5E5AD

Crystal structure of the chromatin-tethering domain of human cytomegalovirus ie1 protein bound to the nucleosome core particle
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
98
structure length
98
Chain Sequence
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/viral protein/dna
molecule keywords DNA (146-MER)
publication title Human cytomegalovirus IE1 protein alters the higher-order chromatin structure by targeting the acidic patch of the nucleosome
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 98
sequence length 98
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5e5aD00
3RELC 5B0ZA 3AZMC 5B0YD 4DRBA 1EQZA 4NE6A 2YFVB 4JJNC 3UT9B 4CSRA 2BYMB 5B24A 4WNNB 3AZHD 1P3LB 3WA9D 5KDMA 5GSUD 5B1LB 1HQ3D 5BO0B 5AVBB 5DNMD 3VH6W 3MGPB 4Z66D 3LJAA 1U35C 1KX3D 4H9SC 3X1TD 2YFVA 4J8UC 3UT9A 1M18D 5B32D 2PYOD 3B6FA 2CV5D 1F1EA 2BYMA 4WNNA 1P3LA 4WU9C 4H9QB 4WV4B 2HIOB 5B40C 3X1SD 5AVBA 5BO0A 4Z2MG 1F66B 3MGPA 3MGRB 4KUDD 5FUGA 3AZFC 3KXBB 4J8WD 3WAAB 1M19B 4H9QA 3REKC 4NFTA 3UTBC 3UTAB 3C1BC 2HIOA 3MNNB 3X1VD 5B33B 3REJC 1P34B 3AV1B 1S32D 3B6GC 4LD9C 3B0BA 2F8NB 3KXBA 3AZKB 1KX5C 3WAAA 4KGCD 5AV6C 5B2IC 5AY8C 3RELB 3AZMB 3MNNA 5CP6D 5CPIC 5B33A 3AZJD 1P34A 4JJNB 3MGSC 3AV1A 4G91C 3W96C 4XZQC 5AV5C 2F8NA 1H3OB 3AZKA 5B0ZD 1P3IC 5JRGA 3AZNC 5B1MD 3RELA 3AZMA 4QLCC 5B24D 4Z2MH 1U35B 4J8UB 4JJNA 4Z5TA 4WZSB 1H3OA 4WU8C 4WU9B 1BH8B 3UT9D 3AN2C 5B40B 5GT0C 5DNNC 1P3BC 5AV8C 1U35A 1P3LD 4H9SA 4J8UA 3AZFB 1HTAA 5B1LD 5AVBD 3VH6T 5DNMA 4YS3C 3REKB 3UTBB 3MGPD 4WU9A 3C1BB 1BH8A 3X1TA 5B32A 5B40A 3B0CT 4H9PA 3REJB 3W97C 3O62C 1P3PC 3B6GB 5B31C 3R45B 4LD9B 2FJ7C 2HIOD 1P3MD 1KX5B 3WTPC 3AFAC 1F66D 3REKA 3UTBA 3MGRD 5AV6B 5B2IB 5AY8B 3MVDC 5CPIB 3REJA 1P3MC 3KXBD 3MGSB 4G91B 1M19D 3B6GA 3W96B 3R45A 3UTAD 4XZQB 5GXQC 1AOIC 5AV5B 4LD9A 1KX5A 1P3IB 3REIC 5B33D 3AZNB 1JFIB 1P34D 3AV1D 5AV6A 4YM6C 2F8NG 5B2IA 5AY8A 4QLCB 5CPIA 2F8ND 3AZKD 3MGSA 3W96A 1P3FC 4XZQA 3VH5W 4WU8B 5F99C 5CP6A 3NQJB 3RELD 3AZMD 1P3IA 3AZNA 1JFIA 4JJND 3LZ1C 3AN2B 5GT0B 5DNNB 3AYWC 4E44A 4QLCA 1P3BB 5AV8B 5GT3C 3KSYA 5B1MA 1ULYA 4YS3B 4WU8A 3WKJC 3NQJA 5CPKC 1U35D 4J8UD 3AN2A 5GT0A 5DNNA 3WTPE 3W97B 3O62B 1P3PB 5AV8A 4WU9D 5B31B 5B32G 2FJ7B 1Q9CA 1B6WA 5B40D 3B0CW 3WTPB 3AFAB 1BH9B 4J8VC 3AZFD 4NE5A 2F8NH 3MVDB 1N1JB 1P3MB 3W97A 5B1LA 2RVQC 3O62A 1P3PA 3A6NC 5B31A 3REKD 3UTBD 5GXQB 4NE3A 3C1BD 1AOIB 1P3OC 2FJ7A 5AVCC 3LZ0C 3WTPA 3REIB 3REJD 3AFAA 2LY8A 4J8XC 1BH9A 4YM6B 3B6GD 1ZLAC 4CAYB 1N1JA 3X1UC 1P3MA 4LD9D 3AV2C 1KX5D 4G92C 1F66A 3MGRA 1P3FB 3W99C 5GXQA 5AV6D 5B2ID 5AY8D 5F99B 3REIA 5CPID 3LZ1B 3MGSD 1M19A 3UTAA 3W96D 3AYWB 4XZQD 5AV5D 4CAYA 3KWQC 5GT3B 3AZND 1P3ID 1P3FA 3C1CC 3NQUB 3WKJB 5F99A 3KUYC 4QLCD 5CPKB 3LZ1A 3AYWA 4H9RB 4E45A 3VH5T 2F8NK 1TZYC 5B2JC 4WU8D 5GT3A 3AN2D 5GT0D 3NQUA 1P3GC 5DNND 3WKJA 3MGQC 4AWLC 5CPKA 1P3BD 5AV8D 4J8VB 4H9RA 4R8PC 4YS3D 3A6NB 5CHLB 1P3OB 5AVCB 3LZ0B 3VH6A 4J8XB 3W97D 3O62D 5CPJC 1P3PD 5B31D 1ZLAB 2FJ7D 3X1UB 3AV2B 4G92B 3WTPD 3A6NA 3AFAD 1KX4C 3W99B 3AZEC 1P3OA 5AVCA 3AZFA 3W98C 3LZ0A 3MVDD 3B0DC 4J8XA 3AZLC 3C1BA 5GXQD 1AOID 1ZLAA 2NQBC 1WWIA 2JSSA 3X1UA 2YFWB 3KWQB 3LJAC 4X23C 3REID 1P3KC 3B6FC 3C1CB 4YM6D 4ZUXC 1KU5A 5E5AC 3KUYB 2HUEC 1P3AC 2AROC 1P3FD 1TZYB 5JA4B 2YFWA 5F99D 5B2JB 3KWQA 3REHC 4H9OB 3LZ1D 3C1CA 3TU4C 1P3GB 3AYWD 5AV5A 3KUYA 3MGQB 4AWLB 3LELC 5GT3D 4EO5C 1TZYA 5JA4A 5B2JA 4R8PB 4XUJC 3WKJD 5CPKD 4H9OA 5AV9C 3AZGC 1P3GA 3MGQA 5G49B 5BT1D 5CPJB 1ID3C 3AZIC 4R8PA 2IO5C 1KX4B 5BT1C 1P3BA 3AZEB 4J8VD 3W98B 3B0DB 5JRGC 3AZLB 2NZDC 2RVQD 4YS3A 3A6ND 2NQBB 1P3OD 5AVCD 3LJAB 4X23B 3LZ0D 1P3KB 4Z5TC 4J8XD 1KX4A 3B6FB 3AZEA 4ZUXB 5E5AB 1ZLAD 3W98A 5B0YC 3X1UD 3AV2D 3AZLA 2HUEB 1P3AB 2AROB 3W99D 2NQBA 3AZHC 3REHB 3MVDA 4X23A 4ZBJC 5FUGB 3WA9C 1P3KA 5GSUC 4ZUXA 1HQ3C 3TU4B 1AOIA 5E5AA 5DNMC 4DRAA 4Z66C 3KWQD 3LELB 1KX3C 3X1TC 1M18C 2PYOC 5B32C 1P3AA 2AROA 2CV5C 4EO5B 1M1AD 1A7WA 4YM6A 3C1CD 4XUJB 3KUYD 3REHA 5C3IC 5AV9B 3AZGB 3X1SC 3TU4A 1M1AC 4KUDC 1TZYD 5B2JD 3LELA 1ID3B 3VH5A 3AZIB 4J8WC 1P3GD 2IO5B 4XUJA 3MGQD 5AV9A 3AZGA 3X1VC 5JRGB 2NZDB 4R8PD 1S32C 1ID3A 5BNVB 3AZIA 4Z5TB 5BNXB 4KGCC 5CPJD 5CP6C 5B0YB 3AZJC 1EQZD 2NZDA 5B31G 1KX4D 1WWSA 5BS7C 4J8VA 3AZHB 3AZED 5BNVA 5B0ZC 3W98D 4ZBJB 3WA9B 5GSUB 1EQZC 5BNXA 3AZLD 5B1MC 1HQ3B 5DNMB 2NQBD 1B67A 5B24C 5B0YA 4Z66B 1KX3B 3LJAD 4X23D 3X1TB 1M18B 2PYOB 1P3KD 5B32B 4HGAC 4H9PB 2CV5B 3B6FD 3AZHA 4ZUXD 5E5AD 3WA9A 3AV2A 5C3IB 5GSUA 3UT9C 4KHAB 3X1SB 2AROD 1HQ3A 1P3AD 1M1AB 3W99A 4KUDB 1TAFB 4Z66A 1P3LC 1KX3A 3REHD 1M18A 2PYOA 2CV5A 4J8WB 5B1LC 5AVBC 3TU4D 3MGPC 3LELD 4H9NB 4KHAA 3X1VB 3X1SA 2CWEA 1M1AA 4KUDA 1BFMA 1R4VA 1TAFA 1S32B 4XUJD 4UUZB 2BYKB 2HIOC 5AV9D 4J8WA 3V9RB 3AZGD 3WAAD 1F66C 4KGCB 3MGRC 4H9NA 1ID3D 5CP6B 3X1VA 3MNND 3AZJB 3KXBC 3AZID 3WAAC 1S32A 1M19C 3UTAC 4UUZA 2BYKA 5B0ZB 3MNNC 3V9RA 5B33C 5JRGD 2L5AA 1EQZB 4KGCA 4M6BA 5B1MB 3AV1C 1P34C 2NZDD 4CSRB 5B24B 3AZJA 3AZKC 5KDMB 4Z5TD 4HGAB 5G49A 5CPJA 5BS7A
chains in the Genus database with same CATH superfamily
3RELC 5B0ZA 3AZMC 5B0YD 4DRBA 1EQZA 4NE6A 2YFVB 4JJNC 3UT9B 4CSRA 2BYMB 5B24A 4WNNB 3AZHD 1P3LB 3WA9D 5KDMA 5GSUD 5B1LB 1HQ3D 5BO0B 5AVBB 5DNMD 3VH6W 3MGPB 4Z66D 3LJAA 1U35C 1KX3D 4H9SC 3X1TD 2YFVA 2Y2JA 4J8UC 3UT9A 5B32D 1M18D 2PYOD 3B6FA 2CV5D 1F1EA 2XD1A 2BYMA 4WNNA 1P3LA 4WU9C 4H9QB 4WV4B 3A1KA 2HIOB 5B40C 3X1SD 5AVBA 5BO0A 4Z2MG 1F66B 3MGPA 3MGRB 4KUDD 5FUGA 2DF4C 3AZFC 3KXBB 4J8WD 3WAAB 1M19B 4H9QA 3REKC 4NFTA 3UTBC 3UTAB 3C1BC 3FDDA 2HIOA 3MNNB 3X1VD 5B33B 3REJC 1P34B 3AV1B 1S32D 3B6GC 4LD9C 3B0BA 2F8NB 3KFUG 3KXBA 3AZKB 1KX5C 3WAAA 4KGCD 5AV6C 5B2IC 5AY8C 3RELB 3AZMB 3MNNA 5CP6D 5CPIC 5B33A 3AZJD 1P34A 4JJNB 3MGSC 3AV1A 4G91C 3W96C 4XZQC 5AV5C 2F8NA 1H3OB 2Y2LA 3AZKA 5B0ZD 1P3IC 5JRGA 3AZNC 5B1MD 3RELA 3AZMA 4QLCC 5B24D 2ZY2A 4Z2MH 1U35B 2Y2MA 4J8UB 4JJNA 4Z5TA 4WZSB 1H3OA 4WU8C 4WU9B 2RIQA 1PZRA 1BH8B 3UT9D 3AN2C 5B40B 5GT0C 5DNNC 1P3BC 5AV8C 1U35A 1P3LD 4H9SA 4J8UA 3AZFB 1HTAA 5B1LD 5AVBD 3VH6T 5DNMA 4YS3C 3REKB 3UTBB 3MGPD 4WU9A 3C1BB 1BH8A 3X1TA 5B32A 5B40A 3B0CT 4H9PA 3REJB 3W97C 3O62C 1P3PC 3B6GB 5B31C 3R45B 4LD9B 2FJ7C 2HIOD 1P3MD 1KX5B 2ZY3A 3WTPC 3AFAC 1F66D 3REKA 3EPKA 3MGRD 3UTBA 5AV6B 5B2IB 5AY8B 2W8SA 3MVDC 5CPIB 3REJA 1W2EA 1P3MC 3KXBD 3MGSB 4G91B 1M19D 3B6GA 3W96B 3R45A 3UTAD 4XZQB 5GXQC 1AOIC 5AV5B 4LD9A 1KX5A 1P3IB 3REIC 5B33D 3AZNB 1Z2CB 2ZY5A 1JFIB 1P34D 3AV1D 2G5IC 5AV6A 4YM6C 2F8NG 5B2IA 5AY8A 4QLCB 5CPIA 2F8ND 3AZKD 2ZM5A 3MGSA 3W96A 1P3FC 4XZQA 3VH5W 4WU8B 5F99C 5CP6A 3NQJB 3RELD 3AZMD 1P3IA 3AZNA 1JFIA 4JJND 3LZ1C 3AN2B 5GT0B 5DNNB 3AYWC 4E44A 3P5JB 4QLCA 1P3BB 5AV8B 5GT3C 3KSYA 5B1MA 2FFFB 1ULYA 4YS3B 4WU8A 3WKJC 3NQJA 5CPKC 1U35D 4J8UD 3AN2A 5GT0A 5DNNA 2Y2GA 3WTPE 3W97B 3O62B 3A1IA 5AV8A 1P3PB 4WU9D 5B31B 5B32G 2FJ7B 1Q9CA 1B6WA 5B40D 3B0CW 3WTPB 3AFAB 1BH9B 4J8VC 3AZFD 4NE5A 2F8NH 3MVDB 1N1JB 1P3MB 3W97A 5B1LA 2RVQC 3O62A 1P3PA 3A6NC 5B31A 3REKD 3UTBD 5GXQB 4NE3A 3C1BD 1AOIB 1P3OC 2FJ7A 5AVCC 3LZ0C 3WTPA 3REIB 3REJD 3AFAA 2LY8A 4J8XC 1BH9A 4YM6B 3B6GD 1ZLAC 4CAYB 1N1JA 2Y2NA 3X1UC 1P3MA 3AV2C 1KX5D 4LD9D 4G92C 1F66A 3MGRA 1P3FB 3W99C 5GXQA 5AV6D 2J8PA 5B2ID 5AY8D 5F99B 3REIA 5CPID 3LZ1B 3MGSD 1M19A 3UTAA 3W96D 3AYWB 4XZQD 5AV5D 4CAYA 3KWQC 5GT3B 3AZND 1P3ID 1P3FA 3C1CC 3NQUB 3WKJB 5F99A 3KUYC 4QLCD 5CPKB 3LZ1A 1T3UA 3AYWA 4H9RB 4E45A 3VH5T 2F8NK 1TZYC 5B2JC 4WU8D 5GT3A 3AN2D 5GT0D 3NQUA 1P3GC 5DNND 3WKJA 3EG5B 3MGQC 4AWLC 5CPKA 1P3BD 5AV8D 2Y2HA 4J8VB 2JE5A 3H0LC 4H9RA 4R8PC 4YS3D 3A6NB 2Y2IA 5CHLB 1P3OB 5AVCB 3LZ0B 3VH6A 4J8XB 3W97D 3O62D 5CPJC 1P3PD 5B31D 1ZLAB 2FJ7D 3X1UB 3AV2B 2ZY4A 4G92B 3WTPD 3A6NA 3AFAD 1KX4C 3W99B 3AZEC 1P3OA 5AVCA 3AZFA 3W98C 3LZ0A 3MVDD 3B0DC 4J8XA 3AZLC 2Y2OA 3C1BA 5GXQD 1AOID 1ZLAA 2NQBC 1WWIA 2JSSA 3X1UA 2YFWB 3KWQB 3LJAC 4X23C 3REID 1P3KC 3B6FC 3C1CB 4YM6D 4ZUXC 1KU5A 5E5AC 3KUYB 2HUEC 3H0RC 4UPKA 2AROC 1P3AC 1P3FD 1TZYB 5JA4B 2YFWA 5F99D 5B2JB 3KWQA 4DQYB 3REHC 4H9OB 3LZ1D 3C1CA 3TU4C 3EPJA 3AYWD 1P3GB 5AV5A 3KUYA 3MGQB 4AWLB 3LELC 5GT3D 4EO5C 1TZYA 5JA4A 5B2JA 4R8PB 4XUJC 3WKJD 5CPKD 4H9OA 5AV9C 3AZGC 1P3GA 3MGQA 5G49B 5BT1D 5CPJB 3AL0C 1ID3C 3F6TA 3AZIC 2Y2QA 2IO5C 4R8PA 1KX4B 5BT1C 1P3BA 3AZEB 4J8VD 3W98B 2F2AC 3B0DB 5JRGC 3AZLB 2BG1A 2NZDC 2RVQD 4YS3A 3A6ND 2NQBB 2UWXA 1P3OD 5AVCD 3LJAB 4X23B 3LZ0D 1P3KB 4Z5TC 4J8XD 1KX4A 3B6FB 2VQRA 2JCHA 3AZEA 4ZUXB 5E5AB 1ZLAD 3W98A 5B0YC 3X1UD 3AV2D 3AZLA 2HUEB 1P3AB 2AROB 3W99D 2NQBA 3AZHC 3REHB 3MVDA 4X23A 4ZBJC 5FUGB 3WA9C 1P3KA 2G5HC 5GSUC 4ZUXA 1HQ3C 3TU4B 1AOIA 5E5AA 5DNMC 3H0MC 4DRAA 4Z66C 3KWQD 3LELB 1KX3C 3X1TC 1M18C 2PYOC 5B32C 1P3AA 2AROA 2CV5C 4EO5B 1M1AD 1A7WA 4YM6A 3C1CD 4XUJB 3KUYD 3REHA 3IP4C 5C3IC 5AV9B 3AZGB 3EPHA 3X1SC 3TU4A 1M1AC 4KUDC 1TZYD 5B2JD 3LELA 1ID3B 3VH5A 3AZIB 4J8WC 1P3GD 2IO5B 4XUJA 3MGQD 5AV9A 3AZGA 3X1VC 5JRGB 2NZDB 4R8PD 1S32C 1ID3A 5BNVB 3AZIA 4Z5TB 5BNXB 4KGCC 5CPJD 5CP6C 5B0YB 3AZJC 1EQZD 4WJ3C 2NZDA 5B31G 1KX4D 1WWSA 5BS7C 4J8VA 3AZHB 3AZED 5BNVA 5B0ZC 3W98D 4ZBJB 3WA9B 5GSUB 1EQZC 5BNXA 3AZLD 5B1MC 2DQNC 1HQ3B 5DNMB 2NQBD 1B67A 5B24C 5B0YA 4Z66B 1KX3B 3LJAD 4X23D 3X1TB 1M18B 2PYOB 1P3KD 5B32B 4HGAC 4H9PB 2CV5B 3B6FD 3AZHA 4ZUXD 5E5AD 3WA9A 3AV2A 5C3IB 5GSUA 3UT9C 4KHAB 3X1SB 2AROD 1HQ3A 1P3AD 1M1AB 3W99A 4KUDB 1TAFB 4Z66A 1P3LC 1KX3A 3REHD 1M18A 2PYOA 2Y2KA 2CV5A 4J8WB 5B1LC 5AVBC 3EPLA 3TU4D 3MGPC 3LELD 4H9NB 4KHAA 3X1VB 3X1SA 2CWEA 1M1AA 4KUDA 1BFMA 1R4VA 1TAFA 1S32B 4XUJD 2XD5A 4UUZB 2BYKB 2HIOC 5AV9D 4J8WA 3V9RB 3AZGD 3WAAD 1F66C 4KGCB 3MGRC 4H9NA 1ID3D 5CP6B 3X1VA 3MNND 3AZJB 3KXBC 3AZID 3WAAC 2Y2PA 1S32A 1M19C 3UTAC 4UUZA 2BYKA 5B0ZB 3MNNC 3V9RA 5B33C 5JRGD 2L5AA 1EQZB 4KGCA 4M6BA 5B1MB 3AV1C 1P34C 2NZDD 4CSRB 5B24B 3AZJA 3AZKC 5KDMB 4Z5TD 4HGAB 5G49A 5CPJA 5BS7A
chains in the Genus database with same CATH topology
3RELC 5B0ZA 3AZMC 5B0YD 4DRBA 1EQZA 4NE6A 2YFVB 4JJNC 3UT9B 4CSRA 2BYMB 5B24A 4WNNB 3AZHD 1P3LB 3WA9D 5KDMA 5GSUD 5B1LB 1HQ3D 5BO0B 5AVBB 5DNMD 3VH6W 3MGPB 4Z66D 3LJAA 1U35C 1KX3D 4H9SC 3X1TD 2YFVA 2Y2JA 4J8UC 3UT9A 5B32D 1M18D 2PYOD 3B6FA 2CV5D 1F1EA 2XD1A 2BYMA 4WNNA 1P3LA 4WU9C 4H9QB 4WV4B 3A1KA 2HIOB 5B40C 3X1SD 5AVBA 5BO0A 4Z2MG 1F66B 3MGPA 3MGRB 4KUDD 5FUGA 2DF4C 3AZFC 3KXBB 4J8WD 3WAAB 1M19B 4H9QA 3REKC 4NFTA 3UTBC 3UTAB 3C1BC 3FDDA 2HIOA 3MNNB 3X1VD 5B33B 3REJC 1P34B 3AV1B 1S32D 3B6GC 4LD9C 3B0BA 2F8NB 3KFUG 3KXBA 3AZKB 1KX5C 3WAAA 4KGCD 5AV6C 5B2IC 5AY8C 3RELB 3AZMB 3MNNA 5CP6D 5CPIC 5B33A 3AZJD 1P34A 4JJNB 3MGSC 3AV1A 4G91C 3W96C 4XZQC 5AV5C 2F8NA 1H3OB 2Y2LA 3AZKA 5B0ZD 1P3IC 5JRGA 3AZNC 5B1MD 3RELA 3AZMA 4QLCC 5B24D 2ZY2A 4Z2MH 1U35B 2Y2MA 4J8UB 4JJNA 4Z5TA 4WZSB 1H3OA 4WU8C 4WU9B 2RIQA 1PZRA 1BH8B 3UT9D 3AN2C 5B40B 5GT0C 5DNNC 1P3BC 5AV8C 1U35A 1P3LD 4H9SA 4J8UA 3AZFB 1HTAA 5B1LD 5AVBD 3VH6T 5DNMA 4YS3C 3REKB 3UTBB 3MGPD 4WU9A 3C1BB 1BH8A 3X1TA 5B32A 5B40A 3B0CT 4H9PA 3REJB 3W97C 3O62C 1P3PC 3B6GB 5B31C 3R45B 4LD9B 2FJ7C 2HIOD 1P3MD 1KX5B 2ZY3A 3WTPC 3AFAC 1F66D 3REKA 3EPKA 3MGRD 3UTBA 5AV6B 5B2IB 5AY8B 2W8SA 3MVDC 5CPIB 3REJA 1W2EA 1P3MC 3KXBD 3MGSB 4G91B 1M19D 3B6GA 3W96B 3R45A 3UTAD 4XZQB 5GXQC 1AOIC 5AV5B 4LD9A 1KX5A 1P3IB 3REIC 5B33D 3AZNB 1Z2CB 2ZY5A 1JFIB 1P34D 3AV1D 2G5IC 5AV6A 4YM6C 2F8NG 5B2IA 5AY8A 4QLCB 5CPIA 2F8ND 3AZKD 2ZM5A 3MGSA 3W96A 1P3FC 4XZQA 3VH5W 4WU8B 5F99C 5CP6A 3NQJB 3RELD 3AZMD 1P3IA 3AZNA 1JFIA 4JJND 3LZ1C 3AN2B 5GT0B 5DNNB 3AYWC 4E44A 3P5JB 4QLCA 1P3BB 5AV8B 5GT3C 3KSYA 5B1MA 2FFFB 1ULYA 4YS3B 4WU8A 3WKJC 3NQJA 5CPKC 1U35D 4J8UD 3AN2A 5GT0A 5DNNA 2Y2GA 3WTPE 3W97B 3O62B 3A1IA 5AV8A 1P3PB 4WU9D 5B31B 5B32G 2FJ7B 1Q9CA 1B6WA 5B40D 3B0CW 3WTPB 3AFAB 1BH9B 4J8VC 3AZFD 4NE5A 2F8NH 3MVDB 1N1JB 1P3MB 3W97A 5B1LA 2RVQC 3O62A 1P3PA 3A6NC 5B31A 3REKD 3UTBD 5GXQB 4NE3A 3C1BD 1AOIB 1P3OC 2FJ7A 5AVCC 3LZ0C 3WTPA 3REIB 3REJD 3AFAA 2LY8A 4J8XC 1BH9A 4YM6B 3B6GD 1ZLAC 4CAYB 1N1JA 2Y2NA 3X1UC 1P3MA 3AV2C 1KX5D 4LD9D 4G92C 1F66A 3MGRA 1P3FB 3W99C 5GXQA 5AV6D 2J8PA 5B2ID 5AY8D 5F99B 3REIA 5CPID 3LZ1B 3MGSD 1M19A 3UTAA 3W96D 3AYWB 4XZQD 5AV5D 4CAYA 3KWQC 5GT3B 3AZND 1P3ID 1P3FA 3C1CC 3NQUB 3WKJB 5F99A 3KUYC 4QLCD 5CPKB 3LZ1A 1T3UA 3AYWA 4H9RB 4E45A 3VH5T 2F8NK 1TZYC 5B2JC 4WU8D 5GT3A 3AN2D 5GT0D 3NQUA 1P3GC 5DNND 3WKJA 3EG5B 3MGQC 4AWLC 5CPKA 1P3BD 5AV8D 2Y2HA 4J8VB 2JE5A 3H0LC 4H9RA 4R8PC 4YS3D 3A6NB 2Y2IA 5CHLB 1P3OB 5AVCB 3LZ0B 3VH6A 4J8XB 3W97D 3O62D 5CPJC 1P3PD 5B31D 1ZLAB 2FJ7D 3X1UB 3AV2B 2ZY4A 4G92B 3WTPD 3A6NA 3AFAD 1KX4C 3W99B 3AZEC 1P3OA 5AVCA 3AZFA 3W98C 3LZ0A 3MVDD 3B0DC 4J8XA 3AZLC 2Y2OA 3C1BA 5GXQD 1AOID 1ZLAA 2NQBC 1WWIA 2JSSA 3X1UA 2YFWB 3KWQB 3LJAC 4X23C 3REID 1P3KC 3B6FC 3C1CB 4YM6D 4ZUXC 1KU5A 5E5AC 3KUYB 2HUEC 3H0RC 4UPKA 2AROC 1P3AC 1P3FD 1TZYB 5JA4B 2YFWA 5F99D 5B2JB 3KWQA 4DQYB 3REHC 4H9OB 3LZ1D 3C1CA 3TU4C 3EPJA 3AYWD 1P3GB 5AV5A 3KUYA 3MGQB 4AWLB 3LELC 5GT3D 4EO5C 1TZYA 5JA4A 5B2JA 4R8PB 4XUJC 3WKJD 5CPKD 4H9OA 5AV9C 3AZGC 1P3GA 3MGQA 5G49B 5BT1D 5CPJB 3AL0C 1ID3C 3F6TA 3AZIC 2Y2QA 2IO5C 4R8PA 1KX4B 5BT1C 1P3BA 3AZEB 4J8VD 3W98B 2F2AC 3B0DB 5JRGC 3AZLB 2BG1A 2NZDC 2RVQD 4YS3A 3A6ND 2NQBB 2UWXA 1P3OD 5AVCD 3LJAB 4X23B 3LZ0D 1P3KB 4Z5TC 4J8XD 1KX4A 3B6FB 2VQRA 2JCHA 3AZEA 4ZUXB 5E5AB 1ZLAD 3W98A 5B0YC 3X1UD 3AV2D 3AZLA 2HUEB 1P3AB 2AROB 3W99D 2NQBA 3AZHC 3REHB 3MVDA 4X23A 4ZBJC 5FUGB 3WA9C 1P3KA 2G5HC 5GSUC 4ZUXA 1HQ3C 3TU4B 1AOIA 5E5AA 5DNMC 3H0MC 4DRAA 4Z66C 3KWQD 3LELB 1KX3C 3X1TC 1M18C 2PYOC 5B32C 1P3AA 2AROA 2CV5C 4EO5B 1M1AD 1A7WA 4YM6A 3C1CD 4XUJB 3KUYD 3REHA 3IP4C 5C3IC 5AV9B 3AZGB 3EPHA 3X1SC 3TU4A 1M1AC 4KUDC 1TZYD 5B2JD 3LELA 1ID3B 3VH5A 3AZIB 4J8WC 1P3GD 2IO5B 4XUJA 3MGQD 5AV9A 3AZGA 3X1VC 5JRGB 2NZDB 4R8PD 1S32C 1ID3A 5BNVB 3AZIA 4Z5TB 5BNXB 4KGCC 5CPJD 5CP6C 5B0YB 3AZJC 1EQZD 4WJ3C 2NZDA 5B31G 1KX4D 1WWSA 5BS7C 4J8VA 3AZHB 3AZED 5BNVA 5B0ZC 3W98D 4ZBJB 3WA9B 5GSUB 1EQZC 5BNXA 3AZLD 5B1MC 2DQNC 1HQ3B 5DNMB 2NQBD 1B67A 5B24C 5B0YA 4Z66B 1KX3B 3LJAD 4X23D 3X1TB 1M18B 2PYOB 1P3KD 5B32B 4HGAC 4H9PB 2CV5B 3B6FD 3AZHA 4ZUXD 5E5AD 3WA9A 3AV2A 5C3IB 5GSUA 3UT9C 4KHAB 3X1SB 2AROD 1HQ3A 1P3AD 1M1AB 3W99A 4KUDB 1TAFB 4Z66A 1P3LC 1KX3A 3REHD 1M18A 2PYOA 2Y2KA 2CV5A 4J8WB 5B1LC 5AVBC 3EPLA 3TU4D 3MGPC 3LELD 4H9NB 4KHAA 3X1VB 3X1SA 2CWEA 1M1AA 4KUDA 1BFMA 1R4VA 1TAFA 1S32B 4XUJD 2XD5A 4UUZB 2BYKB 2HIOC 5AV9D 4J8WA 3V9RB 3AZGD 3WAAD 1F66C 4KGCB 3MGRC 4H9NA 1ID3D 5CP6B 3X1VA 3MNND 3AZJB 3KXBC 3AZID 3WAAC 2Y2PA 1S32A 1M19C 3UTAC 4UUZA 2BYKA 5B0ZB 3MNNC 3V9RA 5B33C 5JRGD 2L5AA 1EQZB 4KGCA 4M6BA 5B1MB 3AV1C 1P34C 2NZDD 4CSRB 5B24B 3AZJA 3AZKC 5KDMB 4Z5TD 4HGAB 5G49A 5CPJA 5BS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REL C;  5B0Z A;  3AZM C;  5B0Y D;  4DRB A;  1EQZ A;  4NE6 A;  2YFV B;  4JJN C;  3UT9 B;  4CSR A;  2BYM B;  5B24 A;  4WNN B;  3AZH D;  1P3L B;  3WA9 D;  5KDM A;  5GSU D;  5B1L B;  1HQ3 D;  5BO0 B;  5AVB B;  5DNM D;  3VH6 W;  3MGP B;  4Z66 D;  3LJA A;  1U35 C;  1KX3 D;  4H9S C;  3X1T D;  2YFV A;  4J8U C;  3UT9 A;  1M18 D;  5B32 D;  2PYO D;  3B6F A;  2CV5 D;  1F1E A;  2BYM A;  4WNN A;  1P3L A;  4WU9 C;  4H9Q B;  4WV4 B;  2HIO B;  5B40 C;  3X1S D;  5AVB A;  5BO0 A;  4Z2M G;  1F66 B;  3MGP A;  3MGR B;  4KUD D;  5FUG A;  3AZF C;  3KXB B;  4J8W D;  3WAA B;  1M19 B;  4H9Q A;  3REK C;  4NFT A;  3UTB C;  3UTA B;  3C1B C;  2HIO A;  3MNN B;  3X1V D;  5B33 B;  3REJ C;  1P34 B;  3AV1 B;  1S32 D;  3B6G C;  4LD9 C;  3B0B A;  2F8N B;  3KXB A;  3AZK B;  1KX5 C;  3WAA A;  4KGC D;  5AV6 C;  5B2I C;  5AY8 C;  3REL B;  3AZM B;  3MNN A;  5CP6 D;  5CPI C;  5B33 A;  3AZJ D;  1P34 A;  4JJN B;  3MGS C;  3AV1 A;  4G91 C;  3W96 C;  4XZQ C;  5AV5 C;  2F8N A;  1H3O B;  3AZK A;  5B0Z D;  1P3I C;  5JRG A;  3AZN C;  5B1M D;  3REL A;  3AZM A;  4QLC C;  5B24 D;  4Z2M H;  1U35 B;  4J8U B;  4JJN A;  4Z5T A;  4WZS B;  1H3O A;  4WU8 C;  4WU9 B;  1BH8 B;  3UT9 D;  3AN2 C;  5B40 B;  5GT0 C;  5DNN C;  1P3B C;  5AV8 C;  1U35 A;  1P3L D;  4H9S A;  4J8U A;  3AZF B;  1HTA A;  5B1L D;  5AVB D;  3VH6 T;  5DNM A;  4YS3 C;  3REK B;  3UTB B;  3MGP D;  4WU9 A;  3C1B B;  1BH8 A;  3X1T A;  5B32 A;  5B40 A;  3B0C T;  4H9P A;  3REJ B;  3W97 C;  3O62 C;  1P3P C;  3B6G B;  5B31 C;  3R45 B;  4LD9 B;  2FJ7 C;  2HIO D;  1P3M D;  1KX5 B;  3WTP C;  3AFA C;  1F66 D;  3REK A;  3UTB A;  3MGR D;  5AV6 B;  5B2I B;  5AY8 B;  3MVD C;  5CPI B;  3REJ A;  1P3M C;  3KXB D;  3MGS B;  4G91 B;  1M19 D;  3B6G A;  3W96 B;  3R45 A;  3UTA D;  4XZQ B;  5GXQ C;  1AOI C;  5AV5 B;  4LD9 A;  1KX5 A;  1P3I B;  3REI C;  5B33 D;  3AZN B;  1JFI B;  1P34 D;  3AV1 D;  5AV6 A;  4YM6 C;  2F8N G;  5B2I A;  5AY8 A;  4QLC B;  5CPI A;  2F8N D;  3AZK D;  3MGS A;  3W96 A;  1P3F C;  4XZQ A;  3VH5 W;  4WU8 B;  5F99 C;  5CP6 A;  3NQJ B;  3REL D;  3AZM D;  1P3I A;  3AZN A;  1JFI A;  4JJN D;  3LZ1 C;  3AN2 B;  5GT0 B;  5DNN B;  3AYW C;  4E44 A;  4QLC A;  1P3B B;  5AV8 B;  5GT3 C;  3KSY A;  5B1M A;  1ULY A;  4YS3 B;  4WU8 A;  3WKJ C;  3NQJ A;  5CPK C;  1U35 D;  4J8U D;  3AN2 A;  5GT0 A;  5DNN A;  3WTP E;  3W97 B;  3O62 B;  1P3P B;  5AV8 A;  4WU9 D;  5B31 B;  5B32 G;  2FJ7 B;  1Q9C A;  1B6W A;  5B40 D;  3B0C W;  3WTP B;  3AFA B;  1BH9 B;  4J8V C;  3AZF D;  4NE5 A;  2F8N H;  3MVD B;  1N1J B;  1P3M B;  3W97 A;  5B1L A;  2RVQ C;  3O62 A;  1P3P A;  3A6N C;  5B31 A;  3REK D;  3UTB D;  5GXQ B;  4NE3 A;  3C1B D;  1AOI B;  1P3O C;  2FJ7 A;  5AVC C;  3LZ0 C;  3WTP A;  3REI B;  3REJ D;  3AFA A;  2LY8 A;  4J8X C;  1BH9 A;  4YM6 B;  3B6G D;  1ZLA C;  4CAY B;  1N1J A;  3X1U C;  1P3M A;  4LD9 D;  3AV2 C;  1KX5 D;  4G92 C;  1F66 A;  3MGR A;  1P3F B;  3W99 C;  5GXQ A;  5AV6 D;  5B2I D;  5AY8 D;  5F99 B;  3REI A;  5CPI D;  3LZ1 B;  3MGS D;  1M19 A;  3UTA A;  3W96 D;  3AYW B;  4XZQ D;  5AV5 D;  4CAY A;  3KWQ C;  5GT3 B;  3AZN D;  1P3I D;  1P3F A;  3C1C C;  3NQU B;  3WKJ B;  5F99 A;  3KUY C;  4QLC D;  5CPK B;  3LZ1 A;  3AYW A;  4H9R B;  4E45 A;  3VH5 T;  2F8N K;  1TZY C;  5B2J C;  4WU8 D;  5GT3 A;  3AN2 D;  5GT0 D;  3NQU A;  1P3G C;  5DNN D;  3WKJ A;  3MGQ C;  4AWL C;  5CPK A;  1P3B D;  5AV8 D;  4J8V B;  4H9R A;  4R8P C;  4YS3 D;  3A6N B;  5CHL B;  1P3O B;  5AVC B;  3LZ0 B;  3VH6 A;  4J8X B;  3W97 D;  3O62 D;  5CPJ C;  1P3P D;  5B31 D;  1ZLA B;  2FJ7 D;  3X1U B;  3AV2 B;  4G92 B;  3WTP D;  3A6N A;  3AFA D;  1KX4 C;  3W99 B;  3AZE C;  1P3O A;  5AVC A;  3AZF A;  3W98 C;  3LZ0 A;  3MVD D;  3B0D C;  4J8X A;  3AZL C;  3C1B A;  5GXQ D;  1AOI D;  1ZLA A;  2NQB C;  1WWI A;  2JSS A;  3X1U A;  2YFW B;  3KWQ B;  3LJA C;  4X23 C;  3REI D;  1P3K C;  3B6F C;  3C1C B;  4YM6 D;  4ZUX C;  1KU5 A;  5E5A C;  3KUY B;  2HUE C;  1P3A C;  2ARO C;  1P3F D;  1TZY B;  5JA4 B;  2YFW A;  5F99 D;  5B2J B;  3KWQ A;  3REH C;  4H9O B;  3LZ1 D;  3C1C A;  3TU4 C;  1P3G B;  3AYW D;  5AV5 A;  3KUY A;  3MGQ B;  4AWL B;  3LEL C;  5GT3 D;  4EO5 C;  1TZY A;  5JA4 A;  5B2J A;  4R8P B;  4XUJ C;  3WKJ D;  5CPK D;  4H9O A;  5AV9 C;  3AZG C;  1P3G A;  3MGQ A;  5G49 B;  5BT1 D;  5CPJ B;  1ID3 C;  3AZI C;  4R8P A;  2IO5 C;  1KX4 B;  5BT1 C;  1P3B A;  3AZE B;  4J8V D;  3W98 B;  3B0D B;  5JRG C;  3AZL B;  2NZD C;  2RVQ D;  4YS3 A;  3A6N D;  2NQB B;  1P3O D;  5AVC D;  3LJA B;  4X23 B;  3LZ0 D;  1P3K B;  4Z5T C;  4J8X D;  1KX4 A;  3B6F B;  3AZE A;  4ZUX B;  5E5A B;  1ZLA D;  3W98 A;  5B0Y C;  3X1U D;  3AV2 D;  3AZL A;  2HUE B;  1P3A B;  2ARO B;  3W99 D;  2NQB A;  3AZH C;  3REH B;  3MVD A;  4X23 A;  4ZBJ C;  5FUG B;  3WA9 C;  1P3K A;  5GSU C;  4ZUX A;  1HQ3 C;  3TU4 B;  1AOI A;  5E5A A;  5DNM C;  4DRA A;  4Z66 C;  3KWQ D;  3LEL B;  1KX3 C;  3X1T C;  1M18 C;  2PYO C;  5B32 C;  1P3A A;  2ARO A;  2CV5 C;  4EO5 B;  1M1A D;  1A7W A;  4YM6 A;  3C1C D;  4XUJ B;  3KUY D;  3REH A;  5C3I C;  5AV9 B;  3AZG B;  3X1S C;  3TU4 A;  1M1A C;  4KUD C;  1TZY D;  5B2J D;  3LEL A;  1ID3 B;  3VH5 A;  3AZI B;  4J8W C;  1P3G D;  2IO5 B;  4XUJ A;  3MGQ D;  5AV9 A;  3AZG A;  3X1V C;  5JRG B;  2NZD B;  4R8P D;  1S32 C;  1ID3 A;  5BNV B;  3AZI A;  4Z5T B;  5BNX B;  4KGC C;  5CPJ D;  5CP6 C;  5B0Y B;  3AZJ C;  1EQZ D;  2NZD A;  5B31 G;  1KX4 D;  1WWS A;  5BS7 C;  4J8V A;  3AZH B;  3AZE D;  5BNV A;  5B0Z C;  3W98 D;  4ZBJ B;  3WA9 B;  5GSU B;  1EQZ C;  5BNX A;  3AZL D;  5B1M C;  1HQ3 B;  5DNM B;  2NQB D;  1B67 A;  5B24 C;  5B0Y A;  4Z66 B;  1KX3 B;  3LJA D;  4X23 D;  3X1T B;  1M18 B;  2PYO B;  1P3K D;  5B32 B;  4HGA C;  4H9P B;  2CV5 B;  3B6F D;  3AZH A;  4ZUX D;  5E5A D;  3WA9 A;  3AV2 A;  5C3I B;  5GSU A;  3UT9 C;  4KHA B;  3X1S B;  2ARO D;  1HQ3 A;  1P3A D;  1M1A B;  3W99 A;  4KUD B;  1TAF B;  4Z66 A;  1P3L C;  1KX3 A;  3REH D;  1M18 A;  2PYO A;  2CV5 A;  4J8W B;  5B1L C;  5AVB C;  3TU4 D;  3MGP C;  3LEL D;  4H9N B;  4KHA A;  3X1V B;  3X1S A;  2CWE A;  1M1A A;  4KUD A;  1BFM A;  1R4V A;  1TAF A;  1S32 B;  4XUJ D;  4UUZ B;  2BYK B;  2HIO C;  5AV9 D;  4J8W A;  3V9R B;  3AZG D;  3WAA D;  1F66 C;  4KGC B;  3MGR C;  4H9N A;  1ID3 D;  5CP6 B;  3X1V A;  3MNN D;  3AZJ B;  3KXB C;  3AZI D;  3WAA C;  1S32 A;  1M19 C;  3UTA C;  4UUZ A;  2BYK A;  5B0Z B;  3MNN C;  3V9R A;  5B33 C;  5JRG D;  2L5A A;  1EQZ B;  4KGC A;  4M6B A;  5B1M B;  3AV1 C;  1P34 C;  2NZD D;  4CSR B;  5B24 B;  3AZJ A;  3AZK C;  5KDM B;  4Z5T D;  4HGA B;  5G49 A;  5CPJ A;  5BS7 A; 
#chains in the Genus database with same CATH topology
 3REL C;  5B0Z A;  3AZM C;  5B0Y D;  4DRB A;  1EQZ A;  4NE6 A;  2YFV B;  4JJN C;  3UT9 B;  4CSR A;  2BYM B;  5B24 A;  4WNN B;  3AZH D;  1P3L B;  3WA9 D;  5KDM A;  5GSU D;  5B1L B;  1HQ3 D;  5BO0 B;  5AVB B;  5DNM D;  3VH6 W;  3MGP B;  4Z66 D;  3LJA A;  1U35 C;  1KX3 D;  4H9S C;  3X1T D;  2YFV A;  2Y2J A;  4J8U C;  3UT9 A;  5B32 D;  1M18 D;  2PYO D;  3B6F A;  2CV5 D;  1F1E A;  2XD1 A;  2BYM A;  4WNN A;  1P3L A;  4WU9 C;  4H9Q B;  4WV4 B;  3A1K A;  2HIO B;  5B40 C;  3X1S D;  5AVB A;  5BO0 A;  4Z2M G;  1F66 B;  3MGP A;  3MGR B;  4KUD D;  5FUG A;  2DF4 C;  3AZF C;  3KXB B;  4J8W D;  3WAA B;  1M19 B;  4H9Q A;  3REK C;  4NFT A;  3UTB C;  3UTA B;  3C1B C;  3FDD A;  2HIO A;  3MNN B;  3X1V D;  5B33 B;  3REJ C;  1P34 B;  3AV1 B;  1S32 D;  3B6G C;  4LD9 C;  3B0B A;  2F8N B;  3KFU G;  3KXB A;  3AZK B;  1KX5 C;  3WAA A;  4KGC D;  5AV6 C;  5B2I C;  5AY8 C;  3REL B;  3AZM B;  3MNN A;  5CP6 D;  5CPI C;  5B33 A;  3AZJ D;  1P34 A;  4JJN B;  3MGS C;  3AV1 A;  4G91 C;  3W96 C;  4XZQ C;  5AV5 C;  2F8N A;  1H3O B;  2Y2L A;  3AZK A;  5B0Z D;  1P3I C;  5JRG A;  3AZN C;  5B1M D;  3REL A;  3AZM A;  4QLC C;  5B24 D;  2ZY2 A;  4Z2M H;  1U35 B;  2Y2M A;  4J8U B;  4JJN A;  4Z5T A;  4WZS B;  1H3O A;  4WU8 C;  4WU9 B;  2RIQ A;  1PZR A;  1BH8 B;  3UT9 D;  3AN2 C;  5B40 B;  5GT0 C;  5DNN C;  1P3B C;  5AV8 C;  1U35 A;  1P3L D;  4H9S A;  4J8U A;  3AZF B;  1HTA A;  5B1L D;  5AVB D;  3VH6 T;  5DNM A;  4YS3 C;  3REK B;  3UTB B;  3MGP D;  4WU9 A;  3C1B B;  1BH8 A;  3X1T A;  5B32 A;  5B40 A;  3B0C T;  4H9P A;  3REJ B;  3W97 C;  3O62 C;  1P3P C;  3B6G B;  5B31 C;  3R45 B;  4LD9 B;  2FJ7 C;  2HIO D;  1P3M D;  1KX5 B;  2ZY3 A;  3WTP C;  3AFA C;  1F66 D;  3REK A;  3EPK A;  3MGR D;  3UTB A;  5AV6 B;  5B2I B;  5AY8 B;  2W8S A;  3MVD C;  5CPI B;  3REJ A;  1W2E A;  1P3M C;  3KXB D;  3MGS B;  4G91 B;  1M19 D;  3B6G A;  3W96 B;  3R45 A;  3UTA D;  4XZQ B;  5GXQ C;  1AOI C;  5AV5 B;  4LD9 A;  1KX5 A;  1P3I B;  3REI C;  5B33 D;  3AZN B;  1Z2C B;  2ZY5 A;  1JFI B;  1P34 D;  3AV1 D;  2G5I C;  5AV6 A;  4YM6 C;  2F8N G;  5B2I A;  5AY8 A;  4QLC B;  5CPI A;  2F8N D;  3AZK D;  2ZM5 A;  3MGS A;  3W96 A;  1P3F C;  4XZQ A;  3VH5 W;  4WU8 B;  5F99 C;  5CP6 A;  3NQJ B;  3REL D;  3AZM D;  1P3I A;  3AZN A;  1JFI A;  4JJN D;  3LZ1 C;  3AN2 B;  5GT0 B;  5DNN B;  3AYW C;  4E44 A;  3P5J B;  4QLC A;  1P3B B;  5AV8 B;  5GT3 C;  3KSY A;  5B1M A;  2FFF B;  1ULY A;  4YS3 B;  4WU8 A;  3WKJ C;  3NQJ A;  5CPK C;  1U35 D;  4J8U D;  3AN2 A;  5GT0 A;  5DNN A;  2Y2G A;  3WTP E;  3W97 B;  3O62 B;  3A1I A;  5AV8 A;  1P3P B;  4WU9 D;  5B31 B;  5B32 G;  2FJ7 B;  1Q9C A;  1B6W A;  5B40 D;  3B0C W;  3WTP B;  3AFA B;  1BH9 B;  4J8V C;  3AZF D;  4NE5 A;  2F8N H;  3MVD B;  1N1J B;  1P3M B;  3W97 A;  5B1L A;  2RVQ C;  3O62 A;  1P3P A;  3A6N C;  5B31 A;  3REK D;  3UTB D;  5GXQ B;  4NE3 A;  3C1B D;  1AOI B;  1P3O C;  2FJ7 A;  5AVC C;  3LZ0 C;  3WTP A;  3REI B;  3REJ D;  3AFA A;  2LY8 A;  4J8X C;  1BH9 A;  4YM6 B;  3B6G D;  1ZLA C;  4CAY B;  1N1J A;  2Y2N A;  3X1U C;  1P3M A;  3AV2 C;  1KX5 D;  4LD9 D;  4G92 C;  1F66 A;  3MGR A;  1P3F B;  3W99 C;  5GXQ A;  5AV6 D;  2J8P A;  5B2I D;  5AY8 D;  5F99 B;  3REI A;  5CPI D;  3LZ1 B;  3MGS D;  1M19 A;  3UTA A;  3W96 D;  3AYW B;  4XZQ D;  5AV5 D;  4CAY A;  3KWQ C;  5GT3 B;  3AZN D;  1P3I D;  1P3F A;  3C1C C;  3NQU B;  3WKJ B;  5F99 A;  3KUY C;  4QLC D;  5CPK B;  3LZ1 A;  1T3U A;  3AYW A;  4H9R B;  4E45 A;  3VH5 T;  2F8N K;  1TZY C;  5B2J C;  4WU8 D;  5GT3 A;  3AN2 D;  5GT0 D;  3NQU A;  1P3G C;  5DNN D;  3WKJ A;  3EG5 B;  3MGQ C;  4AWL C;  5CPK A;  1P3B D;  5AV8 D;  2Y2H A;  4J8V B;  2JE5 A;  3H0L C;  4H9R A;  4R8P C;  4YS3 D;  3A6N B;  2Y2I A;  5CHL B;  1P3O B;  5AVC B;  3LZ0 B;  3VH6 A;  4J8X B;  3W97 D;  3O62 D;  5CPJ C;  1P3P D;  5B31 D;  1ZLA B;  2FJ7 D;  3X1U B;  3AV2 B;  2ZY4 A;  4G92 B;  3WTP D;  3A6N A;  3AFA D;  1KX4 C;  3W99 B;  3AZE C;  1P3O A;  5AVC A;  3AZF A;  3W98 C;  3LZ0 A;  3MVD D;  3B0D C;  4J8X A;  3AZL C;  2Y2O A;  3C1B A;  5GXQ D;  1AOI D;  1ZLA A;  2NQB C;  1WWI A;  2JSS A;  3X1U A;  2YFW B;  3KWQ B;  3LJA C;  4X23 C;  3REI D;  1P3K C;  3B6F C;  3C1C B;  4YM6 D;  4ZUX C;  1KU5 A;  5E5A C;  3KUY B;  2HUE C;  3H0R C;  4UPK A;  2ARO C;  1P3A C;  1P3F D;  1TZY B;  5JA4 B;  2YFW A;  5F99 D;  5B2J B;  3KWQ A;  4DQY B;  3REH C;  4H9O B;  3LZ1 D;  3C1C A;  3TU4 C;  3EPJ A;  3AYW D;  1P3G B;  5AV5 A;  3KUY A;  3MGQ B;  4AWL B;  3LEL C;  5GT3 D;  4EO5 C;  1TZY A;  5JA4 A;  5B2J A;  4R8P B;  4XUJ C;  3WKJ D;  5CPK D;  4H9O A;  5AV9 C;  3AZG C;  1P3G A;  3MGQ A;  5G49 B;  5BT1 D;  5CPJ B;  3AL0 C;  1ID3 C;  3F6T A;  3AZI C;  2Y2Q A;  2IO5 C;  4R8P A;  1KX4 B;  5BT1 C;  1P3B A;  3AZE B;  4J8V D;  3W98 B;  2F2A C;  3B0D B;  5JRG C;  3AZL B;  2BG1 A;  2NZD C;  2RVQ D;  4YS3 A;  3A6N D;  2NQB B;  2UWX A;  1P3O D;  5AVC D;  3LJA B;  4X23 B;  3LZ0 D;  1P3K B;  4Z5T C;  4J8X D;  1KX4 A;  3B6F B;  2VQR A;  2JCH A;  3AZE A;  4ZUX B;  5E5A B;  1ZLA D;  3W98 A;  5B0Y C;  3X1U D;  3AV2 D;  3AZL A;  2HUE B;  1P3A B;  2ARO B;  3W99 D;  2NQB A;  3AZH C;  3REH B;  3MVD A;  4X23 A;  4ZBJ C;  5FUG B;  3WA9 C;  1P3K A;  2G5H C;  5GSU C;  4ZUX A;  1HQ3 C;  3TU4 B;  1AOI A;  5E5A A;  5DNM C;  3H0M C;  4DRA A;  4Z66 C;  3KWQ D;  3LEL B;  1KX3 C;  3X1T C;  1M18 C;  2PYO C;  5B32 C;  1P3A A;  2ARO A;  2CV5 C;  4EO5 B;  1M1A D;  1A7W A;  4YM6 A;  3C1C D;  4XUJ B;  3KUY D;  3REH A;  3IP4 C;  5C3I C;  5AV9 B;  3AZG B;  3EPH A;  3X1S C;  3TU4 A;  1M1A C;  4KUD C;  1TZY D;  5B2J D;  3LEL A;  1ID3 B;  3VH5 A;  3AZI B;  4J8W C;  1P3G D;  2IO5 B;  4XUJ A;  3MGQ D;  5AV9 A;  3AZG A;  3X1V C;  5JRG B;  2NZD B;  4R8P D;  1S32 C;  1ID3 A;  5BNV B;  3AZI A;  4Z5T B;  5BNX B;  4KGC C;  5CPJ D;  5CP6 C;  5B0Y B;  3AZJ C;  1EQZ D;  4WJ3 C;  2NZD A;  5B31 G;  1KX4 D;  1WWS A;  5BS7 C;  4J8V A;  3AZH B;  3AZE D;  5BNV A;  5B0Z C;  3W98 D;  4ZBJ B;  3WA9 B;  5GSU B;  1EQZ C;  5BNX A;  3AZL D;  5B1M C;  2DQN C;  1HQ3 B;  5DNM B;  2NQB D;  1B67 A;  5B24 C;  5B0Y A;  4Z66 B;  1KX3 B;  3LJA D;  4X23 D;  3X1T B;  1M18 B;  2PYO B;  1P3K D;  5B32 B;  4HGA C;  4H9P B;  2CV5 B;  3B6F D;  3AZH A;  4ZUX D;  5E5A D;  3WA9 A;  3AV2 A;  5C3I B;  5GSU A;  3UT9 C;  4KHA B;  3X1S B;  2ARO D;  1HQ3 A;  1P3A D;  1M1A B;  3W99 A;  4KUD B;  1TAF B;  4Z66 A;  1P3L C;  1KX3 A;  3REH D;  1M18 A;  2PYO A;  2Y2K A;  2CV5 A;  4J8W B;  5B1L C;  5AVB C;  3EPL A;  3TU4 D;  3MGP C;  3LEL D;  4H9N B;  4KHA A;  3X1V B;  3X1S A;  2CWE A;  1M1A A;  4KUD A;  1BFM A;  1R4V A;  1TAF A;  1S32 B;  4XUJ D;  2XD5 A;  4UUZ B;  2BYK B;  2HIO C;  5AV9 D;  4J8W A;  3V9R B;  3AZG D;  3WAA D;  1F66 C;  4KGC B;  3MGR C;  4H9N A;  1ID3 D;  5CP6 B;  3X1V A;  3MNN D;  3AZJ B;  3KXB C;  3AZI D;  3WAA C;  2Y2P A;  1S32 A;  1M19 C;  3UTA C;  4UUZ A;  2BYK A;  5B0Z B;  3MNN C;  3V9R A;  5B33 C;  5JRG D;  2L5A A;  1EQZ B;  4KGC A;  4M6B A;  5B1M B;  3AV1 C;  1P34 C;  2NZD D;  4CSR B;  5B24 B;  3AZJ A;  3AZK C;  5KDM B;  4Z5T D;  4HGA B;  5G49 A;  5CPJ A;  5BS7 A; 
#chains in the Genus database with same CATH homology
 3REL C;  5B0Z A;  3AZM C;  5B0Y D;  4DRB A;  1EQZ A;  4NE6 A;  2YFV B;  4JJN C;  3UT9 B;  4CSR A;  2BYM B;  5B24 A;  4WNN B;  3AZH D;  1P3L B;  3WA9 D;  5KDM A;  5GSU D;  5B1L B;  1HQ3 D;  5BO0 B;  5AVB B;  5DNM D;  3VH6 W;  3MGP B;  4Z66 D;  3LJA A;  1U35 C;  1KX3 D;  4H9S C;  3X1T D;  2YFV A;  2Y2J A;  4J8U C;  3UT9 A;  5B32 D;  1M18 D;  2PYO D;  3B6F A;  2CV5 D;  1F1E A;  2XD1 A;  2BYM A;  4WNN A;  1P3L A;  4WU9 C;  4H9Q B;  4WV4 B;  3A1K A;  2HIO B;  5B40 C;  3X1S D;  5AVB A;  5BO0 A;  4Z2M G;  1F66 B;  3MGP A;  3MGR B;  4KUD D;  5FUG A;  2DF4 C;  3AZF C;  3KXB B;  4J8W D;  3WAA B;  1M19 B;  4H9Q A;  3REK C;  4NFT A;  3UTB C;  3UTA B;  3C1B C;  3FDD A;  2HIO A;  3MNN B;  3X1V D;  5B33 B;  3REJ C;  1P34 B;  3AV1 B;  1S32 D;  3B6G C;  4LD9 C;  3B0B A;  2F8N B;  3KFU G;  3KXB A;  3AZK B;  1KX5 C;  3WAA A;  4KGC D;  5AV6 C;  5B2I C;  5AY8 C;  3REL B;  3AZM B;  3MNN A;  5CP6 D;  5CPI C;  5B33 A;  3AZJ D;  1P34 A;  4JJN B;  3MGS C;  3AV1 A;  4G91 C;  3W96 C;  4XZQ C;  5AV5 C;  2F8N A;  1H3O B;  2Y2L A;  3AZK A;  5B0Z D;  1P3I C;  5JRG A;  3AZN C;  5B1M D;  3REL A;  3AZM A;  4QLC C;  5B24 D;  2ZY2 A;  4Z2M H;  1U35 B;  2Y2M A;  4J8U B;  4JJN A;  4Z5T A;  4WZS B;  1H3O A;  4WU8 C;  4WU9 B;  2RIQ A;  1PZR A;  1BH8 B;  3UT9 D;  3AN2 C;  5B40 B;  5GT0 C;  5DNN C;  1P3B C;  5AV8 C;  1U35 A;  1P3L D;  4H9S A;  4J8U A;  3AZF B;  1HTA A;  5B1L D;  5AVB D;  3VH6 T;  5DNM A;  4YS3 C;  3REK B;  3UTB B;  3MGP D;  4WU9 A;  3C1B B;  1BH8 A;  3X1T A;  5B32 A;  5B40 A;  3B0C T;  4H9P A;  3REJ B;  3W97 C;  3O62 C;  1P3P C;  3B6G B;  5B31 C;  3R45 B;  4LD9 B;  2FJ7 C;  2HIO D;  1P3M D;  1KX5 B;  2ZY3 A;  3WTP C;  3AFA C;  1F66 D;  3REK A;  3EPK A;  3MGR D;  3UTB A;  5AV6 B;  5B2I B;  5AY8 B;  2W8S A;  3MVD C;  5CPI B;  3REJ A;  1W2E A;  1P3M C;  3KXB D;  3MGS B;  4G91 B;  1M19 D;  3B6G A;  3W96 B;  3R45 A;  3UTA D;  4XZQ B;  5GXQ C;  1AOI C;  5AV5 B;  4LD9 A;  1KX5 A;  1P3I B;  3REI C;  5B33 D;  3AZN B;  1Z2C B;  2ZY5 A;  1JFI B;  1P34 D;  3AV1 D;  2G5I C;  5AV6 A;  4YM6 C;  2F8N G;  5B2I A;  5AY8 A;  4QLC B;  5CPI A;  2F8N D;  3AZK D;  2ZM5 A;  3MGS A;  3W96 A;  1P3F C;  4XZQ A;  3VH5 W;  4WU8 B;  5F99 C;  5CP6 A;  3NQJ B;  3REL D;  3AZM D;  1P3I A;  3AZN A;  1JFI A;  4JJN D;  3LZ1 C;  3AN2 B;  5GT0 B;  5DNN B;  3AYW C;  4E44 A;  3P5J B;  4QLC A;  1P3B B;  5AV8 B;  5GT3 C;  3KSY A;  5B1M A;  2FFF B;  1ULY A;  4YS3 B;  4WU8 A;  3WKJ C;  3NQJ A;  5CPK C;  1U35 D;  4J8U D;  3AN2 A;  5GT0 A;  5DNN A;  2Y2G A;  3WTP E;  3W97 B;  3O62 B;  3A1I A;  5AV8 A;  1P3P B;  4WU9 D;  5B31 B;  5B32 G;  2FJ7 B;  1Q9C A;  1B6W A;  5B40 D;  3B0C W;  3WTP B;  3AFA B;  1BH9 B;  4J8V C;  3AZF D;  4NE5 A;  2F8N H;  3MVD B;  1N1J B;  1P3M B;  3W97 A;  5B1L A;  2RVQ C;  3O62 A;  1P3P A;  3A6N C;  5B31 A;  3REK D;  3UTB D;  5GXQ B;  4NE3 A;  3C1B D;  1AOI B;  1P3O C;  2FJ7 A;  5AVC C;  3LZ0 C;  3WTP A;  3REI B;  3REJ D;  3AFA A;  2LY8 A;  4J8X C;  1BH9 A;  4YM6 B;  3B6G D;  1ZLA C;  4CAY B;  1N1J A;  2Y2N A;  3X1U C;  1P3M A;  3AV2 C;  1KX5 D;  4LD9 D;  4G92 C;  1F66 A;  3MGR A;  1P3F B;  3W99 C;  5GXQ A;  5AV6 D;  2J8P A;  5B2I D;  5AY8 D;  5F99 B;  3REI A;  5CPI D;  3LZ1 B;  3MGS D;  1M19 A;  3UTA A;  3W96 D;  3AYW B;  4XZQ D;  5AV5 D;  4CAY A;  3KWQ C;  5GT3 B;  3AZN D;  1P3I D;  1P3F A;  3C1C C;  3NQU B;  3WKJ B;  5F99 A;  3KUY C;  4QLC D;  5CPK B;  3LZ1 A;  1T3U A;  3AYW A;  4H9R B;  4E45 A;  3VH5 T;  2F8N K;  1TZY C;  5B2J C;  4WU8 D;  5GT3 A;  3AN2 D;  5GT0 D;  3NQU A;  1P3G C;  5DNN D;  3WKJ A;  3EG5 B;  3MGQ C;  4AWL C;  5CPK A;  1P3B D;  5AV8 D;  2Y2H A;  4J8V B;  2JE5 A;  3H0L C;  4H9R A;  4R8P C;  4YS3 D;  3A6N B;  2Y2I A;  5CHL B;  1P3O B;  5AVC B;  3LZ0 B;  3VH6 A;  4J8X B;  3W97 D;  3O62 D;  5CPJ C;  1P3P D;  5B31 D;  1ZLA B;  2FJ7 D;  3X1U B;  3AV2 B;  2ZY4 A;  4G92 B;  3WTP D;  3A6N A;  3AFA D;  1KX4 C;  3W99 B;  3AZE C;  1P3O A;  5AVC A;  3AZF A;  3W98 C;  3LZ0 A;  3MVD D;  3B0D C;  4J8X A;  3AZL C;  2Y2O A;  3C1B A;  5GXQ D;  1AOI D;  1ZLA A;  2NQB C;  1WWI A;  2JSS A;  3X1U A;  2YFW B;  3KWQ B;  3LJA C;  4X23 C;  3REI D;  1P3K C;  3B6F C;  3C1C B;  4YM6 D;  4ZUX C;  1KU5 A;  5E5A C;  3KUY B;  2HUE C;  3H0R C;  4UPK A;  2ARO C;  1P3A C;  1P3F D;  1TZY B;  5JA4 B;  2YFW A;  5F99 D;  5B2J B;  3KWQ A;  4DQY B;  3REH C;  4H9O B;  3LZ1 D;  3C1C A;  3TU4 C;  3EPJ A;  3AYW D;  1P3G B;  5AV5 A;  3KUY A;  3MGQ B;  4AWL B;  3LEL C;  5GT3 D;  4EO5 C;  1TZY A;  5JA4 A;  5B2J A;  4R8P B;  4XUJ C;  3WKJ D;  5CPK D;  4H9O A;  5AV9 C;  3AZG C;  1P3G A;  3MGQ A;  5G49 B;  5BT1 D;  5CPJ B;  3AL0 C;  1ID3 C;  3F6T A;  3AZI C;  2Y2Q A;  2IO5 C;  4R8P A;  1KX4 B;  5BT1 C;  1P3B A;  3AZE B;  4J8V D;  3W98 B;  2F2A C;  3B0D B;  5JRG C;  3AZL B;  2BG1 A;  2NZD C;  2RVQ D;  4YS3 A;  3A6N D;  2NQB B;  2UWX A;  1P3O D;  5AVC D;  3LJA B;  4X23 B;  3LZ0 D;  1P3K B;  4Z5T C;  4J8X D;  1KX4 A;  3B6F B;  2VQR A;  2JCH A;  3AZE A;  4ZUX B;  5E5A B;  1ZLA D;  3W98 A;  5B0Y C;  3X1U D;  3AV2 D;  3AZL A;  2HUE B;  1P3A B;  2ARO B;  3W99 D;  2NQB A;  3AZH C;  3REH B;  3MVD A;  4X23 A;  4ZBJ C;  5FUG B;  3WA9 C;  1P3K A;  2G5H C;  5GSU C;  4ZUX A;  1HQ3 C;  3TU4 B;  1AOI A;  5E5A A;  5DNM C;  3H0M C;  4DRA A;  4Z66 C;  3KWQ D;  3LEL B;  1KX3 C;  3X1T C;  1M18 C;  2PYO C;  5B32 C;  1P3A A;  2ARO A;  2CV5 C;  4EO5 B;  1M1A D;  1A7W A;  4YM6 A;  3C1C D;  4XUJ B;  3KUY D;  3REH A;  3IP4 C;  5C3I C;  5AV9 B;  3AZG B;  3EPH A;  3X1S C;  3TU4 A;  1M1A C;  4KUD C;  1TZY D;  5B2J D;  3LEL A;  1ID3 B;  3VH5 A;  3AZI B;  4J8W C;  1P3G D;  2IO5 B;  4XUJ A;  3MGQ D;  5AV9 A;  3AZG A;  3X1V C;  5JRG B;  2NZD B;  4R8P D;  1S32 C;  1ID3 A;  5BNV B;  3AZI A;  4Z5T B;  5BNX B;  4KGC C;  5CPJ D;  5CP6 C;  5B0Y B;  3AZJ C;  1EQZ D;  4WJ3 C;  2NZD A;  5B31 G;  1KX4 D;  1WWS A;  5BS7 C;  4J8V A;  3AZH B;  3AZE D;  5BNV A;  5B0Z C;  3W98 D;  4ZBJ B;  3WA9 B;  5GSU B;  1EQZ C;  5BNX A;  3AZL D;  5B1M C;  2DQN C;  1HQ3 B;  5DNM B;  2NQB D;  1B67 A;  5B24 C;  5B0Y A;  4Z66 B;  1KX3 B;  3LJA D;  4X23 D;  3X1T B;  1M18 B;  2PYO B;  1P3K D;  5B32 B;  4HGA C;  4H9P B;  2CV5 B;  3B6F D;  3AZH A;  4ZUX D;  5E5A D;  3WA9 A;  3AV2 A;  5C3I B;  5GSU A;  3UT9 C;  4KHA B;  3X1S B;  2ARO D;  1HQ3 A;  1P3A D;  1M1A B;  3W99 A;  4KUD B;  1TAF B;  4Z66 A;  1P3L C;  1KX3 A;  3REH D;  1M18 A;  2PYO A;  2Y2K A;  2CV5 A;  4J8W B;  5B1L C;  5AVB C;  3EPL A;  3TU4 D;  3MGP C;  3LEL D;  4H9N B;  4KHA A;  3X1V B;  3X1S A;  2CWE A;  1M1A A;  4KUD A;  1BFM A;  1R4V A;  1TAF A;  1S32 B;  4XUJ D;  2XD5 A;  4UUZ B;  2BYK B;  2HIO C;  5AV9 D;  4J8W A;  3V9R B;  3AZG D;  3WAA D;  1F66 C;  4KGC B;  3MGR C;  4H9N A;  1ID3 D;  5CP6 B;  3X1V A;  3MNN D;  3AZJ B;  3KXB C;  3AZI D;  3WAA C;  2Y2P A;  1S32 A;  1M19 C;  3UTA C;  4UUZ A;  2BYK A;  5B0Z B;  3MNN C;  3V9R A;  5B33 C;  5JRG D;  2L5A A;  1EQZ B;  4KGC A;  4M6B A;  5B1M B;  3AV1 C;  1P34 C;  2NZD D;  4CSR B;  5B24 B;  3AZJ A;  3AZK C;  5KDM B;  4Z5T D;  4HGA B;  5G49 A;  5CPJ A;  5BS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...