5E5AD

Crystal structure of the chromatin-tethering domain of human cytomegalovirus ie1 protein bound to the nucleosome core particle
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
98
structure length
98
Chain Sequence
b'KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (146-MER)
publication title Human cytomegalovirus IE1 protein alters the higher-order chromatin structure by targeting the acidic patch of the nucleosome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/viral protein/dna
total genus 37
structure length 98
sequence length 98
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5e5aD00
3UTBA 3LZ1A 5DNND 2NQBA 1P3IC 5AY8C 2NZDD 3C1BC 3WA9B 3TU4D 4LD9C 3REKB 5B1MA 5B2JA 4XZQC 3REJC 3MGQA 4G91C 4WU8D 3WAAB 4ZUXC 3W99D 4Z66D 5AV8B 3KXBC 1HQ3D 3MGPC 4J8UA 1ID3B 3LELB 5BT1C 5CP6A 3AZND 1P34C 1N1JA 3B0CT 3W96B 1P3MB 4KHAB 4R8PB 5AVBC 5CPIB 2HIOD 3X1TD 5JRGA 1M18C 3AZMA 5FUGB 3O62A 5B0YD 4KUDC 5B40C 1AOIB 2NZDA 3B0DC 3X1SB 3WTPD 3AZLC 2AROD 3LZ1B 5AV5A 3VH5W 4QLCC 4XUJC 4WU8A 3REID 5B24C 2BYMA 5AV6C 4Z66A 3A6NC 4WU9C 1P3ID 5AY8D 4J8XC 1HQ3A 3C1BD 1P3FA 4H9PB 4LD9D 2JSSA 4KGCC 3AFAD 5G49B 4X23C 3AZNA 4XZQD 3REJD 1M1AA 2CV5A 5F99A 4J8UB 4H9SC 2HIOA 5BS7A 5CP6B 3KXBD 5AV8C 4Z2MH 1KX5B 3WKJA 5BT1D 5GSUA 1P34D 5JRGB 3AZFB 3LELC 3REHA 5AVBD 5BO0A 1ZLAC 5E5AA 1M18D 1TAFA 4R8PC 1HTAA 3AV1B 3AZEC 4KUDD 1KX3B 3W97A 5B1LC 5GT3C 5AY8A 3AZKA 5AV5B 3C1BA 1AOIC 1P3BC 3X1VC 3AZLD 2IO5C 1P3GA 5CPJD 4CSRA 3MNNB 2F8ND 4QLCD 4XUJD 4ZUXA 5B24D 5AV6D 3A6ND 3AN2B 4WU9D 3LJAC 4J8XD 2CV5B 3MGPA 5F99B 4KGCD 4X23D 1P3KC 4Z5TB 4ZBJC 4CAYB 5AVBA 1TZYC 4WNNA 3AZJC 5AV8D 3X1UC 2RVQC 5B40A 5BO0B 1ID3D 1TAFB 3LELD 3KUYC 5B0ZC 1ZLAD 1KU5A 3W97B 3AZHC 3MGRB 4R8PD 3AZED 3B6FB 3AZKB 2LY8A 4QLCA 4XUJA 4J8WB 3C1CB 2PYOB 5B1LD 5GT3D 5B24A 5AV6A 4JJNC 4YS3A 5KDMA 1P3GB 5GXQB 4J8XA 4CSRB 3MGSB 1AOID 2FJ7B 3VH5A 1P3BD 3X1VD 3MVDC 3W98B 4X23A 1P3LB 3VH5T 1KX4A 4H9SA 1EQZA 1BH9B 2F8NK 3LJAD 3B6GC 5CPKA 1B67A 4J8VB 3UTAA 1BFMA 3UT9A 1U35A 4EO5B 4WNNB 1P3KD 4YM6C 1ZLAA 3R45A 3LZ0C 1TZYD 3AFAC 5AVCA 3AZEA 3AZJD 1H3OA 1P3OC 5GT0A 3X1UD 2RVQD 5B32A 3AV2A 5B1LA 1P3AC 3AZGC 4NE6A 3KUYD 5B0ZD 3WTPE 3X1VA 5AV9C 3AZHD 4YS3B 5KDMB 4UUZA 3MGRC 4AWLB 2CWEA 3KWQB 4JJND 1F66A 3AZIC 3RELB 3AYWB 5GXQC 5BNVB 5B31A 5B33B 1P3PC 1S32C 3MVDD 5B2IC 3MGSC 5DNNA 1M19B 5DNMC 1EQZB 1P3KA 2YFVA 3VH6W 4HGAB 1ULYA 3TU4A 3UTAB 3UTBB 5CPJC 2HUEC 1TZYA 2NQBB 1U35B 3B6GD 3AZJA 4G92B 3W99A 4H9NA 1JFIA 5B1MB 5B2JB 4J8VC 2YFWA 5AVCB 3MGQB 5GT0B 4YM6D 3LZ0D 3AV2B 3WA9C 3REKC 1P3OD 3WAAC 3X1TA 1P3AD 1N1JB 3AZGD 5B0YA 4UUZB 3MVDA 5AV9D 1ID3C 3AZMB 1F66B 3O62B 3MGRD 3W96C 5B31B 3WTPA 1P3MC 2AROA 5DNNB 5CPIC 3AZID 1WWIA 3B6GA 2NZDB 5GXQD 2YFVB 1P3PD 3REIA 1S32D 5B2ID 3MGSD 1WWSA 3TU4B 3AYWC 1P3IA 5DNMD 1M19C 4WU8B 4LD9A 3X1SC 3W99B 5B32G 2BYMB 4Z66B 3AFAA 4H9NB 4XZQA 3REJA 1HQ3B 1P3OA 3LZ1C 1P3FB 1P3AA 3KXBA 4J8VD 3AZNB 1M1AB 5B2JC 3WA9D 2HIOB 5AV9A 3X1TB 1P34A 3REKD 3V9RA 1F1EA 3WKJB 5B31G 3WAAD 5GSUB 1M18A 4J8UC 3AZIA 5CP6C 4KUDA 1P3PA 3REHB 3WTPB 5B2IA 5E5AB 2AROB 3NQJA 1KX5C 5JRGC 3W96D 3AZFC 1P3MD 3AZLA 4WZSB 5CPJA 5CPID 1P3IB 5AY8B 2F8NA 3AV1C 3C1BB 3VH6A 3A6NA 4LD9B 3AYWD 4WU9A 1KX3C 4XZQB 1M19D 4G91B 5AV5C 4ZUXB 3X1SD 4KGCA 3NQUA 3KXBB 3REKA 3LZ1D 3MGPB 2BYKA 3MNNC 1P34B 5AV8A 3AN2C 3V9RB 5B2JD 5AVBB 2CV5C 1ID3A 5F99C 3LELA 5JA4A 4H9QA 1R4VA 5BS7C 1P3MA 4Z5TC 5B40B 4KHAA 4R8PA 4J8UD 3WKJC 3B0DB 5CP6D 5FUGA 4DRBA 5GT3A 3AZLB 1KX5D 3REHC 5E5AC 1AOIA 5JRGD 1P3BA 4QLCB 4XUJB 3AZFD 2F8NB 5B24B 5AV6B 1BH8A 3A6NB 4WU9B 3W97C 4J8XB 3AV1D 3B6FC 3AZKC 2L5AA 4J8WC 4KGCB 3C1CC 1KX3D 3NQUB 3LJAA 2PYOC 4X23B 1P3GC 5AV5D 1KX4B 2BYKB 2FJ7C 4H9PA 4NE3A 1A7WA 3W98C 5G49A 5CPKB 3MNND 1P3LC 3UT9B 1P3FD 3AN2D 3X1UA 5JA4B 4H9QB 1M1AD 2CV5D 1ZLAB 3R45B 1KX5A 5F99D 5BNXA 3B0BA 3AZEB 1H3OB 4EO5C 3KUYA 5B0ZA 5B32B 3AZFA 2F8NG 4Z5TD 5GT3B 5B1LB 3AZHA 3WKJD 5GSUD 3AV1A 1P3BB 4JJNA 3X1VB 2IO5B 1KX3A 3REHD 1BH8B 5E5AD 3W97D 3LJAB 4YS3C 3B6FD 3AZKD 3MNNA 4J8WD 4AWLC 3KWQC 3C1CD 2PYOD 4H9RA 3AN2A 1P3GD 1P3KB 4ZBJB 3RELC 2FJ7D 5B33C 1TZYB 4ZUXD 3W98D 1KX4C 3AZJB 1EQZC 4YM6A 3X1UB 3LZ0A 4Z5TA 1P3LD 1Q9CA 4HGAC 4CAYA 5CPKC 3MGPD 1JFIB 3UTAC 2YFWB 3UTBC 5BNXB 3UT9C 2NQBC 1U35C 3KUYB 5B0ZB 4G92C 4NE5A 4E44A 3AZHB 3AZGA 5B1MC 3B0CW 5C3IB 5AVCC 3MGQC 4JJNB 5GT0C 5B32C 3AV2C 5B40D 3MGRA 5B0YB 3B6FA 3MVDB 4J8WA 3C1CA 2PYOA 5GXQA 1S32A 3MGSA 2FJ7A 5DNMA 3B6GB 4H9RB 3W98A 4YS3D 3AZMC 1F66C 4H9OA 4M6BA 3O62C 3REIB 1P3LA 3KWQD 5B31C 1BH9A 5DNNC 2NZDC 1B6WA 4YM6B 3RELD 3LZ0B 5B33D 3AFAB 4J8VA 3TU4C 3REJB 1KX4D 1P3OB 3VH6T 1EQZD 2F8NH 4DRAA 3WA9A 5CPKD 4WU8C 1P3AB 3W99C 3UTAD 4Z66C 3UTBD 3UT9D 3AZGB 2NQBD 1U35D 3KSYA 1HQ3C 3WAAA 1P3FC 5AV9B 5CHLB 5B1MD 3AZNC 5AVCD 1M1AC 3MGQD 4NFTA 5GT0D 5C3IC 5B32D 1M18B 3AV2D 4E45A 3AZIB 2HIOC 3X1TC 4KUDB 3W96A 1P3PB 1S32B 4Z2MG 5B2IB 5B0YC 3KWQA 5CPIA 3NQJB 5DNMB 5GSUC 4H9OB 3RELA 3AYWA 5BNVA 5B33A 5CPJB 2HUEB 4WV4B 3WTPC 1M19A 2AROC 3AZMD 1F66D 3O62D 3X1SA 5B31D 3REIC
chains in the Genus database with same CATH superfamily
3UTBA 3LZ1A 5DNND 2NQBA 1P3IC 5AY8C 2NZDD 3C1BC 3WA9B 3TU4D 4LD9C 3REKB 2XD1A 5B1MA 5B2JA 4XZQC 3REJC 3MGQA 4G91C 4WU8D 3WAAB 4ZUXC 3W99D 4Z66D 5AV8B 3KXBC 1HQ3D 3MGPC 4J8UA 1ID3B 3LELB 5BT1C 5CP6A 2ZM5A 3AZND 1P34C 1N1JA 3B0CT 3W96B 1P3MB 4KHAB 4R8PB 5AVBC 5CPIB 2HIOD 3X1TD 5JRGA 1M18C 3AZMA 5FUGB 3O62A 5B0YD 4KUDC 5B40C 1AOIB 2FFFB 3B0DC 2NZDA 3X1SB 2Y2OA 3WTPD 3AZLC 2AROD 3LZ1B 4DQYB 5AV5A 3VH5W 4QLCC 2VQRA 4XUJC 4WU8A 3EPLA 3REID 5B24C 2BYMA 5AV6C 4Z66A 3A6NC 4WU9C 1P3ID 5AY8D 4J8XC 1HQ3A 3C1BD 1P3FA 4H9PB 4LD9D 2JSSA 4KGCC 3AFAD 5G49B 4X23C 3AZNA 4XZQD 3REJD 1M1AA 2CV5A 2JE5A 5F99A 4J8UB 3AL0C 4H9SC 2HIOA 5BS7A 5CP6B 3KXBD 5AV8C 4Z2MH 1KX5B 3WKJA 5BT1D 5GSUA 1P34D 5JRGB 3AZFB 3LELC 3REHA 5AVBD 5BO0A 1ZLAC 5E5AA 1M18D 1TAFA 4R8PC 1HTAA 3AV1B 3AZEC 3EPHA 4UPKA 4KUDD 1KX3B 3W97A 5B1LC 5GT3C 5AY8A 3AZKA 5AV5B 3C1BA 1AOIC 1P3BC 3X1VC 3AZLD 2IO5C 1P3GA 3EG5B 5CPJD 4CSRA 3MNNB 2F8ND 4QLCD 4XUJD 3A1IA 4ZUXA 5B24D 5AV6D 3A6ND 3AN2B 4WU9D 3LJAC 4J8XD 2CV5B 3MGPA 5F99B 4KGCD 4X23D 1P3KC 4Z5TB 4ZBJC 2DQNC 4CAYB 5AVBA 1TZYC 4WNNA 3AZJC 5AV8D 3X1UC 2RVQC 5B40A 5BO0B 1ID3D 1TAFB 1PZRA 3LELD 3KUYC 5B0ZC 1ZLAD 1KU5A 3W97B 3AZHC 3MGRB 4R8PD 3AZED 3B6FB 3AZKB 2LY8A 4QLCA 4XUJA 4J8WB 3C1CB 2PYOB 5B1LD 5GT3D 5B24A 5AV6A 4JJNC 4YS3A 5KDMA 1P3GB 5GXQB 4J8XA 4CSRB 3H0MC 3MGSB 1AOID 2FJ7B 3VH5A 1P3BD 2ZY2A 3MVDC 3X1VD 3W98B 4X23A 3H0LC 1P3LB 3VH5T 2Y2KA 1KX4A 4H9SA 1EQZA 1BH9B 2F8NK 3LJAD 3B6GC 5CPKA 1B67A 4J8VB 3F6TA 3UTAA 1BFMA 3UT9A 1U35A 4EO5B 4WNNB 1P3KD 4YM6C 1ZLAA 3R45A 3LZ0C 1TZYD 3AFAC 5AVCA 3AZEA 3AZJD 1H3OA 1P3OC 5GT0A 3X1UD 2RVQD 5B32A 3AV2A 5B1LA 1P3AC 2ZY3A 3AZGC 4NE6A 3KUYD 5B0ZD 3WTPE 3X1VA 5AV9C 3AZHD 4YS3B 5KDMB 4UUZA 2Y2IA 3MGRC 4AWLB 2CWEA 3KWQB 4JJND 1F66A 3AZIC 3RELB 3AYWB 5GXQC 5BNVB 2RIQA 5B31A 5B33B 1S32C 1P3PC 3MVDD 5B2IC 3MGSC 5DNNA 1M19B 5DNMC 1EQZB 1P3KA 2YFVA 3VH6W 4HGAB 1ULYA 3TU4A 3UTAB 3UTBB 5CPJC 2HUEC 1TZYA 2NQBB 1U35B 2G5IC 3B6GD 3AZJA 4G92B 3W99A 4H9NA 1JFIA 5B1MB 5B2JB 4J8VC 2YFWA 5AVCB 3MGQB 5GT0B 4YM6D 3LZ0D 3AV2B 3WA9C 2BG1A 3REKC 1P3OD 3WAAC 3X1TA 1P3AD 1N1JB 3AZGD 5B0YA 4UUZB 3MVDA 5AV9D 1ID3C 2JCHA 3AZMB 1F66B 3O62B 3MGRD 2ZY5A 3W96C 5B31B 3WTPA 1P3MC 2AROA 5DNNB 5CPIC 3AZID 1WWIA 3B6GA 2NZDB 5GXQD 2YFVB 1P3PD 3REIA 1S32D 5B2ID 3MGSD 1WWSA 3TU4B 3AYWC 1P3IA 5DNMD 1M19C 4WU8B 2W8SA 4LD9A 3X1SC 3W99B 5B32G 2BYMB 4Z66B 3AFAA 4H9NB 2Y2NA 4XZQA 3REJA 1HQ3B 1P3OA 3LZ1C 1P3FB 1P3AA 2Y2MA 3KXBA 4J8VD 3AZNB 1M1AB 5B2JC 3WA9D 2HIOB 5AV9A 3X1TB 1P34A 1Z2CB 3EPJA 3REKD 3V9RA 1F1EA 3WKJB 5B31G 3WAAD 5GSUB 1M18A 4J8UC 3AZIA 5CP6C 4KUDA 1P3PA 3REHB 3WTPB 5B2IA 5E5AB 2AROB 3NQJA 1KX5C 5JRGC 3W96D 3AZFC 1P3MD 3AZLA 4WZSB 5CPJA 5CPID 1P3IB 5AY8B 2F8NA 3AV1C 3C1BB 3VH6A 3A6NA 4LD9B 3AYWD 4WU9A 1KX3C 4XZQB 1M19D 4G91B 5AV5C 4ZUXB 3X1SD 4KGCA 3NQUA 3KXBB 3REKA 4WJ3C 3LZ1D 2Y2LA 2BYKA 3MNNC 3MGPB 1P34B 5AV8A 3AN2C 3V9RB 5B2JD 3H0RC 2Y2PA 5AVBB 2CV5C 1ID3A 5F99C 3LELA 5JA4A 4H9QA 1R4VA 5BS7C 1P3MA 4Z5TC 5B40B 4KHAA 4R8PA 4J8UD 3WKJC 3B0DB 5CP6D 5FUGA 4DRBA 5GT3A 3AZLB 1W2EA 1KX5D 3REHC 5E5AC 1AOIA 5JRGD 1P3BA 4QLCB 4XUJB 3AZFD 2F8NB 5B24B 5AV6B 1BH8A 3A6NB 4WU9B 3W97C 4J8XB 3AV1D 3B6FC 3AZKC 2L5AA 4J8WC 4KGCB 3C1CC 1KX3D 3NQUB 3LJAA 2PYOC 4X23B 1P3GC 5AV5D 1KX4B 2BYKB 2FJ7C 4H9PA 4NE3A 1A7WA 3W98C 5G49A 5CPKB 3MNND 1P3LC 3UT9B 1P3FD 3AN2D 3X1UA 5JA4B 4H9QB 1M1AD 2CV5D 1ZLAB 3R45B 1KX5A 5F99D 5BNXA 3B0BA 3FDDA 1H3OB 1T3UA 4EO5C 3AZEB 3KUYA 5B0ZA 5B32B 3AZFA 2F8NG 4Z5TD 2Y2QA 5B1LB 5GT3B 3P5JB 3AZHA 3WKJD 5GSUD 3AV1A 1P3BB 4JJNA 3X1VB 2IO5B 1KX3A 3REHD 1BH8B 5E5AD 3W97D 3LJAB 4YS3C 3B6FD 3AZKD 3MNNA 4J8WD 4AWLC 3KWQC 3C1CD 2PYOD 4H9RA 3IP4C 3AN2A 1P3GD 1P3KB 4ZBJB 3RELC 2FJ7D 5B33C 3A1KA 1TZYB 4ZUXD 3W98D 1KX4C 2Y2JA 3AZJB 1EQZC 4YM6A 3X1UB 3LZ0A 4Z5TA 1P3LD 1Q9CA 4HGAC 4CAYA 5CPKC 3MGPD 1JFIB 3UTAC 2YFWB 3UTBC 5BNXB 3UT9C 2NQBC 1U35C 3KUYB 5B0ZB 4G92C 2J8PA 4NE5A 4E44A 3AZHB 3AZGA 5B1MC 3B0CW 5C3IB 5AVCC 3MGQC 4JJNB 5GT0C 5B32C 3AV2C 5B40D 3MGRA 5B0YB 3B6FA 2Y2GA 3MVDB 4J8WA 3C1CA 2PYOA 5GXQA 3KFUG 1S32A 2XD5A 3MGSA 2FJ7A 5DNMA 3B6GB 4H9RB 3W98A 4YS3D 3AZMC 1F66C 4H9OA 4M6BA 3O62C 3REIB 1P3LA 2ZY4A 2DF4C 5B31C 3KWQD 1BH9A 5DNNC 2NZDC 1B6WA 4YM6B 3RELD 3LZ0B 5B33D 3AFAB 4J8VA 3TU4C 3REJB 1KX4D 1P3OB 3VH6T 1EQZD 2F8NH 4DRAA 3WA9A 5CPKD 4WU8C 1P3AB 3W99C 3UTAD 4Z66C 3UTBD 3UT9D 3AZGB 2NQBD 1U35D 3KSYA 1HQ3C 3WAAA 1P3FC 5AV9B 5CHLB 5B1MD 3AZNC 5AVCD 1M1AC 3MGQD 4NFTA 5GT0D 3EPKA 5C3IC 5B32D 1M18B 3AV2D 2F2AC 4E45A 3AZIB 2HIOC 3X1TC 4KUDB 3W96A 2Y2HA 1P3PB 1S32B 4Z2MG 2G5HC 5B2IB 5B0YC 3KWQA 5CPIA 3NQJB 5DNMB 5GSUC 4H9OB 3RELA 3AYWA 5BNVA 5B33A 5CPJB 2HUEB 4WV4B 3WTPC 2UWXA 2AROC 1M19A 3AZMD 1F66D 3O62D 3X1SA 5B31D 3REIC
chains in the Genus database with same CATH topology
3UTBA 3LZ1A 5DNND 2NQBA 1P3IC 5AY8C 2NZDD 3C1BC 3WA9B 3TU4D 4LD9C 3REKB 2XD1A 5B1MA 5B2JA 4XZQC 3REJC 3MGQA 4G91C 4WU8D 3WAAB 4ZUXC 3W99D 4Z66D 5AV8B 3KXBC 1HQ3D 3MGPC 4J8UA 1ID3B 3LELB 5BT1C 5CP6A 2ZM5A 3AZND 1P34C 1N1JA 3B0CT 3W96B 1P3MB 4KHAB 4R8PB 5AVBC 5CPIB 2HIOD 3X1TD 5JRGA 1M18C 3AZMA 5FUGB 3O62A 5B0YD 4KUDC 5B40C 1AOIB 2FFFB 3B0DC 2NZDA 3X1SB 2Y2OA 3WTPD 3AZLC 2AROD 3LZ1B 4DQYB 5AV5A 3VH5W 4QLCC 2VQRA 4XUJC 4WU8A 3EPLA 3REID 5B24C 2BYMA 5AV6C 4Z66A 3A6NC 4WU9C 1P3ID 5AY8D 4J8XC 1HQ3A 3C1BD 1P3FA 4H9PB 4LD9D 2JSSA 4KGCC 3AFAD 5G49B 4X23C 3AZNA 4XZQD 3REJD 1M1AA 2CV5A 2JE5A 5F99A 4J8UB 3AL0C 4H9SC 2HIOA 5BS7A 5CP6B 3KXBD 5AV8C 4Z2MH 1KX5B 3WKJA 5BT1D 5GSUA 1P34D 5JRGB 3AZFB 3LELC 3REHA 5AVBD 5BO0A 1ZLAC 5E5AA 1M18D 1TAFA 4R8PC 1HTAA 3AV1B 3AZEC 3EPHA 4UPKA 4KUDD 1KX3B 3W97A 5B1LC 5GT3C 5AY8A 3AZKA 5AV5B 3C1BA 1AOIC 1P3BC 3X1VC 3AZLD 2IO5C 1P3GA 3EG5B 5CPJD 4CSRA 3MNNB 2F8ND 4QLCD 4XUJD 3A1IA 4ZUXA 5B24D 5AV6D 3A6ND 3AN2B 4WU9D 3LJAC 4J8XD 2CV5B 3MGPA 5F99B 4KGCD 4X23D 1P3KC 4Z5TB 4ZBJC 2DQNC 4CAYB 5AVBA 1TZYC 4WNNA 3AZJC 5AV8D 3X1UC 2RVQC 5B40A 5BO0B 1ID3D 1TAFB 1PZRA 3LELD 3KUYC 5B0ZC 1ZLAD 1KU5A 3W97B 3AZHC 3MGRB 4R8PD 3AZED 3B6FB 3AZKB 2LY8A 4QLCA 4XUJA 4J8WB 3C1CB 2PYOB 5B1LD 5GT3D 5B24A 5AV6A 4JJNC 4YS3A 5KDMA 1P3GB 5GXQB 4J8XA 4CSRB 3H0MC 3MGSB 1AOID 2FJ7B 3VH5A 1P3BD 2ZY2A 3MVDC 3X1VD 3W98B 4X23A 3H0LC 1P3LB 3VH5T 2Y2KA 1KX4A 4H9SA 1EQZA 1BH9B 2F8NK 3LJAD 3B6GC 5CPKA 1B67A 4J8VB 3F6TA 3UTAA 1BFMA 3UT9A 1U35A 4EO5B 4WNNB 1P3KD 4YM6C 1ZLAA 3R45A 3LZ0C 1TZYD 3AFAC 5AVCA 3AZEA 3AZJD 1H3OA 1P3OC 5GT0A 3X1UD 2RVQD 5B32A 3AV2A 5B1LA 1P3AC 2ZY3A 3AZGC 4NE6A 3KUYD 5B0ZD 3WTPE 3X1VA 5AV9C 3AZHD 4YS3B 5KDMB 4UUZA 2Y2IA 3MGRC 4AWLB 2CWEA 3KWQB 4JJND 1F66A 3AZIC 3RELB 3AYWB 5GXQC 5BNVB 2RIQA 5B31A 5B33B 1S32C 1P3PC 3MVDD 5B2IC 3MGSC 5DNNA 1M19B 5DNMC 1EQZB 1P3KA 2YFVA 3VH6W 4HGAB 1ULYA 3TU4A 3UTAB 3UTBB 5CPJC 2HUEC 1TZYA 2NQBB 1U35B 2G5IC 3B6GD 3AZJA 4G92B 3W99A 4H9NA 1JFIA 5B1MB 5B2JB 4J8VC 2YFWA 5AVCB 3MGQB 5GT0B 4YM6D 3LZ0D 3AV2B 3WA9C 2BG1A 3REKC 1P3OD 3WAAC 3X1TA 1P3AD 1N1JB 3AZGD 5B0YA 4UUZB 3MVDA 5AV9D 1ID3C 2JCHA 3AZMB 1F66B 3O62B 3MGRD 2ZY5A 3W96C 5B31B 3WTPA 1P3MC 2AROA 5DNNB 5CPIC 3AZID 1WWIA 3B6GA 2NZDB 5GXQD 2YFVB 1P3PD 3REIA 1S32D 5B2ID 3MGSD 1WWSA 3TU4B 3AYWC 1P3IA 5DNMD 1M19C 4WU8B 2W8SA 4LD9A 3X1SC 3W99B 5B32G 2BYMB 4Z66B 3AFAA 4H9NB 2Y2NA 4XZQA 3REJA 1HQ3B 1P3OA 3LZ1C 1P3FB 1P3AA 2Y2MA 3KXBA 4J8VD 3AZNB 1M1AB 5B2JC 3WA9D 2HIOB 5AV9A 3X1TB 1P34A 1Z2CB 3EPJA 3REKD 3V9RA 1F1EA 3WKJB 5B31G 3WAAD 5GSUB 1M18A 4J8UC 3AZIA 5CP6C 4KUDA 1P3PA 3REHB 3WTPB 5B2IA 5E5AB 2AROB 3NQJA 1KX5C 5JRGC 3W96D 3AZFC 1P3MD 3AZLA 4WZSB 5CPJA 5CPID 1P3IB 5AY8B 2F8NA 3AV1C 3C1BB 3VH6A 3A6NA 4LD9B 3AYWD 4WU9A 1KX3C 4XZQB 1M19D 4G91B 5AV5C 4ZUXB 3X1SD 4KGCA 3NQUA 3KXBB 3REKA 4WJ3C 3LZ1D 2Y2LA 2BYKA 3MNNC 3MGPB 1P34B 5AV8A 3AN2C 3V9RB 5B2JD 3H0RC 2Y2PA 5AVBB 2CV5C 1ID3A 5F99C 3LELA 5JA4A 4H9QA 1R4VA 5BS7C 1P3MA 4Z5TC 5B40B 4KHAA 4R8PA 4J8UD 3WKJC 3B0DB 5CP6D 5FUGA 4DRBA 5GT3A 3AZLB 1W2EA 1KX5D 3REHC 5E5AC 1AOIA 5JRGD 1P3BA 4QLCB 4XUJB 3AZFD 2F8NB 5B24B 5AV6B 1BH8A 3A6NB 4WU9B 3W97C 4J8XB 3AV1D 3B6FC 3AZKC 2L5AA 4J8WC 4KGCB 3C1CC 1KX3D 3NQUB 3LJAA 2PYOC 4X23B 1P3GC 5AV5D 1KX4B 2BYKB 2FJ7C 4H9PA 4NE3A 1A7WA 3W98C 5G49A 5CPKB 3MNND 1P3LC 3UT9B 1P3FD 3AN2D 3X1UA 5JA4B 4H9QB 1M1AD 2CV5D 1ZLAB 3R45B 1KX5A 5F99D 5BNXA 3B0BA 3FDDA 1H3OB 1T3UA 4EO5C 3AZEB 3KUYA 5B0ZA 5B32B 3AZFA 2F8NG 4Z5TD 2Y2QA 5B1LB 5GT3B 3P5JB 3AZHA 3WKJD 5GSUD 3AV1A 1P3BB 4JJNA 3X1VB 2IO5B 1KX3A 3REHD 1BH8B 5E5AD 3W97D 3LJAB 4YS3C 3B6FD 3AZKD 3MNNA 4J8WD 4AWLC 3KWQC 3C1CD 2PYOD 4H9RA 3IP4C 3AN2A 1P3GD 1P3KB 4ZBJB 3RELC 2FJ7D 5B33C 3A1KA 1TZYB 4ZUXD 3W98D 1KX4C 2Y2JA 3AZJB 1EQZC 4YM6A 3X1UB 3LZ0A 4Z5TA 1P3LD 1Q9CA 4HGAC 4CAYA 5CPKC 3MGPD 1JFIB 3UTAC 2YFWB 3UTBC 5BNXB 3UT9C 2NQBC 1U35C 3KUYB 5B0ZB 4G92C 2J8PA 4NE5A 4E44A 3AZHB 3AZGA 5B1MC 3B0CW 5C3IB 5AVCC 3MGQC 4JJNB 5GT0C 5B32C 3AV2C 5B40D 3MGRA 5B0YB 3B6FA 2Y2GA 3MVDB 4J8WA 3C1CA 2PYOA 5GXQA 3KFUG 1S32A 2XD5A 3MGSA 2FJ7A 5DNMA 3B6GB 4H9RB 3W98A 4YS3D 3AZMC 1F66C 4H9OA 4M6BA 3O62C 3REIB 1P3LA 2ZY4A 2DF4C 5B31C 3KWQD 1BH9A 5DNNC 2NZDC 1B6WA 4YM6B 3RELD 3LZ0B 5B33D 3AFAB 4J8VA 3TU4C 3REJB 1KX4D 1P3OB 3VH6T 1EQZD 2F8NH 4DRAA 3WA9A 5CPKD 4WU8C 1P3AB 3W99C 3UTAD 4Z66C 3UTBD 3UT9D 3AZGB 2NQBD 1U35D 3KSYA 1HQ3C 3WAAA 1P3FC 5AV9B 5CHLB 5B1MD 3AZNC 5AVCD 1M1AC 3MGQD 4NFTA 5GT0D 3EPKA 5C3IC 5B32D 1M18B 3AV2D 2F2AC 4E45A 3AZIB 2HIOC 3X1TC 4KUDB 3W96A 2Y2HA 1P3PB 1S32B 4Z2MG 2G5HC 5B2IB 5B0YC 3KWQA 5CPIA 3NQJB 5DNMB 5GSUC 4H9OB 3RELA 3AYWA 5BNVA 5B33A 5CPJB 2HUEB 4WV4B 3WTPC 2UWXA 2AROC 1M19A 3AZMD 1F66D 3O62D 3X1SA 5B31D 3REIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTB A;  3LZ1 A;  5DNN D;  2NQB A;  1P3I C;  5AY8 C;  2NZD D;  3C1B C;  3WA9 B;  3TU4 D;  4LD9 C;  3REK B;  5B1M A;  5B2J A;  4XZQ C;  3REJ C;  3MGQ A;  4G91 C;  4WU8 D;  3WAA B;  4ZUX C;  3W99 D;  4Z66 D;  5AV8 B;  3KXB C;  1HQ3 D;  3MGP C;  4J8U A;  1ID3 B;  3LEL B;  5BT1 C;  5CP6 A;  3AZN D;  1P34 C;  1N1J A;  3B0C T;  3W96 B;  1P3M B;  4KHA B;  4R8P B;  5AVB C;  5CPI B;  2HIO D;  3X1T D;  5JRG A;  1M18 C;  3AZM A;  5FUG B;  3O62 A;  5B0Y D;  4KUD C;  5B40 C;  1AOI B;  2NZD A;  3B0D C;  3X1S B;  3WTP D;  3AZL C;  2ARO D;  3LZ1 B;  5AV5 A;  3VH5 W;  4QLC C;  4XUJ C;  4WU8 A;  3REI D;  5B24 C;  2BYM A;  5AV6 C;  4Z66 A;  3A6N C;  4WU9 C;  1P3I D;  5AY8 D;  4J8X C;  1HQ3 A;  3C1B D;  1P3F A;  4H9P B;  4LD9 D;  2JSS A;  4KGC C;  3AFA D;  5G49 B;  4X23 C;  3AZN A;  4XZQ D;  3REJ D;  1M1A A;  2CV5 A;  5F99 A;  4J8U B;  4H9S C;  2HIO A;  5BS7 A;  5CP6 B;  3KXB D;  5AV8 C;  4Z2M H;  1KX5 B;  3WKJ A;  5BT1 D;  5GSU A;  1P34 D;  5JRG B;  3AZF B;  3LEL C;  3REH A;  5AVB D;  5BO0 A;  1ZLA C;  5E5A A;  1M18 D;  1TAF A;  4R8P C;  1HTA A;  3AV1 B;  3AZE C;  4KUD D;  1KX3 B;  3W97 A;  5B1L C;  5GT3 C;  5AY8 A;  3AZK A;  5AV5 B;  3C1B A;  1AOI C;  1P3B C;  3X1V C;  3AZL D;  2IO5 C;  1P3G A;  5CPJ D;  4CSR A;  3MNN B;  2F8N D;  4QLC D;  4XUJ D;  4ZUX A;  5B24 D;  5AV6 D;  3A6N D;  3AN2 B;  4WU9 D;  3LJA C;  4J8X D;  2CV5 B;  3MGP A;  5F99 B;  4KGC D;  4X23 D;  1P3K C;  4Z5T B;  4ZBJ C;  4CAY B;  5AVB A;  1TZY C;  4WNN A;  3AZJ C;  5AV8 D;  3X1U C;  2RVQ C;  5B40 A;  5BO0 B;  1ID3 D;  1TAF B;  3LEL D;  3KUY C;  5B0Z C;  1ZLA D;  1KU5 A;  3W97 B;  3AZH C;  3MGR B;  4R8P D;  3AZE D;  3B6F B;  3AZK B;  2LY8 A;  4QLC A;  4XUJ A;  4J8W B;  3C1C B;  2PYO B;  5B1L D;  5GT3 D;  5B24 A;  5AV6 A;  4JJN C;  4YS3 A;  5KDM A;  1P3G B;  5GXQ B;  4J8X A;  4CSR B;  3MGS B;  1AOI D;  2FJ7 B;  3VH5 A;  1P3B D;  3X1V D;  3MVD C;  3W98 B;  4X23 A;  1P3L B;  3VH5 T;  1KX4 A;  4H9S A;  1EQZ A;  1BH9 B;  2F8N K;  3LJA D;  3B6G C;  5CPK A;  1B67 A;  4J8V B;  3UTA A;  1BFM A;  3UT9 A;  1U35 A;  4EO5 B;  4WNN B;  1P3K D;  4YM6 C;  1ZLA A;  3R45 A;  3LZ0 C;  1TZY D;  3AFA C;  5AVC A;  3AZE A;  3AZJ D;  1H3O A;  1P3O C;  5GT0 A;  3X1U D;  2RVQ D;  5B32 A;  3AV2 A;  5B1L A;  1P3A C;  3AZG C;  4NE6 A;  3KUY D;  5B0Z D;  3WTP E;  3X1V A;  5AV9 C;  3AZH D;  4YS3 B;  5KDM B;  4UUZ A;  3MGR C;  4AWL B;  2CWE A;  3KWQ B;  4JJN D;  1F66 A;  3AZI C;  3REL B;  3AYW B;  5GXQ C;  5BNV B;  5B31 A;  5B33 B;  1P3P C;  1S32 C;  3MVD D;  5B2I C;  3MGS C;  5DNN A;  1M19 B;  5DNM C;  1EQZ B;  1P3K A;  2YFV A;  3VH6 W;  4HGA B;  1ULY A;  3TU4 A;  3UTA B;  3UTB B;  5CPJ C;  2HUE C;  1TZY A;  2NQB B;  1U35 B;  3B6G D;  3AZJ A;  4G92 B;  3W99 A;  4H9N A;  1JFI A;  5B1M B;  5B2J B;  4J8V C;  2YFW A;  5AVC B;  3MGQ B;  5GT0 B;  4YM6 D;  3LZ0 D;  3AV2 B;  3WA9 C;  3REK C;  1P3O D;  3WAA C;  3X1T A;  1P3A D;  1N1J B;  3AZG D;  5B0Y A;  4UUZ B;  3MVD A;  5AV9 D;  1ID3 C;  3AZM B;  1F66 B;  3O62 B;  3MGR D;  3W96 C;  5B31 B;  3WTP A;  1P3M C;  2ARO A;  5DNN B;  5CPI C;  3AZI D;  1WWI A;  3B6G A;  2NZD B;  5GXQ D;  2YFV B;  1P3P D;  3REI A;  1S32 D;  5B2I D;  3MGS D;  1WWS A;  3TU4 B;  3AYW C;  1P3I A;  5DNM D;  1M19 C;  4WU8 B;  4LD9 A;  3X1S C;  3W99 B;  5B32 G;  2BYM B;  4Z66 B;  3AFA A;  4H9N B;  4XZQ A;  3REJ A;  1HQ3 B;  1P3O A;  3LZ1 C;  1P3F B;  1P3A A;  3KXB A;  4J8V D;  3AZN B;  1M1A B;  5B2J C;  3WA9 D;  2HIO B;  5AV9 A;  3X1T B;  1P34 A;  3REK D;  3V9R A;  1F1E A;  3WKJ B;  5B31 G;  3WAA D;  5GSU B;  1M18 A;  4J8U C;  3AZI A;  5CP6 C;  4KUD A;  1P3P A;  3REH B;  3WTP B;  5B2I A;  5E5A B;  2ARO B;  3NQJ A;  1KX5 C;  5JRG C;  3W96 D;  3AZF C;  1P3M D;  3AZL A;  4WZS B;  5CPJ A;  5CPI D;  1P3I B;  5AY8 B;  2F8N A;  3AV1 C;  3C1B B;  3VH6 A;  3A6N A;  4LD9 B;  3AYW D;  4WU9 A;  1KX3 C;  4XZQ B;  1M19 D;  4G91 B;  5AV5 C;  4ZUX B;  3X1S D;  4KGC A;  3NQU A;  3KXB B;  3REK A;  3LZ1 D;  3MGP B;  2BYK A;  3MNN C;  1P34 B;  5AV8 A;  3AN2 C;  3V9R B;  5B2J D;  5AVB B;  2CV5 C;  1ID3 A;  5F99 C;  3LEL A;  5JA4 A;  4H9Q A;  1R4V A;  5BS7 C;  1P3M A;  4Z5T C;  5B40 B;  4KHA A;  4R8P A;  4J8U D;  3WKJ C;  3B0D B;  5CP6 D;  5FUG A;  4DRB A;  5GT3 A;  3AZL B;  1KX5 D;  3REH C;  5E5A C;  1AOI A;  5JRG D;  1P3B A;  4QLC B;  4XUJ B;  3AZF D;  2F8N B;  5B24 B;  5AV6 B;  1BH8 A;  3A6N B;  4WU9 B;  3W97 C;  4J8X B;  3AV1 D;  3B6F C;  3AZK C;  2L5A A;  4J8W C;  4KGC B;  3C1C C;  1KX3 D;  3NQU B;  3LJA A;  2PYO C;  4X23 B;  1P3G C;  5AV5 D;  1KX4 B;  2BYK B;  2FJ7 C;  4H9P A;  4NE3 A;  1A7W A;  3W98 C;  5G49 A;  5CPK B;  3MNN D;  1P3L C;  3UT9 B;  1P3F D;  3AN2 D;  3X1U A;  5JA4 B;  4H9Q B;  1M1A D;  2CV5 D;  1ZLA B;  3R45 B;  1KX5 A;  5F99 D;  5BNX A;  3B0B A;  3AZE B;  1H3O B;  4EO5 C;  3KUY A;  5B0Z A;  5B32 B;  3AZF A;  2F8N G;  4Z5T D;  5GT3 B;  5B1L B;  3AZH A;  3WKJ D;  5GSU D;  3AV1 A;  1P3B B;  4JJN A;  3X1V B;  2IO5 B;  1KX3 A;  3REH D;  1BH8 B;  5E5A D;  3W97 D;  3LJA B;  4YS3 C;  3B6F D;  3AZK D;  3MNN A;  4J8W D;  4AWL C;  3KWQ C;  3C1C D;  2PYO D;  4H9R A;  3AN2 A;  1P3G D;  1P3K B;  4ZBJ B;  3REL C;  2FJ7 D;  5B33 C;  1TZY B;  4ZUX D;  3W98 D;  1KX4 C;  3AZJ B;  1EQZ C;  4YM6 A;  3X1U B;  3LZ0 A;  4Z5T A;  1P3L D;  1Q9C A;  4HGA C;  4CAY A;  5CPK C;  3MGP D;  1JFI B;  3UTA C;  2YFW B;  3UTB C;  5BNX B;  3UT9 C;  2NQB C;  1U35 C;  3KUY B;  5B0Z B;  4G92 C;  4NE5 A;  4E44 A;  3AZH B;  3AZG A;  5B1M C;  3B0C W;  5C3I B;  5AVC C;  3MGQ C;  4JJN B;  5GT0 C;  5B32 C;  3AV2 C;  5B40 D;  3MGR A;  5B0Y B;  3B6F A;  3MVD B;  4J8W A;  3C1C A;  2PYO A;  5GXQ A;  1S32 A;  3MGS A;  2FJ7 A;  5DNM A;  3B6G B;  4H9R B;  3W98 A;  4YS3 D;  3AZM C;  1F66 C;  4H9O A;  4M6B A;  3O62 C;  3REI B;  1P3L A;  3KWQ D;  5B31 C;  1BH9 A;  5DNN C;  2NZD C;  1B6W A;  4YM6 B;  3REL D;  3LZ0 B;  5B33 D;  3AFA B;  4J8V A;  3TU4 C;  3REJ B;  1KX4 D;  1P3O B;  3VH6 T;  1EQZ D;  2F8N H;  4DRA A;  3WA9 A;  5CPK D;  4WU8 C;  1P3A B;  3W99 C;  3UTA D;  4Z66 C;  3UTB D;  3UT9 D;  3AZG B;  2NQB D;  1U35 D;  3KSY A;  1HQ3 C;  3WAA A;  1P3F C;  5AV9 B;  5CHL B;  5B1M D;  3AZN C;  5AVC D;  1M1A C;  3MGQ D;  4NFT A;  5GT0 D;  5C3I C;  5B32 D;  1M18 B;  3AV2 D;  4E45 A;  3AZI B;  2HIO C;  3X1T C;  4KUD B;  3W96 A;  1P3P B;  1S32 B;  4Z2M G;  5B2I B;  5B0Y C;  3KWQ A;  5CPI A;  3NQJ B;  5DNM B;  5GSU C;  4H9O B;  3REL A;  3AYW A;  5BNV A;  5B33 A;  5CPJ B;  2HUE B;  4WV4 B;  3WTP C;  1M19 A;  2ARO C;  3AZM D;  1F66 D;  3O62 D;  3X1S A;  5B31 D;  3REI C; 
#chains in the Genus database with same CATH topology
 3UTB A;  3LZ1 A;  5DNN D;  2NQB A;  1P3I C;  5AY8 C;  2NZD D;  3C1B C;  3WA9 B;  3TU4 D;  4LD9 C;  3REK B;  2XD1 A;  5B1M A;  5B2J A;  4XZQ C;  3REJ C;  3MGQ A;  4G91 C;  4WU8 D;  3WAA B;  4ZUX C;  3W99 D;  4Z66 D;  5AV8 B;  3KXB C;  1HQ3 D;  3MGP C;  4J8U A;  1ID3 B;  3LEL B;  5BT1 C;  5CP6 A;  2ZM5 A;  3AZN D;  1P34 C;  1N1J A;  3B0C T;  3W96 B;  1P3M B;  4KHA B;  4R8P B;  5AVB C;  5CPI B;  2HIO D;  3X1T D;  5JRG A;  1M18 C;  3AZM A;  5FUG B;  3O62 A;  5B0Y D;  4KUD C;  5B40 C;  1AOI B;  2FFF B;  3B0D C;  2NZD A;  3X1S B;  2Y2O A;  3WTP D;  3AZL C;  2ARO D;  3LZ1 B;  4DQY B;  5AV5 A;  3VH5 W;  4QLC C;  2VQR A;  4XUJ C;  4WU8 A;  3EPL A;  3REI D;  5B24 C;  2BYM A;  5AV6 C;  4Z66 A;  3A6N C;  4WU9 C;  1P3I D;  5AY8 D;  4J8X C;  1HQ3 A;  3C1B D;  1P3F A;  4H9P B;  4LD9 D;  2JSS A;  4KGC C;  3AFA D;  5G49 B;  4X23 C;  3AZN A;  4XZQ D;  3REJ D;  1M1A A;  2CV5 A;  2JE5 A;  5F99 A;  4J8U B;  3AL0 C;  4H9S C;  2HIO A;  5BS7 A;  5CP6 B;  3KXB D;  5AV8 C;  4Z2M H;  1KX5 B;  3WKJ A;  5BT1 D;  5GSU A;  1P34 D;  5JRG B;  3AZF B;  3LEL C;  3REH A;  5AVB D;  5BO0 A;  1ZLA C;  5E5A A;  1M18 D;  1TAF A;  4R8P C;  1HTA A;  3AV1 B;  3AZE C;  3EPH A;  4UPK A;  4KUD D;  1KX3 B;  3W97 A;  5B1L C;  5GT3 C;  5AY8 A;  3AZK A;  5AV5 B;  3C1B A;  1AOI C;  1P3B C;  3X1V C;  3AZL D;  2IO5 C;  1P3G A;  3EG5 B;  5CPJ D;  4CSR A;  3MNN B;  2F8N D;  4QLC D;  4XUJ D;  3A1I A;  4ZUX A;  5B24 D;  5AV6 D;  3A6N D;  3AN2 B;  4WU9 D;  3LJA C;  4J8X D;  2CV5 B;  3MGP A;  5F99 B;  4KGC D;  4X23 D;  1P3K C;  4Z5T B;  4ZBJ C;  2DQN C;  4CAY B;  5AVB A;  1TZY C;  4WNN A;  3AZJ C;  5AV8 D;  3X1U C;  2RVQ C;  5B40 A;  5BO0 B;  1ID3 D;  1TAF B;  1PZR A;  3LEL D;  3KUY C;  5B0Z C;  1ZLA D;  1KU5 A;  3W97 B;  3AZH C;  3MGR B;  4R8P D;  3AZE D;  3B6F B;  3AZK B;  2LY8 A;  4QLC A;  4XUJ A;  4J8W B;  3C1C B;  2PYO B;  5B1L D;  5GT3 D;  5B24 A;  5AV6 A;  4JJN C;  4YS3 A;  5KDM A;  1P3G B;  5GXQ B;  4J8X A;  4CSR B;  3H0M C;  3MGS B;  1AOI D;  2FJ7 B;  3VH5 A;  1P3B D;  2ZY2 A;  3MVD C;  3X1V D;  3W98 B;  4X23 A;  3H0L C;  1P3L B;  3VH5 T;  2Y2K A;  1KX4 A;  4H9S A;  1EQZ A;  1BH9 B;  2F8N K;  3LJA D;  3B6G C;  5CPK A;  1B67 A;  4J8V B;  3F6T A;  3UTA A;  1BFM A;  3UT9 A;  1U35 A;  4EO5 B;  4WNN B;  1P3K D;  4YM6 C;  1ZLA A;  3R45 A;  3LZ0 C;  1TZY D;  3AFA C;  5AVC A;  3AZE A;  3AZJ D;  1H3O A;  1P3O C;  5GT0 A;  3X1U D;  2RVQ D;  5B32 A;  3AV2 A;  5B1L A;  1P3A C;  2ZY3 A;  3AZG C;  4NE6 A;  3KUY D;  5B0Z D;  3WTP E;  3X1V A;  5AV9 C;  3AZH D;  4YS3 B;  5KDM B;  4UUZ A;  2Y2I A;  3MGR C;  4AWL B;  2CWE A;  3KWQ B;  4JJN D;  1F66 A;  3AZI C;  3REL B;  3AYW B;  5GXQ C;  5BNV B;  2RIQ A;  5B31 A;  5B33 B;  1S32 C;  1P3P C;  3MVD D;  5B2I C;  3MGS C;  5DNN A;  1M19 B;  5DNM C;  1EQZ B;  1P3K A;  2YFV A;  3VH6 W;  4HGA B;  1ULY A;  3TU4 A;  3UTA B;  3UTB B;  5CPJ C;  2HUE C;  1TZY A;  2NQB B;  1U35 B;  2G5I C;  3B6G D;  3AZJ A;  4G92 B;  3W99 A;  4H9N A;  1JFI A;  5B1M B;  5B2J B;  4J8V C;  2YFW A;  5AVC B;  3MGQ B;  5GT0 B;  4YM6 D;  3LZ0 D;  3AV2 B;  3WA9 C;  2BG1 A;  3REK C;  1P3O D;  3WAA C;  3X1T A;  1P3A D;  1N1J B;  3AZG D;  5B0Y A;  4UUZ B;  3MVD A;  5AV9 D;  1ID3 C;  2JCH A;  3AZM B;  1F66 B;  3O62 B;  3MGR D;  2ZY5 A;  3W96 C;  5B31 B;  3WTP A;  1P3M C;  2ARO A;  5DNN B;  5CPI C;  3AZI D;  1WWI A;  3B6G A;  2NZD B;  5GXQ D;  2YFV B;  1P3P D;  3REI A;  1S32 D;  5B2I D;  3MGS D;  1WWS A;  3TU4 B;  3AYW C;  1P3I A;  5DNM D;  1M19 C;  4WU8 B;  2W8S A;  4LD9 A;  3X1S C;  3W99 B;  5B32 G;  2BYM B;  4Z66 B;  3AFA A;  4H9N B;  2Y2N A;  4XZQ A;  3REJ A;  1HQ3 B;  1P3O A;  3LZ1 C;  1P3F B;  1P3A A;  2Y2M A;  3KXB A;  4J8V D;  3AZN B;  1M1A B;  5B2J C;  3WA9 D;  2HIO B;  5AV9 A;  3X1T B;  1P34 A;  1Z2C B;  3EPJ A;  3REK D;  3V9R A;  1F1E A;  3WKJ B;  5B31 G;  3WAA D;  5GSU B;  1M18 A;  4J8U C;  3AZI A;  5CP6 C;  4KUD A;  1P3P A;  3REH B;  3WTP B;  5B2I A;  5E5A B;  2ARO B;  3NQJ A;  1KX5 C;  5JRG C;  3W96 D;  3AZF C;  1P3M D;  3AZL A;  4WZS B;  5CPJ A;  5CPI D;  1P3I B;  5AY8 B;  2F8N A;  3AV1 C;  3C1B B;  3VH6 A;  3A6N A;  4LD9 B;  3AYW D;  4WU9 A;  1KX3 C;  4XZQ B;  1M19 D;  4G91 B;  5AV5 C;  4ZUX B;  3X1S D;  4KGC A;  3NQU A;  3KXB B;  3REK A;  4WJ3 C;  3LZ1 D;  2Y2L A;  2BYK A;  3MNN C;  3MGP B;  1P34 B;  5AV8 A;  3AN2 C;  3V9R B;  5B2J D;  3H0R C;  2Y2P A;  5AVB B;  2CV5 C;  1ID3 A;  5F99 C;  3LEL A;  5JA4 A;  4H9Q A;  1R4V A;  5BS7 C;  1P3M A;  4Z5T C;  5B40 B;  4KHA A;  4R8P A;  4J8U D;  3WKJ C;  3B0D B;  5CP6 D;  5FUG A;  4DRB A;  5GT3 A;  3AZL B;  1W2E A;  1KX5 D;  3REH C;  5E5A C;  1AOI A;  5JRG D;  1P3B A;  4QLC B;  4XUJ B;  3AZF D;  2F8N B;  5B24 B;  5AV6 B;  1BH8 A;  3A6N B;  4WU9 B;  3W97 C;  4J8X B;  3AV1 D;  3B6F C;  3AZK C;  2L5A A;  4J8W C;  4KGC B;  3C1C C;  1KX3 D;  3NQU B;  3LJA A;  2PYO C;  4X23 B;  1P3G C;  5AV5 D;  1KX4 B;  2BYK B;  2FJ7 C;  4H9P A;  4NE3 A;  1A7W A;  3W98 C;  5G49 A;  5CPK B;  3MNN D;  1P3L C;  3UT9 B;  1P3F D;  3AN2 D;  3X1U A;  5JA4 B;  4H9Q B;  1M1A D;  2CV5 D;  1ZLA B;  3R45 B;  1KX5 A;  5F99 D;  5BNX A;  3B0B A;  3FDD A;  1H3O B;  1T3U A;  4EO5 C;  3AZE B;  3KUY A;  5B0Z A;  5B32 B;  3AZF A;  2F8N G;  4Z5T D;  2Y2Q A;  5B1L B;  5GT3 B;  3P5J B;  3AZH A;  3WKJ D;  5GSU D;  3AV1 A;  1P3B B;  4JJN A;  3X1V B;  2IO5 B;  1KX3 A;  3REH D;  1BH8 B;  5E5A D;  3W97 D;  3LJA B;  4YS3 C;  3B6F D;  3AZK D;  3MNN A;  4J8W D;  4AWL C;  3KWQ C;  3C1C D;  2PYO D;  4H9R A;  3IP4 C;  3AN2 A;  1P3G D;  1P3K B;  4ZBJ B;  3REL C;  2FJ7 D;  5B33 C;  3A1K A;  1TZY B;  4ZUX D;  3W98 D;  1KX4 C;  2Y2J A;  3AZJ B;  1EQZ C;  4YM6 A;  3X1U B;  3LZ0 A;  4Z5T A;  1P3L D;  1Q9C A;  4HGA C;  4CAY A;  5CPK C;  3MGP D;  1JFI B;  3UTA C;  2YFW B;  3UTB C;  5BNX B;  3UT9 C;  2NQB C;  1U35 C;  3KUY B;  5B0Z B;  4G92 C;  2J8P A;  4NE5 A;  4E44 A;  3AZH B;  3AZG A;  5B1M C;  3B0C W;  5C3I B;  5AVC C;  3MGQ C;  4JJN B;  5GT0 C;  5B32 C;  3AV2 C;  5B40 D;  3MGR A;  5B0Y B;  3B6F A;  2Y2G A;  3MVD B;  4J8W A;  3C1C A;  2PYO A;  5GXQ A;  3KFU G;  1S32 A;  2XD5 A;  3MGS A;  2FJ7 A;  5DNM A;  3B6G B;  4H9R B;  3W98 A;  4YS3 D;  3AZM C;  1F66 C;  4H9O A;  4M6B A;  3O62 C;  3REI B;  1P3L A;  2ZY4 A;  2DF4 C;  5B31 C;  3KWQ D;  1BH9 A;  5DNN C;  2NZD C;  1B6W A;  4YM6 B;  3REL D;  3LZ0 B;  5B33 D;  3AFA B;  4J8V A;  3TU4 C;  3REJ B;  1KX4 D;  1P3O B;  3VH6 T;  1EQZ D;  2F8N H;  4DRA A;  3WA9 A;  5CPK D;  4WU8 C;  1P3A B;  3W99 C;  3UTA D;  4Z66 C;  3UTB D;  3UT9 D;  3AZG B;  2NQB D;  1U35 D;  3KSY A;  1HQ3 C;  3WAA A;  1P3F C;  5AV9 B;  5CHL B;  5B1M D;  3AZN C;  5AVC D;  1M1A C;  3MGQ D;  4NFT A;  5GT0 D;  3EPK A;  5C3I C;  5B32 D;  1M18 B;  3AV2 D;  2F2A C;  4E45 A;  3AZI B;  2HIO C;  3X1T C;  4KUD B;  3W96 A;  2Y2H A;  1P3P B;  1S32 B;  4Z2M G;  2G5H C;  5B2I B;  5B0Y C;  3KWQ A;  5CPI A;  3NQJ B;  5DNM B;  5GSU C;  4H9O B;  3REL A;  3AYW A;  5BNV A;  5B33 A;  5CPJ B;  2HUE B;  4WV4 B;  3WTP C;  2UWX A;  2ARO C;  1M19 A;  3AZM D;  1F66 D;  3O62 D;  3X1S A;  5B31 D;  3REI C; 
#chains in the Genus database with same CATH homology
 3UTB A;  3LZ1 A;  5DNN D;  2NQB A;  1P3I C;  5AY8 C;  2NZD D;  3C1B C;  3WA9 B;  3TU4 D;  4LD9 C;  3REK B;  2XD1 A;  5B1M A;  5B2J A;  4XZQ C;  3REJ C;  3MGQ A;  4G91 C;  4WU8 D;  3WAA B;  4ZUX C;  3W99 D;  4Z66 D;  5AV8 B;  3KXB C;  1HQ3 D;  3MGP C;  4J8U A;  1ID3 B;  3LEL B;  5BT1 C;  5CP6 A;  2ZM5 A;  3AZN D;  1P34 C;  1N1J A;  3B0C T;  3W96 B;  1P3M B;  4KHA B;  4R8P B;  5AVB C;  5CPI B;  2HIO D;  3X1T D;  5JRG A;  1M18 C;  3AZM A;  5FUG B;  3O62 A;  5B0Y D;  4KUD C;  5B40 C;  1AOI B;  2FFF B;  3B0D C;  2NZD A;  3X1S B;  2Y2O A;  3WTP D;  3AZL C;  2ARO D;  3LZ1 B;  4DQY B;  5AV5 A;  3VH5 W;  4QLC C;  2VQR A;  4XUJ C;  4WU8 A;  3EPL A;  3REI D;  5B24 C;  2BYM A;  5AV6 C;  4Z66 A;  3A6N C;  4WU9 C;  1P3I D;  5AY8 D;  4J8X C;  1HQ3 A;  3C1B D;  1P3F A;  4H9P B;  4LD9 D;  2JSS A;  4KGC C;  3AFA D;  5G49 B;  4X23 C;  3AZN A;  4XZQ D;  3REJ D;  1M1A A;  2CV5 A;  2JE5 A;  5F99 A;  4J8U B;  3AL0 C;  4H9S C;  2HIO A;  5BS7 A;  5CP6 B;  3KXB D;  5AV8 C;  4Z2M H;  1KX5 B;  3WKJ A;  5BT1 D;  5GSU A;  1P34 D;  5JRG B;  3AZF B;  3LEL C;  3REH A;  5AVB D;  5BO0 A;  1ZLA C;  5E5A A;  1M18 D;  1TAF A;  4R8P C;  1HTA A;  3AV1 B;  3AZE C;  3EPH A;  4UPK A;  4KUD D;  1KX3 B;  3W97 A;  5B1L C;  5GT3 C;  5AY8 A;  3AZK A;  5AV5 B;  3C1B A;  1AOI C;  1P3B C;  3X1V C;  3AZL D;  2IO5 C;  1P3G A;  3EG5 B;  5CPJ D;  4CSR A;  3MNN B;  2F8N D;  4QLC D;  4XUJ D;  3A1I A;  4ZUX A;  5B24 D;  5AV6 D;  3A6N D;  3AN2 B;  4WU9 D;  3LJA C;  4J8X D;  2CV5 B;  3MGP A;  5F99 B;  4KGC D;  4X23 D;  1P3K C;  4Z5T B;  4ZBJ C;  2DQN C;  4CAY B;  5AVB A;  1TZY C;  4WNN A;  3AZJ C;  5AV8 D;  3X1U C;  2RVQ C;  5B40 A;  5BO0 B;  1ID3 D;  1TAF B;  1PZR A;  3LEL D;  3KUY C;  5B0Z C;  1ZLA D;  1KU5 A;  3W97 B;  3AZH C;  3MGR B;  4R8P D;  3AZE D;  3B6F B;  3AZK B;  2LY8 A;  4QLC A;  4XUJ A;  4J8W B;  3C1C B;  2PYO B;  5B1L D;  5GT3 D;  5B24 A;  5AV6 A;  4JJN C;  4YS3 A;  5KDM A;  1P3G B;  5GXQ B;  4J8X A;  4CSR B;  3H0M C;  3MGS B;  1AOI D;  2FJ7 B;  3VH5 A;  1P3B D;  2ZY2 A;  3MVD C;  3X1V D;  3W98 B;  4X23 A;  3H0L C;  1P3L B;  3VH5 T;  2Y2K A;  1KX4 A;  4H9S A;  1EQZ A;  1BH9 B;  2F8N K;  3LJA D;  3B6G C;  5CPK A;  1B67 A;  4J8V B;  3F6T A;  3UTA A;  1BFM A;  3UT9 A;  1U35 A;  4EO5 B;  4WNN B;  1P3K D;  4YM6 C;  1ZLA A;  3R45 A;  3LZ0 C;  1TZY D;  3AFA C;  5AVC A;  3AZE A;  3AZJ D;  1H3O A;  1P3O C;  5GT0 A;  3X1U D;  2RVQ D;  5B32 A;  3AV2 A;  5B1L A;  1P3A C;  2ZY3 A;  3AZG C;  4NE6 A;  3KUY D;  5B0Z D;  3WTP E;  3X1V A;  5AV9 C;  3AZH D;  4YS3 B;  5KDM B;  4UUZ A;  2Y2I A;  3MGR C;  4AWL B;  2CWE A;  3KWQ B;  4JJN D;  1F66 A;  3AZI C;  3REL B;  3AYW B;  5GXQ C;  5BNV B;  2RIQ A;  5B31 A;  5B33 B;  1S32 C;  1P3P C;  3MVD D;  5B2I C;  3MGS C;  5DNN A;  1M19 B;  5DNM C;  1EQZ B;  1P3K A;  2YFV A;  3VH6 W;  4HGA B;  1ULY A;  3TU4 A;  3UTA B;  3UTB B;  5CPJ C;  2HUE C;  1TZY A;  2NQB B;  1U35 B;  2G5I C;  3B6G D;  3AZJ A;  4G92 B;  3W99 A;  4H9N A;  1JFI A;  5B1M B;  5B2J B;  4J8V C;  2YFW A;  5AVC B;  3MGQ B;  5GT0 B;  4YM6 D;  3LZ0 D;  3AV2 B;  3WA9 C;  2BG1 A;  3REK C;  1P3O D;  3WAA C;  3X1T A;  1P3A D;  1N1J B;  3AZG D;  5B0Y A;  4UUZ B;  3MVD A;  5AV9 D;  1ID3 C;  2JCH A;  3AZM B;  1F66 B;  3O62 B;  3MGR D;  2ZY5 A;  3W96 C;  5B31 B;  3WTP A;  1P3M C;  2ARO A;  5DNN B;  5CPI C;  3AZI D;  1WWI A;  3B6G A;  2NZD B;  5GXQ D;  2YFV B;  1P3P D;  3REI A;  1S32 D;  5B2I D;  3MGS D;  1WWS A;  3TU4 B;  3AYW C;  1P3I A;  5DNM D;  1M19 C;  4WU8 B;  2W8S A;  4LD9 A;  3X1S C;  3W99 B;  5B32 G;  2BYM B;  4Z66 B;  3AFA A;  4H9N B;  2Y2N A;  4XZQ A;  3REJ A;  1HQ3 B;  1P3O A;  3LZ1 C;  1P3F B;  1P3A A;  2Y2M A;  3KXB A;  4J8V D;  3AZN B;  1M1A B;  5B2J C;  3WA9 D;  2HIO B;  5AV9 A;  3X1T B;  1P34 A;  1Z2C B;  3EPJ A;  3REK D;  3V9R A;  1F1E A;  3WKJ B;  5B31 G;  3WAA D;  5GSU B;  1M18 A;  4J8U C;  3AZI A;  5CP6 C;  4KUD A;  1P3P A;  3REH B;  3WTP B;  5B2I A;  5E5A B;  2ARO B;  3NQJ A;  1KX5 C;  5JRG C;  3W96 D;  3AZF C;  1P3M D;  3AZL A;  4WZS B;  5CPJ A;  5CPI D;  1P3I B;  5AY8 B;  2F8N A;  3AV1 C;  3C1B B;  3VH6 A;  3A6N A;  4LD9 B;  3AYW D;  4WU9 A;  1KX3 C;  4XZQ B;  1M19 D;  4G91 B;  5AV5 C;  4ZUX B;  3X1S D;  4KGC A;  3NQU A;  3KXB B;  3REK A;  4WJ3 C;  3LZ1 D;  2Y2L A;  2BYK A;  3MNN C;  3MGP B;  1P34 B;  5AV8 A;  3AN2 C;  3V9R B;  5B2J D;  3H0R C;  2Y2P A;  5AVB B;  2CV5 C;  1ID3 A;  5F99 C;  3LEL A;  5JA4 A;  4H9Q A;  1R4V A;  5BS7 C;  1P3M A;  4Z5T C;  5B40 B;  4KHA A;  4R8P A;  4J8U D;  3WKJ C;  3B0D B;  5CP6 D;  5FUG A;  4DRB A;  5GT3 A;  3AZL B;  1W2E A;  1KX5 D;  3REH C;  5E5A C;  1AOI A;  5JRG D;  1P3B A;  4QLC B;  4XUJ B;  3AZF D;  2F8N B;  5B24 B;  5AV6 B;  1BH8 A;  3A6N B;  4WU9 B;  3W97 C;  4J8X B;  3AV1 D;  3B6F C;  3AZK C;  2L5A A;  4J8W C;  4KGC B;  3C1C C;  1KX3 D;  3NQU B;  3LJA A;  2PYO C;  4X23 B;  1P3G C;  5AV5 D;  1KX4 B;  2BYK B;  2FJ7 C;  4H9P A;  4NE3 A;  1A7W A;  3W98 C;  5G49 A;  5CPK B;  3MNN D;  1P3L C;  3UT9 B;  1P3F D;  3AN2 D;  3X1U A;  5JA4 B;  4H9Q B;  1M1A D;  2CV5 D;  1ZLA B;  3R45 B;  1KX5 A;  5F99 D;  5BNX A;  3B0B A;  3FDD A;  1H3O B;  1T3U A;  4EO5 C;  3AZE B;  3KUY A;  5B0Z A;  5B32 B;  3AZF A;  2F8N G;  4Z5T D;  2Y2Q A;  5B1L B;  5GT3 B;  3P5J B;  3AZH A;  3WKJ D;  5GSU D;  3AV1 A;  1P3B B;  4JJN A;  3X1V B;  2IO5 B;  1KX3 A;  3REH D;  1BH8 B;  5E5A D;  3W97 D;  3LJA B;  4YS3 C;  3B6F D;  3AZK D;  3MNN A;  4J8W D;  4AWL C;  3KWQ C;  3C1C D;  2PYO D;  4H9R A;  3IP4 C;  3AN2 A;  1P3G D;  1P3K B;  4ZBJ B;  3REL C;  2FJ7 D;  5B33 C;  3A1K A;  1TZY B;  4ZUX D;  3W98 D;  1KX4 C;  2Y2J A;  3AZJ B;  1EQZ C;  4YM6 A;  3X1U B;  3LZ0 A;  4Z5T A;  1P3L D;  1Q9C A;  4HGA C;  4CAY A;  5CPK C;  3MGP D;  1JFI B;  3UTA C;  2YFW B;  3UTB C;  5BNX B;  3UT9 C;  2NQB C;  1U35 C;  3KUY B;  5B0Z B;  4G92 C;  2J8P A;  4NE5 A;  4E44 A;  3AZH B;  3AZG A;  5B1M C;  3B0C W;  5C3I B;  5AVC C;  3MGQ C;  4JJN B;  5GT0 C;  5B32 C;  3AV2 C;  5B40 D;  3MGR A;  5B0Y B;  3B6F A;  2Y2G A;  3MVD B;  4J8W A;  3C1C A;  2PYO A;  5GXQ A;  3KFU G;  1S32 A;  2XD5 A;  3MGS A;  2FJ7 A;  5DNM A;  3B6G B;  4H9R B;  3W98 A;  4YS3 D;  3AZM C;  1F66 C;  4H9O A;  4M6B A;  3O62 C;  3REI B;  1P3L A;  2ZY4 A;  2DF4 C;  5B31 C;  3KWQ D;  1BH9 A;  5DNN C;  2NZD C;  1B6W A;  4YM6 B;  3REL D;  3LZ0 B;  5B33 D;  3AFA B;  4J8V A;  3TU4 C;  3REJ B;  1KX4 D;  1P3O B;  3VH6 T;  1EQZ D;  2F8N H;  4DRA A;  3WA9 A;  5CPK D;  4WU8 C;  1P3A B;  3W99 C;  3UTA D;  4Z66 C;  3UTB D;  3UT9 D;  3AZG B;  2NQB D;  1U35 D;  3KSY A;  1HQ3 C;  3WAA A;  1P3F C;  5AV9 B;  5CHL B;  5B1M D;  3AZN C;  5AVC D;  1M1A C;  3MGQ D;  4NFT A;  5GT0 D;  3EPK A;  5C3I C;  5B32 D;  1M18 B;  3AV2 D;  2F2A C;  4E45 A;  3AZI B;  2HIO C;  3X1T C;  4KUD B;  3W96 A;  2Y2H A;  1P3P B;  1S32 B;  4Z2M G;  2G5H C;  5B2I B;  5B0Y C;  3KWQ A;  5CPI A;  3NQJ B;  5DNM B;  5GSU C;  4H9O B;  3REL A;  3AYW A;  5BNV A;  5B33 A;  5CPJ B;  2HUE B;  4WV4 B;  3WTP C;  2UWX A;  2ARO C;  1M19 A;  3AZM D;  1F66 D;  3O62 D;  3X1S A;  5B31 D;  3REI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...