1M18B

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Palindromic 146 Base Pair DNA Fragment
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 27
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m18B00
1ZLAC 1WWSA 5B40C 4KGCB 3X1UA 1KX4D 3NQUB 1P3MB 3LJAA 1ID3B 4QLCC 3C1BC 5AVBB 5DNMC 3W99D 3UT9C 2NQBA 5CP6A 3AZMA 3B6GD 4J8XD 1P34C 5B1LD 2CV5A 1P3IA 3REHC 1TZYB 4R8PD 3WKJB 5B0ZA 4ZUXA 3AN2D 2F8NK 5E5AA 1F66D 3X1VB 3MGRC 2HIOA 1EQZC 3R45A 3AZLD 5GXQA 5CPIB 1HQ3B 4JJND 5B1MB 3LZ1D 2PYOA 2F8ND 5GT3B 3AZHD 3AZKD 1KX5C 1P3BB 5GSUC 3V9RA 1KX3B 5BNVA 1P3GC 4WU8A 3WTPC 3TU4B 5G49A 3W96C 1AOIB 5AV9D 4CAYB 4Z66D 5JRGB 3W98A 3AFAD 4X23D 3O62D 3AZKC 5AV8A 5C3IC 4M6BA 3AZIA 4XUJD 3AZGA 3X1UC 3AV2B 3VH5W 4H9RB 3LJAC 2FJ7D 3UTAA 4Z2MH 4YM6B 1P3OB 2NQBC 5CP6C 3LZ0D 3AZMC 5B33D 1BH8B 3AV1D 3REKB 2CV5C 1P3IC 2RVQD 5B0YA 2AROD 4WU9A 1P3AA 3B6FB 5B0ZC 2FJ7C 4DRAA 1S32D 5E5AC 1P3KD 2YFVB 2NZDB 2HIOC 4J8UD 3RELB 1P3LA 4EO5B 5GXQC 5B31A 3MGQD 1Q9CA 5CPJB 4ZBJB 4KUDA 2PYOC 5AV6D 3MNNB 3AZJD 3AZEB 4KGCA 1R4VA 4WU8C 3NQUA 1P3MA 1ID3A 2IO5B 5AVBA 3WAAD 3W97D 1M19D 3W98C 3VH5A 3VH6A 4Z2MG 3AZNB 5AV8C 3AZIC 3AZGC 1TZYA 4HGAB 3KXBA 1TAFA 3WKJA 1HTAA 3UTAC 1BFMA 4G92B 1WWIA 3X1VA 3X1TB 3MGSD 3C1CD 3MGPD 3UTBB 5CPIA 1HQ3A 5B1MA 5FUGB 5GT3A 3REJB 1KU5A 1P3PB 5DNNB 5B0YC 3REIB 1P3AC 1P3BA 3A6NA 1KX3A 3X1SD 1A7WA 3TU4A 1P3LC 5B31C 4G91C 4CAYA 1M1AD 4AWLC 5F99B 5JRGA 1M18B 5CPKA 2BYKB 3AZFD 4J8VD 1P3MC 1ID3C 3KWQB 5AVBC 5B40D 4YM6A 1P3OA 1BH8A 5AY8B 4QLCD 3C1BD 3REKA 2YFWB 5DNMD 3MVDB 1TZYC 3B6FA 3UT9D 4KUDB 3WKJC 1P34D 5KDMB 2HUEB 4XZQB 2YFVA 3X1VC 1P3FB 2NZDA 4J8WB 3RELA 3REHD 4NE5A 5B2IB 5CPIC 4H9OB 1JFIB 5B1MC 4E45A 5CPJA 5GT3C 3KUYB 3MGRD 1EQZD 1P3BC 3MNNA 4H9SC 4Z5TB 3AZEA 1KX3C 3AV2D 4WNNB 3TU4C 1AOIC 3KXBB 4CSRB 1TAFB 4JJNA 1KX5D 5GSUD 2F8NA 1P3GD 5JRGC 3WTPE 5BS7A 3WTPD 3AZNA 3W96D 5AVCB 3AV2C 4YS3B 5B32G 5B24B 1U35B 2F8NH 3A6NB 4YM6C 3X1TA 1P3OC 3X1UD 3UTBA 4LD9D 3LJAD 5FUGA 3REKC 3AYWB 3REJA 1P3PA 5DNNA 3B6FC 3REIA 2NQBD 1BH9B 5CP6D 3AZMD 5CPKB 2NZDC 2CV5D 1P3ID 5CHLB 5B32B 5B0ZD 4ZUXD 5F99A 4ZBJC 5CPJC 3WA9B 5GT0B 5E5AD 1M18A 2HIOD 2BYKA 3LELB 4LD9B 3MNNC 5GXQD 3AZEC 1P3KA 5B2JA 2PYOD 2IO5C 3KWQA 1KX4B 4ZUXC 2F8NG 4WU8D 3W99B 5AY8A 3AZNC 3B6GB 1N1JA 4J8XB 2YFWA 4H9NB 3MVDA 4HGAC 5B1LB 3W98D 4R8PB 3AN2B 5KDMA 4XZQA 5AV8D 4G92C 1P3FA 3X1TC 3AZID 4J8WA 3AZGD 1F66B 3UTBC 5B2IA 1B6WA 3AZLB 4H9OA 1JFIA 3UTAD 3KUYA 4JJNB 3REJC 1P3PC 5DNNC 3LZ1B 2F8NB 3REIC 3AZHB 4Z5TA 4WNNA 1ULYA 4NE3A 4CSRA 5B0YD 4WU9D 1P3AD 5AV9B 5AV5A 5F99C 4Z66B 1M18C 4H9QB 1P3LD 3AFAB 4X23B 5B31D 3O62B 5AVCA 4YS3A 4UUZB 4XUJB 4KUDD 5B24A 3KWQC 4WU9C 1U35A 4KHAB 4KGCD 3AZFA 1P3MD 5AY8C 1ID3D 5AVBD 3LZ0B 5B33B 4WZSB 3AYWA 3AV1B 2CWEA 3MVDC 4KUDC 1BH9A 2AROB 1ZLAA 2HUEC 4XZQC 1P3FC 1S32B 4J8WC 5JA4B 5BO0A 5B2JB 1P3KB 5B32A 1TZYD 4KGCC 4J8UB 5B2IC 3WKJD 3MGQB 3WA9A 5GT0A 3KUYC 3X1VD 3LELA 4LD9A 5AV6B 4Z5TC 5CPID 1HQ3D 5B1MD 3AZJB 1N1JB 5GT3D 1KX4A 3KXBC 4H9PB 1P3BD 3WAAB 3A6ND 1KX3D 3W97B 3W99A 1M19B 3TU4D 1AOID 3B6GA 4J8XA 1HQ3C 4H9NA 5AVCC 4YS3C 5B1LA 2L5AA 5B24C 5JRGD 4R8PA 1U35C 3AN2A 3A6NC 1F66A 3AZLA 3MGSB 3C1CB 3KSYA 3MGPB 3AYWC 3LZ1A 4YM6D 5AV5B 1P3OD 3AZHA 2BYMB 3AZKA 5CPKC 3REKD 1F1EA 3X1SB 1H3OA 5BT1C 5B32C 4NE6A 3B6FD 3NQJB 3B0DB 5AV9A 1M1AB 3WA9C 5GT0C 4Z66A 4H9QA 2NZDD 3RELD 3AFAA 3LELC 4LD9C 4X23A 3O62A 5BNXB 3AZFB 3B0CT 4UUZA 4XUJA 5CPJD 4J8VB 1KX4C 2FJ7A 3MNND 4KHAA 1ZLAB 3AZED 5B40B 3W99C 3RELC 5BO0B 3B6GC 4EO5C 3LZ0A 5B33A 4J8XC 4QLCB 3C1BB 3AV1A 5B1LC 5DNMB 2AROA 3UT9B 1B67A 4R8PC 3AZND 3AN2C 1P34B 1S32A 5JA4A 1F66C 4J8UA 3AZLC 3REHB 3MGQA 4JJNC 3LZ1C 3X1TD 3AZHC 5AV6A 3MGRB 3UTBD 5BS7C 1EQZB 4NFTA 3AZJA 3REJD 1P3PD 5DNND 3VH6W 4H9PA 3REID 5AV9C 3WAAA 1KX5B 3W97A 2LY8A 5GSUB 4Z66C 1M19A 1P3GB 3AFAC 3WTPB 4X23C 3O62C 3W96B 5F99D 4XUJC 1M18D 3AZKB 5B2JD 5C3IB 3MGSA 3C1CA 3X1UB 1H3OB 3MGPA 3KWQD 3LZ0C 5B33C 3LJAB 3AV1C 2BYMA 2RVQC 2AROC 5AY8D 2NQBB 5CP6B 3AZMB 3X1SA 1S32C 1P3KC 5B2JC 3MVDD 3B0CW 3NQJA 4J8UC 2CV5B 1P3IB 3MGQC 1M1AA 5B0ZB 2FJ7B 4ZUXB 4XZQD 1P3FD 4J8WD 5E5AB 5AV6C 2HIOB 5BNXA 3R45B 5B2ID 2JSSA 5GXQB 3AZJC 3KUYD 4J8VA 2PYOB 3WAAC 4Z5TD 5B40A 3W97C 3V9RB 1M19C 5BNVB 4WU8B 3KXBD 5G49B 4QLCA 3C1BA 4E44A 5AV5D 5DNMA 3UT9A 3W98B 4H9SA 1P34A 5AV8B 5AVCD 4YS3D 3AZIB 3MGSC 4DRBA 3C1CC 5B24D 3REHA 3MGPC 3AZGB 1AOIA 1U35D 3B0BA 5B31G 3UTAB 5AV5C 3MGRA 1EQZA 3AYWD 3X1SC 3AV2A 4H9RA 3VH5T 3VH6T 3B0DC 5B0YB 4WU9B 1ZLAD 1P3AB 1KX5A 5CPKD 1M1AC 5GSUA 1P3GA 5BT1D 3WTPA 5B32D 3W96A 3AZFC 1P3LB 4WV4B 5B31B 4G91B 3WA9D 5GT0D 4J8VC 4AWLB 3LELD
chains in the Genus database with same CATH superfamily
1ZLAC 1WWSA 5B40C 2F2AC 4KGCB 3X1UA 1KX4D 3H0LC 3NQUB 1P3MB 3LJAA 1ID3B 4QLCC 3C1BC 5AVBB 5DNMC 3W99D 3UT9C 2NQBA 5CP6A 3AZMA 3B6GD 4J8XD 1P34C 5B1LD 2CV5A 2RIQA 1P3IA 3REHC 1TZYB 4R8PD 3WKJB 5B0ZA 4ZUXA 3AN2D 2F8NK 5E5AA 1F66D 3X1VB 3MGRC 2HIOA 1EQZC 3R45A 3AZLD 3A1IA 5GXQA 5CPIB 1HQ3B 4JJND 5B1MB 3LZ1D 2PYOA 2F8ND 5GT3B 3AZHD 3AZKD 1KX5C 1P3BB 5GSUC 3V9RA 1KX3B 3KFUG 5BNVA 1P3GC 4WU8A 3WTPC 3TU4B 5G49A 2UWXA 3W96C 5AV9D 1AOIB 4CAYB 4Z66D 3EPKA 5JRGB 3W98A 3AFAD 4X23D 3O62D 3AZKC 3A1KA 5AV8A 5C3IC 4M6BA 3AZIA 4XUJD 3AZGA 3X1UC 3AV2B 3VH5W 4H9RB 3LJAC 2FJ7D 3UTAA 4Z2MH 4YM6B 1P3OB 2NQBC 2ZY2A 5CP6C 3LZ0D 3AZMC 5B33D 1BH8B 3AV1D 3REKB 2CV5C 1P3IC 2RVQD 5B0YA 2AROD 4WU9A 1P3AA 3B6FB 5B0ZC 2FJ7C 4DRAA 1S32D 5E5AC 1P3KD 2YFVB 2NZDB 2HIOC 4J8UD 3RELB 1P3LA 4EO5B 5GXQC 5B31A 3MGQD 1Q9CA 5CPJB 4ZBJB 2W8SA 4KUDA 2PYOC 5AV6D 3MNNB 3AZJD 3AZEB 4KGCA 1R4VA 4WU8C 2ZY5A 3NQUA 1P3MA 1ID3A 2IO5B 5AVBA 2Y2LA 3WAAD 3W97D 1M19D 3W98C 3VH5A 3VH6A 4Z2MG 3AZNB 5AV8C 3AZIC 3AZGC 1TZYA 4HGAB 3KXBA 1TAFA 3WKJA 1HTAA 3UTAC 1BFMA 4G92B 1WWIA 3X1VA 3X1TB 3MGSD 3C1CD 3MGPD 3UTBB 5CPIA 1HQ3A 3EPLA 5B1MA 5FUGB 2DQNC 5GT3A 3REJB 1KU5A 1P3PB 5DNNB 5B0YC 3REIB 1P3AC 1P3BA 3A6NA 1KX3A 1A7WA 3X1SD 3TU4A 1P3LC 5B31C 4G91C 4CAYA 1M1AD 4AWLC 5F99B 5JRGA 1M18B 5CPKA 2BYKB 3AZFD 2ZY4A 4J8VD 2BG1A 1P3MC 1ID3C 3KWQB 5AVBC 1PZRA 5B40D 4YM6A 1P3OA 1BH8A 5AY8B 4QLCD 3C1BD 3REKA 2YFWB 5DNMD 3MVDB 1TZYC 3B6FA 3UT9D 4KUDB 3WKJC 1P34D 5KDMB 2HUEB 4XZQB 2YFVA 3X1VC 1P3FB 2NZDA 4J8WB 3RELA 3REHD 4NE5A 5B2IB 5CPIC 4H9OB 1JFIB 5B1MC 4E45A 5CPJA 1T3UA 5GT3C 3KUYB 3MGRD 1W2EA 3P5JB 1EQZD 1P3BC 3MNNA 4H9SC 4Z5TB 3AZEA 1KX3C 3AV2D 4WNNB 3TU4C 1AOIC 3KXBB 4CSRB 1TAFB 4JJNA 1KX5D 5GSUD 2F8NA 1P3GD 5JRGC 3WTPE 5BS7A 3WTPD 3AZNA 3W96D 3EPHA 5AVCB 3AV2C 4YS3B 2Y2GA 5B32G 5B24B 1U35B 2F8NH 3A6NB 4YM6C 3X1TA 1P3OC 3X1UD 3UTBA 2VQRA 4LD9D 3LJAD 5FUGA 3REKC 3AYWB 3REJA 1P3PA 5DNNA 3B6FC 3REIA 2NQBD 1BH9B 5CP6D 3AZMD 5CPKB 2Y2MA 2CV5D 1P3ID 2NZDC 5CHLB 3EG5B 5B32B 5B0ZD 4ZUXD 5F99A 4ZBJC 5CPJC 3WA9B 5GT0B 5E5AD 1M18A 2HIOD 2BYKA 3LELB 2XD1A 3MNNC 4LD9B 5GXQD 3AZEC 1P3KA 5B2JA 2PYOD 2IO5C 3KWQA 1KX4B 4ZUXC 2G5HC 2F8NG 4WU8D 3W99B 2Y2IA 3H0MC 5AY8A 3AZNC 3B6GB 1N1JA 4J8XB 2YFWA 4H9NB 3MVDA 4HGAC 5B1LB 3W98D 4R8PB 3AN2B 5KDMA 4XZQA 5AV8D 4G92C 1P3FA 3X1TC 3AZID 4J8WA 3AZGD 1F66B 3UTBC 5B2IA 1B6WA 3AZLB 4H9OA 1JFIA 3UTAD 2Y2PA 3KUYA 4JJNB 3REJC 1P3PC 5DNNC 3LZ1B 2F8NB 3REIC 3AZHB 4Z5TA 4WNNA 1ULYA 4NE3A 4CSRA 5B0YD 4WU9D 1P3AD 5AV9B 5AV5A 5F99C 4Z66B 1M18C 4H9QB 1P3LD 3AFAB 4X23B 5B31D 3O62B 5AVCA 4YS3A 4UUZB 4XUJB 4KUDD 5B24A 3AL0C 3KWQC 4WU9C 1U35A 1Z2CB 4DQYB 4KHAB 4KGCD 3AZFA 1P3MD 5AY8C 1ID3D 5AVBD 3LZ0B 5B33B 4WZSB 3AYWA 2JCHA 3AV1B 2CWEA 3MVDC 4KUDC 1BH9A 2AROB 1ZLAA 4UPKA 2HUEC 4XZQC 1P3FC 1S32B 4J8WC 2FFFB 5BO0A 5JA4B 5B2JB 5B32A 1TZYD 1P3KB 4KGCC 4J8UB 5B2IC 3WKJD 3MGQB 3WA9A 5GT0A 3KUYC 3X1VD 3LELA 4LD9A 5AV6B 4Z5TC 5CPID 1HQ3D 5B1MD 3AZJB 1N1JB 5GT3D 1KX4A 3KXBC 4H9PB 1P3BD 3WAAB 2DF4C 3A6ND 1KX3D 3W97B 3W99A 1M19B 3TU4D 1AOID 3B6GA 4J8XA 1HQ3C 2XD5A 4H9NA 5AVCC 4YS3C 5B1LA 2L5AA 3FDDA 5B24C 5JRGD 4R8PA 1U35C 3AN2A 3A6NC 1F66A 2Y2JA 3IP4C 3AZLA 3MGSB 3C1CB 3KSYA 3MGPB 3AYWC 3LZ1A 4YM6D 5AV5B 1P3OD 3AZHA 2BYMB 3AZKA 4WJ3C 5CPKC 3REKD 1F1EA 3X1SB 1H3OA 5BT1C 5B32C 4NE6A 3B6FD 2Y2NA 3NQJB 3B0DB 5AV9A 1M1AB 3WA9C 5GT0C 4Z66A 4H9QA 2NZDD 3RELD 3AFAA 3LELC 4LD9C 4X23A 3O62A 5BNXB 3AZFB 3B0CT 4UUZA 4XUJA 5CPJD 4J8VB 1KX4C 2FJ7A 3MNND 4KHAA 1ZLAB 3AZED 5B40B 3W99C 3RELC 5BO0B 3B6GC 4EO5C 3LZ0A 5B33A 4J8XC 4QLCB 3C1BB 3AV1A 5B1LC 5DNMB 2AROA 3UT9B 1B67A 4R8PC 3AZND 3AN2C 1P34B 1S32A 5JA4A 1F66C 4J8UA 3AZLC 3REHB 3MGQA 4JJNC 2JE5A 3LZ1C 3X1TD 3AZHC 5AV6A 3MGRB 3EPJA 3UTBD 5BS7C 1EQZB 4NFTA 3AZJA 3H0RC 3REJD 1P3PD 5DNND 3VH6W 4H9PA 3REID 5AV9C 3WAAA 1KX5B 3W97A 2LY8A 5GSUB 4Z66C 1M19A 1P3GB 3AFAC 3WTPB 4X23C 3O62C 3W96B 5F99D 4XUJC 1M18D 3AZKB 5B2JD 5C3IB 3MGSA 3C1CA 3X1UB 1H3OB 3MGPA 3KWQD 3LZ0C 5B33C 3LJAB 3AV1C 2Y2KA 2BYMA 2RVQC 2AROC 5AY8D 2NQBB 5CP6B 3AZMB 2Y2OA 3X1SA 1S32C 1P3KC 5B2JC 3MVDD 3B0CW 3NQJA 4J8UC 2CV5B 1P3IB 3MGQC 1M1AA 5B0ZB 2FJ7B 4ZUXB 2J8PA 4XZQD 2Y2HA 1P3FD 4J8WD 5E5AB 5AV6C 2HIOB 5BNXA 3R45B 5B2ID 2JSSA 5GXQB 3AZJC 3KUYD 4J8VA 2PYOB 2ZM5A 3WAAC 3F6TA 4Z5TD 5B40A 2ZY3A 3W97C 3V9RB 1M19C 5BNVB 4WU8B 3KXBD 5G49B 4QLCA 3C1BA 4E44A 5AV5D 5DNMA 3UT9A 3W98B 4H9SA 1P34A 5AV8B 5AVCD 4YS3D 3AZIB 3MGSC 4DRBA 3C1CC 5B24D 3REHA 3MGPC 3AZGB 1AOIA 1U35D 3B0BA 5B31G 3UTAB 5AV5C 3MGRA 1EQZA 2G5IC 3AYWD 3X1SC 3AV2A 4H9RA 3VH5T 3VH6T 3B0DC 5B0YB 4WU9B 1ZLAD 1P3AB 1KX5A 5CPKD 1M1AC 5GSUA 1P3GA 5BT1D 3WTPA 5B32D 3W96A 3AZFC 1P3LB 4WV4B 5B31B 4G91B 3WA9D 5GT0D 4J8VC 4AWLB 2Y2QA 3LELD
chains in the Genus database with same CATH topology
1ZLAC 1WWSA 5B40C 2F2AC 4KGCB 3X1UA 1KX4D 3H0LC 3NQUB 1P3MB 3LJAA 1ID3B 4QLCC 3C1BC 5AVBB 5DNMC 3W99D 3UT9C 2NQBA 5CP6A 3AZMA 3B6GD 4J8XD 1P34C 5B1LD 2CV5A 2RIQA 1P3IA 3REHC 1TZYB 4R8PD 3WKJB 5B0ZA 4ZUXA 3AN2D 2F8NK 5E5AA 1F66D 3X1VB 3MGRC 2HIOA 1EQZC 3R45A 3AZLD 3A1IA 5GXQA 5CPIB 1HQ3B 4JJND 5B1MB 3LZ1D 2PYOA 2F8ND 5GT3B 3AZHD 3AZKD 1KX5C 1P3BB 5GSUC 3V9RA 1KX3B 3KFUG 5BNVA 1P3GC 4WU8A 3WTPC 3TU4B 5G49A 2UWXA 3W96C 5AV9D 1AOIB 4CAYB 4Z66D 3EPKA 5JRGB 3W98A 3AFAD 4X23D 3O62D 3AZKC 3A1KA 5AV8A 5C3IC 4M6BA 3AZIA 4XUJD 3AZGA 3X1UC 3AV2B 3VH5W 4H9RB 3LJAC 2FJ7D 3UTAA 4Z2MH 4YM6B 1P3OB 2NQBC 2ZY2A 5CP6C 3LZ0D 3AZMC 5B33D 1BH8B 3AV1D 3REKB 2CV5C 1P3IC 2RVQD 5B0YA 2AROD 4WU9A 1P3AA 3B6FB 5B0ZC 2FJ7C 4DRAA 1S32D 5E5AC 1P3KD 2YFVB 2NZDB 2HIOC 4J8UD 3RELB 1P3LA 4EO5B 5GXQC 5B31A 3MGQD 1Q9CA 5CPJB 4ZBJB 2W8SA 4KUDA 2PYOC 5AV6D 3MNNB 3AZJD 3AZEB 4KGCA 1R4VA 4WU8C 2ZY5A 3NQUA 1P3MA 1ID3A 2IO5B 5AVBA 2Y2LA 3WAAD 3W97D 1M19D 3W98C 3VH5A 3VH6A 4Z2MG 3AZNB 5AV8C 3AZIC 3AZGC 1TZYA 4HGAB 3KXBA 1TAFA 3WKJA 1HTAA 3UTAC 1BFMA 4G92B 1WWIA 3X1VA 3X1TB 3MGSD 3C1CD 3MGPD 3UTBB 5CPIA 1HQ3A 3EPLA 5B1MA 5FUGB 2DQNC 5GT3A 3REJB 1KU5A 1P3PB 5DNNB 5B0YC 3REIB 1P3AC 1P3BA 3A6NA 1KX3A 1A7WA 3X1SD 3TU4A 1P3LC 5B31C 4G91C 4CAYA 1M1AD 4AWLC 5F99B 5JRGA 1M18B 5CPKA 2BYKB 3AZFD 2ZY4A 4J8VD 2BG1A 1P3MC 1ID3C 3KWQB 5AVBC 1PZRA 5B40D 4YM6A 1P3OA 1BH8A 5AY8B 4QLCD 3C1BD 3REKA 2YFWB 5DNMD 3MVDB 1TZYC 3B6FA 3UT9D 4KUDB 3WKJC 1P34D 5KDMB 2HUEB 4XZQB 2YFVA 3X1VC 1P3FB 2NZDA 4J8WB 3RELA 3REHD 4NE5A 5B2IB 5CPIC 4H9OB 1JFIB 5B1MC 4E45A 5CPJA 1T3UA 5GT3C 3KUYB 3MGRD 1W2EA 3P5JB 1EQZD 1P3BC 3MNNA 4H9SC 4Z5TB 3AZEA 1KX3C 3AV2D 4WNNB 3TU4C 1AOIC 3KXBB 4CSRB 1TAFB 4JJNA 1KX5D 5GSUD 2F8NA 1P3GD 5JRGC 3WTPE 5BS7A 3WTPD 3AZNA 3W96D 3EPHA 5AVCB 3AV2C 4YS3B 2Y2GA 5B32G 5B24B 1U35B 2F8NH 3A6NB 4YM6C 3X1TA 1P3OC 3X1UD 3UTBA 2VQRA 4LD9D 3LJAD 5FUGA 3REKC 3AYWB 3REJA 1P3PA 5DNNA 3B6FC 3REIA 2NQBD 1BH9B 5CP6D 3AZMD 5CPKB 2Y2MA 2CV5D 1P3ID 2NZDC 5CHLB 3EG5B 5B32B 5B0ZD 4ZUXD 5F99A 4ZBJC 5CPJC 3WA9B 5GT0B 5E5AD 1M18A 2HIOD 2BYKA 3LELB 2XD1A 3MNNC 4LD9B 5GXQD 3AZEC 1P3KA 5B2JA 2PYOD 2IO5C 3KWQA 1KX4B 4ZUXC 2G5HC 2F8NG 4WU8D 3W99B 2Y2IA 3H0MC 5AY8A 3AZNC 3B6GB 1N1JA 4J8XB 2YFWA 4H9NB 3MVDA 4HGAC 5B1LB 3W98D 4R8PB 3AN2B 5KDMA 4XZQA 5AV8D 4G92C 1P3FA 3X1TC 3AZID 4J8WA 3AZGD 1F66B 3UTBC 5B2IA 1B6WA 3AZLB 4H9OA 1JFIA 3UTAD 2Y2PA 3KUYA 4JJNB 3REJC 1P3PC 5DNNC 3LZ1B 2F8NB 3REIC 3AZHB 4Z5TA 4WNNA 1ULYA 4NE3A 4CSRA 5B0YD 4WU9D 1P3AD 5AV9B 5AV5A 5F99C 4Z66B 1M18C 4H9QB 1P3LD 3AFAB 4X23B 5B31D 3O62B 5AVCA 4YS3A 4UUZB 4XUJB 4KUDD 5B24A 3AL0C 3KWQC 4WU9C 1U35A 1Z2CB 4DQYB 4KHAB 4KGCD 3AZFA 1P3MD 5AY8C 1ID3D 5AVBD 3LZ0B 5B33B 4WZSB 3AYWA 2JCHA 3AV1B 2CWEA 3MVDC 4KUDC 1BH9A 2AROB 1ZLAA 4UPKA 2HUEC 4XZQC 1P3FC 1S32B 4J8WC 2FFFB 5BO0A 5JA4B 5B2JB 5B32A 1TZYD 1P3KB 4KGCC 4J8UB 5B2IC 3WKJD 3MGQB 3WA9A 5GT0A 3KUYC 3X1VD 3LELA 4LD9A 5AV6B 4Z5TC 5CPID 1HQ3D 5B1MD 3AZJB 1N1JB 5GT3D 1KX4A 3KXBC 4H9PB 1P3BD 3WAAB 2DF4C 3A6ND 1KX3D 3W97B 3W99A 1M19B 3TU4D 1AOID 3B6GA 4J8XA 1HQ3C 2XD5A 4H9NA 5AVCC 4YS3C 5B1LA 2L5AA 3FDDA 5B24C 5JRGD 4R8PA 1U35C 3AN2A 3A6NC 1F66A 2Y2JA 3IP4C 3AZLA 3MGSB 3C1CB 3KSYA 3MGPB 3AYWC 3LZ1A 4YM6D 5AV5B 1P3OD 3AZHA 2BYMB 3AZKA 4WJ3C 5CPKC 3REKD 1F1EA 3X1SB 1H3OA 5BT1C 5B32C 4NE6A 3B6FD 2Y2NA 3NQJB 3B0DB 5AV9A 1M1AB 3WA9C 5GT0C 4Z66A 4H9QA 2NZDD 3RELD 3AFAA 3LELC 4LD9C 4X23A 3O62A 5BNXB 3AZFB 3B0CT 4UUZA 4XUJA 5CPJD 4J8VB 1KX4C 2FJ7A 3MNND 4KHAA 1ZLAB 3AZED 5B40B 3W99C 3RELC 5BO0B 3B6GC 4EO5C 3LZ0A 5B33A 4J8XC 4QLCB 3C1BB 3AV1A 5B1LC 5DNMB 2AROA 3UT9B 1B67A 4R8PC 3AZND 3AN2C 1P34B 1S32A 5JA4A 1F66C 4J8UA 3AZLC 3REHB 3MGQA 4JJNC 2JE5A 3LZ1C 3X1TD 3AZHC 5AV6A 3MGRB 3EPJA 3UTBD 5BS7C 1EQZB 4NFTA 3AZJA 3H0RC 3REJD 1P3PD 5DNND 3VH6W 4H9PA 3REID 5AV9C 3WAAA 1KX5B 3W97A 2LY8A 5GSUB 4Z66C 1M19A 1P3GB 3AFAC 3WTPB 4X23C 3O62C 3W96B 5F99D 4XUJC 1M18D 3AZKB 5B2JD 5C3IB 3MGSA 3C1CA 3X1UB 1H3OB 3MGPA 3KWQD 3LZ0C 5B33C 3LJAB 3AV1C 2Y2KA 2BYMA 2RVQC 2AROC 5AY8D 2NQBB 5CP6B 3AZMB 2Y2OA 3X1SA 1S32C 1P3KC 5B2JC 3MVDD 3B0CW 3NQJA 4J8UC 2CV5B 1P3IB 3MGQC 1M1AA 5B0ZB 2FJ7B 4ZUXB 2J8PA 4XZQD 2Y2HA 1P3FD 4J8WD 5E5AB 5AV6C 2HIOB 5BNXA 3R45B 5B2ID 2JSSA 5GXQB 3AZJC 3KUYD 4J8VA 2PYOB 2ZM5A 3WAAC 3F6TA 4Z5TD 5B40A 2ZY3A 3W97C 3V9RB 1M19C 5BNVB 4WU8B 3KXBD 5G49B 4QLCA 3C1BA 4E44A 5AV5D 5DNMA 3UT9A 3W98B 4H9SA 1P34A 5AV8B 5AVCD 4YS3D 3AZIB 3MGSC 4DRBA 3C1CC 5B24D 3REHA 3MGPC 3AZGB 1AOIA 1U35D 3B0BA 5B31G 3UTAB 5AV5C 3MGRA 1EQZA 2G5IC 3AYWD 3X1SC 3AV2A 4H9RA 3VH5T 3VH6T 3B0DC 5B0YB 4WU9B 1ZLAD 1P3AB 1KX5A 5CPKD 1M1AC 5GSUA 1P3GA 5BT1D 3WTPA 5B32D 3W96A 3AZFC 1P3LB 4WV4B 5B31B 4G91B 3WA9D 5GT0D 4J8VC 4AWLB 2Y2QA 3LELD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZLA C;  1WWS A;  5B40 C;  4KGC B;  3X1U A;  1KX4 D;  3NQU B;  1P3M B;  3LJA A;  1ID3 B;  4QLC C;  3C1B C;  5AVB B;  5DNM C;  3W99 D;  3UT9 C;  2NQB A;  5CP6 A;  3AZM A;  3B6G D;  4J8X D;  1P34 C;  5B1L D;  2CV5 A;  1P3I A;  3REH C;  1TZY B;  4R8P D;  3WKJ B;  5B0Z A;  4ZUX A;  3AN2 D;  2F8N K;  5E5A A;  1F66 D;  3X1V B;  3MGR C;  2HIO A;  1EQZ C;  3R45 A;  3AZL D;  5GXQ A;  5CPI B;  1HQ3 B;  4JJN D;  5B1M B;  3LZ1 D;  2PYO A;  2F8N D;  5GT3 B;  3AZH D;  3AZK D;  1KX5 C;  1P3B B;  5GSU C;  3V9R A;  1KX3 B;  5BNV A;  1P3G C;  4WU8 A;  3WTP C;  3TU4 B;  5G49 A;  3W96 C;  1AOI B;  5AV9 D;  4CAY B;  4Z66 D;  5JRG B;  3W98 A;  3AFA D;  4X23 D;  3O62 D;  3AZK C;  5AV8 A;  5C3I C;  4M6B A;  3AZI A;  4XUJ D;  3AZG A;  3X1U C;  3AV2 B;  3VH5 W;  4H9R B;  3LJA C;  2FJ7 D;  3UTA A;  4Z2M H;  4YM6 B;  1P3O B;  2NQB C;  5CP6 C;  3LZ0 D;  3AZM C;  5B33 D;  1BH8 B;  3AV1 D;  3REK B;  2CV5 C;  1P3I C;  2RVQ D;  5B0Y A;  2ARO D;  4WU9 A;  1P3A A;  3B6F B;  5B0Z C;  2FJ7 C;  4DRA A;  1S32 D;  5E5A C;  1P3K D;  2YFV B;  2NZD B;  2HIO C;  4J8U D;  3REL B;  1P3L A;  4EO5 B;  5GXQ C;  5B31 A;  3MGQ D;  1Q9C A;  5CPJ B;  4ZBJ B;  4KUD A;  2PYO C;  5AV6 D;  3MNN B;  3AZJ D;  3AZE B;  4KGC A;  1R4V A;  4WU8 C;  3NQU A;  1P3M A;  1ID3 A;  2IO5 B;  5AVB A;  3WAA D;  3W97 D;  1M19 D;  3W98 C;  3VH5 A;  3VH6 A;  4Z2M G;  3AZN B;  5AV8 C;  3AZI C;  3AZG C;  1TZY A;  4HGA B;  3KXB A;  1TAF A;  3WKJ A;  1HTA A;  3UTA C;  1BFM A;  4G92 B;  1WWI A;  3X1V A;  3X1T B;  3MGS D;  3C1C D;  3MGP D;  3UTB B;  5CPI A;  1HQ3 A;  5B1M A;  5FUG B;  5GT3 A;  3REJ B;  1KU5 A;  1P3P B;  5DNN B;  5B0Y C;  3REI B;  1P3A C;  1P3B A;  3A6N A;  1KX3 A;  3X1S D;  1A7W A;  3TU4 A;  1P3L C;  5B31 C;  4G91 C;  4CAY A;  1M1A D;  4AWL C;  5F99 B;  5JRG A;  1M18 B;  5CPK A;  2BYK B;  3AZF D;  4J8V D;  1P3M C;  1ID3 C;  3KWQ B;  5AVB C;  5B40 D;  4YM6 A;  1P3O A;  1BH8 A;  5AY8 B;  4QLC D;  3C1B D;  3REK A;  2YFW B;  5DNM D;  3MVD B;  1TZY C;  3B6F A;  3UT9 D;  4KUD B;  3WKJ C;  1P34 D;  5KDM B;  2HUE B;  4XZQ B;  2YFV A;  3X1V C;  1P3F B;  2NZD A;  4J8W B;  3REL A;  3REH D;  4NE5 A;  5B2I B;  5CPI C;  4H9O B;  1JFI B;  5B1M C;  4E45 A;  5CPJ A;  5GT3 C;  3KUY B;  3MGR D;  1EQZ D;  1P3B C;  3MNN A;  4H9S C;  4Z5T B;  3AZE A;  1KX3 C;  3AV2 D;  4WNN B;  3TU4 C;  1AOI C;  3KXB B;  4CSR B;  1TAF B;  4JJN A;  1KX5 D;  5GSU D;  2F8N A;  1P3G D;  5JRG C;  3WTP E;  5BS7 A;  3WTP D;  3AZN A;  3W96 D;  5AVC B;  3AV2 C;  4YS3 B;  5B32 G;  5B24 B;  1U35 B;  2F8N H;  3A6N B;  4YM6 C;  3X1T A;  1P3O C;  3X1U D;  3UTB A;  4LD9 D;  3LJA D;  5FUG A;  3REK C;  3AYW B;  3REJ A;  1P3P A;  5DNN A;  3B6F C;  3REI A;  2NQB D;  1BH9 B;  5CP6 D;  3AZM D;  5CPK B;  2NZD C;  2CV5 D;  1P3I D;  5CHL B;  5B32 B;  5B0Z D;  4ZUX D;  5F99 A;  4ZBJ C;  5CPJ C;  3WA9 B;  5GT0 B;  5E5A D;  1M18 A;  2HIO D;  2BYK A;  3LEL B;  4LD9 B;  3MNN C;  5GXQ D;  3AZE C;  1P3K A;  5B2J A;  2PYO D;  2IO5 C;  3KWQ A;  1KX4 B;  4ZUX C;  2F8N G;  4WU8 D;  3W99 B;  5AY8 A;  3AZN C;  3B6G B;  1N1J A;  4J8X B;  2YFW A;  4H9N B;  3MVD A;  4HGA C;  5B1L B;  3W98 D;  4R8P B;  3AN2 B;  5KDM A;  4XZQ A;  5AV8 D;  4G92 C;  1P3F A;  3X1T C;  3AZI D;  4J8W A;  3AZG D;  1F66 B;  3UTB C;  5B2I A;  1B6W A;  3AZL B;  4H9O A;  1JFI A;  3UTA D;  3KUY A;  4JJN B;  3REJ C;  1P3P C;  5DNN C;  3LZ1 B;  2F8N B;  3REI C;  3AZH B;  4Z5T A;  4WNN A;  1ULY A;  4NE3 A;  4CSR A;  5B0Y D;  4WU9 D;  1P3A D;  5AV9 B;  5AV5 A;  5F99 C;  4Z66 B;  1M18 C;  4H9Q B;  1P3L D;  3AFA B;  4X23 B;  5B31 D;  3O62 B;  5AVC A;  4YS3 A;  4UUZ B;  4XUJ B;  4KUD D;  5B24 A;  3KWQ C;  4WU9 C;  1U35 A;  4KHA B;  4KGC D;  3AZF A;  1P3M D;  5AY8 C;  1ID3 D;  5AVB D;  3LZ0 B;  5B33 B;  4WZS B;  3AYW A;  3AV1 B;  2CWE A;  3MVD C;  4KUD C;  1BH9 A;  2ARO B;  1ZLA A;  2HUE C;  4XZQ C;  1P3F C;  1S32 B;  4J8W C;  5JA4 B;  5BO0 A;  5B2J B;  1P3K B;  5B32 A;  1TZY D;  4KGC C;  4J8U B;  5B2I C;  3WKJ D;  3MGQ B;  3WA9 A;  5GT0 A;  3KUY C;  3X1V D;  3LEL A;  4LD9 A;  5AV6 B;  4Z5T C;  5CPI D;  1HQ3 D;  5B1M D;  3AZJ B;  1N1J B;  5GT3 D;  1KX4 A;  3KXB C;  4H9P B;  1P3B D;  3WAA B;  3A6N D;  1KX3 D;  3W97 B;  3W99 A;  1M19 B;  3TU4 D;  1AOI D;  3B6G A;  4J8X A;  1HQ3 C;  4H9N A;  5AVC C;  4YS3 C;  5B1L A;  2L5A A;  5B24 C;  5JRG D;  4R8P A;  1U35 C;  3AN2 A;  3A6N C;  1F66 A;  3AZL A;  3MGS B;  3C1C B;  3KSY A;  3MGP B;  3AYW C;  3LZ1 A;  4YM6 D;  5AV5 B;  1P3O D;  3AZH A;  2BYM B;  3AZK A;  5CPK C;  3REK D;  1F1E A;  3X1S B;  1H3O A;  5BT1 C;  5B32 C;  4NE6 A;  3B6F D;  3NQJ B;  3B0D B;  5AV9 A;  1M1A B;  3WA9 C;  5GT0 C;  4Z66 A;  4H9Q A;  2NZD D;  3REL D;  3AFA A;  3LEL C;  4LD9 C;  4X23 A;  3O62 A;  5BNX B;  3AZF B;  3B0C T;  4UUZ A;  4XUJ A;  5CPJ D;  4J8V B;  1KX4 C;  2FJ7 A;  3MNN D;  4KHA A;  1ZLA B;  3AZE D;  5B40 B;  3W99 C;  3REL C;  5BO0 B;  3B6G C;  4EO5 C;  3LZ0 A;  5B33 A;  4J8X C;  4QLC B;  3C1B B;  3AV1 A;  5B1L C;  5DNM B;  2ARO A;  3UT9 B;  1B67 A;  4R8P C;  3AZN D;  3AN2 C;  1P34 B;  1S32 A;  5JA4 A;  1F66 C;  4J8U A;  3AZL C;  3REH B;  3MGQ A;  4JJN C;  3LZ1 C;  3X1T D;  3AZH C;  5AV6 A;  3MGR B;  3UTB D;  5BS7 C;  1EQZ B;  4NFT A;  3AZJ A;  3REJ D;  1P3P D;  5DNN D;  3VH6 W;  4H9P A;  3REI D;  5AV9 C;  3WAA A;  1KX5 B;  3W97 A;  2LY8 A;  5GSU B;  4Z66 C;  1M19 A;  1P3G B;  3AFA C;  3WTP B;  4X23 C;  3O62 C;  3W96 B;  5F99 D;  4XUJ C;  1M18 D;  3AZK B;  5B2J D;  5C3I B;  3MGS A;  3C1C A;  3X1U B;  1H3O B;  3MGP A;  3KWQ D;  3LZ0 C;  5B33 C;  3LJA B;  3AV1 C;  2BYM A;  2RVQ C;  2ARO C;  5AY8 D;  2NQB B;  5CP6 B;  3AZM B;  3X1S A;  1S32 C;  1P3K C;  5B2J C;  3MVD D;  3B0C W;  3NQJ A;  4J8U C;  2CV5 B;  1P3I B;  3MGQ C;  1M1A A;  5B0Z B;  2FJ7 B;  4ZUX B;  4XZQ D;  1P3F D;  4J8W D;  5E5A B;  5AV6 C;  2HIO B;  5BNX A;  3R45 B;  5B2I D;  2JSS A;  5GXQ B;  3AZJ C;  3KUY D;  4J8V A;  2PYO B;  3WAA C;  4Z5T D;  5B40 A;  3W97 C;  3V9R B;  1M19 C;  5BNV B;  4WU8 B;  3KXB D;  5G49 B;  4QLC A;  3C1B A;  4E44 A;  5AV5 D;  5DNM A;  3UT9 A;  3W98 B;  4H9S A;  1P34 A;  5AV8 B;  5AVC D;  4YS3 D;  3AZI B;  3MGS C;  4DRB A;  3C1C C;  5B24 D;  3REH A;  3MGP C;  3AZG B;  1AOI A;  1U35 D;  3B0B A;  5B31 G;  3UTA B;  5AV5 C;  3MGR A;  1EQZ A;  3AYW D;  3X1S C;  3AV2 A;  4H9R A;  3VH5 T;  3VH6 T;  3B0D C;  5B0Y B;  4WU9 B;  1ZLA D;  1P3A B;  1KX5 A;  5CPK D;  1M1A C;  5GSU A;  1P3G A;  5BT1 D;  3WTP A;  5B32 D;  3W96 A;  3AZF C;  1P3L B;  4WV4 B;  5B31 B;  4G91 B;  3WA9 D;  5GT0 D;  4J8V C;  4AWL B;  3LEL D; 
#chains in the Genus database with same CATH topology
 1ZLA C;  1WWS A;  5B40 C;  2F2A C;  4KGC B;  3X1U A;  1KX4 D;  3H0L C;  3NQU B;  1P3M B;  3LJA A;  1ID3 B;  4QLC C;  3C1B C;  5AVB B;  5DNM C;  3W99 D;  3UT9 C;  2NQB A;  5CP6 A;  3AZM A;  3B6G D;  4J8X D;  1P34 C;  5B1L D;  2CV5 A;  2RIQ A;  1P3I A;  3REH C;  1TZY B;  4R8P D;  3WKJ B;  5B0Z A;  4ZUX A;  3AN2 D;  2F8N K;  5E5A A;  1F66 D;  3X1V B;  3MGR C;  2HIO A;  1EQZ C;  3R45 A;  3AZL D;  3A1I A;  5GXQ A;  5CPI B;  1HQ3 B;  4JJN D;  5B1M B;  3LZ1 D;  2PYO A;  2F8N D;  5GT3 B;  3AZH D;  3AZK D;  1KX5 C;  1P3B B;  5GSU C;  3V9R A;  1KX3 B;  3KFU G;  5BNV A;  1P3G C;  4WU8 A;  3WTP C;  3TU4 B;  5G49 A;  2UWX A;  3W96 C;  5AV9 D;  1AOI B;  4CAY B;  4Z66 D;  3EPK A;  5JRG B;  3W98 A;  3AFA D;  4X23 D;  3O62 D;  3AZK C;  3A1K A;  5AV8 A;  5C3I C;  4M6B A;  3AZI A;  4XUJ D;  3AZG A;  3X1U C;  3AV2 B;  3VH5 W;  4H9R B;  3LJA C;  2FJ7 D;  3UTA A;  4Z2M H;  4YM6 B;  1P3O B;  2NQB C;  2ZY2 A;  5CP6 C;  3LZ0 D;  3AZM C;  5B33 D;  1BH8 B;  3AV1 D;  3REK B;  2CV5 C;  1P3I C;  2RVQ D;  5B0Y A;  2ARO D;  4WU9 A;  1P3A A;  3B6F B;  5B0Z C;  2FJ7 C;  4DRA A;  1S32 D;  5E5A C;  1P3K D;  2YFV B;  2NZD B;  2HIO C;  4J8U D;  3REL B;  1P3L A;  4EO5 B;  5GXQ C;  5B31 A;  3MGQ D;  1Q9C A;  5CPJ B;  4ZBJ B;  2W8S A;  4KUD A;  2PYO C;  5AV6 D;  3MNN B;  3AZJ D;  3AZE B;  4KGC A;  1R4V A;  4WU8 C;  2ZY5 A;  3NQU A;  1P3M A;  1ID3 A;  2IO5 B;  5AVB A;  2Y2L A;  3WAA D;  3W97 D;  1M19 D;  3W98 C;  3VH5 A;  3VH6 A;  4Z2M G;  3AZN B;  5AV8 C;  3AZI C;  3AZG C;  1TZY A;  4HGA B;  3KXB A;  1TAF A;  3WKJ A;  1HTA A;  3UTA C;  1BFM A;  4G92 B;  1WWI A;  3X1V A;  3X1T B;  3MGS D;  3C1C D;  3MGP D;  3UTB B;  5CPI A;  1HQ3 A;  3EPL A;  5B1M A;  5FUG B;  2DQN C;  5GT3 A;  3REJ B;  1KU5 A;  1P3P B;  5DNN B;  5B0Y C;  3REI B;  1P3A C;  1P3B A;  3A6N A;  1KX3 A;  1A7W A;  3X1S D;  3TU4 A;  1P3L C;  5B31 C;  4G91 C;  4CAY A;  1M1A D;  4AWL C;  5F99 B;  5JRG A;  1M18 B;  5CPK A;  2BYK B;  3AZF D;  2ZY4 A;  4J8V D;  2BG1 A;  1P3M C;  1ID3 C;  3KWQ B;  5AVB C;  1PZR A;  5B40 D;  4YM6 A;  1P3O A;  1BH8 A;  5AY8 B;  4QLC D;  3C1B D;  3REK A;  2YFW B;  5DNM D;  3MVD B;  1TZY C;  3B6F A;  3UT9 D;  4KUD B;  3WKJ C;  1P34 D;  5KDM B;  2HUE B;  4XZQ B;  2YFV A;  3X1V C;  1P3F B;  2NZD A;  4J8W B;  3REL A;  3REH D;  4NE5 A;  5B2I B;  5CPI C;  4H9O B;  1JFI B;  5B1M C;  4E45 A;  5CPJ A;  1T3U A;  5GT3 C;  3KUY B;  3MGR D;  1W2E A;  3P5J B;  1EQZ D;  1P3B C;  3MNN A;  4H9S C;  4Z5T B;  3AZE A;  1KX3 C;  3AV2 D;  4WNN B;  3TU4 C;  1AOI C;  3KXB B;  4CSR B;  1TAF B;  4JJN A;  1KX5 D;  5GSU D;  2F8N A;  1P3G D;  5JRG C;  3WTP E;  5BS7 A;  3WTP D;  3AZN A;  3W96 D;  3EPH A;  5AVC B;  3AV2 C;  4YS3 B;  2Y2G A;  5B32 G;  5B24 B;  1U35 B;  2F8N H;  3A6N B;  4YM6 C;  3X1T A;  1P3O C;  3X1U D;  3UTB A;  2VQR A;  4LD9 D;  3LJA D;  5FUG A;  3REK C;  3AYW B;  3REJ A;  1P3P A;  5DNN A;  3B6F C;  3REI A;  2NQB D;  1BH9 B;  5CP6 D;  3AZM D;  5CPK B;  2Y2M A;  2CV5 D;  1P3I D;  2NZD C;  5CHL B;  3EG5 B;  5B32 B;  5B0Z D;  4ZUX D;  5F99 A;  4ZBJ C;  5CPJ C;  3WA9 B;  5GT0 B;  5E5A D;  1M18 A;  2HIO D;  2BYK A;  3LEL B;  2XD1 A;  3MNN C;  4LD9 B;  5GXQ D;  3AZE C;  1P3K A;  5B2J A;  2PYO D;  2IO5 C;  3KWQ A;  1KX4 B;  4ZUX C;  2G5H C;  2F8N G;  4WU8 D;  3W99 B;  2Y2I A;  3H0M C;  5AY8 A;  3AZN C;  3B6G B;  1N1J A;  4J8X B;  2YFW A;  4H9N B;  3MVD A;  4HGA C;  5B1L B;  3W98 D;  4R8P B;  3AN2 B;  5KDM A;  4XZQ A;  5AV8 D;  4G92 C;  1P3F A;  3X1T C;  3AZI D;  4J8W A;  3AZG D;  1F66 B;  3UTB C;  5B2I A;  1B6W A;  3AZL B;  4H9O A;  1JFI A;  3UTA D;  2Y2P A;  3KUY A;  4JJN B;  3REJ C;  1P3P C;  5DNN C;  3LZ1 B;  2F8N B;  3REI C;  3AZH B;  4Z5T A;  4WNN A;  1ULY A;  4NE3 A;  4CSR A;  5B0Y D;  4WU9 D;  1P3A D;  5AV9 B;  5AV5 A;  5F99 C;  4Z66 B;  1M18 C;  4H9Q B;  1P3L D;  3AFA B;  4X23 B;  5B31 D;  3O62 B;  5AVC A;  4YS3 A;  4UUZ B;  4XUJ B;  4KUD D;  5B24 A;  3AL0 C;  3KWQ C;  4WU9 C;  1U35 A;  1Z2C B;  4DQY B;  4KHA B;  4KGC D;  3AZF A;  1P3M D;  5AY8 C;  1ID3 D;  5AVB D;  3LZ0 B;  5B33 B;  4WZS B;  3AYW A;  2JCH A;  3AV1 B;  2CWE A;  3MVD C;  4KUD C;  1BH9 A;  2ARO B;  1ZLA A;  4UPK A;  2HUE C;  4XZQ C;  1P3F C;  1S32 B;  4J8W C;  2FFF B;  5BO0 A;  5JA4 B;  5B2J B;  5B32 A;  1TZY D;  1P3K B;  4KGC C;  4J8U B;  5B2I C;  3WKJ D;  3MGQ B;  3WA9 A;  5GT0 A;  3KUY C;  3X1V D;  3LEL A;  4LD9 A;  5AV6 B;  4Z5T C;  5CPI D;  1HQ3 D;  5B1M D;  3AZJ B;  1N1J B;  5GT3 D;  1KX4 A;  3KXB C;  4H9P B;  1P3B D;  3WAA B;  2DF4 C;  3A6N D;  1KX3 D;  3W97 B;  3W99 A;  1M19 B;  3TU4 D;  1AOI D;  3B6G A;  4J8X A;  1HQ3 C;  2XD5 A;  4H9N A;  5AVC C;  4YS3 C;  5B1L A;  2L5A A;  3FDD A;  5B24 C;  5JRG D;  4R8P A;  1U35 C;  3AN2 A;  3A6N C;  1F66 A;  2Y2J A;  3IP4 C;  3AZL A;  3MGS B;  3C1C B;  3KSY A;  3MGP B;  3AYW C;  3LZ1 A;  4YM6 D;  5AV5 B;  1P3O D;  3AZH A;  2BYM B;  3AZK A;  4WJ3 C;  5CPK C;  3REK D;  1F1E A;  3X1S B;  1H3O A;  5BT1 C;  5B32 C;  4NE6 A;  3B6F D;  2Y2N A;  3NQJ B;  3B0D B;  5AV9 A;  1M1A B;  3WA9 C;  5GT0 C;  4Z66 A;  4H9Q A;  2NZD D;  3REL D;  3AFA A;  3LEL C;  4LD9 C;  4X23 A;  3O62 A;  5BNX B;  3AZF B;  3B0C T;  4UUZ A;  4XUJ A;  5CPJ D;  4J8V B;  1KX4 C;  2FJ7 A;  3MNN D;  4KHA A;  1ZLA B;  3AZE D;  5B40 B;  3W99 C;  3REL C;  5BO0 B;  3B6G C;  4EO5 C;  3LZ0 A;  5B33 A;  4J8X C;  4QLC B;  3C1B B;  3AV1 A;  5B1L C;  5DNM B;  2ARO A;  3UT9 B;  1B67 A;  4R8P C;  3AZN D;  3AN2 C;  1P34 B;  1S32 A;  5JA4 A;  1F66 C;  4J8U A;  3AZL C;  3REH B;  3MGQ A;  4JJN C;  2JE5 A;  3LZ1 C;  3X1T D;  3AZH C;  5AV6 A;  3MGR B;  3EPJ A;  3UTB D;  5BS7 C;  1EQZ B;  4NFT A;  3AZJ A;  3H0R C;  3REJ D;  1P3P D;  5DNN D;  3VH6 W;  4H9P A;  3REI D;  5AV9 C;  3WAA A;  1KX5 B;  3W97 A;  2LY8 A;  5GSU B;  4Z66 C;  1M19 A;  1P3G B;  3AFA C;  3WTP B;  4X23 C;  3O62 C;  3W96 B;  5F99 D;  4XUJ C;  1M18 D;  3AZK B;  5B2J D;  5C3I B;  3MGS A;  3C1C A;  3X1U B;  1H3O B;  3MGP A;  3KWQ D;  3LZ0 C;  5B33 C;  3LJA B;  3AV1 C;  2Y2K A;  2BYM A;  2RVQ C;  2ARO C;  5AY8 D;  2NQB B;  5CP6 B;  3AZM B;  2Y2O A;  3X1S A;  1S32 C;  1P3K C;  5B2J C;  3MVD D;  3B0C W;  3NQJ A;  4J8U C;  2CV5 B;  1P3I B;  3MGQ C;  1M1A A;  5B0Z B;  2FJ7 B;  4ZUX B;  2J8P A;  4XZQ D;  2Y2H A;  1P3F D;  4J8W D;  5E5A B;  5AV6 C;  2HIO B;  5BNX A;  3R45 B;  5B2I D;  2JSS A;  5GXQ B;  3AZJ C;  3KUY D;  4J8V A;  2PYO B;  2ZM5 A;  3WAA C;  3F6T A;  4Z5T D;  5B40 A;  2ZY3 A;  3W97 C;  3V9R B;  1M19 C;  5BNV B;  4WU8 B;  3KXB D;  5G49 B;  4QLC A;  3C1B A;  4E44 A;  5AV5 D;  5DNM A;  3UT9 A;  3W98 B;  4H9S A;  1P34 A;  5AV8 B;  5AVC D;  4YS3 D;  3AZI B;  3MGS C;  4DRB A;  3C1C C;  5B24 D;  3REH A;  3MGP C;  3AZG B;  1AOI A;  1U35 D;  3B0B A;  5B31 G;  3UTA B;  5AV5 C;  3MGR A;  1EQZ A;  2G5I C;  3AYW D;  3X1S C;  3AV2 A;  4H9R A;  3VH5 T;  3VH6 T;  3B0D C;  5B0Y B;  4WU9 B;  1ZLA D;  1P3A B;  1KX5 A;  5CPK D;  1M1A C;  5GSU A;  1P3G A;  5BT1 D;  3WTP A;  5B32 D;  3W96 A;  3AZF C;  1P3L B;  4WV4 B;  5B31 B;  4G91 B;  3WA9 D;  5GT0 D;  4J8V C;  4AWL B;  2Y2Q A;  3LEL D; 
#chains in the Genus database with same CATH homology
 1ZLA C;  1WWS A;  5B40 C;  2F2A C;  4KGC B;  3X1U A;  1KX4 D;  3H0L C;  3NQU B;  1P3M B;  3LJA A;  1ID3 B;  4QLC C;  3C1B C;  5AVB B;  5DNM C;  3W99 D;  3UT9 C;  2NQB A;  5CP6 A;  3AZM A;  3B6G D;  4J8X D;  1P34 C;  5B1L D;  2CV5 A;  2RIQ A;  1P3I A;  3REH C;  1TZY B;  4R8P D;  3WKJ B;  5B0Z A;  4ZUX A;  3AN2 D;  2F8N K;  5E5A A;  1F66 D;  3X1V B;  3MGR C;  2HIO A;  1EQZ C;  3R45 A;  3AZL D;  3A1I A;  5GXQ A;  5CPI B;  1HQ3 B;  4JJN D;  5B1M B;  3LZ1 D;  2PYO A;  2F8N D;  5GT3 B;  3AZH D;  3AZK D;  1KX5 C;  1P3B B;  5GSU C;  3V9R A;  1KX3 B;  3KFU G;  5BNV A;  1P3G C;  4WU8 A;  3WTP C;  3TU4 B;  5G49 A;  2UWX A;  3W96 C;  5AV9 D;  1AOI B;  4CAY B;  4Z66 D;  3EPK A;  5JRG B;  3W98 A;  3AFA D;  4X23 D;  3O62 D;  3AZK C;  3A1K A;  5AV8 A;  5C3I C;  4M6B A;  3AZI A;  4XUJ D;  3AZG A;  3X1U C;  3AV2 B;  3VH5 W;  4H9R B;  3LJA C;  2FJ7 D;  3UTA A;  4Z2M H;  4YM6 B;  1P3O B;  2NQB C;  2ZY2 A;  5CP6 C;  3LZ0 D;  3AZM C;  5B33 D;  1BH8 B;  3AV1 D;  3REK B;  2CV5 C;  1P3I C;  2RVQ D;  5B0Y A;  2ARO D;  4WU9 A;  1P3A A;  3B6F B;  5B0Z C;  2FJ7 C;  4DRA A;  1S32 D;  5E5A C;  1P3K D;  2YFV B;  2NZD B;  2HIO C;  4J8U D;  3REL B;  1P3L A;  4EO5 B;  5GXQ C;  5B31 A;  3MGQ D;  1Q9C A;  5CPJ B;  4ZBJ B;  2W8S A;  4KUD A;  2PYO C;  5AV6 D;  3MNN B;  3AZJ D;  3AZE B;  4KGC A;  1R4V A;  4WU8 C;  2ZY5 A;  3NQU A;  1P3M A;  1ID3 A;  2IO5 B;  5AVB A;  2Y2L A;  3WAA D;  3W97 D;  1M19 D;  3W98 C;  3VH5 A;  3VH6 A;  4Z2M G;  3AZN B;  5AV8 C;  3AZI C;  3AZG C;  1TZY A;  4HGA B;  3KXB A;  1TAF A;  3WKJ A;  1HTA A;  3UTA C;  1BFM A;  4G92 B;  1WWI A;  3X1V A;  3X1T B;  3MGS D;  3C1C D;  3MGP D;  3UTB B;  5CPI A;  1HQ3 A;  3EPL A;  5B1M A;  5FUG B;  2DQN C;  5GT3 A;  3REJ B;  1KU5 A;  1P3P B;  5DNN B;  5B0Y C;  3REI B;  1P3A C;  1P3B A;  3A6N A;  1KX3 A;  1A7W A;  3X1S D;  3TU4 A;  1P3L C;  5B31 C;  4G91 C;  4CAY A;  1M1A D;  4AWL C;  5F99 B;  5JRG A;  1M18 B;  5CPK A;  2BYK B;  3AZF D;  2ZY4 A;  4J8V D;  2BG1 A;  1P3M C;  1ID3 C;  3KWQ B;  5AVB C;  1PZR A;  5B40 D;  4YM6 A;  1P3O A;  1BH8 A;  5AY8 B;  4QLC D;  3C1B D;  3REK A;  2YFW B;  5DNM D;  3MVD B;  1TZY C;  3B6F A;  3UT9 D;  4KUD B;  3WKJ C;  1P34 D;  5KDM B;  2HUE B;  4XZQ B;  2YFV A;  3X1V C;  1P3F B;  2NZD A;  4J8W B;  3REL A;  3REH D;  4NE5 A;  5B2I B;  5CPI C;  4H9O B;  1JFI B;  5B1M C;  4E45 A;  5CPJ A;  1T3U A;  5GT3 C;  3KUY B;  3MGR D;  1W2E A;  3P5J B;  1EQZ D;  1P3B C;  3MNN A;  4H9S C;  4Z5T B;  3AZE A;  1KX3 C;  3AV2 D;  4WNN B;  3TU4 C;  1AOI C;  3KXB B;  4CSR B;  1TAF B;  4JJN A;  1KX5 D;  5GSU D;  2F8N A;  1P3G D;  5JRG C;  3WTP E;  5BS7 A;  3WTP D;  3AZN A;  3W96 D;  3EPH A;  5AVC B;  3AV2 C;  4YS3 B;  2Y2G A;  5B32 G;  5B24 B;  1U35 B;  2F8N H;  3A6N B;  4YM6 C;  3X1T A;  1P3O C;  3X1U D;  3UTB A;  2VQR A;  4LD9 D;  3LJA D;  5FUG A;  3REK C;  3AYW B;  3REJ A;  1P3P A;  5DNN A;  3B6F C;  3REI A;  2NQB D;  1BH9 B;  5CP6 D;  3AZM D;  5CPK B;  2Y2M A;  2CV5 D;  1P3I D;  2NZD C;  5CHL B;  3EG5 B;  5B32 B;  5B0Z D;  4ZUX D;  5F99 A;  4ZBJ C;  5CPJ C;  3WA9 B;  5GT0 B;  5E5A D;  1M18 A;  2HIO D;  2BYK A;  3LEL B;  2XD1 A;  3MNN C;  4LD9 B;  5GXQ D;  3AZE C;  1P3K A;  5B2J A;  2PYO D;  2IO5 C;  3KWQ A;  1KX4 B;  4ZUX C;  2G5H C;  2F8N G;  4WU8 D;  3W99 B;  2Y2I A;  3H0M C;  5AY8 A;  3AZN C;  3B6G B;  1N1J A;  4J8X B;  2YFW A;  4H9N B;  3MVD A;  4HGA C;  5B1L B;  3W98 D;  4R8P B;  3AN2 B;  5KDM A;  4XZQ A;  5AV8 D;  4G92 C;  1P3F A;  3X1T C;  3AZI D;  4J8W A;  3AZG D;  1F66 B;  3UTB C;  5B2I A;  1B6W A;  3AZL B;  4H9O A;  1JFI A;  3UTA D;  2Y2P A;  3KUY A;  4JJN B;  3REJ C;  1P3P C;  5DNN C;  3LZ1 B;  2F8N B;  3REI C;  3AZH B;  4Z5T A;  4WNN A;  1ULY A;  4NE3 A;  4CSR A;  5B0Y D;  4WU9 D;  1P3A D;  5AV9 B;  5AV5 A;  5F99 C;  4Z66 B;  1M18 C;  4H9Q B;  1P3L D;  3AFA B;  4X23 B;  5B31 D;  3O62 B;  5AVC A;  4YS3 A;  4UUZ B;  4XUJ B;  4KUD D;  5B24 A;  3AL0 C;  3KWQ C;  4WU9 C;  1U35 A;  1Z2C B;  4DQY B;  4KHA B;  4KGC D;  3AZF A;  1P3M D;  5AY8 C;  1ID3 D;  5AVB D;  3LZ0 B;  5B33 B;  4WZS B;  3AYW A;  2JCH A;  3AV1 B;  2CWE A;  3MVD C;  4KUD C;  1BH9 A;  2ARO B;  1ZLA A;  4UPK A;  2HUE C;  4XZQ C;  1P3F C;  1S32 B;  4J8W C;  2FFF B;  5BO0 A;  5JA4 B;  5B2J B;  5B32 A;  1TZY D;  1P3K B;  4KGC C;  4J8U B;  5B2I C;  3WKJ D;  3MGQ B;  3WA9 A;  5GT0 A;  3KUY C;  3X1V D;  3LEL A;  4LD9 A;  5AV6 B;  4Z5T C;  5CPI D;  1HQ3 D;  5B1M D;  3AZJ B;  1N1J B;  5GT3 D;  1KX4 A;  3KXB C;  4H9P B;  1P3B D;  3WAA B;  2DF4 C;  3A6N D;  1KX3 D;  3W97 B;  3W99 A;  1M19 B;  3TU4 D;  1AOI D;  3B6G A;  4J8X A;  1HQ3 C;  2XD5 A;  4H9N A;  5AVC C;  4YS3 C;  5B1L A;  2L5A A;  3FDD A;  5B24 C;  5JRG D;  4R8P A;  1U35 C;  3AN2 A;  3A6N C;  1F66 A;  2Y2J A;  3IP4 C;  3AZL A;  3MGS B;  3C1C B;  3KSY A;  3MGP B;  3AYW C;  3LZ1 A;  4YM6 D;  5AV5 B;  1P3O D;  3AZH A;  2BYM B;  3AZK A;  4WJ3 C;  5CPK C;  3REK D;  1F1E A;  3X1S B;  1H3O A;  5BT1 C;  5B32 C;  4NE6 A;  3B6F D;  2Y2N A;  3NQJ B;  3B0D B;  5AV9 A;  1M1A B;  3WA9 C;  5GT0 C;  4Z66 A;  4H9Q A;  2NZD D;  3REL D;  3AFA A;  3LEL C;  4LD9 C;  4X23 A;  3O62 A;  5BNX B;  3AZF B;  3B0C T;  4UUZ A;  4XUJ A;  5CPJ D;  4J8V B;  1KX4 C;  2FJ7 A;  3MNN D;  4KHA A;  1ZLA B;  3AZE D;  5B40 B;  3W99 C;  3REL C;  5BO0 B;  3B6G C;  4EO5 C;  3LZ0 A;  5B33 A;  4J8X C;  4QLC B;  3C1B B;  3AV1 A;  5B1L C;  5DNM B;  2ARO A;  3UT9 B;  1B67 A;  4R8P C;  3AZN D;  3AN2 C;  1P34 B;  1S32 A;  5JA4 A;  1F66 C;  4J8U A;  3AZL C;  3REH B;  3MGQ A;  4JJN C;  2JE5 A;  3LZ1 C;  3X1T D;  3AZH C;  5AV6 A;  3MGR B;  3EPJ A;  3UTB D;  5BS7 C;  1EQZ B;  4NFT A;  3AZJ A;  3H0R C;  3REJ D;  1P3P D;  5DNN D;  3VH6 W;  4H9P A;  3REI D;  5AV9 C;  3WAA A;  1KX5 B;  3W97 A;  2LY8 A;  5GSU B;  4Z66 C;  1M19 A;  1P3G B;  3AFA C;  3WTP B;  4X23 C;  3O62 C;  3W96 B;  5F99 D;  4XUJ C;  1M18 D;  3AZK B;  5B2J D;  5C3I B;  3MGS A;  3C1C A;  3X1U B;  1H3O B;  3MGP A;  3KWQ D;  3LZ0 C;  5B33 C;  3LJA B;  3AV1 C;  2Y2K A;  2BYM A;  2RVQ C;  2ARO C;  5AY8 D;  2NQB B;  5CP6 B;  3AZM B;  2Y2O A;  3X1S A;  1S32 C;  1P3K C;  5B2J C;  3MVD D;  3B0C W;  3NQJ A;  4J8U C;  2CV5 B;  1P3I B;  3MGQ C;  1M1A A;  5B0Z B;  2FJ7 B;  4ZUX B;  2J8P A;  4XZQ D;  2Y2H A;  1P3F D;  4J8W D;  5E5A B;  5AV6 C;  2HIO B;  5BNX A;  3R45 B;  5B2I D;  2JSS A;  5GXQ B;  3AZJ C;  3KUY D;  4J8V A;  2PYO B;  2ZM5 A;  3WAA C;  3F6T A;  4Z5T D;  5B40 A;  2ZY3 A;  3W97 C;  3V9R B;  1M19 C;  5BNV B;  4WU8 B;  3KXB D;  5G49 B;  4QLC A;  3C1B A;  4E44 A;  5AV5 D;  5DNM A;  3UT9 A;  3W98 B;  4H9S A;  1P34 A;  5AV8 B;  5AVC D;  4YS3 D;  3AZI B;  3MGS C;  4DRB A;  3C1C C;  5B24 D;  3REH A;  3MGP C;  3AZG B;  1AOI A;  1U35 D;  3B0B A;  5B31 G;  3UTA B;  5AV5 C;  3MGR A;  1EQZ A;  2G5I C;  3AYW D;  3X1S C;  3AV2 A;  4H9R A;  3VH5 T;  3VH6 T;  3B0D C;  5B0Y B;  4WU9 B;  1ZLA D;  1P3A B;  1KX5 A;  5CPK D;  1M1A C;  5GSU A;  1P3G A;  5BT1 D;  3WTP A;  5B32 D;  3W96 A;  3AZF C;  1P3L B;  4WV4 B;  5B31 B;  4G91 B;  3WA9 D;  5GT0 D;  4J8V C;  4AWL B;  2Y2Q A;  3LEL D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...