5BNVA

Crystal structure of human mcm2 hbd chaperoning a histone h3-h4 tetramer
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
77
structure length
77
Chain Sequence
TELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/dna binding protein
molecule keywords Histone H3.3
publication title A unique binding mode enables MCM2 to chaperone histones H3-H4 at replication forks.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 77
sequence length 77
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5bnvA00
1ZLAB 1P34A 3X1SB 5BO0A 1P3PB 3W96C 5B0YC 3AYWA 5DNND 3AZEC 3WAAC 1P3BB 3W98C 3W99B 1M18A 2HUEC 3UT9A 1Q9CA 1EQZC 3WKJC 4KUDD 1P34B 5BO0B 3WTPA 2AROC 3TU4D 3AV1A 3AYWB 1KX5C 1BH8A 4J8VD 1HQ3C 3AV2C 3W97D 5B0ZA 2F8NH 2YFVA 1M18B 3O62A 1M1AD 4G92B 3UT9B 2F8NK 5GT3C 4J8UA 1KX3D 5AY8D 1M19A 3WTPB 3MNND 3AV1B 1BH8B 1P3MA 4LD9D 5B0ZB 2YFVB 3O62B 4R8PC 5B32C 3C1CC 4J8UB 5KDMA 3LJAC 1M19B 5CPKD 3X1UA 3KXBD 3X1TC 4HGAC 1P3MB 3LZ1C 1M1AC 3AZLD 4H9SC 4H9QA 3W96A 5GSUD 5KDMB 1KX3C 5AVCD 5AY8C 2IO5B 2LY8A 3WAAA 3X1UB 2F8NA 3NQJA 3MNNC 4LD9C 3WKJA 4NFTA 3B0DC 4YS3D 3LZ0A 1P3KC 4H9QB 3W96B 3A6NC 5GXQC 3WAAB 1ID3D 5CPKC 2F8NB 3B6FC 3NQJB 3AZHA 2HUEB 5BS7A 5GT3A 3WKJB 3REIA 1P3IC 1N1JA 1P3BD 3LZ0B 5B1LD 3AZLC 5GSUC 1KX4A 1AOIC 5DNNA 3AZHB 5B32G 4ZUXA 5F99C 1P34D 5GT3B 2NQBA 3REIB 4KUDA 1TZYD 1N1JB 1M18D 1KX4B 3TU4A 3W97A 5DNNB 4J8VA 1ID3C 4ZUXB 3X1SC 3WTPD 2NQBB 1P3PC 4KUDB 5AY8A 1P3BC 5AV9D 3MNNA 3LELD 3TU4B 4HGAB 4J8VB 4J8UD 3W97B 4LD9A 3AZFD 3REKD 3RELD 1P34C 4J8XD 4DRAA 1BFMA 5AY8B 3AZKD 3AYWC 1TZYC 3KXBA 1M18C 3MNNB 1A7WA 4G92C 3UT9C 1P3AD 4LD9B 5C3IB 3X1UD 3WTPC 3AZIA 3AZLA 1H3OA 3AV1C 5AVCA 5AVBD 3KXBB 2JSSA 3MGQD 4J8UC 3AZFC 1M19C 4E44A 4X23D 3WTPE 4EO5C 3RELC 4YS3A 3AZIB 3AZLB 4WU9D 1H3OB 4KGCD 5AVCB 5B31D 1ID3A 5BNVA 1P3FD 1P3AC 5B24D 3MGPA 4YS3B 3KWQA 3X1UC 5B1LA 3AZHD 2RVQD 5GT0D 1TAFA 3REID 1ID3B 5BNVB 3MGQC 1KX4D 5AV8D 3MGPB 4X23C 1TZYA 3WA9D 3KWQB 4H9OA 5B1LB 3VH6W 4ZUXD 1WWSA 2NQBD 2CV5A 1TAFB 3MVDA 5CHLB 3LZ0C 3REHD 5B24C 3MGSA 1TZYB 4H9OB 5AV5D 5AV9A 3AZHC 5BS7C 2RVQC 3LELA 2CV5B 5GT0C 3AZFA 3REIC 3MVDB 3REKA 3RELA 4NE5A 4H9RA 1KX4C 4J8XA 3AFAD 3MGSB 3AZKA 4XZQA 5DNNC 5CP6A 5AV9B 4ZUXC 3LELB 2L5AA 3VH5W 1P3AA 2NQBC 3AZFB 4KUDC 3REKB 4EO5B 3RELB 4H9RB 4J8XB 5B2IA 3TU4C 3AZKB 3AN2A 4XZQB 5AVBA 4J8VC 3W97C 5CP6B 5AV5C 1F66D 3MGQA 3AZID 1P3AB 4X23A 4ZBJB 2F8NG 4WU9A 5B2IB 1S32A 4KGCA 5B31A 5BNXA 3AN2B 5AVBB 2NZDD 4Z2MH 5C3IC 3MGQB 1P3FA 4QLCD 5B40D 5B24A 4X23B 4WU9B 3KXBC 1S32B 4KGCB 3R45A 5B31B 5BNXB 5GT0A 3MGPD 3KWQD 1P3FB 1F66C 3AZIC 5B24B 5AV8A 5AVCC 3WA9A 3R45B 3VH6T 5GT0B 2CWEA 4YS3C 5DNMA 3REHA 4QLCC 5B40C 5AV8B 2CV5D 4E45A 3WA9B 5AV5A 4Z2MG 3MVDD 3REJD 2FJ7D 3UTBA 3MGSD 3MGPC 4KHAA 3KWQC 4WZSB 5DNMB 5B1LC 5BT1D 1ULYA 3REHB 3AFAA 5FUGA 5AV5B 3AZMA 5E5AD 4WV4B 3VH5T 3UTBB 4XUJD 4XZQD 5CP6D 4KHAB 1P3LD 3AFAB 2CV5C 4CAYA 5FUGB 3MVDC 3REJC 3AZMB 1F66A 5B2ID 2FJ7C 5AV6A 3AN2D 3MGSC 2HIOD 5AV9C 4Z5TD 5B33D 3LELC 4CAYB 2NZDA 3REKC 1F66B 4QLCA 5B40A 1S32D 4J8XC 5AV6B 5CPIA 4Z66D 4XUJC 3AZKC 4XZQC 5CP6C 4JJND 1P3LC 3C1BD 4G91B 2BYKA 2NZDB 2PYOD 4ZBJC 1P3OD 4QLCB 5B40B 5B2IC 5CPIB 3AN2C 5JA4A 5AVBC 4YM6A 5B0YD 2BYKB 3AZED 3AZNA 4WU9C 1S32C 4KGCC 5B31C 5JA4B 4Z66C 1EQZD 5B2JA 4YM6B 1R4VA 3REJA 4JJNC 5DNMD 1P3FC 1KX5D 2FJ7A 1HQ3D 2PYOC 3AZGA 1P3OC 3AZNB 5JRGA 4J8WA 3B6GA 5B2JB 3UTBD 3REJB 4WU8A 5E5AA 1P3GA 2FJ7B 5AV8C 5CPJA 4XUJA 3AZGB 3WA9C 3X1VD 4UUZA 4R8PD 3AZMD 5B32D 1P3LA 5JRGB 3C1CD 1B67A 4J8WB 3B6GB 3LJAD 1WWIA 4WU8B 5E5AB 1P3GB 3X1TD 5DNMC 3REHC 1HTAA 5CPJB 4XUJB 3LZ1D 4UUZB 2HIOA 1P3LB 4Z5TA 4H9PA 3B0CW 5B33A 4AWLB 5AV6D 3UTBC 4WNNA 5B31G 3AFAC 4Z66A 3X1VC 2HIOB 1P3KD 3AZMC 4Z5TB 4H9PB 5B33B 4JJNA 3A6ND 3C1BA 5CPID 5GXQD 1KU5A 2PYOA 3B6FD 1P3OA 4WNNB 3NQUA 4DRBA 4Z66B 1P3ID 4JJNB 3C1BB 5B0YA 1AOID 5AV6C 3AZEA 2PYOB 3W98A 2YFWA 4YM6D 1P3OB 5F99D 3NQUB 3KSYA 4G91C 1EQZA 2NZDC 3KUYD 1U35D 1F1EA 2AROA 5B0YB 3UTAD 3AZND 1KX5A 5B1MD 3MGRD 3AV2A 1HQ3A 5CPIC 3AZEB 3W98B 5B2JD 2YFWB 3AZJD 1ZLAD 3X1SD 1P3PD 1EQZB 3AZGD 3W99D 2AROB 5JRGD 1KX5B 3AV2B 4J8WD 1HQ3B 3B6GD 3X1VA 4YM6C 4R8PA 4WU8D 5B32A 1JFIA 1P3GD 3C1CA 3LJAA 3AYWD 5CPJD 3KUYC 5G49A 1U35C 3X1TA 3UTAC 3AZNC 3UT9D 5B1MC 3MGRC 5B2JC 3LZ1A 3AZJC 3X1VB 4R8PB 1ZLAC 5B32B 1M1AA 1JFIB 4H9SA 3C1CB 3B0CT 3AV1D 3LJAB 1KX3A 5G49B 5B0ZD 3AZGC 3W99C 3O62D 3X1TB 5BT1C 5JRGC 4J8WC 3B6GC 3LZ1B 1M19D 4CSRA 3VH6A 1P3KA 1BH9A 4WU8C 1M1AB 5E5AC 1P3GC 3A6NA 3B0BA 1KX3B 1P3MD 5CPJC 5GXQA 5CPKA 3B6FA 4AWLC 1P3IA 4CSRB 1B6WA 1P3KB 1BH9B 3B0DB 5GSUA 3A6NB 1AOIA 5GXQB 5B0ZC 5CPKB 3B6FB 2HIOC 3O62C 5F99A 4Z5TC 5B33C 3W96D 3V9RA 2BYMA 1P3IB 3KUYA 4H9NA 1U35A 3WAAD 3W98D 2F8ND 5GSUB 3VH5A 3UTAA 1AOIB 5B1MA 3MGRA 1P3MC 3WKJD 4NE6A 3AZJA 5F99B 1ZLAA 3X1SA 3LZ0D 2AROD 3V9RB 3C1BC 1P3PA 2BYMB 4M6BA 3AV2D 3KUYB 2IO5C 4H9NB 1U35B 1P3BA 3W99A 3UTAB 5GT3D 5B1MB 3MGRB 3AZJB 4NE3A
chains in the Genus database with same CATH superfamily
1ZLAB 1P34A 3X1SB 5BO0A 1P3PB 3W96C 5B0YC 3AYWA 5DNND 3AZEC 3FDDA 3WAAC 1P3BB 3W98C 3W99B 1M18A 2HUEC 1T3UA 3UT9A 1Q9CA 1EQZC 3WKJC 4KUDD 1P34B 5BO0B 3WTPA 2AROC 3TU4D 3AV1A 3AYWB 1PZRA 1KX5C 1BH8A 4J8VD 1HQ3C 3AV2C 3W97D 5B0ZA 2F8NH 2YFVA 3IP4C 3O62A 1M18B 1M1AD 4G92B 3UT9B 2F8NK 5GT3C 4J8UA 1KX3D 5AY8D 1M19A 2J8PA 3WTPB 3MNND 3AV1B 1BH8B 1P3MA 4LD9D 5B0ZB 2YFVB 3O62B 4R8PC 5B32C 3C1CC 4J8UB 5KDMA 3LJAC 1M19B 5CPKD 3X1UA 3KXBD 3X1TC 4HGAC 1P3MB 3LZ1C 1M1AC 3AZLD 4H9SC 4H9QA 3W96A 5GSUD 5KDMB 1KX3C 5AVCD 5AY8C 4WJ3C 2IO5B 2LY8A 3WAAA 3X1UB 2F8NA 3NQJA 3MNNC 4LD9C 3WKJA 4NFTA 3B0DC 4YS3D 3LZ0A 1P3KC 4H9QB 3W96B 2RIQA 3A6NC 5GXQC 3WAAB 1ID3D 5CPKC 2F8NB 3B6FC 3NQJB 3AZHA 2HUEB 5BS7A 5GT3A 2Y2PA 3WKJB 3REIA 1P3IC 2Y2MA 1N1JA 1P3BD 3LZ0B 1W2EA 5B1LD 5GSUC 3AZLC 1KX4A 1AOIC 5DNNA 2ZY2A 3AZHB 5B32G 4ZUXA 5F99C 1P34D 5GT3B 2NQBA 3REIB 4KUDA 1TZYD 1N1JB 2DF4C 1M18D 1KX4B 3TU4A 3W97A 5DNNB 4J8VA 1ID3C 3EPLA 4ZUXB 3X1SC 3WTPD 2NQBB 1P3PC 4KUDB 5AY8A 1P3BC 5AV9D 3MNNA 3LELD 2Y2GA 3TU4B 4HGAB 4J8VB 4J8UD 3W97B 4LD9A 3AZFD 3REKD 3RELD 1P34C 4J8XD 4DRAA 1BFMA 5AY8B 3AZKD 3AYWC 1TZYC 3KXBA 1M18C 3MNNB 2XD1A 2Y2JA 1A7WA 4G92C 3UT9C 1P3AD 4LD9B 2Y2IA 5C3IB 3X1UD 3WTPC 3AZIA 3AZLA 1H3OA 3AV1C 5AVCA 5AVBD 3KXBB 2JSSA 3MGQD 4J8UC 3AZFC 1M19C 4E44A 4X23D 3WTPE 4EO5C 3RELC 4YS3A 3AZIB 3AZLB 4WU9D 1H3OB 4UPKA 4KGCD 5AVCB 5B31D 1ID3A 5BNVA 2Y2QA 1P3FD 2Y2OA 1P3AC 3EPKA 5B24D 3MGPA 4YS3B 3KWQA 3X1UC 5B1LA 3AZHD 2RVQD 5GT0D 1TAFA 3REID 1ID3B 5BNVB 3MGQC 1KX4D 5AV8D 3MGPB 4X23C 1TZYA 3WA9D 3KWQB 4H9OA 5B1LB 3VH6W 4ZUXD 1WWSA 2NQBD 2CV5A 1TAFB 3MVDA 5CHLB 3LZ0C 3REHD 5B24C 3MGSA 1TZYB 3AL0C 4H9OB 5AV5D 5AV9A 3AZHC 5BS7C 2RVQC 3LELA 2CV5B 5GT0C 3AZFA 3REIC 3MVDB 3REKA 3RELA 4NE5A 4H9RA 1KX4C 4J8XA 3AFAD 3MGSB 3AZKA 4XZQA 5DNNC 5CP6A 5AV9B 4ZUXC 3LELB 2L5AA 3VH5W 1P3AA 2NQBC 3AZFB 4KUDC 3REKB 4EO5B 3RELB 4H9RB 4J8XB 5B2IA 3TU4C 3AZKB 3AN2A 4XZQB 5AVBA 4J8VC 3W97C 5CP6B 5AV5C 3EG5B 2JE5A 1F66D 3MGQA 3AZID 1P3AB 4X23A 3H0RC 4ZBJB 2F8NG 4WU9A 5B2IB 1S32A 4KGCA 5B31A 5BNXA 3AN2B 5AVBB 2NZDD 4Z2MH 5C3IC 3MGQB 1P3FA 4QLCD 5B40D 5B24A 4X23B 4WU9B 3KXBC 2BG1A 1S32B 2UWXA 3R45A 4KGCB 5B31B 5BNXB 5GT0A 3MGPD 3KWQD 1P3FB 1F66C 3AZIC 5B24B 5AV8A 5AVCC 3WA9A 3R45B 3VH6T 5GT0B 2CWEA 3KFUG 4YS3C 5DNMA 3REHA 4QLCC 5B40C 5AV8B 4DQYB 2CV5D 4E45A 3WA9B 5AV5A 4Z2MG 3MVDD 3REJD 2Y2HA 2FJ7D 3UTBA 3MGSD 3MGPC 4KHAA 3KWQC 4WZSB 5DNMB 5B1LC 5BT1D 1ULYA 3REHB 3AFAA 5FUGA 5AV5B 3AZMA 5E5AD 2G5HC 4WV4B 3VH5T 3UTBB 4XUJD 4XZQD 5CP6D 4KHAB 1P3LD 3AFAB 2CV5C 4CAYA 5FUGB 3MVDC 3REJC 3AZMB 1F66A 5B2ID 2FJ7C 5AV6A 3AN2D 3MGSC 2HIOD 5AV9C 4Z5TD 5B33D 3LELC 4CAYB 2NZDA 3REKC 1F66B 4QLCA 5B40A 1S32D 4J8XC 5AV6B 5CPIA 4XUJC 4Z66D 3AZKC 4XZQC 5CP6C 4JJND 1P3LC 3C1BD 4G91B 2BYKA 2NZDB 2ZY4A 2PYOD 3P5JB 2ZY5A 4ZBJC 1P3OD 4QLCB 5B40B 5B2IC 5CPIB 3AN2C 5JA4A 5AVBC 4YM6A 5B0YD 2BYKB 3AZED 3AZNA 4WU9C 1S32C 4KGCC 3H0MC 5B31C 3EPHA 5JA4B 4Z66C 2ZY3A 5B2JA 1EQZD 4YM6B 1R4VA 3REJA 4JJNC 5DNMD 1P3FC 2W8SA 1KX5D 2FJ7A 1HQ3D 2PYOC 3AZGA 1P3OC 3AZNB 5JRGA 4J8WA 3B6GA 5B2JB 3UTBD 3REJB 4WU8A 5E5AA 1P3GA 2FJ7B 5AV8C 5CPJA 4XUJA 3AZGB 3WA9C 3X1VD 4UUZA 4R8PD 3AZMD 5B32D 1P3LA 5JRGB 3C1CD 1B67A 4J8WB 3B6GB 3LJAD 1WWIA 4WU8B 5E5AB 1P3GB 3X1TD 5DNMC 3REHC 1HTAA 5CPJB 4XUJB 3LZ1D 4UUZB 2HIOA 1P3LB 4Z5TA 4H9PA 3B0CW 5B33A 3H0LC 4AWLB 3EPJA 5AV6D 3UTBC 2F2AC 3A1IA 2VQRA 4WNNA 5B31G 3AFAC 2Y2LA 4Z66A 3X1VC 2HIOB 1P3KD 3AZMC 4Z5TB 4H9PB 5B33B 4JJNA 3A6ND 3C1BA 5CPID 5GXQD 1KU5A 2PYOA 3B6FD 1P3OA 4WNNB 3F6TA 3NQUA 4DRBA 4Z66B 1P3ID 4JJNB 3C1BB 5B0YA 1AOID 5AV6C 3AZEA 2PYOB 3W98A 2YFWA 4YM6D 1P3OB 5F99D 3NQUB 3KSYA 4G91C 1EQZA 1Z2CB 3KUYD 2NZDC 1U35D 1F1EA 2AROA 5B0YB 3UTAD 3AZND 1KX5A 5B1MD 3MGRD 3AV2A 1HQ3A 5CPIC 3AZEB 3W98B 5B2JD 2YFWB 3AZJD 1ZLAD 2G5IC 3X1SD 1P3PD 1EQZB 3AZGD 3W99D 2AROB 5JRGD 1KX5B 2JCHA 3AV2B 4J8WD 1HQ3B 3B6GD 3X1VA 4YM6C 4R8PA 4WU8D 5B32A 1JFIA 1P3GD 3C1CA 3LJAA 3AYWD 5CPJD 3KUYC 5G49A 1U35C 3X1TA 3UTAC 3AZNC 3UT9D 5B1MC 3MGRC 5B2JC 3LZ1A 3AZJC 3X1VB 4R8PB 2FFFB 1ZLAC 5B32B 1M1AA 1JFIB 4H9SA 3C1CB 3B0CT 3AV1D 3LJAB 1KX3A 5G49B 5B0ZD 2DQNC 3AZGC 3W99C 3O62D 3X1TB 5BT1C 5JRGC 2XD5A 4J8WC 3B6GC 3LZ1B 1M19D 4CSRA 3VH6A 1P3KA 1BH9A 4WU8C 1M1AB 5E5AC 1P3GC 3A6NA 3B0BA 1KX3B 1P3MD 5CPJC 5GXQA 5CPKA 3B6FA 4AWLC 1P3IA 4CSRB 1B6WA 1P3KB 1BH9B 3B0DB 5GSUA 3A6NB 1AOIA 2Y2KA 5GXQB 5B0ZC 5CPKB 3B6FB 2HIOC 3O62C 5F99A 4Z5TC 5B33C 3W96D 2Y2NA 3V9RA 2BYMA 1P3IB 3KUYA 4H9NA 1U35A 3WAAD 3W98D 2F8ND 5GSUB 3VH5A 3UTAA 3A1KA 1AOIB 5B1MA 3MGRA 1P3MC 3WKJD 4NE6A 3AZJA 5F99B 1ZLAA 3X1SA 3LZ0D 2AROD 3V9RB 3C1BC 1P3PA 2BYMB 4M6BA 3AV2D 3KUYB 2IO5C 4H9NB 1U35B 1P3BA 3W99A 3UTAB 5GT3D 5B1MB 3MGRB 2ZM5A 3AZJB 4NE3A
chains in the Genus database with same CATH topology
1ZLAB 1P34A 3X1SB 5BO0A 1P3PB 3W96C 5B0YC 3AYWA 5DNND 3AZEC 3FDDA 3WAAC 1P3BB 3W98C 3W99B 1M18A 2HUEC 1T3UA 3UT9A 1Q9CA 1EQZC 3WKJC 4KUDD 1P34B 5BO0B 3WTPA 2AROC 3TU4D 3AV1A 3AYWB 1PZRA 1KX5C 1BH8A 4J8VD 1HQ3C 3AV2C 3W97D 5B0ZA 2F8NH 2YFVA 3IP4C 3O62A 1M18B 1M1AD 4G92B 3UT9B 2F8NK 5GT3C 4J8UA 1KX3D 5AY8D 1M19A 2J8PA 3WTPB 3MNND 3AV1B 1BH8B 1P3MA 4LD9D 5B0ZB 2YFVB 3O62B 4R8PC 5B32C 3C1CC 4J8UB 5KDMA 3LJAC 1M19B 5CPKD 3X1UA 3KXBD 3X1TC 4HGAC 1P3MB 3LZ1C 1M1AC 3AZLD 4H9SC 4H9QA 3W96A 5GSUD 5KDMB 1KX3C 5AVCD 5AY8C 4WJ3C 2IO5B 2LY8A 3WAAA 3X1UB 2F8NA 3NQJA 3MNNC 4LD9C 3WKJA 4NFTA 3B0DC 4YS3D 3LZ0A 1P3KC 4H9QB 3W96B 2RIQA 3A6NC 5GXQC 3WAAB 1ID3D 5CPKC 2F8NB 3B6FC 3NQJB 3AZHA 2HUEB 5BS7A 5GT3A 2Y2PA 3WKJB 3REIA 1P3IC 2Y2MA 1N1JA 1P3BD 3LZ0B 1W2EA 5B1LD 5GSUC 3AZLC 1KX4A 1AOIC 5DNNA 2ZY2A 3AZHB 5B32G 4ZUXA 5F99C 1P34D 5GT3B 2NQBA 3REIB 4KUDA 1TZYD 1N1JB 2DF4C 1M18D 1KX4B 3TU4A 3W97A 5DNNB 4J8VA 1ID3C 3EPLA 4ZUXB 3X1SC 3WTPD 2NQBB 1P3PC 4KUDB 5AY8A 1P3BC 5AV9D 3MNNA 3LELD 2Y2GA 3TU4B 4HGAB 4J8VB 4J8UD 3W97B 4LD9A 3AZFD 3REKD 3RELD 1P34C 4J8XD 4DRAA 1BFMA 5AY8B 3AZKD 3AYWC 1TZYC 3KXBA 1M18C 3MNNB 2XD1A 2Y2JA 1A7WA 4G92C 3UT9C 1P3AD 4LD9B 2Y2IA 5C3IB 3X1UD 3WTPC 3AZIA 3AZLA 1H3OA 3AV1C 5AVCA 5AVBD 3KXBB 2JSSA 3MGQD 4J8UC 3AZFC 1M19C 4E44A 4X23D 3WTPE 4EO5C 3RELC 4YS3A 3AZIB 3AZLB 4WU9D 1H3OB 4UPKA 4KGCD 5AVCB 5B31D 1ID3A 5BNVA 2Y2QA 1P3FD 2Y2OA 1P3AC 3EPKA 5B24D 3MGPA 4YS3B 3KWQA 3X1UC 5B1LA 3AZHD 2RVQD 5GT0D 1TAFA 3REID 1ID3B 5BNVB 3MGQC 1KX4D 5AV8D 3MGPB 4X23C 1TZYA 3WA9D 3KWQB 4H9OA 5B1LB 3VH6W 4ZUXD 1WWSA 2NQBD 2CV5A 1TAFB 3MVDA 5CHLB 3LZ0C 3REHD 5B24C 3MGSA 1TZYB 3AL0C 4H9OB 5AV5D 5AV9A 3AZHC 5BS7C 2RVQC 3LELA 2CV5B 5GT0C 3AZFA 3REIC 3MVDB 3REKA 3RELA 4NE5A 4H9RA 1KX4C 4J8XA 3AFAD 3MGSB 3AZKA 4XZQA 5DNNC 5CP6A 5AV9B 4ZUXC 3LELB 2L5AA 3VH5W 1P3AA 2NQBC 3AZFB 4KUDC 3REKB 4EO5B 3RELB 4H9RB 4J8XB 5B2IA 3TU4C 3AZKB 3AN2A 4XZQB 5AVBA 4J8VC 3W97C 5CP6B 5AV5C 3EG5B 2JE5A 1F66D 3MGQA 3AZID 1P3AB 4X23A 3H0RC 4ZBJB 2F8NG 4WU9A 5B2IB 1S32A 4KGCA 5B31A 5BNXA 3AN2B 5AVBB 2NZDD 4Z2MH 5C3IC 3MGQB 1P3FA 4QLCD 5B40D 5B24A 4X23B 4WU9B 3KXBC 2BG1A 1S32B 2UWXA 3R45A 4KGCB 5B31B 5BNXB 5GT0A 3MGPD 3KWQD 1P3FB 1F66C 3AZIC 5B24B 5AV8A 5AVCC 3WA9A 3R45B 3VH6T 5GT0B 2CWEA 3KFUG 4YS3C 5DNMA 3REHA 4QLCC 5B40C 5AV8B 4DQYB 2CV5D 4E45A 3WA9B 5AV5A 4Z2MG 3MVDD 3REJD 2Y2HA 2FJ7D 3UTBA 3MGSD 3MGPC 4KHAA 3KWQC 4WZSB 5DNMB 5B1LC 5BT1D 1ULYA 3REHB 3AFAA 5FUGA 5AV5B 3AZMA 5E5AD 2G5HC 4WV4B 3VH5T 3UTBB 4XUJD 4XZQD 5CP6D 4KHAB 1P3LD 3AFAB 2CV5C 4CAYA 5FUGB 3MVDC 3REJC 3AZMB 1F66A 5B2ID 2FJ7C 5AV6A 3AN2D 3MGSC 2HIOD 5AV9C 4Z5TD 5B33D 3LELC 4CAYB 2NZDA 3REKC 1F66B 4QLCA 5B40A 1S32D 4J8XC 5AV6B 5CPIA 4XUJC 4Z66D 3AZKC 4XZQC 5CP6C 4JJND 1P3LC 3C1BD 4G91B 2BYKA 2NZDB 2ZY4A 2PYOD 3P5JB 2ZY5A 4ZBJC 1P3OD 4QLCB 5B40B 5B2IC 5CPIB 3AN2C 5JA4A 5AVBC 4YM6A 5B0YD 2BYKB 3AZED 3AZNA 4WU9C 1S32C 4KGCC 3H0MC 5B31C 3EPHA 5JA4B 4Z66C 2ZY3A 5B2JA 1EQZD 4YM6B 1R4VA 3REJA 4JJNC 5DNMD 1P3FC 2W8SA 1KX5D 2FJ7A 1HQ3D 2PYOC 3AZGA 1P3OC 3AZNB 5JRGA 4J8WA 3B6GA 5B2JB 3UTBD 3REJB 4WU8A 5E5AA 1P3GA 2FJ7B 5AV8C 5CPJA 4XUJA 3AZGB 3WA9C 3X1VD 4UUZA 4R8PD 3AZMD 5B32D 1P3LA 5JRGB 3C1CD 1B67A 4J8WB 3B6GB 3LJAD 1WWIA 4WU8B 5E5AB 1P3GB 3X1TD 5DNMC 3REHC 1HTAA 5CPJB 4XUJB 3LZ1D 4UUZB 2HIOA 1P3LB 4Z5TA 4H9PA 3B0CW 5B33A 3H0LC 4AWLB 3EPJA 5AV6D 3UTBC 2F2AC 3A1IA 2VQRA 4WNNA 5B31G 3AFAC 2Y2LA 4Z66A 3X1VC 2HIOB 1P3KD 3AZMC 4Z5TB 4H9PB 5B33B 4JJNA 3A6ND 3C1BA 5CPID 5GXQD 1KU5A 2PYOA 3B6FD 1P3OA 4WNNB 3F6TA 3NQUA 4DRBA 4Z66B 1P3ID 4JJNB 3C1BB 5B0YA 1AOID 5AV6C 3AZEA 2PYOB 3W98A 2YFWA 4YM6D 1P3OB 5F99D 3NQUB 3KSYA 4G91C 1EQZA 1Z2CB 3KUYD 2NZDC 1U35D 1F1EA 2AROA 5B0YB 3UTAD 3AZND 1KX5A 5B1MD 3MGRD 3AV2A 1HQ3A 5CPIC 3AZEB 3W98B 5B2JD 2YFWB 3AZJD 1ZLAD 2G5IC 3X1SD 1P3PD 1EQZB 3AZGD 3W99D 2AROB 5JRGD 1KX5B 2JCHA 3AV2B 4J8WD 1HQ3B 3B6GD 3X1VA 4YM6C 4R8PA 4WU8D 5B32A 1JFIA 1P3GD 3C1CA 3LJAA 3AYWD 5CPJD 3KUYC 5G49A 1U35C 3X1TA 3UTAC 3AZNC 3UT9D 5B1MC 3MGRC 5B2JC 3LZ1A 3AZJC 3X1VB 4R8PB 2FFFB 1ZLAC 5B32B 1M1AA 1JFIB 4H9SA 3C1CB 3B0CT 3AV1D 3LJAB 1KX3A 5G49B 5B0ZD 2DQNC 3AZGC 3W99C 3O62D 3X1TB 5BT1C 5JRGC 2XD5A 4J8WC 3B6GC 3LZ1B 1M19D 4CSRA 3VH6A 1P3KA 1BH9A 4WU8C 1M1AB 5E5AC 1P3GC 3A6NA 3B0BA 1KX3B 1P3MD 5CPJC 5GXQA 5CPKA 3B6FA 4AWLC 1P3IA 4CSRB 1B6WA 1P3KB 1BH9B 3B0DB 5GSUA 3A6NB 1AOIA 2Y2KA 5GXQB 5B0ZC 5CPKB 3B6FB 2HIOC 3O62C 5F99A 4Z5TC 5B33C 3W96D 2Y2NA 3V9RA 2BYMA 1P3IB 3KUYA 4H9NA 1U35A 3WAAD 3W98D 2F8ND 5GSUB 3VH5A 3UTAA 3A1KA 1AOIB 5B1MA 3MGRA 1P3MC 3WKJD 4NE6A 3AZJA 5F99B 1ZLAA 3X1SA 3LZ0D 2AROD 3V9RB 3C1BC 1P3PA 2BYMB 4M6BA 3AV2D 3KUYB 2IO5C 4H9NB 1U35B 1P3BA 3W99A 3UTAB 5GT3D 5B1MB 3MGRB 2ZM5A 3AZJB 4NE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZLA B;  1P34 A;  3X1S B;  5BO0 A;  1P3P B;  3W96 C;  5B0Y C;  3AYW A;  5DNN D;  3AZE C;  3WAA C;  1P3B B;  3W98 C;  3W99 B;  1M18 A;  2HUE C;  3UT9 A;  1Q9C A;  1EQZ C;  3WKJ C;  4KUD D;  1P34 B;  5BO0 B;  3WTP A;  2ARO C;  3TU4 D;  3AV1 A;  3AYW B;  1KX5 C;  1BH8 A;  4J8V D;  1HQ3 C;  3AV2 C;  3W97 D;  5B0Z A;  2F8N H;  2YFV A;  1M18 B;  3O62 A;  1M1A D;  4G92 B;  3UT9 B;  2F8N K;  5GT3 C;  4J8U A;  1KX3 D;  5AY8 D;  1M19 A;  3WTP B;  3MNN D;  3AV1 B;  1BH8 B;  1P3M A;  4LD9 D;  5B0Z B;  2YFV B;  3O62 B;  4R8P C;  5B32 C;  3C1C C;  4J8U B;  5KDM A;  3LJA C;  1M19 B;  5CPK D;  3X1U A;  3KXB D;  3X1T C;  4HGA C;  1P3M B;  3LZ1 C;  1M1A C;  3AZL D;  4H9S C;  4H9Q A;  3W96 A;  5GSU D;  5KDM B;  1KX3 C;  5AVC D;  5AY8 C;  2IO5 B;  2LY8 A;  3WAA A;  3X1U B;  2F8N A;  3NQJ A;  3MNN C;  4LD9 C;  3WKJ A;  4NFT A;  3B0D C;  4YS3 D;  3LZ0 A;  1P3K C;  4H9Q B;  3W96 B;  3A6N C;  5GXQ C;  3WAA B;  1ID3 D;  5CPK C;  2F8N B;  3B6F C;  3NQJ B;  3AZH A;  2HUE B;  5BS7 A;  5GT3 A;  3WKJ B;  3REI A;  1P3I C;  1N1J A;  1P3B D;  3LZ0 B;  5B1L D;  3AZL C;  5GSU C;  1KX4 A;  1AOI C;  5DNN A;  3AZH B;  5B32 G;  4ZUX A;  5F99 C;  1P34 D;  5GT3 B;  2NQB A;  3REI B;  4KUD A;  1TZY D;  1N1J B;  1M18 D;  1KX4 B;  3TU4 A;  3W97 A;  5DNN B;  4J8V A;  1ID3 C;  4ZUX B;  3X1S C;  3WTP D;  2NQB B;  1P3P C;  4KUD B;  5AY8 A;  1P3B C;  5AV9 D;  3MNN A;  3LEL D;  3TU4 B;  4HGA B;  4J8V B;  4J8U D;  3W97 B;  4LD9 A;  3AZF D;  3REK D;  3REL D;  1P34 C;  4J8X D;  4DRA A;  1BFM A;  5AY8 B;  3AZK D;  3AYW C;  1TZY C;  3KXB A;  1M18 C;  3MNN B;  1A7W A;  4G92 C;  3UT9 C;  1P3A D;  4LD9 B;  5C3I B;  3X1U D;  3WTP C;  3AZI A;  3AZL A;  1H3O A;  3AV1 C;  5AVC A;  5AVB D;  3KXB B;  2JSS A;  3MGQ D;  4J8U C;  3AZF C;  1M19 C;  4E44 A;  4X23 D;  3WTP E;  4EO5 C;  3REL C;  4YS3 A;  3AZI B;  3AZL B;  4WU9 D;  1H3O B;  4KGC D;  5AVC B;  5B31 D;  1ID3 A;  5BNV A;  1P3F D;  1P3A C;  5B24 D;  3MGP A;  4YS3 B;  3KWQ A;  3X1U C;  5B1L A;  3AZH D;  2RVQ D;  5GT0 D;  1TAF A;  3REI D;  1ID3 B;  5BNV B;  3MGQ C;  1KX4 D;  5AV8 D;  3MGP B;  4X23 C;  1TZY A;  3WA9 D;  3KWQ B;  4H9O A;  5B1L B;  3VH6 W;  4ZUX D;  1WWS A;  2NQB D;  2CV5 A;  1TAF B;  3MVD A;  5CHL B;  3LZ0 C;  3REH D;  5B24 C;  3MGS A;  1TZY B;  4H9O B;  5AV5 D;  5AV9 A;  3AZH C;  5BS7 C;  2RVQ C;  3LEL A;  2CV5 B;  5GT0 C;  3AZF A;  3REI C;  3MVD B;  3REK A;  3REL A;  4NE5 A;  4H9R A;  1KX4 C;  4J8X A;  3AFA D;  3MGS B;  3AZK A;  4XZQ A;  5DNN C;  5CP6 A;  5AV9 B;  4ZUX C;  3LEL B;  2L5A A;  3VH5 W;  1P3A A;  2NQB C;  3AZF B;  4KUD C;  3REK B;  4EO5 B;  3REL B;  4H9R B;  4J8X B;  5B2I A;  3TU4 C;  3AZK B;  3AN2 A;  4XZQ B;  5AVB A;  4J8V C;  3W97 C;  5CP6 B;  5AV5 C;  1F66 D;  3MGQ A;  3AZI D;  1P3A B;  4X23 A;  4ZBJ B;  2F8N G;  4WU9 A;  5B2I B;  1S32 A;  4KGC A;  5B31 A;  5BNX A;  3AN2 B;  5AVB B;  2NZD D;  4Z2M H;  5C3I C;  3MGQ B;  1P3F A;  4QLC D;  5B40 D;  5B24 A;  4X23 B;  4WU9 B;  3KXB C;  1S32 B;  4KGC B;  3R45 A;  5B31 B;  5BNX B;  5GT0 A;  3MGP D;  3KWQ D;  1P3F B;  1F66 C;  3AZI C;  5B24 B;  5AV8 A;  5AVC C;  3WA9 A;  3R45 B;  3VH6 T;  5GT0 B;  2CWE A;  4YS3 C;  5DNM A;  3REH A;  4QLC C;  5B40 C;  5AV8 B;  2CV5 D;  4E45 A;  3WA9 B;  5AV5 A;  4Z2M G;  3MVD D;  3REJ D;  2FJ7 D;  3UTB A;  3MGS D;  3MGP C;  4KHA A;  3KWQ C;  4WZS B;  5DNM B;  5B1L C;  5BT1 D;  1ULY A;  3REH B;  3AFA A;  5FUG A;  5AV5 B;  3AZM A;  5E5A D;  4WV4 B;  3VH5 T;  3UTB B;  4XUJ D;  4XZQ D;  5CP6 D;  4KHA B;  1P3L D;  3AFA B;  2CV5 C;  4CAY A;  5FUG B;  3MVD C;  3REJ C;  3AZM B;  1F66 A;  5B2I D;  2FJ7 C;  5AV6 A;  3AN2 D;  3MGS C;  2HIO D;  5AV9 C;  4Z5T D;  5B33 D;  3LEL C;  4CAY B;  2NZD A;  3REK C;  1F66 B;  4QLC A;  5B40 A;  1S32 D;  4J8X C;  5AV6 B;  5CPI A;  4Z66 D;  4XUJ C;  3AZK C;  4XZQ C;  5CP6 C;  4JJN D;  1P3L C;  3C1B D;  4G91 B;  2BYK A;  2NZD B;  2PYO D;  4ZBJ C;  1P3O D;  4QLC B;  5B40 B;  5B2I C;  5CPI B;  3AN2 C;  5JA4 A;  5AVB C;  4YM6 A;  5B0Y D;  2BYK B;  3AZE D;  3AZN A;  4WU9 C;  1S32 C;  4KGC C;  5B31 C;  5JA4 B;  4Z66 C;  1EQZ D;  5B2J A;  4YM6 B;  1R4V A;  3REJ A;  4JJN C;  5DNM D;  1P3F C;  1KX5 D;  2FJ7 A;  1HQ3 D;  2PYO C;  3AZG A;  1P3O C;  3AZN B;  5JRG A;  4J8W A;  3B6G A;  5B2J B;  3UTB D;  3REJ B;  4WU8 A;  5E5A A;  1P3G A;  2FJ7 B;  5AV8 C;  5CPJ A;  4XUJ A;  3AZG B;  3WA9 C;  3X1V D;  4UUZ A;  4R8P D;  3AZM D;  5B32 D;  1P3L A;  5JRG B;  3C1C D;  1B67 A;  4J8W B;  3B6G B;  3LJA D;  1WWI A;  4WU8 B;  5E5A B;  1P3G B;  3X1T D;  5DNM C;  3REH C;  1HTA A;  5CPJ B;  4XUJ B;  3LZ1 D;  4UUZ B;  2HIO A;  1P3L B;  4Z5T A;  4H9P A;  3B0C W;  5B33 A;  4AWL B;  5AV6 D;  3UTB C;  4WNN A;  5B31 G;  3AFA C;  4Z66 A;  3X1V C;  2HIO B;  1P3K D;  3AZM C;  4Z5T B;  4H9P B;  5B33 B;  4JJN A;  3A6N D;  3C1B A;  5CPI D;  5GXQ D;  1KU5 A;  2PYO A;  3B6F D;  1P3O A;  4WNN B;  3NQU A;  4DRB A;  4Z66 B;  1P3I D;  4JJN B;  3C1B B;  5B0Y A;  1AOI D;  5AV6 C;  3AZE A;  2PYO B;  3W98 A;  2YFW A;  4YM6 D;  1P3O B;  5F99 D;  3NQU B;  3KSY A;  4G91 C;  1EQZ A;  2NZD C;  3KUY D;  1U35 D;  1F1E A;  2ARO A;  5B0Y B;  3UTA D;  3AZN D;  1KX5 A;  5B1M D;  3MGR D;  3AV2 A;  1HQ3 A;  5CPI C;  3AZE B;  3W98 B;  5B2J D;  2YFW B;  3AZJ D;  1ZLA D;  3X1S D;  1P3P D;  1EQZ B;  3AZG D;  3W99 D;  2ARO B;  5JRG D;  1KX5 B;  3AV2 B;  4J8W D;  1HQ3 B;  3B6G D;  3X1V A;  4YM6 C;  4R8P A;  4WU8 D;  5B32 A;  1JFI A;  1P3G D;  3C1C A;  3LJA A;  3AYW D;  5CPJ D;  3KUY C;  5G49 A;  1U35 C;  3X1T A;  3UTA C;  3AZN C;  3UT9 D;  5B1M C;  3MGR C;  5B2J C;  3LZ1 A;  3AZJ C;  3X1V B;  4R8P B;  1ZLA C;  5B32 B;  1M1A A;  1JFI B;  4H9S A;  3C1C B;  3B0C T;  3AV1 D;  3LJA B;  1KX3 A;  5G49 B;  5B0Z D;  3AZG C;  3W99 C;  3O62 D;  3X1T B;  5BT1 C;  5JRG C;  4J8W C;  3B6G C;  3LZ1 B;  1M19 D;  4CSR A;  3VH6 A;  1P3K A;  1BH9 A;  4WU8 C;  1M1A B;  5E5A C;  1P3G C;  3A6N A;  3B0B A;  1KX3 B;  1P3M D;  5CPJ C;  5GXQ A;  5CPK A;  3B6F A;  4AWL C;  1P3I A;  4CSR B;  1B6W A;  1P3K B;  1BH9 B;  3B0D B;  5GSU A;  3A6N B;  1AOI A;  5GXQ B;  5B0Z C;  5CPK B;  3B6F B;  2HIO C;  3O62 C;  5F99 A;  4Z5T C;  5B33 C;  3W96 D;  3V9R A;  2BYM A;  1P3I B;  3KUY A;  4H9N A;  1U35 A;  3WAA D;  3W98 D;  2F8N D;  5GSU B;  3VH5 A;  3UTA A;  1AOI B;  5B1M A;  3MGR A;  1P3M C;  3WKJ D;  4NE6 A;  3AZJ A;  5F99 B;  1ZLA A;  3X1S A;  3LZ0 D;  2ARO D;  3V9R B;  3C1B C;  1P3P A;  2BYM B;  4M6B A;  3AV2 D;  3KUY B;  2IO5 C;  4H9N B;  1U35 B;  1P3B A;  3W99 A;  3UTA B;  5GT3 D;  5B1M B;  3MGR B;  3AZJ B;  4NE3 A; 
#chains in the Genus database with same CATH topology
 1ZLA B;  1P34 A;  3X1S B;  5BO0 A;  1P3P B;  3W96 C;  5B0Y C;  3AYW A;  5DNN D;  3AZE C;  3FDD A;  3WAA C;  1P3B B;  3W98 C;  3W99 B;  1M18 A;  2HUE C;  1T3U A;  3UT9 A;  1Q9C A;  1EQZ C;  3WKJ C;  4KUD D;  1P34 B;  5BO0 B;  3WTP A;  2ARO C;  3TU4 D;  3AV1 A;  3AYW B;  1PZR A;  1KX5 C;  1BH8 A;  4J8V D;  1HQ3 C;  3AV2 C;  3W97 D;  5B0Z A;  2F8N H;  2YFV A;  3IP4 C;  3O62 A;  1M18 B;  1M1A D;  4G92 B;  3UT9 B;  2F8N K;  5GT3 C;  4J8U A;  1KX3 D;  5AY8 D;  1M19 A;  2J8P A;  3WTP B;  3MNN D;  3AV1 B;  1BH8 B;  1P3M A;  4LD9 D;  5B0Z B;  2YFV B;  3O62 B;  4R8P C;  5B32 C;  3C1C C;  4J8U B;  5KDM A;  3LJA C;  1M19 B;  5CPK D;  3X1U A;  3KXB D;  3X1T C;  4HGA C;  1P3M B;  3LZ1 C;  1M1A C;  3AZL D;  4H9S C;  4H9Q A;  3W96 A;  5GSU D;  5KDM B;  1KX3 C;  5AVC D;  5AY8 C;  4WJ3 C;  2IO5 B;  2LY8 A;  3WAA A;  3X1U B;  2F8N A;  3NQJ A;  3MNN C;  4LD9 C;  3WKJ A;  4NFT A;  3B0D C;  4YS3 D;  3LZ0 A;  1P3K C;  4H9Q B;  3W96 B;  2RIQ A;  3A6N C;  5GXQ C;  3WAA B;  1ID3 D;  5CPK C;  2F8N B;  3B6F C;  3NQJ B;  3AZH A;  2HUE B;  5BS7 A;  5GT3 A;  2Y2P A;  3WKJ B;  3REI A;  1P3I C;  2Y2M A;  1N1J A;  1P3B D;  3LZ0 B;  1W2E A;  5B1L D;  5GSU C;  3AZL C;  1KX4 A;  1AOI C;  5DNN A;  2ZY2 A;  3AZH B;  5B32 G;  4ZUX A;  5F99 C;  1P34 D;  5GT3 B;  2NQB A;  3REI B;  4KUD A;  1TZY D;  1N1J B;  2DF4 C;  1M18 D;  1KX4 B;  3TU4 A;  3W97 A;  5DNN B;  4J8V A;  1ID3 C;  3EPL A;  4ZUX B;  3X1S C;  3WTP D;  2NQB B;  1P3P C;  4KUD B;  5AY8 A;  1P3B C;  5AV9 D;  3MNN A;  3LEL D;  2Y2G A;  3TU4 B;  4HGA B;  4J8V B;  4J8U D;  3W97 B;  4LD9 A;  3AZF D;  3REK D;  3REL D;  1P34 C;  4J8X D;  4DRA A;  1BFM A;  5AY8 B;  3AZK D;  3AYW C;  1TZY C;  3KXB A;  1M18 C;  3MNN B;  2XD1 A;  2Y2J A;  1A7W A;  4G92 C;  3UT9 C;  1P3A D;  4LD9 B;  2Y2I A;  5C3I B;  3X1U D;  3WTP C;  3AZI A;  3AZL A;  1H3O A;  3AV1 C;  5AVC A;  5AVB D;  3KXB B;  2JSS A;  3MGQ D;  4J8U C;  3AZF C;  1M19 C;  4E44 A;  4X23 D;  3WTP E;  4EO5 C;  3REL C;  4YS3 A;  3AZI B;  3AZL B;  4WU9 D;  1H3O B;  4UPK A;  4KGC D;  5AVC B;  5B31 D;  1ID3 A;  5BNV A;  2Y2Q A;  1P3F D;  2Y2O A;  1P3A C;  3EPK A;  5B24 D;  3MGP A;  4YS3 B;  3KWQ A;  3X1U C;  5B1L A;  3AZH D;  2RVQ D;  5GT0 D;  1TAF A;  3REI D;  1ID3 B;  5BNV B;  3MGQ C;  1KX4 D;  5AV8 D;  3MGP B;  4X23 C;  1TZY A;  3WA9 D;  3KWQ B;  4H9O A;  5B1L B;  3VH6 W;  4ZUX D;  1WWS A;  2NQB D;  2CV5 A;  1TAF B;  3MVD A;  5CHL B;  3LZ0 C;  3REH D;  5B24 C;  3MGS A;  1TZY B;  3AL0 C;  4H9O B;  5AV5 D;  5AV9 A;  3AZH C;  5BS7 C;  2RVQ C;  3LEL A;  2CV5 B;  5GT0 C;  3AZF A;  3REI C;  3MVD B;  3REK A;  3REL A;  4NE5 A;  4H9R A;  1KX4 C;  4J8X A;  3AFA D;  3MGS B;  3AZK A;  4XZQ A;  5DNN C;  5CP6 A;  5AV9 B;  4ZUX C;  3LEL B;  2L5A A;  3VH5 W;  1P3A A;  2NQB C;  3AZF B;  4KUD C;  3REK B;  4EO5 B;  3REL B;  4H9R B;  4J8X B;  5B2I A;  3TU4 C;  3AZK B;  3AN2 A;  4XZQ B;  5AVB A;  4J8V C;  3W97 C;  5CP6 B;  5AV5 C;  3EG5 B;  2JE5 A;  1F66 D;  3MGQ A;  3AZI D;  1P3A B;  4X23 A;  3H0R C;  4ZBJ B;  2F8N G;  4WU9 A;  5B2I B;  1S32 A;  4KGC A;  5B31 A;  5BNX A;  3AN2 B;  5AVB B;  2NZD D;  4Z2M H;  5C3I C;  3MGQ B;  1P3F A;  4QLC D;  5B40 D;  5B24 A;  4X23 B;  4WU9 B;  3KXB C;  2BG1 A;  1S32 B;  2UWX A;  3R45 A;  4KGC B;  5B31 B;  5BNX B;  5GT0 A;  3MGP D;  3KWQ D;  1P3F B;  1F66 C;  3AZI C;  5B24 B;  5AV8 A;  5AVC C;  3WA9 A;  3R45 B;  3VH6 T;  5GT0 B;  2CWE A;  3KFU G;  4YS3 C;  5DNM A;  3REH A;  4QLC C;  5B40 C;  5AV8 B;  4DQY B;  2CV5 D;  4E45 A;  3WA9 B;  5AV5 A;  4Z2M G;  3MVD D;  3REJ D;  2Y2H A;  2FJ7 D;  3UTB A;  3MGS D;  3MGP C;  4KHA A;  3KWQ C;  4WZS B;  5DNM B;  5B1L C;  5BT1 D;  1ULY A;  3REH B;  3AFA A;  5FUG A;  5AV5 B;  3AZM A;  5E5A D;  2G5H C;  4WV4 B;  3VH5 T;  3UTB B;  4XUJ D;  4XZQ D;  5CP6 D;  4KHA B;  1P3L D;  3AFA B;  2CV5 C;  4CAY A;  5FUG B;  3MVD C;  3REJ C;  3AZM B;  1F66 A;  5B2I D;  2FJ7 C;  5AV6 A;  3AN2 D;  3MGS C;  2HIO D;  5AV9 C;  4Z5T D;  5B33 D;  3LEL C;  4CAY B;  2NZD A;  3REK C;  1F66 B;  4QLC A;  5B40 A;  1S32 D;  4J8X C;  5AV6 B;  5CPI A;  4XUJ C;  4Z66 D;  3AZK C;  4XZQ C;  5CP6 C;  4JJN D;  1P3L C;  3C1B D;  4G91 B;  2BYK A;  2NZD B;  2ZY4 A;  2PYO D;  3P5J B;  2ZY5 A;  4ZBJ C;  1P3O D;  4QLC B;  5B40 B;  5B2I C;  5CPI B;  3AN2 C;  5JA4 A;  5AVB C;  4YM6 A;  5B0Y D;  2BYK B;  3AZE D;  3AZN A;  4WU9 C;  1S32 C;  4KGC C;  3H0M C;  5B31 C;  3EPH A;  5JA4 B;  4Z66 C;  2ZY3 A;  5B2J A;  1EQZ D;  4YM6 B;  1R4V A;  3REJ A;  4JJN C;  5DNM D;  1P3F C;  2W8S A;  1KX5 D;  2FJ7 A;  1HQ3 D;  2PYO C;  3AZG A;  1P3O C;  3AZN B;  5JRG A;  4J8W A;  3B6G A;  5B2J B;  3UTB D;  3REJ B;  4WU8 A;  5E5A A;  1P3G A;  2FJ7 B;  5AV8 C;  5CPJ A;  4XUJ A;  3AZG B;  3WA9 C;  3X1V D;  4UUZ A;  4R8P D;  3AZM D;  5B32 D;  1P3L A;  5JRG B;  3C1C D;  1B67 A;  4J8W B;  3B6G B;  3LJA D;  1WWI A;  4WU8 B;  5E5A B;  1P3G B;  3X1T D;  5DNM C;  3REH C;  1HTA A;  5CPJ B;  4XUJ B;  3LZ1 D;  4UUZ B;  2HIO A;  1P3L B;  4Z5T A;  4H9P A;  3B0C W;  5B33 A;  3H0L C;  4AWL B;  3EPJ A;  5AV6 D;  3UTB C;  2F2A C;  3A1I A;  2VQR A;  4WNN A;  5B31 G;  3AFA C;  2Y2L A;  4Z66 A;  3X1V C;  2HIO B;  1P3K D;  3AZM C;  4Z5T B;  4H9P B;  5B33 B;  4JJN A;  3A6N D;  3C1B A;  5CPI D;  5GXQ D;  1KU5 A;  2PYO A;  3B6F D;  1P3O A;  4WNN B;  3F6T A;  3NQU A;  4DRB A;  4Z66 B;  1P3I D;  4JJN B;  3C1B B;  5B0Y A;  1AOI D;  5AV6 C;  3AZE A;  2PYO B;  3W98 A;  2YFW A;  4YM6 D;  1P3O B;  5F99 D;  3NQU B;  3KSY A;  4G91 C;  1EQZ A;  1Z2C B;  3KUY D;  2NZD C;  1U35 D;  1F1E A;  2ARO A;  5B0Y B;  3UTA D;  3AZN D;  1KX5 A;  5B1M D;  3MGR D;  3AV2 A;  1HQ3 A;  5CPI C;  3AZE B;  3W98 B;  5B2J D;  2YFW B;  3AZJ D;  1ZLA D;  2G5I C;  3X1S D;  1P3P D;  1EQZ B;  3AZG D;  3W99 D;  2ARO B;  5JRG D;  1KX5 B;  2JCH A;  3AV2 B;  4J8W D;  1HQ3 B;  3B6G D;  3X1V A;  4YM6 C;  4R8P A;  4WU8 D;  5B32 A;  1JFI A;  1P3G D;  3C1C A;  3LJA A;  3AYW D;  5CPJ D;  3KUY C;  5G49 A;  1U35 C;  3X1T A;  3UTA C;  3AZN C;  3UT9 D;  5B1M C;  3MGR C;  5B2J C;  3LZ1 A;  3AZJ C;  3X1V B;  4R8P B;  2FFF B;  1ZLA C;  5B32 B;  1M1A A;  1JFI B;  4H9S A;  3C1C B;  3B0C T;  3AV1 D;  3LJA B;  1KX3 A;  5G49 B;  5B0Z D;  2DQN C;  3AZG C;  3W99 C;  3O62 D;  3X1T B;  5BT1 C;  5JRG C;  2XD5 A;  4J8W C;  3B6G C;  3LZ1 B;  1M19 D;  4CSR A;  3VH6 A;  1P3K A;  1BH9 A;  4WU8 C;  1M1A B;  5E5A C;  1P3G C;  3A6N A;  3B0B A;  1KX3 B;  1P3M D;  5CPJ C;  5GXQ A;  5CPK A;  3B6F A;  4AWL C;  1P3I A;  4CSR B;  1B6W A;  1P3K B;  1BH9 B;  3B0D B;  5GSU A;  3A6N B;  1AOI A;  2Y2K A;  5GXQ B;  5B0Z C;  5CPK B;  3B6F B;  2HIO C;  3O62 C;  5F99 A;  4Z5T C;  5B33 C;  3W96 D;  2Y2N A;  3V9R A;  2BYM A;  1P3I B;  3KUY A;  4H9N A;  1U35 A;  3WAA D;  3W98 D;  2F8N D;  5GSU B;  3VH5 A;  3UTA A;  3A1K A;  1AOI B;  5B1M A;  3MGR A;  1P3M C;  3WKJ D;  4NE6 A;  3AZJ A;  5F99 B;  1ZLA A;  3X1S A;  3LZ0 D;  2ARO D;  3V9R B;  3C1B C;  1P3P A;  2BYM B;  4M6B A;  3AV2 D;  3KUY B;  2IO5 C;  4H9N B;  1U35 B;  1P3B A;  3W99 A;  3UTA B;  5GT3 D;  5B1M B;  3MGR B;  2ZM5 A;  3AZJ B;  4NE3 A; 
#chains in the Genus database with same CATH homology
 1ZLA B;  1P34 A;  3X1S B;  5BO0 A;  1P3P B;  3W96 C;  5B0Y C;  3AYW A;  5DNN D;  3AZE C;  3FDD A;  3WAA C;  1P3B B;  3W98 C;  3W99 B;  1M18 A;  2HUE C;  1T3U A;  3UT9 A;  1Q9C A;  1EQZ C;  3WKJ C;  4KUD D;  1P34 B;  5BO0 B;  3WTP A;  2ARO C;  3TU4 D;  3AV1 A;  3AYW B;  1PZR A;  1KX5 C;  1BH8 A;  4J8V D;  1HQ3 C;  3AV2 C;  3W97 D;  5B0Z A;  2F8N H;  2YFV A;  3IP4 C;  3O62 A;  1M18 B;  1M1A D;  4G92 B;  3UT9 B;  2F8N K;  5GT3 C;  4J8U A;  1KX3 D;  5AY8 D;  1M19 A;  2J8P A;  3WTP B;  3MNN D;  3AV1 B;  1BH8 B;  1P3M A;  4LD9 D;  5B0Z B;  2YFV B;  3O62 B;  4R8P C;  5B32 C;  3C1C C;  4J8U B;  5KDM A;  3LJA C;  1M19 B;  5CPK D;  3X1U A;  3KXB D;  3X1T C;  4HGA C;  1P3M B;  3LZ1 C;  1M1A C;  3AZL D;  4H9S C;  4H9Q A;  3W96 A;  5GSU D;  5KDM B;  1KX3 C;  5AVC D;  5AY8 C;  4WJ3 C;  2IO5 B;  2LY8 A;  3WAA A;  3X1U B;  2F8N A;  3NQJ A;  3MNN C;  4LD9 C;  3WKJ A;  4NFT A;  3B0D C;  4YS3 D;  3LZ0 A;  1P3K C;  4H9Q B;  3W96 B;  2RIQ A;  3A6N C;  5GXQ C;  3WAA B;  1ID3 D;  5CPK C;  2F8N B;  3B6F C;  3NQJ B;  3AZH A;  2HUE B;  5BS7 A;  5GT3 A;  2Y2P A;  3WKJ B;  3REI A;  1P3I C;  2Y2M A;  1N1J A;  1P3B D;  3LZ0 B;  1W2E A;  5B1L D;  5GSU C;  3AZL C;  1KX4 A;  1AOI C;  5DNN A;  2ZY2 A;  3AZH B;  5B32 G;  4ZUX A;  5F99 C;  1P34 D;  5GT3 B;  2NQB A;  3REI B;  4KUD A;  1TZY D;  1N1J B;  2DF4 C;  1M18 D;  1KX4 B;  3TU4 A;  3W97 A;  5DNN B;  4J8V A;  1ID3 C;  3EPL A;  4ZUX B;  3X1S C;  3WTP D;  2NQB B;  1P3P C;  4KUD B;  5AY8 A;  1P3B C;  5AV9 D;  3MNN A;  3LEL D;  2Y2G A;  3TU4 B;  4HGA B;  4J8V B;  4J8U D;  3W97 B;  4LD9 A;  3AZF D;  3REK D;  3REL D;  1P34 C;  4J8X D;  4DRA A;  1BFM A;  5AY8 B;  3AZK D;  3AYW C;  1TZY C;  3KXB A;  1M18 C;  3MNN B;  2XD1 A;  2Y2J A;  1A7W A;  4G92 C;  3UT9 C;  1P3A D;  4LD9 B;  2Y2I A;  5C3I B;  3X1U D;  3WTP C;  3AZI A;  3AZL A;  1H3O A;  3AV1 C;  5AVC A;  5AVB D;  3KXB B;  2JSS A;  3MGQ D;  4J8U C;  3AZF C;  1M19 C;  4E44 A;  4X23 D;  3WTP E;  4EO5 C;  3REL C;  4YS3 A;  3AZI B;  3AZL B;  4WU9 D;  1H3O B;  4UPK A;  4KGC D;  5AVC B;  5B31 D;  1ID3 A;  5BNV A;  2Y2Q A;  1P3F D;  2Y2O A;  1P3A C;  3EPK A;  5B24 D;  3MGP A;  4YS3 B;  3KWQ A;  3X1U C;  5B1L A;  3AZH D;  2RVQ D;  5GT0 D;  1TAF A;  3REI D;  1ID3 B;  5BNV B;  3MGQ C;  1KX4 D;  5AV8 D;  3MGP B;  4X23 C;  1TZY A;  3WA9 D;  3KWQ B;  4H9O A;  5B1L B;  3VH6 W;  4ZUX D;  1WWS A;  2NQB D;  2CV5 A;  1TAF B;  3MVD A;  5CHL B;  3LZ0 C;  3REH D;  5B24 C;  3MGS A;  1TZY B;  3AL0 C;  4H9O B;  5AV5 D;  5AV9 A;  3AZH C;  5BS7 C;  2RVQ C;  3LEL A;  2CV5 B;  5GT0 C;  3AZF A;  3REI C;  3MVD B;  3REK A;  3REL A;  4NE5 A;  4H9R A;  1KX4 C;  4J8X A;  3AFA D;  3MGS B;  3AZK A;  4XZQ A;  5DNN C;  5CP6 A;  5AV9 B;  4ZUX C;  3LEL B;  2L5A A;  3VH5 W;  1P3A A;  2NQB C;  3AZF B;  4KUD C;  3REK B;  4EO5 B;  3REL B;  4H9R B;  4J8X B;  5B2I A;  3TU4 C;  3AZK B;  3AN2 A;  4XZQ B;  5AVB A;  4J8V C;  3W97 C;  5CP6 B;  5AV5 C;  3EG5 B;  2JE5 A;  1F66 D;  3MGQ A;  3AZI D;  1P3A B;  4X23 A;  3H0R C;  4ZBJ B;  2F8N G;  4WU9 A;  5B2I B;  1S32 A;  4KGC A;  5B31 A;  5BNX A;  3AN2 B;  5AVB B;  2NZD D;  4Z2M H;  5C3I C;  3MGQ B;  1P3F A;  4QLC D;  5B40 D;  5B24 A;  4X23 B;  4WU9 B;  3KXB C;  2BG1 A;  1S32 B;  2UWX A;  3R45 A;  4KGC B;  5B31 B;  5BNX B;  5GT0 A;  3MGP D;  3KWQ D;  1P3F B;  1F66 C;  3AZI C;  5B24 B;  5AV8 A;  5AVC C;  3WA9 A;  3R45 B;  3VH6 T;  5GT0 B;  2CWE A;  3KFU G;  4YS3 C;  5DNM A;  3REH A;  4QLC C;  5B40 C;  5AV8 B;  4DQY B;  2CV5 D;  4E45 A;  3WA9 B;  5AV5 A;  4Z2M G;  3MVD D;  3REJ D;  2Y2H A;  2FJ7 D;  3UTB A;  3MGS D;  3MGP C;  4KHA A;  3KWQ C;  4WZS B;  5DNM B;  5B1L C;  5BT1 D;  1ULY A;  3REH B;  3AFA A;  5FUG A;  5AV5 B;  3AZM A;  5E5A D;  2G5H C;  4WV4 B;  3VH5 T;  3UTB B;  4XUJ D;  4XZQ D;  5CP6 D;  4KHA B;  1P3L D;  3AFA B;  2CV5 C;  4CAY A;  5FUG B;  3MVD C;  3REJ C;  3AZM B;  1F66 A;  5B2I D;  2FJ7 C;  5AV6 A;  3AN2 D;  3MGS C;  2HIO D;  5AV9 C;  4Z5T D;  5B33 D;  3LEL C;  4CAY B;  2NZD A;  3REK C;  1F66 B;  4QLC A;  5B40 A;  1S32 D;  4J8X C;  5AV6 B;  5CPI A;  4XUJ C;  4Z66 D;  3AZK C;  4XZQ C;  5CP6 C;  4JJN D;  1P3L C;  3C1B D;  4G91 B;  2BYK A;  2NZD B;  2ZY4 A;  2PYO D;  3P5J B;  2ZY5 A;  4ZBJ C;  1P3O D;  4QLC B;  5B40 B;  5B2I C;  5CPI B;  3AN2 C;  5JA4 A;  5AVB C;  4YM6 A;  5B0Y D;  2BYK B;  3AZE D;  3AZN A;  4WU9 C;  1S32 C;  4KGC C;  3H0M C;  5B31 C;  3EPH A;  5JA4 B;  4Z66 C;  2ZY3 A;  5B2J A;  1EQZ D;  4YM6 B;  1R4V A;  3REJ A;  4JJN C;  5DNM D;  1P3F C;  2W8S A;  1KX5 D;  2FJ7 A;  1HQ3 D;  2PYO C;  3AZG A;  1P3O C;  3AZN B;  5JRG A;  4J8W A;  3B6G A;  5B2J B;  3UTB D;  3REJ B;  4WU8 A;  5E5A A;  1P3G A;  2FJ7 B;  5AV8 C;  5CPJ A;  4XUJ A;  3AZG B;  3WA9 C;  3X1V D;  4UUZ A;  4R8P D;  3AZM D;  5B32 D;  1P3L A;  5JRG B;  3C1C D;  1B67 A;  4J8W B;  3B6G B;  3LJA D;  1WWI A;  4WU8 B;  5E5A B;  1P3G B;  3X1T D;  5DNM C;  3REH C;  1HTA A;  5CPJ B;  4XUJ B;  3LZ1 D;  4UUZ B;  2HIO A;  1P3L B;  4Z5T A;  4H9P A;  3B0C W;  5B33 A;  3H0L C;  4AWL B;  3EPJ A;  5AV6 D;  3UTB C;  2F2A C;  3A1I A;  2VQR A;  4WNN A;  5B31 G;  3AFA C;  2Y2L A;  4Z66 A;  3X1V C;  2HIO B;  1P3K D;  3AZM C;  4Z5T B;  4H9P B;  5B33 B;  4JJN A;  3A6N D;  3C1B A;  5CPI D;  5GXQ D;  1KU5 A;  2PYO A;  3B6F D;  1P3O A;  4WNN B;  3F6T A;  3NQU A;  4DRB A;  4Z66 B;  1P3I D;  4JJN B;  3C1B B;  5B0Y A;  1AOI D;  5AV6 C;  3AZE A;  2PYO B;  3W98 A;  2YFW A;  4YM6 D;  1P3O B;  5F99 D;  3NQU B;  3KSY A;  4G91 C;  1EQZ A;  1Z2C B;  3KUY D;  2NZD C;  1U35 D;  1F1E A;  2ARO A;  5B0Y B;  3UTA D;  3AZN D;  1KX5 A;  5B1M D;  3MGR D;  3AV2 A;  1HQ3 A;  5CPI C;  3AZE B;  3W98 B;  5B2J D;  2YFW B;  3AZJ D;  1ZLA D;  2G5I C;  3X1S D;  1P3P D;  1EQZ B;  3AZG D;  3W99 D;  2ARO B;  5JRG D;  1KX5 B;  2JCH A;  3AV2 B;  4J8W D;  1HQ3 B;  3B6G D;  3X1V A;  4YM6 C;  4R8P A;  4WU8 D;  5B32 A;  1JFI A;  1P3G D;  3C1C A;  3LJA A;  3AYW D;  5CPJ D;  3KUY C;  5G49 A;  1U35 C;  3X1T A;  3UTA C;  3AZN C;  3UT9 D;  5B1M C;  3MGR C;  5B2J C;  3LZ1 A;  3AZJ C;  3X1V B;  4R8P B;  2FFF B;  1ZLA C;  5B32 B;  1M1A A;  1JFI B;  4H9S A;  3C1C B;  3B0C T;  3AV1 D;  3LJA B;  1KX3 A;  5G49 B;  5B0Z D;  2DQN C;  3AZG C;  3W99 C;  3O62 D;  3X1T B;  5BT1 C;  5JRG C;  2XD5 A;  4J8W C;  3B6G C;  3LZ1 B;  1M19 D;  4CSR A;  3VH6 A;  1P3K A;  1BH9 A;  4WU8 C;  1M1A B;  5E5A C;  1P3G C;  3A6N A;  3B0B A;  1KX3 B;  1P3M D;  5CPJ C;  5GXQ A;  5CPK A;  3B6F A;  4AWL C;  1P3I A;  4CSR B;  1B6W A;  1P3K B;  1BH9 B;  3B0D B;  5GSU A;  3A6N B;  1AOI A;  2Y2K A;  5GXQ B;  5B0Z C;  5CPK B;  3B6F B;  2HIO C;  3O62 C;  5F99 A;  4Z5T C;  5B33 C;  3W96 D;  2Y2N A;  3V9R A;  2BYM A;  1P3I B;  3KUY A;  4H9N A;  1U35 A;  3WAA D;  3W98 D;  2F8N D;  5GSU B;  3VH5 A;  3UTA A;  3A1K A;  1AOI B;  5B1M A;  3MGR A;  1P3M C;  3WKJ D;  4NE6 A;  3AZJ A;  5F99 B;  1ZLA A;  3X1S A;  3LZ0 D;  2ARO D;  3V9R B;  3C1B C;  1P3P A;  2BYM B;  4M6B A;  3AV2 D;  3KUY B;  2IO5 C;  4H9N B;  1U35 B;  1P3B A;  3W99 A;  3UTA B;  5GT3 D;  5B1M B;  3MGR B;  2ZM5 A;  3AZJ B;  4NE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...