5E5AD

Crystal structure of the chromatin-tethering domain of human cytomegalovirus ie1 protein bound to the nucleosome core particle
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
98
structure length
98
Chain Sequence
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (146-MER)
publication title Human cytomegalovirus IE1 protein alters the higher-order chromatin structure by targeting the acidic patch of the nucleosome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/viral protein/dna
total genus 37
structure length 98
sequence length 98
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-10-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5e5aD00
1P3OB 5B1LC 3MGSA 3C1CC 4J8XA 2YFWB 3W99B 1P34C 4J8UA 3WKJA 5E5AB 5BS7C 3B6FA 3AZJA 1WWSA 4Z5TD 1P3MD 5F99A 4G92B 3AZGC 2AROC 5GT3D 3AZID 3AZNA 2FJ7B 2F8NH 4Z66C 5AV9A 3X1TC 1P3AA 1AOIA 3VH5W 5GT0D 2PYOD 5B2IB 5B31B 1N1JB 3MNND 3AN2B 1P3KC 3O62A 1ULYA 3AYWB 3A6NB 3KUYC 1B67A 3X1SB 2F8NA 5B1LD 3C1CD 4DRAA 1P3IC 1ID3B 3REHB 3WA9C 1P34D 1P3PD 4XZQB 5KDMA 1KX3B 1P3GB 4J8VB 5GSUC 4Z5TA 5AVBC 1P3MA 5AY8B 3AZGD 2RVQD 2AROD 3AZIA 5GT3A 1P3BB 5B2JC 1TZYD 4Z66D 3AV2C 4YM6C 4QLCB 4CSRB 4J8WB 5GT0A 2PYOA 1HQ3B 1P3FB 4KUDB 3REJB 3MNNA 2CV5C 1P3KD 1BH9B 5BO0B 1EQZB 3KUYD 3AZLC 2YFVA 3AV1C 5B1LA 3B0DC 3C1CA 3KWQB 1P3ID 4WU8B 4NE5A 3WA9D 3REKB 1M1AB 2JSSA 3WKJC 1P34A 1P3PA 2BYMB 5BT1C 4UUZB 3RELB 5B33B 3B6GB 5F99C 5GSUD 1JFIA 5AVBD 3LELC 3AZGA 4Z2MG 2AROA 4YS3C 3W98C 3WAAB 5G49A 1TZYA 4Z66A 4JJNB 3AV2D 4YM6D 5BNVB 5JA4B 5B0ZB 3MGQD 1U35B 2HIOB 4X23B 2CV5D 4H9QB 1P3KA 3REIB 3R45B 4AWLB 3AZFD 3KUYA 3AZLD 2CWEA 3AV1D 3MVDB 3TU4C 1P3IA 5B2JB 3WA9A 1F66C 5BT1D 3X1UB 1P3LC 4Z5TC 3MGPB 2NQBB 5GSUA 5AVBA 3LELD 2IO5B 4WZSB 3AZIC 3W96D 4DRBA 3C1BC 4LD9D 4YS3D 5GXQD 3W98D 4H9PA 3AV2A 4YM6A 5CPKC 1TAFB 5AV8C 3MGQA 3MGSB 2NZDD 4J8XB 5CPJC 2CV5A 3W97C 5B40B 4J8UB 3WKJB 3B6FB 3AZJB 3AZFA 3AZEC 3VH6W 4NE3A 3AZLA 3AV1A 3AZNB 4EO5C 3TU4D 5B0YB 5AV9B 1P3PC 1KX4C 3UTBC 1P3AB 1AOIB 1F66D 3LZ0C 5C3IC 1P3LD 2HUEC 3MGRD 2RVQC 5DNMC 3LELA 3LJAC 4WNNA 3W96A 3C1BD 4LD9A 4YS3A 5GXQA 3W98A 4HGAB 1TZYC 5B32B 3O62B 5CPKD 5B24C 2F8NB 4ZUXC 5AV8D 4H9SC 4G91B 2NZDA 4KHAA 5CPJD 3W97D 2LY8A 5KDMB 4XUJC 3V9RB 3X1SD 5AVCC 1ZLAC 3AZED 4Z5TB 1P3MB 3UTAC 3UT9C 5GT3B 3AZMC 3TU4A 3AZKC 1KX4D 3UTBD 1F66A 1P3GD 3LZ0D 2PYOB 5GT0B 1P3LA 3MGRA 5DNMD 5CP6C 3LJAD 3C1BA 3WTPC 3MNNB 4WV4B 5B1MC 1S32C 3NQJA 5CPKA 1M18B 5B24D 3MGQC 4ZUXD 3X1VC 1N1JA 5AV8A 5DNNC 5B1LB 3C1CB 5CPJA 3AZHD 3W97A 1P34B 4WU9C 5JRGC 4XUJD 3AZFC 1ZLAD 3X1SA 5AVCD 5BNXA 3AZEA 5CPIC 1JFIB 3AZGB 3UTAD 3KWQD 2AROB 3UT9D 3AZMD 3AZKD 5G49B 3REKD 4Z66B 3X1TB 1KX4A 3UTBA 3RELD 5B33D 1P3GA 3B6GD 1M19C 3LZ0A 3KSYA 5CP6D 5DNMA 3W96C 4LD9C 3LJAA 3WAAD 5GXQC 3WTPD 4H9NA 5B1MD 1S32D 1P3KB 1KX5C 5AV6C 5B0ZD 4NFTA 3KXBC 3KUYB 4KGCC 5B24A 4ZUXA 3X1VD 4X23D 4H9SA 5DNND 2NZDC 3LZ1C 1P3IB 3AFAC 5AV5C 3WA9B 3AZHA 5BO0A 4ZBJC 5FUGA 5JRGD 4WU9D 4R8PC 4XUJA 1ZLAA 5AVCA 2BYKA 1P3OC 4H9RA 5GSUB 5CPID 5AVBB 4H9OA 3MVDD 3UTAA 3KWQA 3UT9A 3AZMA 3AZKA 3W99C 3B0CT 3REKA 4H9PB 5CHLB 5E5AC 3AV2B 4YM6B 3RELA 5B33A 3NQUA 3B6GA 1M19D 4G92C 3MGRC 4CAYA 3B0BA 5CP6A 2FJ7C 1H3OA 3WTPA 2CV5B 5B1MA 1S32A 1KX5D 5AV6D 5B0ZA 5B2IC 3KXBD 5B31C 4KGCD 3AZLB 3AV1B 3X1VA 1WWIA 4X23A 5DNNA 3AN2C 3B0DB 3LZ1D 3AFAD 5AV5D 5B40D 3AYWC 3A6NC 4WU9A 3X1SC 5JRGA 4R8PD 1BFMA 5F99B 1P3OD 5CPIA 3LELB 4WNNB 3MVDA 1ID3C 4YS3B 3REHC 3W98B 5B0YD 3W99D 5B32G 4XZQC 1A7WA 5E5AD 1KX3C 1P3GC 4J8VC 5AY8C 1M19A 1P3BC 5B31G 1BH8A 2FJ7D 4KHAB 5B32D 4QLCC 3VH5A 1KX5A 4J8WC 5AV6A 5B2ID 1HQ3C 3VH5T 5B31D 3KXBA 1P3FC 4KGCA 4KUDC 3REJC 3AN2D 3TU4B 3LZ1A 3AZHC 3AFAA 5AV5A 1EQZC 5B40A 3AYWD 3A6ND 1F66B 1R4VA 4R8PA 1P3LB 3MGRB 1P3OA 3KWQC 3AZIB 4WU8C 3C1BB 1ID3D 4E45A 3REHD 5B0YA 2YFWA 3REKC 1M1AC 3W99A 4XZQD 5E5AA 3RELC 1KX3D 5B33C 3B6GC 3NQJB 4J8VD 5CPKB 5AY8D 1P3BD 5AV8B 3WAAC 2FJ7A 5CPJB 5B32A 4JJNC 4QLCD 3W97B 5B0ZC 4J8WD 1M18D 5B2IA 1HQ3D 5BNXB 2YFVB 3AZEB 5B31A 1U35C 2HIOC 4X23C 1P3FD 4KUDD 3REJD 4EO5B 3AN2A 1EQZD 3REIC 1P3PB 1KX4B 3UTBB 1HTAA 4AWLC 3AYWA 3V9RA 3A6NA 3LZ0B 5C3IB 1F1EA 1Q9CA 2HUEB 3MVDC 5DNMB 3LJAB 4WU8D 1ID3A 3REHA 1M1AD 1TZYB 4H9NB 3X1TD 3X1UC 4XZQA 3WTPE 1KX3A 3MGPC 2NQBC 4J8VA 2IO5C 5AY8A 5B24B 4ZUXB 1P3BA 4E44A 4JJND 3AZHB 4QLCA 5FUGB 4CSRA 4XUJB 4J8WA 1ZLAB 5AVCB 1M18A 2BYKB 1HQ3A 4H9RB 3MGSC 4H9OB 1B6WA 2HIOD 4J8XC 3UTAB 1U35D 1P3FA 4KUDA 3UT9B 3REJA 3AZMB 3AZKB 1BH9A 4J8UC 5B40C 3B6FC 3REID 1EQZA 3AZJC 5BS7A 4M6BA 3NQUB 4CAYB 3AZNC 5CP6B 1H3OB 4WU8A 4NE6A 5B0YC 5B2JD 3WTPB 5AV9C 1M1AA 1P3AC 1AOIC 3X1TA 5B1MB 2BYMA 3X1UD 1S32B 1KU5A 4UUZA 3MGPD 2NQBD 3MGQB 3X1VB 3WAAA 5DNNB 4HGAC 5B32C 4JJNA 3O62C 5BNVA 5JA4A 4WU9B 2L5AA 5JRGB 3AZFB 4G91C 3MGSD 5CPIB 4J8XD 2F8NK 1U35A 2HIOA 3B0CW 4Z2MH 4H9QA 4J8UD 3WKJD 3B6FD 3REIA 3VH6A 3R45A 3AZJD 1P3MC 5F99D 1M19B 3VH6T 5GT3C 3AZND 1BH8B 3W96B 4LD9B 5GXQB 5B2JA 5AV9D 1P3AD 1AOID 3X1UA 1KX5B 2PYOC 5GT0C 5AV6B 3MGPA 2NQBA 3KXBB 2F8NG 4KGCB 2NZDB 3MNNC 3LZ1B 3AFAB 5AV5B 3O62D 4ZBJB 1M18C 4R8PB 1TAFA 2F8ND
chains in the Genus database with same CATH superfamily
2J8PA 1P3OB 5B1LC 3MGSA 3C1CC 4J8XA 2YFWB 3W99B 1P34C 4J8UA 3WKJA 5E5AB 5BS7C 3B6FA 3AZJA 1WWSA 4Z5TD 1P3MD 5F99A 4G92B 3AZGC 2AROC 5GT3D 3AZID 3AZNA 2FJ7B 2F8NH 4Z66C 5AV9A 3X1TC 1P3AA 1AOIA 3VH5W 5GT0D 2PYOD 5B2IB 2UWXA 5B31B 3EG5B 1N1JB 3MNND 3AN2B 1P3KC 2ZY3A 3O62A 1ULYA 3AYWB 3A6NB 3KUYC 1B67A 3X1SB 2F8NA 5B1LD 3C1CD 4DRAA 1P3IC 1ID3B 3REHB 3WA9C 2ZY5A 1P34D 1P3PD 4XZQB 5KDMA 1KX3B 1P3GB 4J8VB 5GSUC 4Z5TA 5AVBC 1P3MA 5AY8B 3AZGD 2RVQD 2AROD 3AZIA 5GT3A 1P3BB 5B2JC 1TZYD 4Z66D 3AV2C 4YM6C 2Y2KA 4QLCB 4CSRB 4J8WB 5GT0A 2PYOA 1HQ3B 1P3FB 4KUDB 3REJB 3MNNA 2CV5C 1P3KD 1BH9B 5BO0B 1EQZB 3KUYD 3AZLC 2YFVA 3AV1C 5B1LA 3B0DC 3C1CA 3KWQB 1P3ID 4WU8B 4NE5A 3WA9D 3REKB 1M1AB 2JSSA 3WKJC 1P34A 1P3PA 2BYMB 5BT1C 1PZRA 4UUZB 3RELB 5B33B 3B6GB 5F99C 2Y2GA 5GSUD 1JFIA 5AVBD 3LELC 3AZGA 4Z2MG 2AROA 4YS3C 3W98C 3P5JB 3WAAB 5G49A 1TZYA 4Z66A 4JJNB 3AV2D 4YM6D 5BNVB 5JA4B 5B0ZB 3MGQD 1U35B 2HIOB 4X23B 2CV5D 4H9QB 1P3KA 3KFUG 2ZM5A 3REIB 3R45B 2FFFB 4AWLB 3AZFD 3KUYA 3AZLD 2CWEA 3AV1D 3MVDB 3TU4C 1P3IA 5B2JB 3WA9A 1F66C 5BT1D 3X1UB 1P3LC 4Z5TC 3MGPB 2NQBB 5GSUA 5AVBA 3LELD 2IO5B 4WZSB 3AZIC 3W96D 4DRBA 3C1BC 4LD9D 4YS3D 5GXQD 3W98D 4H9PA 3EPJA 3AV2A 4YM6A 5CPKC 1TAFB 5AV8C 3MGQA 3MGSB 2NZDD 4J8XB 5CPJC 2RIQA 2CV5A 3W97C 5B40B 4J8UB 3WKJB 3B6FB 3AZJB 3AZFA 3AZEC 3VH6W 4NE3A 3AZLA 3AV1A 3AZNB 4EO5C 3TU4D 5B0YB 5AV9B 1P3PC 1KX4C 3UTBC 1P3AB 1AOIB 1F66D 3LZ0C 5C3IC 1P3LD 2HUEC 3MGRD 2RVQC 5DNMC 3LELA 3LJAC 4WNNA 3W96A 3C1BD 4LD9A 4YS3A 5GXQA 3W98A 4HGAB 3EPKA 2Y2JA 1TZYC 5B32B 3O62B 5CPKD 5B24C 2F8NB 4ZUXC 5AV8D 4H9SC 4G91B 2NZDA 4KHAA 5CPJD 2ZY4A 3IP4C 3W97D 2LY8A 5KDMB 2XD5A 4XUJC 3V9RB 3X1SD 5AVCC 1ZLAC 3AZED 2Y2LA 4Z5TB 1P3MB 3UTAC 3UT9C 5GT3B 3AZMC 3TU4A 3AZKC 1KX4D 3UTBD 1F66A 1P3GD 3LZ0D 2PYOB 5GT0B 1P3LA 3MGRA 5DNMD 5CP6C 3LJAD 4UPKA 3C1BA 3WTPC 2Y2QA 3MNNB 3H0MC 4WV4B 5B1MC 1S32C 3NQJA 5CPKA 1M18B 5B24D 3MGQC 4ZUXD 1N1JA 3X1VC 5AV8A 5DNNC 5B1LB 3C1CB 2DQNC 5CPJA 3AZHD 3W97A 1P34B 4WU9C 5JRGC 4XUJD 3AZFC 1ZLAD 3X1SA 5AVCD 5BNXA 3AZEA 2Y2HA 2Y2NA 5CPIC 3EPLA 1JFIB 3AZGB 3UTAD 3KWQD 2AROB 3UT9D 3AZMD 3AZKD 5G49B 3REKD 4Z66B 3X1TB 1KX4A 3UTBA 3RELD 5B33D 1P3GA 3B6GD 1M19C 3LZ0A 3KSYA 5CP6D 5DNMA 3W96C 4LD9C 3LJAA 3WAAD 5GXQC 3WTPD 4H9NA 5B1MD 1S32D 1P3KB 3H0LC 1KX5C 5AV6C 5B0ZD 4NFTA 3KXBC 3KUYB 4KGCC 5B24A 2DF4C 4ZUXA 4X23D 4H9SA 2ZY2A 5DNND 3X1VD 2NZDC 3LZ1C 1P3IB 3AFAC 5AV5C 3WA9B 3AZHA 5BO0A 4ZBJC 5FUGA 5JRGD 4WU9D 4R8PC 4XUJA 1ZLAA 5AVCA 2BYKA 1P3OC 4H9RA 5GSUB 5CPID 5AVBB 4H9OA 3MVDD 3UTAA 3KWQA 3UT9A 3AZMA 3AZKA 3W99C 3B0CT 3REKA 4H9PB 5CHLB 5E5AC 3AV2B 4YM6B 3RELA 5B33A 3NQUA 3B6GA 1M19D 4G92C 3MGRC 4CAYA 3B0BA 5CP6A 2FJ7C 1H3OA 3WTPA 2G5IC 2CV5B 5B1MA 1S32A 1KX5D 5AV6D 5B0ZA 5B2IC 2XD1A 3KXBD 5B31C 4KGCD 3AZLB 3AV1B 3X1VA 1WWIA 4X23A 5DNNA 3AN2C 3B0DB 3LZ1D 2BG1A 3AFAD 5AV5D 5B40D 3AYWC 1W2EA 3A6NC 4WU9A 3X1SC 5JRGA 4R8PD 1BFMA 5F99B 1P3OD 2VQRA 5CPIA 3LELB 4WNNB 3MVDA 1ID3C 4YS3B 3REHC 3W98B 5B0YD 3A1IA 3W99D 5B32G 4XZQC 1A7WA 5E5AD 1KX3C 1P3GC 4J8VC 5AY8C 1M19A 1P3BC 5B31G 1BH8A 2FJ7D 3FDDA 4KHAB 5B32D 4QLCC 3VH5A 1KX5A 4J8WC 5AV6A 5B2ID 1HQ3C 3VH5T 5B31D 3F6TA 3KXBA 1P3FC 4KGCA 4KUDC 3REJC 3AN2D 3TU4B 1Z2CB 3LZ1A 3EPHA 3AZHC 3AFAA 5AV5A 1EQZC 5B40A 3AYWD 3A6ND 1F66B 1R4VA 4R8PA 1P3LB 3MGRB 1P3OA 3KWQC 3AZIB 4WU8C 3C1BB 1ID3D 4E45A 3REHD 5B0YA 2YFWA 3REKC 1M1AC 3W99A 4XZQD 5E5AA 3RELC 1KX3D 5B33C 3B6GC 3NQJB 2Y2OA 4J8VD 5CPKB 5AY8D 1P3BD 5AV8B 3WAAC 4WJ3C 2FJ7A 5CPJB 5B32A 4JJNC 4QLCD 4DQYB 3W97B 2Y2MA 5B0ZC 4J8WD 1M18D 5B2IA 1HQ3D 5BNXB 2YFVB 3AZEB 5B31A 1U35C 2HIOC 4X23C 1P3FD 4KUDD 3REJD 4EO5B 3AN2A 3AL0C 2G5HC 1EQZD 3REIC 1P3PB 1KX4B 3UTBB 1HTAA 4AWLC 3AYWA 3V9RA 3A6NA 3LZ0B 5C3IB 1F1EA 1Q9CA 2HUEB 3MVDC 5DNMB 3LJAB 4WU8D 1ID3A 3REHA 1M1AD 1TZYB 4H9NB 3X1TD 3X1UC 4XZQA 3WTPE 1KX3A 3MGPC 2NQBC 4J8VA 3A1KA 2IO5C 5AY8A 5B24B 4ZUXB 1P3BA 4E44A 4JJND 3AZHB 4QLCA 5FUGB 4CSRA 4XUJB 4J8WA 1ZLAB 5AVCB 1M18A 2BYKB 1HQ3A 4H9RB 3MGSC 4H9OB 1B6WA 2HIOD 4J8XC 3UTAB 1U35D 1P3FA 4KUDA 3UT9B 3REJA 3AZMB 3AZKB 1BH9A 4J8UC 5B40C 3B6FC 3REID 1EQZA 3AZJC 5BS7A 4M6BA 3NQUB 4CAYB 3AZNC 5CP6B 1H3OB 4WU8A 4NE6A 5B0YC 2Y2PA 5B2JD 3WTPB 5AV9C 1M1AA 1P3AC 1T3UA 1AOIC 3X1TA 5B1MB 2BYMA 3X1UD 2F2AC 1S32B 1KU5A 4UUZA 3MGPD 2NQBD 2JE5A 3MGQB 3X1VB 3WAAA 2Y2IA 4HGAC 5DNNB 5B32C 2W8SA 4JJNA 3O62C 5BNVA 5JA4A 4WU9B 2L5AA 5JRGB 2JCHA 3AZFB 4G91C 3MGSD 5CPIB 4J8XD 2F8NK 1U35A 2HIOA 3B0CW 4Z2MH 4H9QA 4J8UD 3WKJD 3B6FD 3REIA 3VH6A 3R45A 3AZJD 1P3MC 5F99D 1M19B 3VH6T 5GT3C 3AZND 1BH8B 3W96B 4LD9B 5GXQB 5B2JA 5AV9D 1P3AD 1AOID 3X1UA 1KX5B 2PYOC 5GT0C 5AV6B 3MGPA 2NQBA 3KXBB 2F8NG 4KGCB 2NZDB 3MNNC 3LZ1B 3AFAB 5AV5B 3O62D 3H0RC 4ZBJB 1M18C 4R8PB 1TAFA 2F8ND
chains in the Genus database with same CATH topology
2J8PA 1P3OB 5B1LC 3MGSA 3C1CC 4J8XA 2YFWB 3W99B 1P34C 4J8UA 3WKJA 5E5AB 5BS7C 3B6FA 3AZJA 1WWSA 4Z5TD 1P3MD 5F99A 4G92B 3AZGC 2AROC 5GT3D 3AZID 3AZNA 2FJ7B 2F8NH 4Z66C 5AV9A 3X1TC 1P3AA 1AOIA 3VH5W 5GT0D 2PYOD 5B2IB 2UWXA 5B31B 3EG5B 1N1JB 3MNND 3AN2B 1P3KC 2ZY3A 3O62A 1ULYA 3AYWB 3A6NB 3KUYC 1B67A 3X1SB 2F8NA 5B1LD 3C1CD 4DRAA 1P3IC 1ID3B 3REHB 3WA9C 2ZY5A 1P34D 1P3PD 4XZQB 5KDMA 1KX3B 1P3GB 4J8VB 5GSUC 4Z5TA 5AVBC 1P3MA 5AY8B 3AZGD 2RVQD 2AROD 3AZIA 5GT3A 1P3BB 5B2JC 1TZYD 4Z66D 3AV2C 4YM6C 2Y2KA 4QLCB 4CSRB 4J8WB 5GT0A 2PYOA 1HQ3B 1P3FB 4KUDB 3REJB 3MNNA 2CV5C 1P3KD 1BH9B 5BO0B 1EQZB 3KUYD 3AZLC 2YFVA 3AV1C 5B1LA 3B0DC 3C1CA 3KWQB 1P3ID 4WU8B 4NE5A 3WA9D 3REKB 1M1AB 2JSSA 3WKJC 1P34A 1P3PA 2BYMB 5BT1C 1PZRA 4UUZB 3RELB 5B33B 3B6GB 5F99C 2Y2GA 5GSUD 1JFIA 5AVBD 3LELC 3AZGA 4Z2MG 2AROA 4YS3C 3W98C 3P5JB 3WAAB 5G49A 1TZYA 4Z66A 4JJNB 3AV2D 4YM6D 5BNVB 5JA4B 5B0ZB 3MGQD 1U35B 2HIOB 4X23B 2CV5D 4H9QB 1P3KA 3KFUG 2ZM5A 3REIB 3R45B 2FFFB 4AWLB 3AZFD 3KUYA 3AZLD 2CWEA 3AV1D 3MVDB 3TU4C 1P3IA 5B2JB 3WA9A 1F66C 5BT1D 3X1UB 1P3LC 4Z5TC 3MGPB 2NQBB 5GSUA 5AVBA 3LELD 2IO5B 4WZSB 3AZIC 3W96D 4DRBA 3C1BC 4LD9D 4YS3D 5GXQD 3W98D 4H9PA 3EPJA 3AV2A 4YM6A 5CPKC 1TAFB 5AV8C 3MGQA 3MGSB 2NZDD 4J8XB 5CPJC 2RIQA 2CV5A 3W97C 5B40B 4J8UB 3WKJB 3B6FB 3AZJB 3AZFA 3AZEC 3VH6W 4NE3A 3AZLA 3AV1A 3AZNB 4EO5C 3TU4D 5B0YB 5AV9B 1P3PC 1KX4C 3UTBC 1P3AB 1AOIB 1F66D 3LZ0C 5C3IC 1P3LD 2HUEC 3MGRD 2RVQC 5DNMC 3LELA 3LJAC 4WNNA 3W96A 3C1BD 4LD9A 4YS3A 5GXQA 3W98A 4HGAB 3EPKA 2Y2JA 1TZYC 5B32B 3O62B 5CPKD 5B24C 2F8NB 4ZUXC 5AV8D 4H9SC 4G91B 2NZDA 4KHAA 5CPJD 2ZY4A 3IP4C 3W97D 2LY8A 5KDMB 2XD5A 4XUJC 3V9RB 3X1SD 5AVCC 1ZLAC 3AZED 2Y2LA 4Z5TB 1P3MB 3UTAC 3UT9C 5GT3B 3AZMC 3TU4A 3AZKC 1KX4D 3UTBD 1F66A 1P3GD 3LZ0D 2PYOB 5GT0B 1P3LA 3MGRA 5DNMD 5CP6C 3LJAD 4UPKA 3C1BA 3WTPC 2Y2QA 3MNNB 3H0MC 4WV4B 5B1MC 1S32C 3NQJA 5CPKA 1M18B 5B24D 3MGQC 4ZUXD 1N1JA 3X1VC 5AV8A 5DNNC 5B1LB 3C1CB 2DQNC 5CPJA 3AZHD 3W97A 1P34B 4WU9C 5JRGC 4XUJD 3AZFC 1ZLAD 3X1SA 5AVCD 5BNXA 3AZEA 2Y2HA 2Y2NA 5CPIC 3EPLA 1JFIB 3AZGB 3UTAD 3KWQD 2AROB 3UT9D 3AZMD 3AZKD 5G49B 3REKD 4Z66B 3X1TB 1KX4A 3UTBA 3RELD 5B33D 1P3GA 3B6GD 1M19C 3LZ0A 3KSYA 5CP6D 5DNMA 3W96C 4LD9C 3LJAA 3WAAD 5GXQC 3WTPD 4H9NA 5B1MD 1S32D 1P3KB 3H0LC 1KX5C 5AV6C 5B0ZD 4NFTA 3KXBC 3KUYB 4KGCC 5B24A 2DF4C 4ZUXA 4X23D 4H9SA 2ZY2A 5DNND 3X1VD 2NZDC 3LZ1C 1P3IB 3AFAC 5AV5C 3WA9B 3AZHA 5BO0A 4ZBJC 5FUGA 5JRGD 4WU9D 4R8PC 4XUJA 1ZLAA 5AVCA 2BYKA 1P3OC 4H9RA 5GSUB 5CPID 5AVBB 4H9OA 3MVDD 3UTAA 3KWQA 3UT9A 3AZMA 3AZKA 3W99C 3B0CT 3REKA 4H9PB 5CHLB 5E5AC 3AV2B 4YM6B 3RELA 5B33A 3NQUA 3B6GA 1M19D 4G92C 3MGRC 4CAYA 3B0BA 5CP6A 2FJ7C 1H3OA 3WTPA 2G5IC 2CV5B 5B1MA 1S32A 1KX5D 5AV6D 5B0ZA 5B2IC 2XD1A 3KXBD 5B31C 4KGCD 3AZLB 3AV1B 3X1VA 1WWIA 4X23A 5DNNA 3AN2C 3B0DB 3LZ1D 2BG1A 3AFAD 5AV5D 5B40D 3AYWC 1W2EA 3A6NC 4WU9A 3X1SC 5JRGA 4R8PD 1BFMA 5F99B 1P3OD 2VQRA 5CPIA 3LELB 4WNNB 3MVDA 1ID3C 4YS3B 3REHC 3W98B 5B0YD 3A1IA 3W99D 5B32G 4XZQC 1A7WA 5E5AD 1KX3C 1P3GC 4J8VC 5AY8C 1M19A 1P3BC 5B31G 1BH8A 2FJ7D 3FDDA 4KHAB 5B32D 4QLCC 3VH5A 1KX5A 4J8WC 5AV6A 5B2ID 1HQ3C 3VH5T 5B31D 3F6TA 3KXBA 1P3FC 4KGCA 4KUDC 3REJC 3AN2D 3TU4B 1Z2CB 3LZ1A 3EPHA 3AZHC 3AFAA 5AV5A 1EQZC 5B40A 3AYWD 3A6ND 1F66B 1R4VA 4R8PA 1P3LB 3MGRB 1P3OA 3KWQC 3AZIB 4WU8C 3C1BB 1ID3D 4E45A 3REHD 5B0YA 2YFWA 3REKC 1M1AC 3W99A 4XZQD 5E5AA 3RELC 1KX3D 5B33C 3B6GC 3NQJB 2Y2OA 4J8VD 5CPKB 5AY8D 1P3BD 5AV8B 3WAAC 4WJ3C 2FJ7A 5CPJB 5B32A 4JJNC 4QLCD 4DQYB 3W97B 2Y2MA 5B0ZC 4J8WD 1M18D 5B2IA 1HQ3D 5BNXB 2YFVB 3AZEB 5B31A 1U35C 2HIOC 4X23C 1P3FD 4KUDD 3REJD 4EO5B 3AN2A 3AL0C 2G5HC 1EQZD 3REIC 1P3PB 1KX4B 3UTBB 1HTAA 4AWLC 3AYWA 3V9RA 3A6NA 3LZ0B 5C3IB 1F1EA 1Q9CA 2HUEB 3MVDC 5DNMB 3LJAB 4WU8D 1ID3A 3REHA 1M1AD 1TZYB 4H9NB 3X1TD 3X1UC 4XZQA 3WTPE 1KX3A 3MGPC 2NQBC 4J8VA 3A1KA 2IO5C 5AY8A 5B24B 4ZUXB 1P3BA 4E44A 4JJND 3AZHB 4QLCA 5FUGB 4CSRA 4XUJB 4J8WA 1ZLAB 5AVCB 1M18A 2BYKB 1HQ3A 4H9RB 3MGSC 4H9OB 1B6WA 2HIOD 4J8XC 3UTAB 1U35D 1P3FA 4KUDA 3UT9B 3REJA 3AZMB 3AZKB 1BH9A 4J8UC 5B40C 3B6FC 3REID 1EQZA 3AZJC 5BS7A 4M6BA 3NQUB 4CAYB 3AZNC 5CP6B 1H3OB 4WU8A 4NE6A 5B0YC 2Y2PA 5B2JD 3WTPB 5AV9C 1M1AA 1P3AC 1T3UA 1AOIC 3X1TA 5B1MB 2BYMA 3X1UD 2F2AC 1S32B 1KU5A 4UUZA 3MGPD 2NQBD 2JE5A 3MGQB 3X1VB 3WAAA 2Y2IA 4HGAC 5DNNB 5B32C 2W8SA 4JJNA 3O62C 5BNVA 5JA4A 4WU9B 2L5AA 5JRGB 2JCHA 3AZFB 4G91C 3MGSD 5CPIB 4J8XD 2F8NK 1U35A 2HIOA 3B0CW 4Z2MH 4H9QA 4J8UD 3WKJD 3B6FD 3REIA 3VH6A 3R45A 3AZJD 1P3MC 5F99D 1M19B 3VH6T 5GT3C 3AZND 1BH8B 3W96B 4LD9B 5GXQB 5B2JA 5AV9D 1P3AD 1AOID 3X1UA 1KX5B 2PYOC 5GT0C 5AV6B 3MGPA 2NQBA 3KXBB 2F8NG 4KGCB 2NZDB 3MNNC 3LZ1B 3AFAB 5AV5B 3O62D 3H0RC 4ZBJB 1M18C 4R8PB 1TAFA 2F8ND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3O B;  5B1L C;  3MGS A;  3C1C C;  4J8X A;  2YFW B;  3W99 B;  1P34 C;  4J8U A;  3WKJ A;  5E5A B;  5BS7 C;  3B6F A;  3AZJ A;  1WWS A;  4Z5T D;  1P3M D;  5F99 A;  4G92 B;  3AZG C;  2ARO C;  5GT3 D;  3AZI D;  3AZN A;  2FJ7 B;  2F8N H;  4Z66 C;  5AV9 A;  3X1T C;  1P3A A;  1AOI A;  3VH5 W;  5GT0 D;  2PYO D;  5B2I B;  5B31 B;  1N1J B;  3MNN D;  3AN2 B;  1P3K C;  3O62 A;  1ULY A;  3AYW B;  3A6N B;  3KUY C;  1B67 A;  3X1S B;  2F8N A;  5B1L D;  3C1C D;  4DRA A;  1P3I C;  1ID3 B;  3REH B;  3WA9 C;  1P34 D;  1P3P D;  4XZQ B;  5KDM A;  1KX3 B;  1P3G B;  4J8V B;  5GSU C;  4Z5T A;  5AVB C;  1P3M A;  5AY8 B;  3AZG D;  2RVQ D;  2ARO D;  3AZI A;  5GT3 A;  1P3B B;  5B2J C;  1TZY D;  4Z66 D;  3AV2 C;  4YM6 C;  4QLC B;  4CSR B;  4J8W B;  5GT0 A;  2PYO A;  1HQ3 B;  1P3F B;  4KUD B;  3REJ B;  3MNN A;  2CV5 C;  1P3K D;  1BH9 B;  5BO0 B;  1EQZ B;  3KUY D;  3AZL C;  2YFV A;  3AV1 C;  5B1L A;  3B0D C;  3C1C A;  3KWQ B;  1P3I D;  4WU8 B;  4NE5 A;  3WA9 D;  3REK B;  1M1A B;  2JSS A;  3WKJ C;  1P34 A;  1P3P A;  2BYM B;  5BT1 C;  4UUZ B;  3REL B;  5B33 B;  3B6G B;  5F99 C;  5GSU D;  1JFI A;  5AVB D;  3LEL C;  3AZG A;  4Z2M G;  2ARO A;  4YS3 C;  3W98 C;  3WAA B;  5G49 A;  1TZY A;  4Z66 A;  4JJN B;  3AV2 D;  4YM6 D;  5BNV B;  5JA4 B;  5B0Z B;  3MGQ D;  1U35 B;  2HIO B;  4X23 B;  2CV5 D;  4H9Q B;  1P3K A;  3REI B;  3R45 B;  4AWL B;  3AZF D;  3KUY A;  3AZL D;  2CWE A;  3AV1 D;  3MVD B;  3TU4 C;  1P3I A;  5B2J B;  3WA9 A;  1F66 C;  5BT1 D;  3X1U B;  1P3L C;  4Z5T C;  3MGP B;  2NQB B;  5GSU A;  5AVB A;  3LEL D;  2IO5 B;  4WZS B;  3AZI C;  3W96 D;  4DRB A;  3C1B C;  4LD9 D;  4YS3 D;  5GXQ D;  3W98 D;  4H9P A;  3AV2 A;  4YM6 A;  5CPK C;  1TAF B;  5AV8 C;  3MGQ A;  3MGS B;  2NZD D;  4J8X B;  5CPJ C;  2CV5 A;  3W97 C;  5B40 B;  4J8U B;  3WKJ B;  3B6F B;  3AZJ B;  3AZF A;  3AZE C;  3VH6 W;  4NE3 A;  3AZL A;  3AV1 A;  3AZN B;  4EO5 C;  3TU4 D;  5B0Y B;  5AV9 B;  1P3P C;  1KX4 C;  3UTB C;  1P3A B;  1AOI B;  1F66 D;  3LZ0 C;  5C3I C;  1P3L D;  2HUE C;  3MGR D;  2RVQ C;  5DNM C;  3LEL A;  3LJA C;  4WNN A;  3W96 A;  3C1B D;  4LD9 A;  4YS3 A;  5GXQ A;  3W98 A;  4HGA B;  1TZY C;  5B32 B;  3O62 B;  5CPK D;  5B24 C;  2F8N B;  4ZUX C;  5AV8 D;  4H9S C;  4G91 B;  2NZD A;  4KHA A;  5CPJ D;  3W97 D;  2LY8 A;  5KDM B;  4XUJ C;  3V9R B;  3X1S D;  5AVC C;  1ZLA C;  3AZE D;  4Z5T B;  1P3M B;  3UTA C;  3UT9 C;  5GT3 B;  3AZM C;  3TU4 A;  3AZK C;  1KX4 D;  3UTB D;  1F66 A;  1P3G D;  3LZ0 D;  2PYO B;  5GT0 B;  1P3L A;  3MGR A;  5DNM D;  5CP6 C;  3LJA D;  3C1B A;  3WTP C;  3MNN B;  4WV4 B;  5B1M C;  1S32 C;  3NQJ A;  5CPK A;  1M18 B;  5B24 D;  3MGQ C;  4ZUX D;  3X1V C;  1N1J A;  5AV8 A;  5DNN C;  5B1L B;  3C1C B;  5CPJ A;  3AZH D;  3W97 A;  1P34 B;  4WU9 C;  5JRG C;  4XUJ D;  3AZF C;  1ZLA D;  3X1S A;  5AVC D;  5BNX A;  3AZE A;  5CPI C;  1JFI B;  3AZG B;  3UTA D;  3KWQ D;  2ARO B;  3UT9 D;  3AZM D;  3AZK D;  5G49 B;  3REK D;  4Z66 B;  3X1T B;  1KX4 A;  3UTB A;  3REL D;  5B33 D;  1P3G A;  3B6G D;  1M19 C;  3LZ0 A;  3KSY A;  5CP6 D;  5DNM A;  3W96 C;  4LD9 C;  3LJA A;  3WAA D;  5GXQ C;  3WTP D;  4H9N A;  5B1M D;  1S32 D;  1P3K B;  1KX5 C;  5AV6 C;  5B0Z D;  4NFT A;  3KXB C;  3KUY B;  4KGC C;  5B24 A;  4ZUX A;  3X1V D;  4X23 D;  4H9S A;  5DNN D;  2NZD C;  3LZ1 C;  1P3I B;  3AFA C;  5AV5 C;  3WA9 B;  3AZH A;  5BO0 A;  4ZBJ C;  5FUG A;  5JRG D;  4WU9 D;  4R8P C;  4XUJ A;  1ZLA A;  5AVC A;  2BYK A;  1P3O C;  4H9R A;  5GSU B;  5CPI D;  5AVB B;  4H9O A;  3MVD D;  3UTA A;  3KWQ A;  3UT9 A;  3AZM A;  3AZK A;  3W99 C;  3B0C T;  3REK A;  4H9P B;  5CHL B;  5E5A C;  3AV2 B;  4YM6 B;  3REL A;  5B33 A;  3NQU A;  3B6G A;  1M19 D;  4G92 C;  3MGR C;  4CAY A;  3B0B A;  5CP6 A;  2FJ7 C;  1H3O A;  3WTP A;  2CV5 B;  5B1M A;  1S32 A;  1KX5 D;  5AV6 D;  5B0Z A;  5B2I C;  3KXB D;  5B31 C;  4KGC D;  3AZL B;  3AV1 B;  3X1V A;  1WWI A;  4X23 A;  5DNN A;  3AN2 C;  3B0D B;  3LZ1 D;  3AFA D;  5AV5 D;  5B40 D;  3AYW C;  3A6N C;  4WU9 A;  3X1S C;  5JRG A;  4R8P D;  1BFM A;  5F99 B;  1P3O D;  5CPI A;  3LEL B;  4WNN B;  3MVD A;  1ID3 C;  4YS3 B;  3REH C;  3W98 B;  5B0Y D;  3W99 D;  5B32 G;  4XZQ C;  1A7W A;  5E5A D;  1KX3 C;  1P3G C;  4J8V C;  5AY8 C;  1M19 A;  1P3B C;  5B31 G;  1BH8 A;  2FJ7 D;  4KHA B;  5B32 D;  4QLC C;  3VH5 A;  1KX5 A;  4J8W C;  5AV6 A;  5B2I D;  1HQ3 C;  3VH5 T;  5B31 D;  3KXB A;  1P3F C;  4KGC A;  4KUD C;  3REJ C;  3AN2 D;  3TU4 B;  3LZ1 A;  3AZH C;  3AFA A;  5AV5 A;  1EQZ C;  5B40 A;  3AYW D;  3A6N D;  1F66 B;  1R4V A;  4R8P A;  1P3L B;  3MGR B;  1P3O A;  3KWQ C;  3AZI B;  4WU8 C;  3C1B B;  1ID3 D;  4E45 A;  3REH D;  5B0Y A;  2YFW A;  3REK C;  1M1A C;  3W99 A;  4XZQ D;  5E5A A;  3REL C;  1KX3 D;  5B33 C;  3B6G C;  3NQJ B;  4J8V D;  5CPK B;  5AY8 D;  1P3B D;  5AV8 B;  3WAA C;  2FJ7 A;  5CPJ B;  5B32 A;  4JJN C;  4QLC D;  3W97 B;  5B0Z C;  4J8W D;  1M18 D;  5B2I A;  1HQ3 D;  5BNX B;  2YFV B;  3AZE B;  5B31 A;  1U35 C;  2HIO C;  4X23 C;  1P3F D;  4KUD D;  3REJ D;  4EO5 B;  3AN2 A;  1EQZ D;  3REI C;  1P3P B;  1KX4 B;  3UTB B;  1HTA A;  4AWL C;  3AYW A;  3V9R A;  3A6N A;  3LZ0 B;  5C3I B;  1F1E A;  1Q9C A;  2HUE B;  3MVD C;  5DNM B;  3LJA B;  4WU8 D;  1ID3 A;  3REH A;  1M1A D;  1TZY B;  4H9N B;  3X1T D;  3X1U C;  4XZQ A;  3WTP E;  1KX3 A;  3MGP C;  2NQB C;  4J8V A;  2IO5 C;  5AY8 A;  5B24 B;  4ZUX B;  1P3B A;  4E44 A;  4JJN D;  3AZH B;  4QLC A;  5FUG B;  4CSR A;  4XUJ B;  4J8W A;  1ZLA B;  5AVC B;  1M18 A;  2BYK B;  1HQ3 A;  4H9R B;  3MGS C;  4H9O B;  1B6W A;  2HIO D;  4J8X C;  3UTA B;  1U35 D;  1P3F A;  4KUD A;  3UT9 B;  3REJ A;  3AZM B;  3AZK B;  1BH9 A;  4J8U C;  5B40 C;  3B6F C;  3REI D;  1EQZ A;  3AZJ C;  5BS7 A;  4M6B A;  3NQU B;  4CAY B;  3AZN C;  5CP6 B;  1H3O B;  4WU8 A;  4NE6 A;  5B0Y C;  5B2J D;  3WTP B;  5AV9 C;  1M1A A;  1P3A C;  1AOI C;  3X1T A;  5B1M B;  2BYM A;  3X1U D;  1S32 B;  1KU5 A;  4UUZ A;  3MGP D;  2NQB D;  3MGQ B;  3X1V B;  3WAA A;  5DNN B;  4HGA C;  5B32 C;  4JJN A;  3O62 C;  5BNV A;  5JA4 A;  4WU9 B;  2L5A A;  5JRG B;  3AZF B;  4G91 C;  3MGS D;  5CPI B;  4J8X D;  2F8N K;  1U35 A;  2HIO A;  3B0C W;  4Z2M H;  4H9Q A;  4J8U D;  3WKJ D;  3B6F D;  3REI A;  3VH6 A;  3R45 A;  3AZJ D;  1P3M C;  5F99 D;  1M19 B;  3VH6 T;  5GT3 C;  3AZN D;  1BH8 B;  3W96 B;  4LD9 B;  5GXQ B;  5B2J A;  5AV9 D;  1P3A D;  1AOI D;  3X1U A;  1KX5 B;  2PYO C;  5GT0 C;  5AV6 B;  3MGP A;  2NQB A;  3KXB B;  2F8N G;  4KGC B;  2NZD B;  3MNN C;  3LZ1 B;  3AFA B;  5AV5 B;  3O62 D;  4ZBJ B;  1M18 C;  4R8P B;  1TAF A;  2F8N D; 
#chains in the Genus database with same CATH topology
 2J8P A;  1P3O B;  5B1L C;  3MGS A;  3C1C C;  4J8X A;  2YFW B;  3W99 B;  1P34 C;  4J8U A;  3WKJ A;  5E5A B;  5BS7 C;  3B6F A;  3AZJ A;  1WWS A;  4Z5T D;  1P3M D;  5F99 A;  4G92 B;  3AZG C;  2ARO C;  5GT3 D;  3AZI D;  3AZN A;  2FJ7 B;  2F8N H;  4Z66 C;  5AV9 A;  3X1T C;  1P3A A;  1AOI A;  3VH5 W;  5GT0 D;  2PYO D;  5B2I B;  2UWX A;  5B31 B;  3EG5 B;  1N1J B;  3MNN D;  3AN2 B;  1P3K C;  2ZY3 A;  3O62 A;  1ULY A;  3AYW B;  3A6N B;  3KUY C;  1B67 A;  3X1S B;  2F8N A;  5B1L D;  3C1C D;  4DRA A;  1P3I C;  1ID3 B;  3REH B;  3WA9 C;  2ZY5 A;  1P34 D;  1P3P D;  4XZQ B;  5KDM A;  1KX3 B;  1P3G B;  4J8V B;  5GSU C;  4Z5T A;  5AVB C;  1P3M A;  5AY8 B;  3AZG D;  2RVQ D;  2ARO D;  3AZI A;  5GT3 A;  1P3B B;  5B2J C;  1TZY D;  4Z66 D;  3AV2 C;  4YM6 C;  2Y2K A;  4QLC B;  4CSR B;  4J8W B;  5GT0 A;  2PYO A;  1HQ3 B;  1P3F B;  4KUD B;  3REJ B;  3MNN A;  2CV5 C;  1P3K D;  1BH9 B;  5BO0 B;  1EQZ B;  3KUY D;  3AZL C;  2YFV A;  3AV1 C;  5B1L A;  3B0D C;  3C1C A;  3KWQ B;  1P3I D;  4WU8 B;  4NE5 A;  3WA9 D;  3REK B;  1M1A B;  2JSS A;  3WKJ C;  1P34 A;  1P3P A;  2BYM B;  5BT1 C;  1PZR A;  4UUZ B;  3REL B;  5B33 B;  3B6G B;  5F99 C;  2Y2G A;  5GSU D;  1JFI A;  5AVB D;  3LEL C;  3AZG A;  4Z2M G;  2ARO A;  4YS3 C;  3W98 C;  3P5J B;  3WAA B;  5G49 A;  1TZY A;  4Z66 A;  4JJN B;  3AV2 D;  4YM6 D;  5BNV B;  5JA4 B;  5B0Z B;  3MGQ D;  1U35 B;  2HIO B;  4X23 B;  2CV5 D;  4H9Q B;  1P3K A;  3KFU G;  2ZM5 A;  3REI B;  3R45 B;  2FFF B;  4AWL B;  3AZF D;  3KUY A;  3AZL D;  2CWE A;  3AV1 D;  3MVD B;  3TU4 C;  1P3I A;  5B2J B;  3WA9 A;  1F66 C;  5BT1 D;  3X1U B;  1P3L C;  4Z5T C;  3MGP B;  2NQB B;  5GSU A;  5AVB A;  3LEL D;  2IO5 B;  4WZS B;  3AZI C;  3W96 D;  4DRB A;  3C1B C;  4LD9 D;  4YS3 D;  5GXQ D;  3W98 D;  4H9P A;  3EPJ A;  3AV2 A;  4YM6 A;  5CPK C;  1TAF B;  5AV8 C;  3MGQ A;  3MGS B;  2NZD D;  4J8X B;  5CPJ C;  2RIQ A;  2CV5 A;  3W97 C;  5B40 B;  4J8U B;  3WKJ B;  3B6F B;  3AZJ B;  3AZF A;  3AZE C;  3VH6 W;  4NE3 A;  3AZL A;  3AV1 A;  3AZN B;  4EO5 C;  3TU4 D;  5B0Y B;  5AV9 B;  1P3P C;  1KX4 C;  3UTB C;  1P3A B;  1AOI B;  1F66 D;  3LZ0 C;  5C3I C;  1P3L D;  2HUE C;  3MGR D;  2RVQ C;  5DNM C;  3LEL A;  3LJA C;  4WNN A;  3W96 A;  3C1B D;  4LD9 A;  4YS3 A;  5GXQ A;  3W98 A;  4HGA B;  3EPK A;  2Y2J A;  1TZY C;  5B32 B;  3O62 B;  5CPK D;  5B24 C;  2F8N B;  4ZUX C;  5AV8 D;  4H9S C;  4G91 B;  2NZD A;  4KHA A;  5CPJ D;  2ZY4 A;  3IP4 C;  3W97 D;  2LY8 A;  5KDM B;  2XD5 A;  4XUJ C;  3V9R B;  3X1S D;  5AVC C;  1ZLA C;  3AZE D;  2Y2L A;  4Z5T B;  1P3M B;  3UTA C;  3UT9 C;  5GT3 B;  3AZM C;  3TU4 A;  3AZK C;  1KX4 D;  3UTB D;  1F66 A;  1P3G D;  3LZ0 D;  2PYO B;  5GT0 B;  1P3L A;  3MGR A;  5DNM D;  5CP6 C;  3LJA D;  4UPK A;  3C1B A;  3WTP C;  2Y2Q A;  3MNN B;  3H0M C;  4WV4 B;  5B1M C;  1S32 C;  3NQJ A;  5CPK A;  1M18 B;  5B24 D;  3MGQ C;  4ZUX D;  1N1J A;  3X1V C;  5AV8 A;  5DNN C;  5B1L B;  3C1C B;  2DQN C;  5CPJ A;  3AZH D;  3W97 A;  1P34 B;  4WU9 C;  5JRG C;  4XUJ D;  3AZF C;  1ZLA D;  3X1S A;  5AVC D;  5BNX A;  3AZE A;  2Y2H A;  2Y2N A;  5CPI C;  3EPL A;  1JFI B;  3AZG B;  3UTA D;  3KWQ D;  2ARO B;  3UT9 D;  3AZM D;  3AZK D;  5G49 B;  3REK D;  4Z66 B;  3X1T B;  1KX4 A;  3UTB A;  3REL D;  5B33 D;  1P3G A;  3B6G D;  1M19 C;  3LZ0 A;  3KSY A;  5CP6 D;  5DNM A;  3W96 C;  4LD9 C;  3LJA A;  3WAA D;  5GXQ C;  3WTP D;  4H9N A;  5B1M D;  1S32 D;  1P3K B;  3H0L C;  1KX5 C;  5AV6 C;  5B0Z D;  4NFT A;  3KXB C;  3KUY B;  4KGC C;  5B24 A;  2DF4 C;  4ZUX A;  4X23 D;  4H9S A;  2ZY2 A;  5DNN D;  3X1V D;  2NZD C;  3LZ1 C;  1P3I B;  3AFA C;  5AV5 C;  3WA9 B;  3AZH A;  5BO0 A;  4ZBJ C;  5FUG A;  5JRG D;  4WU9 D;  4R8P C;  4XUJ A;  1ZLA A;  5AVC A;  2BYK A;  1P3O C;  4H9R A;  5GSU B;  5CPI D;  5AVB B;  4H9O A;  3MVD D;  3UTA A;  3KWQ A;  3UT9 A;  3AZM A;  3AZK A;  3W99 C;  3B0C T;  3REK A;  4H9P B;  5CHL B;  5E5A C;  3AV2 B;  4YM6 B;  3REL A;  5B33 A;  3NQU A;  3B6G A;  1M19 D;  4G92 C;  3MGR C;  4CAY A;  3B0B A;  5CP6 A;  2FJ7 C;  1H3O A;  3WTP A;  2G5I C;  2CV5 B;  5B1M A;  1S32 A;  1KX5 D;  5AV6 D;  5B0Z A;  5B2I C;  2XD1 A;  3KXB D;  5B31 C;  4KGC D;  3AZL B;  3AV1 B;  3X1V A;  1WWI A;  4X23 A;  5DNN A;  3AN2 C;  3B0D B;  3LZ1 D;  2BG1 A;  3AFA D;  5AV5 D;  5B40 D;  3AYW C;  1W2E A;  3A6N C;  4WU9 A;  3X1S C;  5JRG A;  4R8P D;  1BFM A;  5F99 B;  1P3O D;  2VQR A;  5CPI A;  3LEL B;  4WNN B;  3MVD A;  1ID3 C;  4YS3 B;  3REH C;  3W98 B;  5B0Y D;  3A1I A;  3W99 D;  5B32 G;  4XZQ C;  1A7W A;  5E5A D;  1KX3 C;  1P3G C;  4J8V C;  5AY8 C;  1M19 A;  1P3B C;  5B31 G;  1BH8 A;  2FJ7 D;  3FDD A;  4KHA B;  5B32 D;  4QLC C;  3VH5 A;  1KX5 A;  4J8W C;  5AV6 A;  5B2I D;  1HQ3 C;  3VH5 T;  5B31 D;  3F6T A;  3KXB A;  1P3F C;  4KGC A;  4KUD C;  3REJ C;  3AN2 D;  3TU4 B;  1Z2C B;  3LZ1 A;  3EPH A;  3AZH C;  3AFA A;  5AV5 A;  1EQZ C;  5B40 A;  3AYW D;  3A6N D;  1F66 B;  1R4V A;  4R8P A;  1P3L B;  3MGR B;  1P3O A;  3KWQ C;  3AZI B;  4WU8 C;  3C1B B;  1ID3 D;  4E45 A;  3REH D;  5B0Y A;  2YFW A;  3REK C;  1M1A C;  3W99 A;  4XZQ D;  5E5A A;  3REL C;  1KX3 D;  5B33 C;  3B6G C;  3NQJ B;  2Y2O A;  4J8V D;  5CPK B;  5AY8 D;  1P3B D;  5AV8 B;  3WAA C;  4WJ3 C;  2FJ7 A;  5CPJ B;  5B32 A;  4JJN C;  4QLC D;  4DQY B;  3W97 B;  2Y2M A;  5B0Z C;  4J8W D;  1M18 D;  5B2I A;  1HQ3 D;  5BNX B;  2YFV B;  3AZE B;  5B31 A;  1U35 C;  2HIO C;  4X23 C;  1P3F D;  4KUD D;  3REJ D;  4EO5 B;  3AN2 A;  3AL0 C;  2G5H C;  1EQZ D;  3REI C;  1P3P B;  1KX4 B;  3UTB B;  1HTA A;  4AWL C;  3AYW A;  3V9R A;  3A6N A;  3LZ0 B;  5C3I B;  1F1E A;  1Q9C A;  2HUE B;  3MVD C;  5DNM B;  3LJA B;  4WU8 D;  1ID3 A;  3REH A;  1M1A D;  1TZY B;  4H9N B;  3X1T D;  3X1U C;  4XZQ A;  3WTP E;  1KX3 A;  3MGP C;  2NQB C;  4J8V A;  3A1K A;  2IO5 C;  5AY8 A;  5B24 B;  4ZUX B;  1P3B A;  4E44 A;  4JJN D;  3AZH B;  4QLC A;  5FUG B;  4CSR A;  4XUJ B;  4J8W A;  1ZLA B;  5AVC B;  1M18 A;  2BYK B;  1HQ3 A;  4H9R B;  3MGS C;  4H9O B;  1B6W A;  2HIO D;  4J8X C;  3UTA B;  1U35 D;  1P3F A;  4KUD A;  3UT9 B;  3REJ A;  3AZM B;  3AZK B;  1BH9 A;  4J8U C;  5B40 C;  3B6F C;  3REI D;  1EQZ A;  3AZJ C;  5BS7 A;  4M6B A;  3NQU B;  4CAY B;  3AZN C;  5CP6 B;  1H3O B;  4WU8 A;  4NE6 A;  5B0Y C;  2Y2P A;  5B2J D;  3WTP B;  5AV9 C;  1M1A A;  1P3A C;  1T3U A;  1AOI C;  3X1T A;  5B1M B;  2BYM A;  3X1U D;  2F2A C;  1S32 B;  1KU5 A;  4UUZ A;  3MGP D;  2NQB D;  2JE5 A;  3MGQ B;  3X1V B;  3WAA A;  2Y2I A;  4HGA C;  5DNN B;  5B32 C;  2W8S A;  4JJN A;  3O62 C;  5BNV A;  5JA4 A;  4WU9 B;  2L5A A;  5JRG B;  2JCH A;  3AZF B;  4G91 C;  3MGS D;  5CPI B;  4J8X D;  2F8N K;  1U35 A;  2HIO A;  3B0C W;  4Z2M H;  4H9Q A;  4J8U D;  3WKJ D;  3B6F D;  3REI A;  3VH6 A;  3R45 A;  3AZJ D;  1P3M C;  5F99 D;  1M19 B;  3VH6 T;  5GT3 C;  3AZN D;  1BH8 B;  3W96 B;  4LD9 B;  5GXQ B;  5B2J A;  5AV9 D;  1P3A D;  1AOI D;  3X1U A;  1KX5 B;  2PYO C;  5GT0 C;  5AV6 B;  3MGP A;  2NQB A;  3KXB B;  2F8N G;  4KGC B;  2NZD B;  3MNN C;  3LZ1 B;  3AFA B;  5AV5 B;  3O62 D;  3H0R C;  4ZBJ B;  1M18 C;  4R8P B;  1TAF A;  2F8N D; 
#chains in the Genus database with same CATH homology
 2J8P A;  1P3O B;  5B1L C;  3MGS A;  3C1C C;  4J8X A;  2YFW B;  3W99 B;  1P34 C;  4J8U A;  3WKJ A;  5E5A B;  5BS7 C;  3B6F A;  3AZJ A;  1WWS A;  4Z5T D;  1P3M D;  5F99 A;  4G92 B;  3AZG C;  2ARO C;  5GT3 D;  3AZI D;  3AZN A;  2FJ7 B;  2F8N H;  4Z66 C;  5AV9 A;  3X1T C;  1P3A A;  1AOI A;  3VH5 W;  5GT0 D;  2PYO D;  5B2I B;  2UWX A;  5B31 B;  3EG5 B;  1N1J B;  3MNN D;  3AN2 B;  1P3K C;  2ZY3 A;  3O62 A;  1ULY A;  3AYW B;  3A6N B;  3KUY C;  1B67 A;  3X1S B;  2F8N A;  5B1L D;  3C1C D;  4DRA A;  1P3I C;  1ID3 B;  3REH B;  3WA9 C;  2ZY5 A;  1P34 D;  1P3P D;  4XZQ B;  5KDM A;  1KX3 B;  1P3G B;  4J8V B;  5GSU C;  4Z5T A;  5AVB C;  1P3M A;  5AY8 B;  3AZG D;  2RVQ D;  2ARO D;  3AZI A;  5GT3 A;  1P3B B;  5B2J C;  1TZY D;  4Z66 D;  3AV2 C;  4YM6 C;  2Y2K A;  4QLC B;  4CSR B;  4J8W B;  5GT0 A;  2PYO A;  1HQ3 B;  1P3F B;  4KUD B;  3REJ B;  3MNN A;  2CV5 C;  1P3K D;  1BH9 B;  5BO0 B;  1EQZ B;  3KUY D;  3AZL C;  2YFV A;  3AV1 C;  5B1L A;  3B0D C;  3C1C A;  3KWQ B;  1P3I D;  4WU8 B;  4NE5 A;  3WA9 D;  3REK B;  1M1A B;  2JSS A;  3WKJ C;  1P34 A;  1P3P A;  2BYM B;  5BT1 C;  1PZR A;  4UUZ B;  3REL B;  5B33 B;  3B6G B;  5F99 C;  2Y2G A;  5GSU D;  1JFI A;  5AVB D;  3LEL C;  3AZG A;  4Z2M G;  2ARO A;  4YS3 C;  3W98 C;  3P5J B;  3WAA B;  5G49 A;  1TZY A;  4Z66 A;  4JJN B;  3AV2 D;  4YM6 D;  5BNV B;  5JA4 B;  5B0Z B;  3MGQ D;  1U35 B;  2HIO B;  4X23 B;  2CV5 D;  4H9Q B;  1P3K A;  3KFU G;  2ZM5 A;  3REI B;  3R45 B;  2FFF B;  4AWL B;  3AZF D;  3KUY A;  3AZL D;  2CWE A;  3AV1 D;  3MVD B;  3TU4 C;  1P3I A;  5B2J B;  3WA9 A;  1F66 C;  5BT1 D;  3X1U B;  1P3L C;  4Z5T C;  3MGP B;  2NQB B;  5GSU A;  5AVB A;  3LEL D;  2IO5 B;  4WZS B;  3AZI C;  3W96 D;  4DRB A;  3C1B C;  4LD9 D;  4YS3 D;  5GXQ D;  3W98 D;  4H9P A;  3EPJ A;  3AV2 A;  4YM6 A;  5CPK C;  1TAF B;  5AV8 C;  3MGQ A;  3MGS B;  2NZD D;  4J8X B;  5CPJ C;  2RIQ A;  2CV5 A;  3W97 C;  5B40 B;  4J8U B;  3WKJ B;  3B6F B;  3AZJ B;  3AZF A;  3AZE C;  3VH6 W;  4NE3 A;  3AZL A;  3AV1 A;  3AZN B;  4EO5 C;  3TU4 D;  5B0Y B;  5AV9 B;  1P3P C;  1KX4 C;  3UTB C;  1P3A B;  1AOI B;  1F66 D;  3LZ0 C;  5C3I C;  1P3L D;  2HUE C;  3MGR D;  2RVQ C;  5DNM C;  3LEL A;  3LJA C;  4WNN A;  3W96 A;  3C1B D;  4LD9 A;  4YS3 A;  5GXQ A;  3W98 A;  4HGA B;  3EPK A;  2Y2J A;  1TZY C;  5B32 B;  3O62 B;  5CPK D;  5B24 C;  2F8N B;  4ZUX C;  5AV8 D;  4H9S C;  4G91 B;  2NZD A;  4KHA A;  5CPJ D;  2ZY4 A;  3IP4 C;  3W97 D;  2LY8 A;  5KDM B;  2XD5 A;  4XUJ C;  3V9R B;  3X1S D;  5AVC C;  1ZLA C;  3AZE D;  2Y2L A;  4Z5T B;  1P3M B;  3UTA C;  3UT9 C;  5GT3 B;  3AZM C;  3TU4 A;  3AZK C;  1KX4 D;  3UTB D;  1F66 A;  1P3G D;  3LZ0 D;  2PYO B;  5GT0 B;  1P3L A;  3MGR A;  5DNM D;  5CP6 C;  3LJA D;  4UPK A;  3C1B A;  3WTP C;  2Y2Q A;  3MNN B;  3H0M C;  4WV4 B;  5B1M C;  1S32 C;  3NQJ A;  5CPK A;  1M18 B;  5B24 D;  3MGQ C;  4ZUX D;  1N1J A;  3X1V C;  5AV8 A;  5DNN C;  5B1L B;  3C1C B;  2DQN C;  5CPJ A;  3AZH D;  3W97 A;  1P34 B;  4WU9 C;  5JRG C;  4XUJ D;  3AZF C;  1ZLA D;  3X1S A;  5AVC D;  5BNX A;  3AZE A;  2Y2H A;  2Y2N A;  5CPI C;  3EPL A;  1JFI B;  3AZG B;  3UTA D;  3KWQ D;  2ARO B;  3UT9 D;  3AZM D;  3AZK D;  5G49 B;  3REK D;  4Z66 B;  3X1T B;  1KX4 A;  3UTB A;  3REL D;  5B33 D;  1P3G A;  3B6G D;  1M19 C;  3LZ0 A;  3KSY A;  5CP6 D;  5DNM A;  3W96 C;  4LD9 C;  3LJA A;  3WAA D;  5GXQ C;  3WTP D;  4H9N A;  5B1M D;  1S32 D;  1P3K B;  3H0L C;  1KX5 C;  5AV6 C;  5B0Z D;  4NFT A;  3KXB C;  3KUY B;  4KGC C;  5B24 A;  2DF4 C;  4ZUX A;  4X23 D;  4H9S A;  2ZY2 A;  5DNN D;  3X1V D;  2NZD C;  3LZ1 C;  1P3I B;  3AFA C;  5AV5 C;  3WA9 B;  3AZH A;  5BO0 A;  4ZBJ C;  5FUG A;  5JRG D;  4WU9 D;  4R8P C;  4XUJ A;  1ZLA A;  5AVC A;  2BYK A;  1P3O C;  4H9R A;  5GSU B;  5CPI D;  5AVB B;  4H9O A;  3MVD D;  3UTA A;  3KWQ A;  3UT9 A;  3AZM A;  3AZK A;  3W99 C;  3B0C T;  3REK A;  4H9P B;  5CHL B;  5E5A C;  3AV2 B;  4YM6 B;  3REL A;  5B33 A;  3NQU A;  3B6G A;  1M19 D;  4G92 C;  3MGR C;  4CAY A;  3B0B A;  5CP6 A;  2FJ7 C;  1H3O A;  3WTP A;  2G5I C;  2CV5 B;  5B1M A;  1S32 A;  1KX5 D;  5AV6 D;  5B0Z A;  5B2I C;  2XD1 A;  3KXB D;  5B31 C;  4KGC D;  3AZL B;  3AV1 B;  3X1V A;  1WWI A;  4X23 A;  5DNN A;  3AN2 C;  3B0D B;  3LZ1 D;  2BG1 A;  3AFA D;  5AV5 D;  5B40 D;  3AYW C;  1W2E A;  3A6N C;  4WU9 A;  3X1S C;  5JRG A;  4R8P D;  1BFM A;  5F99 B;  1P3O D;  2VQR A;  5CPI A;  3LEL B;  4WNN B;  3MVD A;  1ID3 C;  4YS3 B;  3REH C;  3W98 B;  5B0Y D;  3A1I A;  3W99 D;  5B32 G;  4XZQ C;  1A7W A;  5E5A D;  1KX3 C;  1P3G C;  4J8V C;  5AY8 C;  1M19 A;  1P3B C;  5B31 G;  1BH8 A;  2FJ7 D;  3FDD A;  4KHA B;  5B32 D;  4QLC C;  3VH5 A;  1KX5 A;  4J8W C;  5AV6 A;  5B2I D;  1HQ3 C;  3VH5 T;  5B31 D;  3F6T A;  3KXB A;  1P3F C;  4KGC A;  4KUD C;  3REJ C;  3AN2 D;  3TU4 B;  1Z2C B;  3LZ1 A;  3EPH A;  3AZH C;  3AFA A;  5AV5 A;  1EQZ C;  5B40 A;  3AYW D;  3A6N D;  1F66 B;  1R4V A;  4R8P A;  1P3L B;  3MGR B;  1P3O A;  3KWQ C;  3AZI B;  4WU8 C;  3C1B B;  1ID3 D;  4E45 A;  3REH D;  5B0Y A;  2YFW A;  3REK C;  1M1A C;  3W99 A;  4XZQ D;  5E5A A;  3REL C;  1KX3 D;  5B33 C;  3B6G C;  3NQJ B;  2Y2O A;  4J8V D;  5CPK B;  5AY8 D;  1P3B D;  5AV8 B;  3WAA C;  4WJ3 C;  2FJ7 A;  5CPJ B;  5B32 A;  4JJN C;  4QLC D;  4DQY B;  3W97 B;  2Y2M A;  5B0Z C;  4J8W D;  1M18 D;  5B2I A;  1HQ3 D;  5BNX B;  2YFV B;  3AZE B;  5B31 A;  1U35 C;  2HIO C;  4X23 C;  1P3F D;  4KUD D;  3REJ D;  4EO5 B;  3AN2 A;  3AL0 C;  2G5H C;  1EQZ D;  3REI C;  1P3P B;  1KX4 B;  3UTB B;  1HTA A;  4AWL C;  3AYW A;  3V9R A;  3A6N A;  3LZ0 B;  5C3I B;  1F1E A;  1Q9C A;  2HUE B;  3MVD C;  5DNM B;  3LJA B;  4WU8 D;  1ID3 A;  3REH A;  1M1A D;  1TZY B;  4H9N B;  3X1T D;  3X1U C;  4XZQ A;  3WTP E;  1KX3 A;  3MGP C;  2NQB C;  4J8V A;  3A1K A;  2IO5 C;  5AY8 A;  5B24 B;  4ZUX B;  1P3B A;  4E44 A;  4JJN D;  3AZH B;  4QLC A;  5FUG B;  4CSR A;  4XUJ B;  4J8W A;  1ZLA B;  5AVC B;  1M18 A;  2BYK B;  1HQ3 A;  4H9R B;  3MGS C;  4H9O B;  1B6W A;  2HIO D;  4J8X C;  3UTA B;  1U35 D;  1P3F A;  4KUD A;  3UT9 B;  3REJ A;  3AZM B;  3AZK B;  1BH9 A;  4J8U C;  5B40 C;  3B6F C;  3REI D;  1EQZ A;  3AZJ C;  5BS7 A;  4M6B A;  3NQU B;  4CAY B;  3AZN C;  5CP6 B;  1H3O B;  4WU8 A;  4NE6 A;  5B0Y C;  2Y2P A;  5B2J D;  3WTP B;  5AV9 C;  1M1A A;  1P3A C;  1T3U A;  1AOI C;  3X1T A;  5B1M B;  2BYM A;  3X1U D;  2F2A C;  1S32 B;  1KU5 A;  4UUZ A;  3MGP D;  2NQB D;  2JE5 A;  3MGQ B;  3X1V B;  3WAA A;  2Y2I A;  4HGA C;  5DNN B;  5B32 C;  2W8S A;  4JJN A;  3O62 C;  5BNV A;  5JA4 A;  4WU9 B;  2L5A A;  5JRG B;  2JCH A;  3AZF B;  4G91 C;  3MGS D;  5CPI B;  4J8X D;  2F8N K;  1U35 A;  2HIO A;  3B0C W;  4Z2M H;  4H9Q A;  4J8U D;  3WKJ D;  3B6F D;  3REI A;  3VH6 A;  3R45 A;  3AZJ D;  1P3M C;  5F99 D;  1M19 B;  3VH6 T;  5GT3 C;  3AZN D;  1BH8 B;  3W96 B;  4LD9 B;  5GXQ B;  5B2J A;  5AV9 D;  1P3A D;  1AOI D;  3X1U A;  1KX5 B;  2PYO C;  5GT0 C;  5AV6 B;  3MGP A;  2NQB A;  3KXB B;  2F8N G;  4KGC B;  2NZD B;  3MNN C;  3LZ1 B;  3AFA B;  5AV5 B;  3O62 D;  3H0R C;  4ZBJ B;  1M18 C;  4R8P B;  1TAF A;  2F8N D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...