AV2B 1P3IB 3AZGD 2FJ7A 1P3MD 3UTBB 5AV9A 3AZMA 3W97B 1P3AD 5B33A 3X1TA 3VH5T 5B32G 5B0ZB 5G49B 5DNMA 4J8XD 1P3BC 1BFMA 5CPIA 3AFAD 4QLCB 3KUYA 3AZNC 4ZBJB 5GT3C 3LZ0A 3MNNB 5CPJA 1P34D 1KX3B 5JRGA 1AOIC 3AZEA 4EO5C 3REHD 5GSUA 3VH5A 2HIOC 4X23A 3AZLA 3AV1B 3AZHA 2DF4C 1M1AB 3REJC 3WA9A 5CP6A 1S32A 1P3KB 2AROA 2Y2PA 4KGCA 3AL0C 3AZID 3VH6W 4HGAC 2XD5A 5CHLB 3REKC 3RELB 3NQUB 4ZUXB 5AV5C 2RVQD 4H9QB 4WU9B 5F99B 3TU4A 2PYOC 2F8NG 2NQBC 5B32C 4Z66D 1F1EA 1KU5A 2W8SA 3V9RA 4R8PD 1JFIA 4CAYA 3X1SD 2HUEC 3W96C 3WAAC 3KXBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVB D;  1HQ3 C;  4J8X A;  3REI B;  5BNX A;  3LZ1 B;  5B2I A;  3MGQ C;  5GT0 C;  3MGP A;  4J8W A;  4J8U C;  3AV1 D;  1P3P C;  4J8V C;  1TZY B;  5AVC D;  3UTA B;  5B31 A;  3MVD A;  1P3L B;  3MGR D;  3O62 B;  1ID3 D;  4LD9 B;  5B2J D;  5B24 D;  3AZK D;  3KWQ A;  3AZF A;  4Z2M H;  2CWE A;  5GXQ D;  3B0D B;  1KX4 B;  4H9P B;  4E44 A;  5BO0 A;  1EQZ C;  2BYK A;  3AV2 A;  4YS3 B;  1P3I A;  1U35 D;  2NZD D;  1M19 D;  3UTB A;  3LEL D;  3W97 A;  3B6G D;  3W99 B;  5B0Z A;  1HTA A;  5G49 A;  5C3I C;  5AV8 C;  3REI D;  4QLC A;  5B1M B;  3WKJ B;  1Q9C A;  1F66 C;  3MNN A;  1KX3 A;  3A6N B;  4Z5T C;  1WWI A;  1B67 A;  3UTA D;  3AV1 A;  1P3O B;  5DNN B;  1P3B D;  1M1A A;  1P3K A;  2CV5 B;  3B0C T;  3AN2 C;  3AZN D;  4WU8 B;  5GT3 D;  1ZLA C;  1M18 B;  3REL A;  5FUG B;  1AOI D;  3NQU A;  4ZUX A;  3AZG B;  1N1J B;  2HIO D;  1P3M B;  4H9Q A;  4WU9 A;  3X1U C;  4JJN B;  4XZQ C;  5F99 A;  1P3A B;  3KSY A;  3REJ D;  5E5A C;  1H3O B;  3B6F C;  3X1V C;  3AFA B;  1TAF B;  5AV5 D;  3REI A;  4G91 B;  1P34 B;  4YM6 C;  3LZ1 A;  3UT9 B;  2PYO D;  2NQB D;  5B0Y B;  5B32 D;  3REH B;  2LY8 A;  3W96 D;  1TZY A;  3UTA A;  5DNN D;  2IO5 C;  1KX5 C;  3AZI B;  1HQ3 D;  2CV5 D;  1P3L A;  3O62 A;  3MGQ D;  4LD9 A;  4XUJ B;  4NE3 A;  1KX4 A;  4H9P A;  3LJA B;  4J8U D;  4J8V D;  4JJN D;  4Z66 B;  4YS3 A;  5BT1 C;  4R8P B;  3AZJ C;  3X1S B;  5AY8 C;  3KXB B;  5AVB B;  3W99 A;  1EQZ D;  3VH6 T;  2F8N D;  1P3F C;  5B40 C;  3UT9 D;  5B1M A;  3WKJ A;  3WTP C;  5B0Y D;  3MGS C;  3A6N A;  5AVC B;  3VH6 A;  3AYW C;  3MGR B;  1P3O A;  1ID3 B;  5DNN A;  5B2J B;  5AV8 D;  5B24 B;  1P3G C;  3AZK B;  5CPK C;  2CV5 A;  4UUZ B;  5GXQ B;  4KUD C;  4WU8 A;  3W98 C;  1F66 D;  4XUJ D;  5BS7 A;  1M18 A;  3LJA D;  5FUG A;  2NZD B;  1U35 B;  3AZG A;  4Z5T D;  1A7W A;  3C1B B;  1M19 B;  1N1J A;  1P3M A;  5AV6 B;  3LEL B;  4JJN A;  2FJ7 C;  1P3A A;  1BH9 B;  3B6G B;  5AV9 C;  3AZM C;  3AN2 D;  4AWL B;  5B33 C;  1ZLA D;  1H3O A;  3C1C B;  3X1T C;  5DNM C;  3AFA A;  1TAF A;  5CPI C;  3KUY C;  1P34 A;  3UT9 A;  3LZ0 C;  5B0Y A;  3WTP E;  3REH A;  5CPJ C;  5JRG C;  3AZE C;  5GSU C;  5B1L D;  4X23 C;  3AZL C;  1P3B B;  3B6F D;  3X1V D;  3AZH C;  3AZN B;  3AZI A;  5GT3 B;  5CP6 C;  1S32 C;  3WA9 C;  2ARO C;  4H9S A;  4KGC C;  4YM6 D;  5B31 G;  1AOI B;  1R4V A;  4EO5 B;  2HIO B;  4XUJ A;  3C1B D;  3LJA A;  5AV6 D;  3REJ B;  4Z66 A;  3TU4 C;  4R8P A;  1KX5 D;  3REK B;  4HGA B;  3X1S A;  4WZS B;  3C1C D;  5AV5 B;  3KXB A;  5AVB A;  4J8X C;  2PYO B;  2NQB B;  5B32 B;  5B2I C;  3AZJ D;  4E45 A;  2HUE B;  3W96 B;  3MGP C;  4J8W C;  3WAA B;  5AVC A;  5AY8 D;  5B1L A;  1HQ3 B;  4G92 C;  5B31 C;  4H9N B;  3MVD C;  3MGR A;  1ID3 A;  3MGQ B;  5B2J A;  5B24 A;  5GT0 B;  1P3F D;  3AZK A;  4UUZ A;  5GXQ A;  3KWQ C;  4J8U B;  3AZF C;  3MGS D;  1P3P B;  4J8V B;  2NZD A;  1U35 A;  3C1B A;  1M19 A;  3AV2 C;  1P3I C;  5AV6 A;  3LEL A;  3REK D;  3AYW D;  1BH9 A;  1P3G D;  3UTB C;  3B6G A;  3W97 C;  5CPK D;  4KUD D;  3W98 D;  1EQZ B;  2F8N B;  3C1C A;  4H9R B;  5B0Z C;  4Z2M G;  4QLC C;  4ZBJ C;  2FJ7 D;  4WNN B;  5AV9 D;  3MNN C;  3AZM D;  1KX3 C;  3WAA D;  5B33 D;  5C3I B;  3X1T D;  5AV8 B;  3AV1 C;  1P3B A;  3NQJ B;  5DNM D;  5GT0 D;  3AZN A;  1M1A C;  5GT3 A;  1P3K C;  1F66 B;  3KUY D;  1WWS A;  3B0B A;  1AOI A;  3LZ0 D;  5CPJ D;  4Z5T B;  3REL C;  1P3P D;  2HIO A;  5JRG D;  4ZUX C;  3AZE D;  2F8N H;  5GSU D;  4X23 D;  1B6W A;  1BH8 B;  2YFV B;  3AZL D;  4WU9 C;  3REJ A;  5F99 C;  3AZH D;  3AN2 B;  3WA9 D;  3REK A;  5CP6 D;  1S32 D;  2ARO D;  1ZLA B;  5JA4 B;  5CPK A;  5AV5 A;  3X1U B;  4XZQ B;  2PYO A;  4NE5 A;  4H9O B;  3REI C;  2NQB A;  5B32 A;  3TU4 D;  5E5A B;  3LZ1 C;  5B1L B;  3W96 A;  1ULY A;  3B6F B;  3WAA A;  3X1V B;  1HQ3 A;  1TZY C;  3UTA C;  4H9N A;  4YM6 B;  3MGQ A;  1P3L C;  5GT0 A;  3O62 C;  4NFT A;  4CSR B;  5B2I D;  4LD9 C;  4J8U A;  3B0D C;  3MGP D;  4J8W D;  4J8V A;  1P3P A;  1KX4 C;  4DRB A;  2IO5 B;  4M6B A;  1KX5 B;  4YS3 C;  3VH5 W;  5B31 D;  3MVD D;  3KWQ D;  3AZF D;  1EQZ A;  2F8N A;  3W99 C;  4H9R A;  3X1U D;  4XZQ D;  3AZJ B;  3AV2 D;  5E5A D;  1P3I D;  5B1M C;  3WKJ C;  3UTB D;  5AY8 B;  4WNN A;  3W97 D;  3R45 B;  3A6N C;  5KDM B;  4WV4 B;  5AV8 A;  5B0Z D;  1P3F B;  5B40 B;  3NQJ A;  1P3O C;  5DNN C;  3WTP B;  2CV5 C;  1F66 A;  4QLC D;  3MGS B;  4WU8 C;  2YFW B;  5BS7 C;  3MNN D;  1M18 C;  4Z5T A;  1KX3 D;  3AZG C;  2JSS A;  3AYW B;  1P3M C;  1BH8 A;  2YFV A;  1P3G B;  4JJN C;  5CPK B;  1P3A C;  3AN2 A;  2BYM B;  4KUD B;  1M1A D;  3W98 B;  1P3K D;  1ZLA A;  5JA4 A;  2F8N K;  4KHA B;  5BNV B;  3REL D;  4ZUX D;  3AFA C;  5BT1 D;  3X1U A;  4XZQ A;  2FJ7 B;  4H9O A;  4WU9 D;  4G91 C;  5AV9 B;  3AZM B;  5F99 D;  1P34 C;  5E5A A;  3UT9 C;  5B33 B;  5B0Y C;  3REH C;  3X1T B;  3B6F A;  5DNM B;  3X1V A;  5B40 D;  5CPI B;  3KUY B;  3WTP D;  3AZI C;  4YM6 A;  4H9S C;  3LZ0 B;  5CPJ B;  4CSR A;  3LZ1 D;  5JRG B;  3AZE B;  5GSU B;  4X23 B;  2RVQ C;  4XUJ C;  3AZL B;  3LJA C;  3AZH B;  1KX5 A;  3WA9 B;  5CP6 B;  1S32 B;  1TZY D;  4Z66 C;  2ARO B;  4KGC B;  4R8P C;  3X1S C;  1P3L D;  3O62 D;  4LD9 D;  3KXB C;  5AVB C;  1KX4 D;  3TU4 B;  3AZJ A;  4YS3 D;  3V9R B;  1JFI B;  4CAY B;  5AY8 A;  3B0C W;  3R45 A;  5KDM A;  5AVC C;  5CPI D;  3W99 D;  5B1L C;  4J8X B;  1P3F A;  5B40 A;  3MGR C;  5BNX B;  5B2I B;  1ID3 C;  5B2J C;  5B24 C;  3WTP A;  3AZK C;  5B1M D;  5GXQ C;  3MGS A;  3WKJ D;  2YFW A;  3MGP B;  4J8W B;  3A6N D;  4G92 B;  2NZD C;  1U35 C;  5B31 B;  3MVD B;  3C1B C;  3AYW A;  1M19 C;  2L5A A;  4KGC D;  1P3G A;  5AV6 C;  3LEL C;  1P3O D;  2BYM A;  4DRA A;  4KUD A;  3B6G C;  3W98 A;  3KWQ B;  3AZF B;  4AWL C;  4NE6 A;  4WU8 D;  4KHA A;  5BO0 B;  5BNV A;  2BYK B;  3C1C C;  1M18 D;  3AV2 B;  1P3I B;  3AZG D;  2FJ7 A;  1P3M D;  3UTB B;  5AV9 A;  3AZM A;  3W97 B;  1P3A D;  5B33 A;  3X1T A;  3VH5 T;  5B32 G;  5B0Z B;  5G49 B;  5DNM A;  4J8X D;  1P3B C;  1BFM A;  5CPI A;  3AFA D;  4QLC B;  3KUY A;  3AZN C;  4ZBJ B;  5GT3 C;  3LZ0 A;  3MNN B;  5CPJ A;  1P34 D;  1KX3 B;  5JRG A;  1AOI C;  3AZE A;  4EO5 C;  3REH D;  5GSU A;  3VH5 A;  2HIO C;  4X23 A;  3AZL A;  3AV1 B;  3AZH A;  1M1A B;  3REJ C;  3WA9 A;  5CP6 A;  1S32 A;  1P3K B;  2ARO A;  4KGC A;  3AZI D;  3VH6 W;  4HGA C;  3REK C;  5CHL B;  3REL B;  3NQU B;  4ZUX B;  5AV5 C;  2RVQ D;  4H9Q B;  4WU9 B;  5F99 B;  3TU4 A;  2PYO C;  2F8N G;  2NQB C;  5B32 C;  4Z66 D;  1F1E A;  1KU5 A;  3V9R A;  4R8P D;  1JFI A;  4CAY A;  3X1S D;  2HUE C;  3W96 C;  3WAA C;  3KXB D; 
#chains in the Genus database with same CATH topology
 5AVB D;  1HQ3 C;  4J8X A;  2ZY4 A;  3REI B;  5BNX A;  3LZ1 B;  5B2I A;  3MGQ C;  2Y2N A;  5GT0 C;  3MGP A;  4J8W A;  4J8U C;  3AV1 D;  1P3P C;  4J8V C;  1TZY B;  5AVC D;  3UTA B;  5B31 A;  3MVD A;  1P3L B;  3MGR D;  3O62 B;  1ID3 D;  4LD9 B;  5B2J D;  5B24 D;  3AZK D;  3KWQ A;  3AZF A;  4Z2M H;  2CWE A;  5GXQ D;  3B0D B;  1KX4 B;  4H9P B;  4E44 A;  5BO0 A;  1EQZ C;  2BYK A;  3AV2 A;  4YS3 B;  1P3I A;  1U35 D;  2NZD D;  1M19 D;  3UTB A;  3LEL D;  3W97 A;  3B6G D;  3W99 B;  5B0Z A;  1HTA A;  5G49 A;  5C3I C;  5AV8 C;  3REI D;  4QLC A;  5B1M B;  3WKJ B;  1Q9C A;  1F66 C;  3MNN A;  1KX3 A;  3A6N B;  3IP4 C;  4Z5T C;  1WWI A;  1B67 A;  3UTA D;  3AV1 A;  2JE5 A;  1P3O B;  5DNN B;  1P3B D;  1M1A A;  1P3K A;  2CV5 B;  3B0C T;  3AN2 C;  3AZN D;  4WU8 B;  5GT3 D;  1W2E A;  1ZLA C;  1M18 B;  3REL A;  5FUG B;  1AOI D;  3NQU A;  4ZUX A;  3AZG B;  4UPK A;  1N1J B;  2HIO D;  1P3M B;  4H9Q A;  4WU9 A;  3X1U C;  4JJN B;  4XZQ C;  5F99 A;  1P3A B;  3KSY A;  3REJ D;  5E5A C;  2G5H C;  1H3O B;  3B6F C;  3X1V C;  3AFA B;  1TAF B;  2G5I C;  5AV5 D;  3REI A;  4G91 B;  1P34 B;  4YM6 C;  3LZ1 A;  3UT9 B;  2PYO D;  2NQB D;  5B32 D;  5B0Y B;  3REH B;  2LY8 A;  3W96 D;  1TZY A;  3A1I A;  5DNN D;  3UTA A;  2IO5 C;  1KX5 C;  3AZI B;  1HQ3 D;  2CV5 D;  1P3L A;  3O62 A;  4WJ3 C;  2ZY5 A;  3MGQ D;  4LD9 A;  3F6T A;  4XUJ B;  4NE3 A;  1KX4 A;  4H9P A;  3LJA B;  2F2A C;  4J8U D;  4J8V D;  4JJN D;  2Y2Q A;  4Z66 B;  4YS3 A;  5BT1 C;  4R8P B;  3AZJ C;  3X1S B;  2Y2M A;  5AY8 C;  3H0M C;  3KXB B;  5AVB B;  3W99 A;  1EQZ D;  3VH6 T;  2F8N D;  3A1K A;  1P3F C;  5B40 C;  3UT9 D;  5B1M A;  3WKJ A;  3WTP C;  5B0Y D;  2ZM5 A;  3MGS C;  3A6N A;  2BG1 A;  5AVC B;  3VH6 A;  3AYW C;  3MGR B;  1P3O A;  1ID3 B;  5DNN A;  5B2J B;  5AV8 D;  5B24 B;  1P3G C;  3AZK B;  5CPK C;  2CV5 A;  4UUZ B;  5GXQ B;  4KUD C;  2UWX A;  4WU8 A;  3W98 C;  1F66 D;  2Y2J A;  4XUJ D;  5BS7 A;  1M18 A;  3LJA D;  5FUG A;  2NZD B;  1U35 B;  3AZG A;  4Z5T D;  1A7W A;  3C1B B;  1M19 B;  1N1J A;  3H0L C;  1P3M A;  5AV6 B;  3LEL B;  4JJN A;  2FJ7 C;  1P3A A;  1BH9 B;  3B6G B;  5AV9 C;  3AZM C;  2RIQ A;  3AN2 D;  4AWL B;  5B33 C;  1ZLA D;  1H3O A;  3C1C B;  3X1T C;  5DNM C;  3AFA A;  1TAF A;  5CPI C;  3KUY C;  1P34 A;  3UT9 A;  3LZ0 C;  5B0Y A;  3WTP E;  3REH A;  5CPJ C;  5JRG C;  3AZE C;  5GSU C;  5B1L D;  4X23 C;  3AZL C;  1P3B B;  2Y2K A;  3B6F D;  3X1V D;  3AZH C;  3AZN B;  3AZI A;  5GT3 B;  1T3U A;  5CP6 C;  1S32 C;  3WA9 C;  2ARO C;  4H9S A;  4KGC C;  4YM6 D;  5B31 G;  1AOI B;  1R4V A;  4EO5 B;  2HIO B;  4XUJ A;  3C1B D;  3LJA A;  2ZY3 A;  5AV6 D;  3REJ B;  4Z66 A;  3TU4 C;  4R8P A;  1KX5 D;  3REK B;  4HGA B;  3X1S A;  4WZS B;  3C1C D;  5AV5 B;  3KXB A;  5AVB A;  4J8X C;  2PYO B;  2NQB B;  5B32 B;  5B2I C;  3AZJ D;  4E45 A;  2HUE B;  3W96 B;  3MGP C;  4J8W C;  3WAA B;  5AVC A;  5AY8 D;  2Y2L A;  5B1L A;  1HQ3 B;  4G92 C;  5B31 C;  4H9N B;  3MVD C;  3MGR A;  1ID3 A;  3MGQ B;  5B2J A;  5B24 A;  5GT0 B;  1P3F D;  3AZK A;  4UUZ A;  5GXQ A;  3KWQ C;  4J8U B;  3AZF C;  3MGS D;  1P3P B;  4J8V B;  2NZD A;  1U35 A;  3C1B A;  1M19 A;  3AV2 C;  1P3I C;  5AV6 A;  3LEL A;  3REK D;  3AYW D;  1BH9 A;  1P3G D;  3UTB C;  3B6G A;  3W97 C;  5CPK D;  3P5J B;  4KUD D;  3W98 D;  1EQZ B;  2F8N B;  3C1C A;  2FFF B;  4H9R B;  5B0Z C;  3H0R C;  4Z2M G;  4QLC C;  4ZBJ C;  2FJ7 D;  3EPK A;  4WNN B;  5AV9 D;  3MNN C;  3AZM D;  1KX3 C;  3WAA D;  5B33 D;  5C3I B;  3X1T D;  5AV8 B;  3AV1 C;  1P3B A;  2Y2O A;  3NQJ B;  5DNM D;  5GT0 D;  3AZN A;  1M1A C;  5GT3 A;  1P3K C;  1F66 B;  3KUY D;  1WWS A;  3B0B A;  1AOI A;  3LZ0 D;  5CPJ D;  4Z5T B;  3REL C;  1P3P D;  2HIO A;  5JRG D;  4ZUX C;  3AZE D;  2F8N H;  5GSU D;  4X23 D;  1B6W A;  1BH8 B;  2YFV B;  4DQY B;  3AZL D;  4WU9 C;  3REJ A;  2VQR A;  5F99 C;  3AZH D;  3AN2 B;  3WA9 D;  3REK A;  5CP6 D;  1S32 D;  2ARO D;  1ZLA B;  5JA4 B;  5CPK A;  5AV5 A;  3X1U B;  4XZQ B;  2PYO A;  4NE5 A;  4H9O B;  2DQN C;  3REI C;  2NQB A;  5B32 A;  3TU4 D;  5E5A B;  3LZ1 C;  5B1L B;  3W96 A;  1ULY A;  3B6F B;  3WAA A;  3X1V B;  1HQ3 A;  1TZY C;  3UTA C;  4H9N A;  4YM6 B;  3MGQ A;  1P3L C;  5GT0 A;  3O62 C;  4NFT A;  4CSR B;  5B2I D;  4LD9 C;  4J8U A;  3B0D C;  3MGP D;  4J8W D;  4J8V A;  1P3P A;  1KX4 C;  4DRB A;  2IO5 B;  4M6B A;  1KX5 B;  4YS3 C;  3VH5 W;  5B31 D;  3MVD D;  3KWQ D;  3AZF D;  1EQZ A;  2F8N A;  3W99 C;  4H9R A;  3X1U D;  2J8P A;  4XZQ D;  2XD1 A;  3AZJ B;  3AV2 D;  5E5A D;  1P3I D;  5B1M C;  3WKJ C;  3UTB D;  5AY8 B;  4WNN A;  3W97 D;  3R45 B;  3A6N C;  5KDM B;  4WV4 B;  5AV8 A;  5B0Z D;  1P3F B;  5B40 B;  3NQJ A;  1P3O C;  5DNN C;  3WTP B;  2CV5 C;  1F66 A;  4QLC D;  3MGS B;  4WU8 C;  2YFW B;  5BS7 C;  3MNN D;  1M18 C;  4Z5T A;  1KX3 D;  3EPL A;  3AZG C;  2JSS A;  3AYW B;  1P3M C;  1BH8 A;  2YFV A;  1P3G B;  4JJN C;  5CPK B;  1P3A C;  3AN2 A;  2BYM B;  4KUD B;  1M1A D;  1PZR A;  1P3K D;  3W98 B;  1ZLA A;  5JA4 A;  2F8N K;  4KHA B;  5BNV B;  2ZY2 A;  3REL D;  2Y2H A;  4ZUX D;  3AFA C;  5BT1 D;  3X1U A;  4XZQ A;  2Y2I A;  2FJ7 B;  4H9O A;  4WU9 D;  4G91 C;  5AV9 B;  3EPJ A;  5F99 D;  3AZM B;  1P34 C;  5E5A A;  3UT9 C;  5B33 B;  5B0Y C;  3REH C;  3X1T B;  3B6F A;  5DNM B;  3X1V A;  5B40 D;  5CPI B;  3KUY B;  3WTP D;  3AZI C;  4YM6 A;  4H9S C;  3LZ0 B;  5CPJ B;  4CSR A;  3LZ1 D;  5JRG B;  3AZE B;  5GSU B;  4X23 B;  2RVQ C;  4XUJ C;  3AZL B;  3EG5 B;  3LJA C;  3AZH B;  1KX5 A;  3WA9 B;  5CP6 B;  1S32 B;  1TZY D;  4Z66 C;  2ARO B;  4KGC B;  4R8P C;  3X1S C;  1P3L D;  3O62 D;  4LD9 D;  2JCH A;  3KXB C;  5AVB C;  1KX4 D;  3TU4 B;  2Y2G A;  3AZJ A;  4YS3 D;  3V9R B;  1JFI B;  4CAY B;  5AY8 A;  3B0C W;  3R45 A;  5KDM A;  5AVC C;  5CPI D;  3W99 D;  5B1L C;  4J8X B;  1P3F A;  5B40 A;  3MGR C;  5BNX B;  5B2I B;  1ID3 C;  5B2J C;  5B24 C;  3WTP A;  3AZK C;  5B1M D;  5GXQ C;  3MGS A;  3WKJ D;  2YFW A;  3MGP B;  4J8W B;  3FDD A;  3A6N D;  4G92 B;  2NZD C;  1U35 C;  5B31 B;  3MVD B;  3C1B C;  3AYW A;  1M19 C;  2L5A A;  3KFU G;  1Z2C B;  4KGC D;  1P3G A;  5AV6 C;  3LEL C;  1P3O D;  2BYM A;  4DRA A;  4KUD A;  3B6G C;  3W98 A;  3KWQ B;  3AZF B;  4AWL C;  4NE6 A;  4WU8 D;  4KHA A;  5BO0 B;  5BNV A;  3EPH A;  2BYK B;  3C1C C;  1M18 D;  3AV2 B;  1P3I B;  3AZG D;  2FJ7 A;  1P3M D;  3UTB B;  5AV9 A;  3AZM A;  3W97 B;  1P3A D;  5B33 A;  3X1T A;  3VH5 T;  5B32 G;  5B0Z B;  5G49 B;  5DNM A;  4J8X D;  1P3B C;  1BFM A;  5CPI A;  3AFA D;  4QLC B;  3KUY A;  3AZN C;  4ZBJ B;  5GT3 C;  3LZ0 A;  3MNN B;  5CPJ A;  1P34 D;  1KX3 B;  5JRG A;  1AOI C;  3AZE A;  4EO5 C;  3REH D;  5GSU A;  3VH5 A;  2HIO C;  4X23 A;  3AZL A;  3AV1 B;  3AZH A;  2DF4 C;  1M1A B;  3REJ C;  3WA9 A;  5CP6 A;  1S32 A;  1P3K B;  2ARO A;  2Y2P A;  4KGC A;  3AL0 C;  3AZI D;  3VH6 W;  4HGA C;  2XD5 A;  5CHL B;  3REK C;  3REL B;  3NQU B;  4ZUX B;  5AV5 C;  2RVQ D;  4H9Q B;  4WU9 B;  5F99 B;  3TU4 A;  2PYO C;  2F8N G;  2NQB C;  5B32 C;  4Z66 D;  1F1E A;  1KU5 A;  2W8S A;  3V9R A;  4R8P D;  1JFI A;  4CAY A;  3X1S D;  2HUE C;  3W96 C;  3WAA C;  3KXB D; 
#chains in the Genus database with same CATH homology
 5AVB D;  1HQ3 C;  4J8X A;  2ZY4 A;  3REI B;  5BNX A;  3LZ1 B;  5B2I A;  3MGQ C;  2Y2N A;  5GT0 C;  3MGP A;  4J8W A;  4J8U C;  3AV1 D;  1P3P C;  4J8V C;  1TZY B;  5AVC D;  3UTA B;  5B31 A;  3MVD A;  1P3L B;  3MGR D;  3O62 B;  1ID3 D;  4LD9 B;  5B2J D;  5B24 D;  3AZK D;  3KWQ A;  3AZF A;  4Z2M H;  2CWE A;  5GXQ D;  3B0D B;  1KX4 B;  4H9P B;  4E44 A;  5BO0 A;  1EQZ C;  2BYK A;  3AV2 A;  4YS3 B;  1P3I A;  1U35 D;  2NZD D;  1M19 D;  3UTB A;  3LEL D;  3W97 A;  3B6G D;  3W99 B;  5B0Z A;  1HTA A;  5G49 A;  5C3I C;  5AV8 C;  3REI D;  4QLC A;  5B1M B;  3WKJ B;  1Q9C A;  1F66 C;  3MNN A;  1KX3 A;  3A6N B;  3IP4 C;  4Z5T C;  1WWI A;  1B67 A;  3UTA D;  3AV1 A;  2JE5 A;  1P3O B;  5DNN B;  1P3B D;  1M1A A;  1P3K A;  2CV5 B;  3B0C T;  3AN2 C;  3AZN D;  4WU8 B;  5GT3 D;  1W2E A;  1ZLA C;  1M18 B;  3REL A;  5FUG B;  1AOI D;  3NQU A;  4ZUX A;  3AZG B;  4UPK A;  1N1J B;  2HIO D;  1P3M B;  4H9Q A;  4WU9 A;  3X1U C;  4JJN B;  4XZQ C;  5F99 A;  1P3A B;  3KSY A;  3REJ D;  5E5A C;  2G5H C;  1H3O B;  3B6F C;  3X1V C;  3AFA B;  1TAF B;  2G5I C;  5AV5 D;  3REI A;  4G91 B;  1P34 B;  4YM6 C;  3LZ1 A;  3UT9 B;  2PYO D;  2NQB D;  5B32 D;  5B0Y B;  3REH B;  2LY8 A;  3W96 D;  1TZY A;  3A1I A;  5DNN D;  3UTA A;  2IO5 C;  1KX5 C;  3AZI B;  1HQ3 D;  2CV5 D;  1P3L A;  3O62 A;  4WJ3 C;  2ZY5 A;  3MGQ D;  4LD9 A;  3F6T A;  4XUJ B;  4NE3 A;  1KX4 A;  4H9P A;  3LJA B;  2F2A C;  4J8U D;  4J8V D;  4JJN D;  2Y2Q A;  4Z66 B;  4YS3 A;  5BT1 C;  4R8P B;  3AZJ C;  3X1S B;  2Y2M A;  5AY8 C;  3H0M C;  3KXB B;  5AVB B;  3W99 A;  1EQZ D;  3VH6 T;  2F8N D;  3A1K A;  1P3F C;  5B40 C;  3UT9 D;  5B1M A;  3WKJ A;  3WTP C;  5B0Y D;  2ZM5 A;  3MGS C;  3A6N A;  2BG1 A;  5AVC B;  3VH6 A;  3AYW C;  3MGR B;  1P3O A;  1ID3 B;  5DNN A;  5B2J B;  5AV8 D;  5B24 B;  1P3G C;  3AZK B;  5CPK C;  2CV5 A;  4UUZ B;  5GXQ B;  4KUD C;  2UWX A;  4WU8 A;  3W98 C;  1F66 D;  2Y2J A;  4XUJ D;  5BS7 A;  1M18 A;  3LJA D;  5FUG A;  2NZD B;  1U35 B;  3AZG A;  4Z5T D;  1A7W A;  3C1B B;  1M19 B;  1N1J A;  3H0L C;  1P3M A;  5AV6 B;  3LEL B;  4JJN A;  2FJ7 C;  1P3A A;  1BH9 B;  3B6G B;  5AV9 C;  3AZM C;  2RIQ A;  3AN2 D;  4AWL B;  5B33 C;  1ZLA D;  1H3O A;  3C1C B;  3X1T C;  5DNM C;  3AFA A;  1TAF A;  5CPI C;  3KUY C;  1P34 A;  3UT9 A;  3LZ0 C;  5B0Y A;  3WTP E;  3REH A;  5CPJ C;  5JRG C;  3AZE C;  5GSU C;  5B1L D;  4X23 C;  3AZL C;  1P3B B;  2Y2K A;  3B6F D;  3X1V D;  3AZH C;  3AZN B;  3AZI A;  5GT3 B;  1T3U A;  5CP6 C;  1S32 C;  3WA9 C;  2ARO C;  4H9S A;  4KGC C;  4YM6 D;  5B31 G;  1AOI B;  1R4V A;  4EO5 B;  2HIO B;  4XUJ A;  3C1B D;  3LJA A;  2ZY3 A;  5AV6 D;  3REJ B;  4Z66 A;  3TU4 C;  4R8P A;  1KX5 D;  3REK B;  4HGA B;  3X1S A;  4WZS B;  3C1C D;  5AV5 B;  3KXB A;  5AVB A;  4J8X C;  2PYO B;  2NQB B;  5B32 B;  5B2I C;  3AZJ D;  4E45 A;  2HUE B;  3W96 B;  3MGP C;  4J8W C;  3WAA B;  5AVC A;  5AY8 D;  2Y2L A;  5B1L A;  1HQ3 B;  4G92 C;  5B31 C;  4H9N B;  3MVD C;  3MGR A;  1ID3 A;  3MGQ B;  5B2J A;  5B24 A;  5GT0 B;  1P3F D;  3AZK A;  4UUZ A;  5GXQ A;  3KWQ C;  4J8U B;  3AZF C;  3MGS D;  1P3P B;  4J8V B;  2NZD A;  1U35 A;  3C1B A;  1M19 A;  3AV2 C;  1P3I C;  5AV6 A;  3LEL A;  3REK D;  3AYW D;  1BH9 A;  1P3G D;  3UTB C;  3B6G A;  3W97 C;  5CPK D;  3P5J B;  4KUD D;  3W98 D;  1EQZ B;  2F8N B;  3C1C A;  2FFF B;  4H9R B;  5B0Z C;  3H0R C;  4Z2M G;  4QLC C;  4ZBJ C;  2FJ7 D;  3EPK A;  4WNN B;  5AV9 D;  3MNN C;  3AZM D;  1KX3 C;  3WAA D;  5B33 D;  5C3I B;  3X1T D;  5AV8 B;  3AV1 C;  1P3B A;  2Y2O A;  3NQJ B;  5DNM D;  5GT0 D;  3AZN A;  1M1A C;  5GT3 A;  1P3K C;  1F66 B;  3KUY D;  1WWS A;  3B0B A;  1AOI A;  3LZ0 D;  5CPJ D;  4Z5T B;  3REL C;  1P3P D;  2HIO A;  5JRG D;  4ZUX C;  3AZE D;  2F8N H;  5GSU D;  4X23 D;  1B6W A;  1BH8 B;  2YFV B;  4DQY B;  3AZL D;  4WU9 C;  3REJ A;  2VQR A;  5F99 C;  3AZH D;  3AN2 B;  3WA9 D;  3REK A;  5CP6 D;  1S32 D;  2ARO D;  1ZLA B;  5JA4 B;  5CPK A;  5AV5 A;  3X1U B;  4XZQ B;  2PYO A;  4NE5 A;  4H9O B;  2DQN C;  3REI C;  2NQB A;  5B32 A;  3TU4 D;  5E5A B;  3LZ1 C;  5B1L B;  3W96 A;  1ULY A;  3B6F B;  3WAA A;  3X1V B;  1HQ3 A;  1TZY C;  3UTA C;  4H9N A;  4YM6 B;  3MGQ A;  1P3L C;  5GT0 A;  3O62 C;  4NFT A;  4CSR B;  5B2I D;  4LD9 C;  4J8U A;  3B0D C;  3MGP D;  4J8W D;  4J8V A;  1P3P A;  1KX4 C;  4DRB A;  2IO5 B;  4M6B A;  1KX5 B;  4YS3 C;  3VH5 W;  5B31 D;  3MVD D;  3KWQ D;  3AZF D;  1EQZ A;  2F8N A;  3W99 C;  4H9R A;  3X1U D;  2J8P A;  4XZQ D;  2XD1 A;  3AZJ B;  3AV2 D;  5E5A D;  1P3I D;  5B1M C;  3WKJ C;  3UTB D;  5AY8 B;  4WNN A;  3W97 D;  3R45 B;  3A6N C;  5KDM B;  4WV4 B;  5AV8 A;  5B0Z D;  1P3F B;  5B40 B;  3NQJ A;  1P3O C;  5DNN C;  3WTP B;  2CV5 C;  1F66 A;  4QLC D;  3MGS B;  4WU8 C;  2YFW B;  5BS7 C;  3MNN D;  1M18 C;  4Z5T A;  1KX3 D;  3EPL A;  3AZG C;  2JSS A;  3AYW B;  1P3M C;  1BH8 A;  2YFV A;  1P3G B;  4JJN C;  5CPK B;  1P3A C;  3AN2 A;  2BYM B;  4KUD B;  1M1A D;  1PZR A;  1P3K D;  3W98 B;  1ZLA A;  5JA4 A;  2F8N K;  4KHA B;  5BNV B;  2ZY2 A;  3REL D;  2Y2H A;  4ZUX D;  3AFA C;  5BT1 D;  3X1U A;  4XZQ A;  2Y2I A;  2FJ7 B;  4H9O A;  4WU9 D;  4G91 C;  5AV9 B;  3EPJ A;  5F99 D;  3AZM B;  1P34 C;  5E5A A;  3UT9 C;  5B33 B;  5B0Y C;  3REH C;  3X1T B;  3B6F A;  5DNM B;  3X1V A;  5B40 D;  5CPI B;  3KUY B;  3WTP D;  3AZI C;  4YM6 A;  4H9S C;  3LZ0 B;  5CPJ B;  4CSR A;  3LZ1 D;  5JRG B;  3AZE B;  5GSU B;  4X23 B;  2RVQ C;  4XUJ C;  3AZL B;  3EG5 B;  3LJA C;  3AZH B;  1KX5 A;  3WA9 B;  5CP6 B;  1S32 B;  1TZY D;  4Z66 C;  2ARO B;  4KGC B;  4R8P C;  3X1S C;  1P3L D;  3O62 D;  4LD9 D;  2JCH A;  3KXB C;  5AVB C;  1KX4 D;  3TU4 B;  2Y2G A;  3AZJ A;  4YS3 D;  3V9R B;  1JFI B;  4CAY B;  5AY8 A;  3B0C W;  3R45 A;  5KDM A;  5AVC C;  5CPI D;  3W99 D;  5B1L C;  4J8X B;  1P3F A;  5B40 A;  3MGR C;  5BNX B;  5B2I B;  1ID3 C;  5B2J C;  5B24 C;  3WTP A;  3AZK C;  5B1M D;  5GXQ C;  3MGS A;  3WKJ D;  2YFW A;  3MGP B;  4J8W B;  3FDD A;  3A6N D;  4G92 B;  2NZD C;  1U35 C;  5B31 B;  3MVD B;  3C1B C;  3AYW A;  1M19 C;  2L5A A;  3KFU G;  1Z2C B;  4KGC D;  1P3G A;  5AV6 C;  3LEL C;  1P3O D;  2BYM A;  4DRA A;  4KUD A;  3B6G C;  3W98 A;  3KWQ B;  3AZF B;  4AWL C;  4NE6 A;  4WU8 D;  4KHA A;  5BO0 B;  5BNV A;  3EPH A;  2BYK B;  3C1C C;  1M18 D;  3AV2 B;  1P3I B;  3AZG D;  2FJ7 A;  1P3M D;  3UTB B;  5AV9 A;  3AZM A;  3W97 B;  1P3A D;  5B33 A;  3X1T A;  3VH5 T;  5B32 G;  5B0Z B;  5G49 B;  5DNM A;  4J8X D;  1P3B C;  1BFM A;  5CPI A;  3AFA D;  4QLC B;  3KUY A;  3AZN C;  4ZBJ B;  5GT3 C;  3LZ0 A;  3MNN B;  5CPJ A;  1P34 D;  1KX3 B;  5JRG A;  1AOI C;  3AZE A;  4EO5 C;  3REH D;  5GSU A;  3VH5 A;  2HIO C;  4X23 A;  3AZL A;  3AV1 B;  3AZH A;  2DF4 C;  1M1A B;  3REJ C;  3WA9 A;  5CP6 A;  1S32 A;  1P3K B;  2ARO A;  2Y2P A;  4KGC A;  3AL0 C;  3AZI D;  3VH6 W;  4HGA C;  2XD5 A;  5CHL B;  3REK C;  3REL B;  3NQU B;  4ZUX B;  5AV5 C;  2RVQ D;  4H9Q B;  4WU9 B;  5F99 B;  3TU4 A;  2PYO C;  2F8N G;  2NQB C;  5B32 C;  4Z66 D;  1F1E A;  1KU5 A;  2W8S A;  3V9R A;  4R8P D;  1JFI A;  4CAY A;  3X1S D;  2HUE C;  3W96 C;  3WAA C;  3KXB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...