1M18B

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Palindromic 146 Base Pair DNA Fragment
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
total genus 27
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m18B00
4G91C 2IO5C 5DNND 4XUJC 5B0YC 3C1CD 3AZFA 1P3OD 4E45A 4J8VD 1EQZC 5AY8B 5GSUB 5B33B 2HUEC 3B0CW 4Z5TC 5AV8D 4KGCD 4XZQB 4Z2MG 4LD9C 5AY8A 5GSUA 5B33A 1M19C 4XZQA 3X1UB 3MGQA 1P3LB 1M18B 1TZYB 3REIB 5AVCB 5CPJC 4Z66D 3X1UA 3AZED 5B40C 1P3PC 1P3LA 1M18A 3W99B 1TZYA 3REJD 3REIA 1P3BC 5AVCA 3AZKD 3AZHB 1P3KD 3UTAD 3W99A 1P3ID 5B0ZC 3UT9C 2AROC 1WWSA 5F99B 5DNNB 3AZHA 5B2IC 3C1CB 1P3OB 4H9NB 5F99A 5JA4B 5DNNA 3LZ1C 3C1CA 3MGPB 1KX5D 5CPKB 1P3OA 5AV8B 4H9NA 5JA4A 1S32C 3MGPA 4JJNB 1HQ3C 5B24D 2RVQC 3AFAC 5CPKA 5AV8A 3B6FC 3RELC 4WU9C 1ID3C 4JJNA 5BNXB 1Q9CA 1B6WA 2HIOD 4H9SA 5JRGB 5BNXA 3REJB 2FJ7C 5AV6C 3WA9D 3AZMD 3AZKB 5B1MD 3UTAB 1P3IB 4X23C 5JRGA 3KWQB 3REJA 4ZBJB 3KXBB 3AZNC 2PYOC 4QLCB 3AZKA 3X1VB 3UTAA 1P3IA 1KX4B 3KWQA 3KXBA 5B1LC 3X1TC 4QLCA 3B6GC 3X1VA 3W96D 1KX4A 5AV5D 3KSYA 3B0DC 4ZUXB 4YS3B 5AV9D 1U35C 4G91B 3WAAC 4XUJB 4ZUXA 4YS3A 5B0YB 3C1BD 3A6NC 1P3FC 3WTPD 4XUJA 4KUDC 5BT1D 5B0YA 3MVDC 3B0BA 4J8UC 2HUEB 4Z5TB 1KX3D 3VH6W 1ULYA 3W97C 4LD9B 4DRAA 3KUYC 2NQBC 2NZDC 3VH5W 4E44A 1M19B 4DRBA 1B67A 4Z5TA 4CSRB 4LD9A 3AZIC 5AY8D 3O62D 1M19A 4CSRA 5B40B 3W96B 4J8WC 5AV5B 2BYMB 3UTBC 1P3BB 4R8PC 5B40A 3W96A 3X1UD 1F66D 5AV9B 1P3LD 1M18D 5AV5A 2BYMA 1TZYD 2AROB 3UT9B 1P3BA 3REID 2L5AA 5B2IB 5AV9A 3C1BB 3UT9A 2AROA 5BO0B 1KU5A 4Z66C 3LZ1B 5B2IA 3AZHD 5B31G 3AZLC 3AZJC 3C1BA 1P34C 5BO0A 1BH9B 3VH5A 1KX3B 4J8XD 5F99D 3LZ1A 1S32B 1HQ3B 3TU4C 1P3AC 1BH9A 1KX3A 3REKC 1S32A 4WU9B 5BS7C 1HQ3A 3MGPD 4YM6C 3O62B 4G92C 5CPKD 4EO5C 5CPIC 3MGSD 1P3MC 5B31D 4WU9A 4JJND 3MGRC 3O62A 2FJ7B 4M6BA 2CV5C 1M1AC 1F66B 2PYOB 3AZNB 4Z2MH 2FJ7A 1P3GC 1F66A 2PYOA 5JRGD 4CAYB 3KWQD 3KXBD 3REHD 4QLCD 4CAYA 4J8XB 5CP6C 3X1VD 5GT3C 1KX4D 3AYWD 5B32C 1U35B 3WAAB 4J8XA 3WKJD 3AN2D 3LELC 3A6NB 3AV2C 1U35A 3WAAA 3MNND 3MGSB 5DNMC 4KUDB 2F8NK 3MVDB 4ZUXD 5B31B 4YS3D 3X1SC 1ZLAD 4J8UB 3A6NA 5GT0C 3MGSA 4KUDA 3W97B 4XUJD 3MVDA 5GXQC 5B31A 5B0YD 1H3OB 4J8UA 3LZ0C 2NZDB 3AZGC 1AOIC 5E5AB 3AV1C 3W97A 1EQZD 4HGAC 1H3OA 2NZDA 1WWIA 5E5AA 4Z5TD 4J8WB 4LD9D 1TAFB 4R8PB 3REHB 4WU8C 3AZFC 5AVBC 1M19D 3W98B 4J8WA 1TAFA 4R8PA 3REHA 3AYWB 5B32G 5CPJD 3WKJB 3AN2B 5B40D 1P3PD 3LJAC 3W98A 5AY8C 5GSUC 5B33C 3AYWA 1P3BD 3MNNB 3WKJA 4XZQC 3MGQC 3AN2A 1ZLAB 3AZLB 3AZJB 5B0ZD 1P34B 3UT9D 2AROD 5G49B 3MNNA 2F8NG 2IO5B 5B2ID 3AZLA 1ZLAA 3AZJA 1P34A 5G49A 5AVCC 3REKB 1EQZB 3LZ1D 3W99C 5B2JC 4YM6B 2JSSA 4EO5B 5CPIB 3REKA 1EQZA 1P3MB 5BS7A 1S32D 3MGRB 1HQ3D 4YM6A 2RVQD 3AFAD 5CPIA 2CV5B 3B6FD 5DNNC 1P3MA 3RELD 3C1CC 4WU9D 3MGRA 1P3OC 5CPJB 2CV5A 4J8VC 1P3GB 1P3PB 5KDMB 5CPJA 2FJ7D 5AV8C 4KGCC 1P3GA 1P3PA 4X23D 5B0ZB 2PYOD 5KDMA 1R4VA 3AZND 5CP6B 4H9SC 4WZSB 5B0ZA 5B1LD 5B32B 3X1TD 3B6GD 5CP6A 3AZEC 3VH6A 5FUGB 3LELB 3REJC 3AV2B 5B32A 4NE6A 3AZKC 1P3KC 3UTAC 1P3IC 3LELA 5FUGA 3V9RB 5GT0B 3AV2A 3WTPE 3AFAB 1U35D 4AWLC 2F8NB 3WAAD 3B6FB 5GXQB 3RELB 1ID3B 3LZ0B 3V9RA 5GT0A 3A6ND 1AOIB 3AFAA 2F8NA 3B6FA 4KUDD 5GXQA 3RELA 4HGAB 3MVDD 1ID3A 3LZ0A 3VH5T 4J8UD 1AOIA 1KX5C 5AV6B 3W97D 3KUYD 4X23B 2NQBD 2NZDD 5C3IC 5B24C 4WU8B 5AVBB 5AV6A 5E5AD 3NQJB 4X23A 3AZID 3AZNA 5B1LB 4WU8A 3X1TB 5AVBA 3B6GB 3NQJA 2HIOC 3LJAB 5BNVB 4J8WD 5B1LA 3UTBD 4R8PD 3X1TA 3B6GA 3WA9C 3AZMC 3B0DB 3MGQB 5B1MC 3LJAA 5BNVA 3W98D 5CHLB 1P3FB 4H9RB 3W96C 5B2JB 3AZLD 5AV5C 3AZJD 1P34D 1P3FA 4H9RA 5B2JA 5AV9C 3KUYB 2NQBB 3TU4D 3B0CT 1P3AD 2YFVB 3REKD 3KUYA 3AZIB 2NQBA 1N1JB 3C1BC 4YM6D 3WTPC 4J8VB 5CPID 2YFVA 5BT1C 1P3MD 1JFIB 3AZIA 1A7WA 1N1JA 3MGRD 3UTBB 4KGCB 1KX3C 4J8VA 2CV5D 1M1AD 1JFIA 3UTBA 1BFMA 4KGCA 1P3GD 3O62C 4Z66B 2CWEA 3AZEB 3NQUB 4H9OB 4Z66A 1P3KB 5CP6D 3AZEA 3X1UC 4WV4B 5GT3D 1P3LC 1F66C 1M18C 3NQUA 1TZYC 3TU4B 4H9OA 1P3AB 5B32D 4AWLB 3REIC 1P3KA 2F8NH 3LELD 3TU4A 1P3AA 4G92B 3AV2D 4NE5A 4WNNB 2YFWB 5DNMD 3AZHC 2LY8A 3X1SD 5GT0D 1KX5B 4WNNA 2F8ND 4J8XC 2YFWA 1BH8B 5F99C 1M1AB 5GXQD 1ID3D 3LZ0D 5C3IB 5B24B 3AZGD 1KX5A 1AOID 1HTAA 1BH8A 3AV1D 1M1AA 3MGPC 5B24A 5CPKC 5AV6D 3MGSC 2HIOB 3R45B 5B31C 4JJNC 4WU8D 3AZFD 5AVBD 3WA9B 3AZMB 2HIOA 3R45A 5B1MB 5GT3B 4KHAB 3WA9A 5E5AC 3AZMA 5B1MA 5GT3A 3LJAD 5JRGC 5GSUD 4KHAA 5B33D 5DNMB 4XZQD 3MGQD 4UUZB 3X1SB 3KWQC 4ZBJC 3KXBC 3REHC 4QLCC 4H9QB 5DNMA 3X1VC 2BYKB 4UUZA 3W98C 3X1SA 1KX4C 3AZGB 3AYWC 1F1EA 1P3FD 5AVCD 3VH6T 4H9QA 3WKJC 3AV1B 2BYKA 3AN2C 3W99D 5B2JD 3AZGA 3WTPB 4H9PB 3MNNC 3AV1A 4ZUXC 1ZLAC 4YS3C 4NE3A 3WTPA 3AZFB 4H9PA 4NFTA
chains in the Genus database with same CATH superfamily
4G91C 2IO5C 5DNND 4XUJC 4DQYB 5B0YC 3C1CD 3AZFA 1P3OD 1W2EA 4E45A 4J8VD 1EQZC 5AY8B 5GSUB 3EG5B 5B33B 2HUEC 3B0CW 2ZY4A 3P5JB 4Z5TC 5AV8D 4KGCD 4XZQB 4Z2MG 4LD9C 5AY8A 5GSUA 5B33A 1M19C 4XZQA 3X1UB 3MGQA 1P3LB 1M18B 1TZYB 3REIB 5AVCB 5CPJC 4Z66D 3X1UA 3AZED 5B40C 1P3PC 1P3LA 1M18A 3W99B 1TZYA 3REJD 3REIA 1P3BC 5AVCA 3AZKD 3AZHB 1P3KD 3UTAD 3W99A 1P3ID 5B0ZC 3UT9C 2AROC 1WWSA 5F99B 5DNNB 3AZHA 2Y2LA 5B2IC 3C1CB 1P3OB 4H9NB 5F99A 5JA4B 2BG1A 5DNNA 3LZ1C 3C1CA 3MGPB 1KX5D 5CPKB 1P3OA 5AV8B 4H9NA 5JA4A 1S32C 3MGPA 4JJNB 1HQ3C 5B24D 2RVQC 3AFAC 5CPKA 5AV8A 3B6FC 3RELC 4WU9C 1ID3C 4JJNA 5BNXB 1Q9CA 1B6WA 2HIOD 4H9SA 5JRGB 5BNXA 3REJB 2FJ7C 5AV6C 3WA9D 3AZMD 2ZY5A 3AZKB 5B1MD 3UTAB 1P3IB 4X23C 5JRGA 3KWQB 3REJA 4ZBJB 3KXBB 3AZNC 2PYOC 1Z2CB 4QLCB 3EPLA 3AZKA 3X1VB 3UTAA 4UPKA 3KFUG 1P3IA 1KX4B 3KWQA 3KXBA 5B1LC 3X1TC 4QLCA 3B6GC 3X1VA 3W96D 1KX4A 5AV5D 3KSYA 3B0DC 4ZUXB 4YS3B 2Y2KA 5AV9D 1U35C 4G91B 3WAAC 4XUJB 4ZUXA 4YS3A 5B0YB 3C1BD 3A6NC 1P3FC 3WTPD 4XUJA 4KUDC 5BT1D 5B0YA 3MVDC 3B0BA 4J8UC 2HUEB 4Z5TB 2JCHA 1KX3D 3VH6W 1ULYA 3W97C 4LD9B 4DRAA 3KUYC 2NQBC 2NZDC 3VH5W 4E44A 1M19B 4DRBA 1B67A 4Z5TA 4CSRB 4LD9A 3AZIC 5AY8D 3O62D 1M19A 4CSRA 5B40B 3W96B 4J8WC 5AV5B 2BYMB 3UTBC 1P3BB 4R8PC 5B40A 3W96A 3X1UD 2JE5A 1F66D 5AV9B 1P3LD 1M18D 5AV5A 2BYMA 1TZYD 2AROB 3UT9B 1P3BA 3REID 2L5AA 1PZRA 5B2IB 5AV9A 3C1BB 3UT9A 2AROA 5BO0B 1KU5A 4Z66C 3LZ1B 5B2IA 3AZHD 5B31G 2G5HC 3AZLC 3AZJC 3C1BA 1P34C 5BO0A 1BH9B 3VH5A 1KX3B 4J8XD 5F99D 3LZ1A 1S32B 1HQ3B 3TU4C 1P3AC 1BH9A 1KX3A 3REKC 1S32A 4WU9B 5BS7C 1HQ3A 3MGPD 4YM6C 3O62B 4G92C 5CPKD 2ZY2A 3H0RC 4EO5C 5CPIC 3MGSD 1P3MC 5B31D 4WU9A 4JJND 3MGRC 3O62A 2FJ7B 4M6BA 2CV5C 1M1AC 1F66B 2PYOB 3AZNB 4Z2MH 2FJ7A 1P3GC 1F66A 2PYOA 5JRGD 4CAYB 2ZM5A 3KWQD 3KXBD 3REHD 4QLCD 4CAYA 4J8XB 5CP6C 3X1VD 2Y2MA 5GT3C 1KX4D 3AYWD 5B32C 1U35B 3WAAB 4J8XA 3WKJD 3AN2D 3LELC 3A6NB 3AV2C 1U35A 3IP4C 3WAAA 3MNND 3MGSB 5DNMC 4KUDB 2F8NK 3MVDB 4ZUXD 5B31B 4YS3D 3X1SC 1ZLAD 4J8UB 3A6NA 5GT0C 3MGSA 4KUDA 3W97B 4XUJD 3MVDA 5GXQC 5B31A 5B0YD 1H3OB 4J8UA 3LZ0C 2NZDB 3AZGC 1AOIC 5E5AB 3AV1C 3W97A 1EQZD 4HGAC 1H3OA 2NZDA 1WWIA 5E5AA 4Z5TD 4J8WB 4LD9D 1TAFB 4R8PB 3REHB 4WU8C 3AZFC 5AVBC 1M19D 3W98B 4J8WA 1TAFA 4R8PA 3REHA 3AYWB 5B32G 5CPJD 3WKJB 3AN2B 5B40D 1P3PD 3LJAC 3W98A 5AY8C 3FDDA 5GSUC 5B33C 3AYWA 1P3BD 3MNNB 3WKJA 4XZQC 3MGQC 3AN2A 1ZLAB 3AZLB 3AZJB 5B0ZD 1P34B 3UT9D 2AROD 5G49B 3MNNA 2F8NG 2IO5B 5B2ID 3AZLA 1ZLAA 3AZJA 1P34A 5G49A 5AVCC 3REKB 1EQZB 1T3UA 3W99C 3LZ1D 5B2JC 4YM6B 2JSSA 4EO5B 5CPIB 3REKA 1EQZA 1P3MB 5BS7A 1S32D 3MGRB 1HQ3D 4YM6A 2RVQD 3AFAD 5CPIA 2CV5B 3B6FD 5DNNC 1P3MA 3RELD 3C1CC 4WU9D 3MGRA 2XD5A 5CPJB 1P3OC 2CV5A 4J8VC 2G5IC 1P3GB 1P3PB 5KDMB 5CPJA 2FJ7D 5AV8C 4KGCC 1P3GA 1P3PA 4X23D 5B0ZB 2PYOD 5KDMA 1R4VA 3AZND 5CP6B 4H9SC 4WZSB 5B0ZA 5B1LD 5B32B 3X1TD 3B6GD 4WJ3C 5CP6A 3AZEC 3VH6A 5FUGB 3LELB 3REJC 3AV2B 5B32A 3AL0C 4NE6A 3AZKC 1P3KC 3UTAC 1P3IC 2RIQA 5FUGA 3V9RB 5GT0B 3LELA 3AV2A 3WTPE 3AFAB 1U35D 4AWLC 2F8NB 3WAAD 3B6FB 2Y2PA 5GXQB 3RELB 2ZY3A 1ID3B 3LZ0B 3V9RA 5GT0A 3A6ND 1AOIB 3AFAA 3H0LC 2F8NA 3B6FA 4KUDD 5GXQA 3RELA 4HGAB 3MVDD 1ID3A 2J8PA 2Y2GA 3VH5T 3LZ0A 4J8UD 1AOIA 1KX5C 5AV6B 3EPJA 3W97D 2W8SA 4X23B 3KUYD 2NQBD 2NZDD 5C3IC 5B24C 4WU8B 5AVBB 5AV6A 5E5AD 3NQJB 4X23A 3AZID 3AZNA 5B1LB 4WU8A 3X1TB 5AVBA 3B6GB 2DF4C 3NQJA 2HIOC 3LJAB 5BNVB 2Y2QA 4J8WD 5B1LA 3UTBD 4R8PD 3X1TA 3B6GA 3WA9C 3AZMC 3B0DB 3MGQB 5B1MC 3LJAA 5BNVA 3W98D 5CHLB 2Y2JA 1P3FB 4H9RB 2XD1A 3W96C 3EPKA 5B2JB 3AZLD 5AV5C 3AZJD 1P34D 1P3FA 4H9RA 2Y2HA 5B2JA 5AV9C 3KUYB 2NQBB 3TU4D 3B0CT 1P3AD 2YFVB 3REKD 3KUYA 3AZIB 2NQBA 1N1JB 3C1BC 4YM6D 3WTPC 4J8VB 5CPID 2YFVA 5BT1C 1P3MD 1JFIB 3AZIA 1A7WA 1N1JA 3MGRD 3UTBB 4KGCB 1KX3C 4J8VA 2CV5D 1M1AD 1JFIA 2FFFB 3UTBA 1BFMA 4KGCA 1P3GD 2DQNC 3O62C 4Z66B 2CWEA 3AZEB 2Y2NA 3NQUB 2Y2IA 4H9OB 4Z66A 1P3KB 5CP6D 3AZEA 3X1UC 4WV4B 5GT3D 1P3LC 1F66C 1M18C 3NQUA 1TZYC 3TU4B 4H9OA 1P3AB 5B32D 4AWLB 3REIC 1P3KA 2F8NH 3LELD 3A1KA 3TU4A 1P3AA 4G92B 3AV2D 2VQRA 4NE5A 4WNNB 2YFWB 5DNMD 3AZHC 2F2AC 2LY8A 3X1SD 5GT0D 1KX5B 4WNNA 2F8ND 4J8XC 2YFWA 1BH8B 5F99C 1M1AB 5GXQD 1ID3D 3LZ0D 5C3IB 5B24B 3AZGD 1KX5A 1AOID 1HTAA 1BH8A 3AV1D 1M1AA 3MGPC 5B24A 5CPKC 5AV6D 3F6TA 3MGSC 2HIOB 3R45B 5B31C 4JJNC 4WU8D 2Y2OA 5AVBD 3AZFD 3WA9B 3AZMB 2HIOA 3R45A 5B1MB 5GT3B 2UWXA 4KHAB 3WA9A 5E5AC 3AZMA 5B1MA 5GT3A 3LJAD 5JRGC 5GSUD 4KHAA 5B33D 5DNMB 4XZQD 3MGQD 3EPHA 4UUZB 3X1SB 3KWQC 4ZBJC 3KXBC 3REHC 4QLCC 4H9QB 5DNMA 3X1VC 2BYKB 4UUZA 3W98C 3X1SA 1KX4C 3AZGB 3AYWC 1F1EA 1P3FD 5AVCD 3VH6T 4H9QA 3WKJC 3AV1B 2BYKA 3AN2C 3W99D 3H0MC 5B2JD 3AZGA 3WTPB 4H9PB 3MNNC 3AV1A 4ZUXC 1ZLAC 4YS3C 4NE3A 3WTPA 3AZFB 4H9PA 4NFTA 3A1IA
chains in the Genus database with same CATH topology
4G91C 2IO5C 5DNND 4XUJC 4DQYB 5B0YC 3C1CD 3AZFA 1P3OD 1W2EA 4E45A 4J8VD 1EQZC 5AY8B 5GSUB 3EG5B 5B33B 2HUEC 3B0CW 2ZY4A 3P5JB 4Z5TC 5AV8D 4KGCD 4XZQB 4Z2MG 4LD9C 5AY8A 5GSUA 5B33A 1M19C 4XZQA 3X1UB 3MGQA 1P3LB 1M18B 1TZYB 3REIB 5AVCB 5CPJC 4Z66D 3X1UA 3AZED 5B40C 1P3PC 1P3LA 1M18A 3W99B 1TZYA 3REJD 3REIA 1P3BC 5AVCA 3AZKD 3AZHB 1P3KD 3UTAD 3W99A 1P3ID 5B0ZC 3UT9C 2AROC 1WWSA 5F99B 5DNNB 3AZHA 2Y2LA 5B2IC 3C1CB 1P3OB 4H9NB 5F99A 5JA4B 2BG1A 5DNNA 3LZ1C 3C1CA 3MGPB 1KX5D 5CPKB 1P3OA 5AV8B 4H9NA 5JA4A 1S32C 3MGPA 4JJNB 1HQ3C 5B24D 2RVQC 3AFAC 5CPKA 5AV8A 3B6FC 3RELC 4WU9C 1ID3C 4JJNA 5BNXB 1Q9CA 1B6WA 2HIOD 4H9SA 5JRGB 5BNXA 3REJB 2FJ7C 5AV6C 3WA9D 3AZMD 2ZY5A 3AZKB 5B1MD 3UTAB 1P3IB 4X23C 5JRGA 3KWQB 3REJA 4ZBJB 3KXBB 3AZNC 2PYOC 1Z2CB 4QLCB 3EPLA 3AZKA 3X1VB 3UTAA 4UPKA 3KFUG 1P3IA 1KX4B 3KWQA 3KXBA 5B1LC 3X1TC 4QLCA 3B6GC 3X1VA 3W96D 1KX4A 5AV5D 3KSYA 3B0DC 4ZUXB 4YS3B 2Y2KA 5AV9D 1U35C 4G91B 3WAAC 4XUJB 4ZUXA 4YS3A 5B0YB 3C1BD 3A6NC 1P3FC 3WTPD 4XUJA 4KUDC 5BT1D 5B0YA 3MVDC 3B0BA 4J8UC 2HUEB 4Z5TB 2JCHA 1KX3D 3VH6W 1ULYA 3W97C 4LD9B 4DRAA 3KUYC 2NQBC 2NZDC 3VH5W 4E44A 1M19B 4DRBA 1B67A 4Z5TA 4CSRB 4LD9A 3AZIC 5AY8D 3O62D 1M19A 4CSRA 5B40B 3W96B 4J8WC 5AV5B 2BYMB 3UTBC 1P3BB 4R8PC 5B40A 3W96A 3X1UD 2JE5A 1F66D 5AV9B 1P3LD 1M18D 5AV5A 2BYMA 1TZYD 2AROB 3UT9B 1P3BA 3REID 2L5AA 1PZRA 5B2IB 5AV9A 3C1BB 3UT9A 2AROA 5BO0B 1KU5A 4Z66C 3LZ1B 5B2IA 3AZHD 5B31G 2G5HC 3AZLC 3AZJC 3C1BA 1P34C 5BO0A 1BH9B 3VH5A 1KX3B 4J8XD 5F99D 3LZ1A 1S32B 1HQ3B 3TU4C 1P3AC 1BH9A 1KX3A 3REKC 1S32A 4WU9B 5BS7C 1HQ3A 3MGPD 4YM6C 3O62B 4G92C 5CPKD 2ZY2A 3H0RC 4EO5C 5CPIC 3MGSD 1P3MC 5B31D 4WU9A 4JJND 3MGRC 3O62A 2FJ7B 4M6BA 2CV5C 1M1AC 1F66B 2PYOB 3AZNB 4Z2MH 2FJ7A 1P3GC 1F66A 2PYOA 5JRGD 4CAYB 2ZM5A 3KWQD 3KXBD 3REHD 4QLCD 4CAYA 4J8XB 5CP6C 3X1VD 2Y2MA 5GT3C 1KX4D 3AYWD 5B32C 1U35B 3WAAB 4J8XA 3WKJD 3AN2D 3LELC 3A6NB 3AV2C 1U35A 3IP4C 3WAAA 3MNND 3MGSB 5DNMC 4KUDB 2F8NK 3MVDB 4ZUXD 5B31B 4YS3D 3X1SC 1ZLAD 4J8UB 3A6NA 5GT0C 3MGSA 4KUDA 3W97B 4XUJD 3MVDA 5GXQC 5B31A 5B0YD 1H3OB 4J8UA 3LZ0C 2NZDB 3AZGC 1AOIC 5E5AB 3AV1C 3W97A 1EQZD 4HGAC 1H3OA 2NZDA 1WWIA 5E5AA 4Z5TD 4J8WB 4LD9D 1TAFB 4R8PB 3REHB 4WU8C 3AZFC 5AVBC 1M19D 3W98B 4J8WA 1TAFA 4R8PA 3REHA 3AYWB 5B32G 5CPJD 3WKJB 3AN2B 5B40D 1P3PD 3LJAC 3W98A 5AY8C 3FDDA 5GSUC 5B33C 3AYWA 1P3BD 3MNNB 3WKJA 4XZQC 3MGQC 3AN2A 1ZLAB 3AZLB 3AZJB 5B0ZD 1P34B 3UT9D 2AROD 5G49B 3MNNA 2F8NG 2IO5B 5B2ID 3AZLA 1ZLAA 3AZJA 1P34A 5G49A 5AVCC 3REKB 1EQZB 1T3UA 3W99C 3LZ1D 5B2JC 4YM6B 2JSSA 4EO5B 5CPIB 3REKA 1EQZA 1P3MB 5BS7A 1S32D 3MGRB 1HQ3D 4YM6A 2RVQD 3AFAD 5CPIA 2CV5B 3B6FD 5DNNC 1P3MA 3RELD 3C1CC 4WU9D 3MGRA 2XD5A 5CPJB 1P3OC 2CV5A 4J8VC 2G5IC 1P3GB 1P3PB 5KDMB 5CPJA 2FJ7D 5AV8C 4KGCC 1P3GA 1P3PA 4X23D 5B0ZB 2PYOD 5KDMA 1R4VA 3AZND 5CP6B 4H9SC 4WZSB 5B0ZA 5B1LD 5B32B 3X1TD 3B6GD 4WJ3C 5CP6A 3AZEC 3VH6A 5FUGB 3LELB 3REJC 3AV2B 5B32A 3AL0C 4NE6A 3AZKC 1P3KC 3UTAC 1P3IC 2RIQA 5FUGA 3V9RB 5GT0B 3LELA 3AV2A 3WTPE 3AFAB 1U35D 4AWLC 2F8NB 3WAAD 3B6FB 2Y2PA 5GXQB 3RELB 2ZY3A 1ID3B 3LZ0B 3V9RA 5GT0A 3A6ND 1AOIB 3AFAA 3H0LC 2F8NA 3B6FA 4KUDD 5GXQA 3RELA 4HGAB 3MVDD 1ID3A 2J8PA 2Y2GA 3VH5T 3LZ0A 4J8UD 1AOIA 1KX5C 5AV6B 3EPJA 3W97D 2W8SA 4X23B 3KUYD 2NQBD 2NZDD 5C3IC 5B24C 4WU8B 5AVBB 5AV6A 5E5AD 3NQJB 4X23A 3AZID 3AZNA 5B1LB 4WU8A 3X1TB 5AVBA 3B6GB 2DF4C 3NQJA 2HIOC 3LJAB 5BNVB 2Y2QA 4J8WD 5B1LA 3UTBD 4R8PD 3X1TA 3B6GA 3WA9C 3AZMC 3B0DB 3MGQB 5B1MC 3LJAA 5BNVA 3W98D 5CHLB 2Y2JA 1P3FB 4H9RB 2XD1A 3W96C 3EPKA 5B2JB 3AZLD 5AV5C 3AZJD 1P34D 1P3FA 4H9RA 2Y2HA 5B2JA 5AV9C 3KUYB 2NQBB 3TU4D 3B0CT 1P3AD 2YFVB 3REKD 3KUYA 3AZIB 2NQBA 1N1JB 3C1BC 4YM6D 3WTPC 4J8VB 5CPID 2YFVA 5BT1C 1P3MD 1JFIB 3AZIA 1A7WA 1N1JA 3MGRD 3UTBB 4KGCB 1KX3C 4J8VA 2CV5D 1M1AD 1JFIA 2FFFB 3UTBA 1BFMA 4KGCA 1P3GD 2DQNC 3O62C 4Z66B 2CWEA 3AZEB 2Y2NA 3NQUB 2Y2IA 4H9OB 4Z66A 1P3KB 5CP6D 3AZEA 3X1UC 4WV4B 5GT3D 1P3LC 1F66C 1M18C 3NQUA 1TZYC 3TU4B 4H9OA 1P3AB 5B32D 4AWLB 3REIC 1P3KA 2F8NH 3LELD 3A1KA 3TU4A 1P3AA 4G92B 3AV2D 2VQRA 4NE5A 4WNNB 2YFWB 5DNMD 3AZHC 2F2AC 2LY8A 3X1SD 5GT0D 1KX5B 4WNNA 2F8ND 4J8XC 2YFWA 1BH8B 5F99C 1M1AB 5GXQD 1ID3D 3LZ0D 5C3IB 5B24B 3AZGD 1KX5A 1AOID 1HTAA 1BH8A 3AV1D 1M1AA 3MGPC 5B24A 5CPKC 5AV6D 3F6TA 3MGSC 2HIOB 3R45B 5B31C 4JJNC 4WU8D 2Y2OA 5AVBD 3AZFD 3WA9B 3AZMB 2HIOA 3R45A 5B1MB 5GT3B 2UWXA 4KHAB 3WA9A 5E5AC 3AZMA 5B1MA 5GT3A 3LJAD 5JRGC 5GSUD 4KHAA 5B33D 5DNMB 4XZQD 3MGQD 3EPHA 4UUZB 3X1SB 3KWQC 4ZBJC 3KXBC 3REHC 4QLCC 4H9QB 5DNMA 3X1VC 2BYKB 4UUZA 3W98C 3X1SA 1KX4C 3AZGB 3AYWC 1F1EA 1P3FD 5AVCD 3VH6T 4H9QA 3WKJC 3AV1B 2BYKA 3AN2C 3W99D 3H0MC 5B2JD 3AZGA 3WTPB 4H9PB 3MNNC 3AV1A 4ZUXC 1ZLAC 4YS3C 4NE3A 3WTPA 3AZFB 4H9PA 4NFTA 3A1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G91 C;  2IO5 C;  5DNN D;  4XUJ C;  5B0Y C;  3C1C D;  3AZF A;  1P3O D;  4E45 A;  4J8V D;  1EQZ C;  5AY8 B;  5GSU B;  5B33 B;  2HUE C;  3B0C W;  4Z5T C;  5AV8 D;  4KGC D;  4XZQ B;  4Z2M G;  4LD9 C;  5AY8 A;  5GSU A;  5B33 A;  1M19 C;  4XZQ A;  3X1U B;  3MGQ A;  1P3L B;  1M18 B;  1TZY B;  3REI B;  5AVC B;  5CPJ C;  4Z66 D;  3X1U A;  3AZE D;  5B40 C;  1P3P C;  1P3L A;  1M18 A;  3W99 B;  1TZY A;  3REJ D;  3REI A;  1P3B C;  5AVC A;  3AZK D;  3AZH B;  1P3K D;  3UTA D;  3W99 A;  1P3I D;  5B0Z C;  3UT9 C;  2ARO C;  1WWS A;  5F99 B;  5DNN B;  3AZH A;  5B2I C;  3C1C B;  1P3O B;  4H9N B;  5F99 A;  5JA4 B;  5DNN A;  3LZ1 C;  3C1C A;  3MGP B;  1KX5 D;  5CPK B;  1P3O A;  5AV8 B;  4H9N A;  5JA4 A;  1S32 C;  3MGP A;  4JJN B;  1HQ3 C;  5B24 D;  2RVQ C;  3AFA C;  5CPK A;  5AV8 A;  3B6F C;  3REL C;  4WU9 C;  1ID3 C;  4JJN A;  5BNX B;  1Q9C A;  1B6W A;  2HIO D;  4H9S A;  5JRG B;  5BNX A;  3REJ B;  2FJ7 C;  5AV6 C;  3WA9 D;  3AZM D;  3AZK B;  5B1M D;  3UTA B;  1P3I B;  4X23 C;  5JRG A;  3KWQ B;  3REJ A;  4ZBJ B;  3KXB B;  3AZN C;  2PYO C;  4QLC B;  3AZK A;  3X1V B;  3UTA A;  1P3I A;  1KX4 B;  3KWQ A;  3KXB A;  5B1L C;  3X1T C;  4QLC A;  3B6G C;  3X1V A;  3W96 D;  1KX4 A;  5AV5 D;  3KSY A;  3B0D C;  4ZUX B;  4YS3 B;  5AV9 D;  1U35 C;  4G91 B;  3WAA C;  4XUJ B;  4ZUX A;  4YS3 A;  5B0Y B;  3C1B D;  3A6N C;  1P3F C;  3WTP D;  4XUJ A;  4KUD C;  5BT1 D;  5B0Y A;  3MVD C;  3B0B A;  4J8U C;  2HUE B;  4Z5T B;  1KX3 D;  3VH6 W;  1ULY A;  3W97 C;  4LD9 B;  4DRA A;  3KUY C;  2NQB C;  2NZD C;  3VH5 W;  4E44 A;  1M19 B;  4DRB A;  1B67 A;  4Z5T A;  4CSR B;  4LD9 A;  3AZI C;  5AY8 D;  3O62 D;  1M19 A;  4CSR A;  5B40 B;  3W96 B;  4J8W C;  5AV5 B;  2BYM B;  3UTB C;  1P3B B;  4R8P C;  5B40 A;  3W96 A;  3X1U D;  1F66 D;  5AV9 B;  1P3L D;  1M18 D;  5AV5 A;  2BYM A;  1TZY D;  2ARO B;  3UT9 B;  1P3B A;  3REI D;  2L5A A;  5B2I B;  5AV9 A;  3C1B B;  3UT9 A;  2ARO A;  5BO0 B;  1KU5 A;  4Z66 C;  3LZ1 B;  5B2I A;  3AZH D;  5B31 G;  3AZL C;  3AZJ C;  3C1B A;  1P34 C;  5BO0 A;  1BH9 B;  3VH5 A;  1KX3 B;  4J8X D;  5F99 D;  3LZ1 A;  1S32 B;  1HQ3 B;  3TU4 C;  1P3A C;  1BH9 A;  1KX3 A;  3REK C;  1S32 A;  4WU9 B;  5BS7 C;  1HQ3 A;  3MGP D;  4YM6 C;  3O62 B;  4G92 C;  5CPK D;  4EO5 C;  5CPI C;  3MGS D;  1P3M C;  5B31 D;  4WU9 A;  4JJN D;  3MGR C;  3O62 A;  2FJ7 B;  4M6B A;  2CV5 C;  1M1A C;  1F66 B;  2PYO B;  3AZN B;  4Z2M H;  2FJ7 A;  1P3G C;  1F66 A;  2PYO A;  5JRG D;  4CAY B;  3KWQ D;  3KXB D;  3REH D;  4QLC D;  4CAY A;  4J8X B;  5CP6 C;  3X1V D;  5GT3 C;  1KX4 D;  3AYW D;  5B32 C;  1U35 B;  3WAA B;  4J8X A;  3WKJ D;  3AN2 D;  3LEL C;  3A6N B;  3AV2 C;  1U35 A;  3WAA A;  3MNN D;  3MGS B;  5DNM C;  4KUD B;  2F8N K;  3MVD B;  4ZUX D;  5B31 B;  4YS3 D;  3X1S C;  1ZLA D;  4J8U B;  3A6N A;  5GT0 C;  3MGS A;  4KUD A;  3W97 B;  4XUJ D;  3MVD A;  5GXQ C;  5B31 A;  5B0Y D;  1H3O B;  4J8U A;  3LZ0 C;  2NZD B;  3AZG C;  1AOI C;  5E5A B;  3AV1 C;  3W97 A;  1EQZ D;  4HGA C;  1H3O A;  2NZD A;  1WWI A;  5E5A A;  4Z5T D;  4J8W B;  4LD9 D;  1TAF B;  4R8P B;  3REH B;  4WU8 C;  3AZF C;  5AVB C;  1M19 D;  3W98 B;  4J8W A;  1TAF A;  4R8P A;  3REH A;  3AYW B;  5B32 G;  5CPJ D;  3WKJ B;  3AN2 B;  5B40 D;  1P3P D;  3LJA C;  3W98 A;  5AY8 C;  5GSU C;  5B33 C;  3AYW A;  1P3B D;  3MNN B;  3WKJ A;  4XZQ C;  3MGQ C;  3AN2 A;  1ZLA B;  3AZL B;  3AZJ B;  5B0Z D;  1P34 B;  3UT9 D;  2ARO D;  5G49 B;  3MNN A;  2F8N G;  2IO5 B;  5B2I D;  3AZL A;  1ZLA A;  3AZJ A;  1P34 A;  5G49 A;  5AVC C;  3REK B;  1EQZ B;  3LZ1 D;  3W99 C;  5B2J C;  4YM6 B;  2JSS A;  4EO5 B;  5CPI B;  3REK A;  1EQZ A;  1P3M B;  5BS7 A;  1S32 D;  3MGR B;  1HQ3 D;  4YM6 A;  2RVQ D;  3AFA D;  5CPI A;  2CV5 B;  3B6F D;  5DNN C;  1P3M A;  3REL D;  3C1C C;  4WU9 D;  3MGR A;  1P3O C;  5CPJ B;  2CV5 A;  4J8V C;  1P3G B;  1P3P B;  5KDM B;  5CPJ A;  2FJ7 D;  5AV8 C;  4KGC C;  1P3G A;  1P3P A;  4X23 D;  5B0Z B;  2PYO D;  5KDM A;  1R4V A;  3AZN D;  5CP6 B;  4H9S C;  4WZS B;  5B0Z A;  5B1L D;  5B32 B;  3X1T D;  3B6G D;  5CP6 A;  3AZE C;  3VH6 A;  5FUG B;  3LEL B;  3REJ C;  3AV2 B;  5B32 A;  4NE6 A;  3AZK C;  1P3K C;  3UTA C;  1P3I C;  3LEL A;  5FUG A;  3V9R B;  5GT0 B;  3AV2 A;  3WTP E;  3AFA B;  1U35 D;  4AWL C;  2F8N B;  3WAA D;  3B6F B;  5GXQ B;  3REL B;  1ID3 B;  3LZ0 B;  3V9R A;  5GT0 A;  3A6N D;  1AOI B;  3AFA A;  2F8N A;  3B6F A;  4KUD D;  5GXQ A;  3REL A;  4HGA B;  3MVD D;  1ID3 A;  3LZ0 A;  3VH5 T;  4J8U D;  1AOI A;  1KX5 C;  5AV6 B;  3W97 D;  3KUY D;  4X23 B;  2NQB D;  2NZD D;  5C3I C;  5B24 C;  4WU8 B;  5AVB B;  5AV6 A;  5E5A D;  3NQJ B;  4X23 A;  3AZI D;  3AZN A;  5B1L B;  4WU8 A;  3X1T B;  5AVB A;  3B6G B;  3NQJ A;  2HIO C;  3LJA B;  5BNV B;  4J8W D;  5B1L A;  3UTB D;  4R8P D;  3X1T A;  3B6G A;  3WA9 C;  3AZM C;  3B0D B;  3MGQ B;  5B1M C;  3LJA A;  5BNV A;  3W98 D;  5CHL B;  1P3F B;  4H9R B;  3W96 C;  5B2J B;  3AZL D;  5AV5 C;  3AZJ D;  1P34 D;  1P3F A;  4H9R A;  5B2J A;  5AV9 C;  3KUY B;  2NQB B;  3TU4 D;  3B0C T;  1P3A D;  2YFV B;  3REK D;  3KUY A;  3AZI B;  2NQB A;  1N1J B;  3C1B C;  4YM6 D;  3WTP C;  4J8V B;  5CPI D;  2YFV A;  5BT1 C;  1P3M D;  1JFI B;  3AZI A;  1A7W A;  1N1J A;  3MGR D;  3UTB B;  4KGC B;  1KX3 C;  4J8V A;  2CV5 D;  1M1A D;  1JFI A;  3UTB A;  1BFM A;  4KGC A;  1P3G D;  3O62 C;  4Z66 B;  2CWE A;  3AZE B;  3NQU B;  4H9O B;  4Z66 A;  1P3K B;  5CP6 D;  3AZE A;  3X1U C;  4WV4 B;  5GT3 D;  1P3L C;  1F66 C;  1M18 C;  3NQU A;  1TZY C;  3TU4 B;  4H9O A;  1P3A B;  5B32 D;  4AWL B;  3REI C;  1P3K A;  2F8N H;  3LEL D;  3TU4 A;  1P3A A;  4G92 B;  3AV2 D;  4NE5 A;  4WNN B;  2YFW B;  5DNM D;  3AZH C;  2LY8 A;  3X1S D;  5GT0 D;  1KX5 B;  4WNN A;  2F8N D;  4J8X C;  2YFW A;  1BH8 B;  5F99 C;  1M1A B;  5GXQ D;  1ID3 D;  3LZ0 D;  5C3I B;  5B24 B;  3AZG D;  1KX5 A;  1AOI D;  1HTA A;  1BH8 A;  3AV1 D;  1M1A A;  3MGP C;  5B24 A;  5CPK C;  5AV6 D;  3MGS C;  2HIO B;  3R45 B;  5B31 C;  4JJN C;  4WU8 D;  3AZF D;  5AVB D;  3WA9 B;  3AZM B;  2HIO A;  3R45 A;  5B1M B;  5GT3 B;  4KHA B;  3WA9 A;  5E5A C;  3AZM A;  5B1M A;  5GT3 A;  3LJA D;  5JRG C;  5GSU D;  4KHA A;  5B33 D;  5DNM B;  4XZQ D;  3MGQ D;  4UUZ B;  3X1S B;  3KWQ C;  4ZBJ C;  3KXB C;  3REH C;  4QLC C;  4H9Q B;  5DNM A;  3X1V C;  2BYK B;  4UUZ A;  3W98 C;  3X1S A;  1KX4 C;  3AZG B;  3AYW C;  1F1E A;  1P3F D;  5AVC D;  3VH6 T;  4H9Q A;  3WKJ C;  3AV1 B;  2BYK A;  3AN2 C;  3W99 D;  5B2J D;  3AZG A;  3WTP B;  4H9P B;  3MNN C;  3AV1 A;  4ZUX C;  1ZLA C;  4YS3 C;  4NE3 A;  3WTP A;  3AZF B;  4H9P A;  4NFT A; 
#chains in the Genus database with same CATH topology
 4G91 C;  2IO5 C;  5DNN D;  4XUJ C;  4DQY B;  5B0Y C;  3C1C D;  3AZF A;  1P3O D;  1W2E A;  4E45 A;  4J8V D;  1EQZ C;  5AY8 B;  5GSU B;  3EG5 B;  5B33 B;  2HUE C;  3B0C W;  2ZY4 A;  3P5J B;  4Z5T C;  5AV8 D;  4KGC D;  4XZQ B;  4Z2M G;  4LD9 C;  5AY8 A;  5GSU A;  5B33 A;  1M19 C;  4XZQ A;  3X1U B;  3MGQ A;  1P3L B;  1M18 B;  1TZY B;  3REI B;  5AVC B;  5CPJ C;  4Z66 D;  3X1U A;  3AZE D;  5B40 C;  1P3P C;  1P3L A;  1M18 A;  3W99 B;  1TZY A;  3REJ D;  3REI A;  1P3B C;  5AVC A;  3AZK D;  3AZH B;  1P3K D;  3UTA D;  3W99 A;  1P3I D;  5B0Z C;  3UT9 C;  2ARO C;  1WWS A;  5F99 B;  5DNN B;  3AZH A;  2Y2L A;  5B2I C;  3C1C B;  1P3O B;  4H9N B;  5F99 A;  5JA4 B;  2BG1 A;  5DNN A;  3LZ1 C;  3C1C A;  3MGP B;  1KX5 D;  5CPK B;  1P3O A;  5AV8 B;  4H9N A;  5JA4 A;  1S32 C;  3MGP A;  4JJN B;  1HQ3 C;  5B24 D;  2RVQ C;  3AFA C;  5CPK A;  5AV8 A;  3B6F C;  3REL C;  4WU9 C;  1ID3 C;  4JJN A;  5BNX B;  1Q9C A;  1B6W A;  2HIO D;  4H9S A;  5JRG B;  5BNX A;  3REJ B;  2FJ7 C;  5AV6 C;  3WA9 D;  3AZM D;  2ZY5 A;  3AZK B;  5B1M D;  3UTA B;  1P3I B;  4X23 C;  5JRG A;  3KWQ B;  3REJ A;  4ZBJ B;  3KXB B;  3AZN C;  2PYO C;  1Z2C B;  4QLC B;  3EPL A;  3AZK A;  3X1V B;  3UTA A;  4UPK A;  3KFU G;  1P3I A;  1KX4 B;  3KWQ A;  3KXB A;  5B1L C;  3X1T C;  4QLC A;  3B6G C;  3X1V A;  3W96 D;  1KX4 A;  5AV5 D;  3KSY A;  3B0D C;  4ZUX B;  4YS3 B;  2Y2K A;  5AV9 D;  1U35 C;  4G91 B;  3WAA C;  4XUJ B;  4ZUX A;  4YS3 A;  5B0Y B;  3C1B D;  3A6N C;  1P3F C;  3WTP D;  4XUJ A;  4KUD C;  5BT1 D;  5B0Y A;  3MVD C;  3B0B A;  4J8U C;  2HUE B;  4Z5T B;  2JCH A;  1KX3 D;  3VH6 W;  1ULY A;  3W97 C;  4LD9 B;  4DRA A;  3KUY C;  2NQB C;  2NZD C;  3VH5 W;  4E44 A;  1M19 B;  4DRB A;  1B67 A;  4Z5T A;  4CSR B;  4LD9 A;  3AZI C;  5AY8 D;  3O62 D;  1M19 A;  4CSR A;  5B40 B;  3W96 B;  4J8W C;  5AV5 B;  2BYM B;  3UTB C;  1P3B B;  4R8P C;  5B40 A;  3W96 A;  3X1U D;  2JE5 A;  1F66 D;  5AV9 B;  1P3L D;  1M18 D;  5AV5 A;  2BYM A;  1TZY D;  2ARO B;  3UT9 B;  1P3B A;  3REI D;  2L5A A;  1PZR A;  5B2I B;  5AV9 A;  3C1B B;  3UT9 A;  2ARO A;  5BO0 B;  1KU5 A;  4Z66 C;  3LZ1 B;  5B2I A;  3AZH D;  5B31 G;  2G5H C;  3AZL C;  3AZJ C;  3C1B A;  1P34 C;  5BO0 A;  1BH9 B;  3VH5 A;  1KX3 B;  4J8X D;  5F99 D;  3LZ1 A;  1S32 B;  1HQ3 B;  3TU4 C;  1P3A C;  1BH9 A;  1KX3 A;  3REK C;  1S32 A;  4WU9 B;  5BS7 C;  1HQ3 A;  3MGP D;  4YM6 C;  3O62 B;  4G92 C;  5CPK D;  2ZY2 A;  3H0R C;  4EO5 C;  5CPI C;  3MGS D;  1P3M C;  5B31 D;  4WU9 A;  4JJN D;  3MGR C;  3O62 A;  2FJ7 B;  4M6B A;  2CV5 C;  1M1A C;  1F66 B;  2PYO B;  3AZN B;  4Z2M H;  2FJ7 A;  1P3G C;  1F66 A;  2PYO A;  5JRG D;  4CAY B;  2ZM5 A;  3KWQ D;  3KXB D;  3REH D;  4QLC D;  4CAY A;  4J8X B;  5CP6 C;  3X1V D;  2Y2M A;  5GT3 C;  1KX4 D;  3AYW D;  5B32 C;  1U35 B;  3WAA B;  4J8X A;  3WKJ D;  3AN2 D;  3LEL C;  3A6N B;  3AV2 C;  1U35 A;  3IP4 C;  3WAA A;  3MNN D;  3MGS B;  5DNM C;  4KUD B;  2F8N K;  3MVD B;  4ZUX D;  5B31 B;  4YS3 D;  3X1S C;  1ZLA D;  4J8U B;  3A6N A;  5GT0 C;  3MGS A;  4KUD A;  3W97 B;  4XUJ D;  3MVD A;  5GXQ C;  5B31 A;  5B0Y D;  1H3O B;  4J8U A;  3LZ0 C;  2NZD B;  3AZG C;  1AOI C;  5E5A B;  3AV1 C;  3W97 A;  1EQZ D;  4HGA C;  1H3O A;  2NZD A;  1WWI A;  5E5A A;  4Z5T D;  4J8W B;  4LD9 D;  1TAF B;  4R8P B;  3REH B;  4WU8 C;  3AZF C;  5AVB C;  1M19 D;  3W98 B;  4J8W A;  1TAF A;  4R8P A;  3REH A;  3AYW B;  5B32 G;  5CPJ D;  3WKJ B;  3AN2 B;  5B40 D;  1P3P D;  3LJA C;  3W98 A;  5AY8 C;  3FDD A;  5GSU C;  5B33 C;  3AYW A;  1P3B D;  3MNN B;  3WKJ A;  4XZQ C;  3MGQ C;  3AN2 A;  1ZLA B;  3AZL B;  3AZJ B;  5B0Z D;  1P34 B;  3UT9 D;  2ARO D;  5G49 B;  3MNN A;  2F8N G;  2IO5 B;  5B2I D;  3AZL A;  1ZLA A;  3AZJ A;  1P34 A;  5G49 A;  5AVC C;  3REK B;  1EQZ B;  1T3U A;  3W99 C;  3LZ1 D;  5B2J C;  4YM6 B;  2JSS A;  4EO5 B;  5CPI B;  3REK A;  1EQZ A;  1P3M B;  5BS7 A;  1S32 D;  3MGR B;  1HQ3 D;  4YM6 A;  2RVQ D;  3AFA D;  5CPI A;  2CV5 B;  3B6F D;  5DNN C;  1P3M A;  3REL D;  3C1C C;  4WU9 D;  3MGR A;  2XD5 A;  5CPJ B;  1P3O C;  2CV5 A;  4J8V C;  2G5I C;  1P3G B;  1P3P B;  5KDM B;  5CPJ A;  2FJ7 D;  5AV8 C;  4KGC C;  1P3G A;  1P3P A;  4X23 D;  5B0Z B;  2PYO D;  5KDM A;  1R4V A;  3AZN D;  5CP6 B;  4H9S C;  4WZS B;  5B0Z A;  5B1L D;  5B32 B;  3X1T D;  3B6G D;  4WJ3 C;  5CP6 A;  3AZE C;  3VH6 A;  5FUG B;  3LEL B;  3REJ C;  3AV2 B;  5B32 A;  3AL0 C;  4NE6 A;  3AZK C;  1P3K C;  3UTA C;  1P3I C;  2RIQ A;  5FUG A;  3V9R B;  5GT0 B;  3LEL A;  3AV2 A;  3WTP E;  3AFA B;  1U35 D;  4AWL C;  2F8N B;  3WAA D;  3B6F B;  2Y2P A;  5GXQ B;  3REL B;  2ZY3 A;  1ID3 B;  3LZ0 B;  3V9R A;  5GT0 A;  3A6N D;  1AOI B;  3AFA A;  3H0L C;  2F8N A;  3B6F A;  4KUD D;  5GXQ A;  3REL A;  4HGA B;  3MVD D;  1ID3 A;  2J8P A;  2Y2G A;  3VH5 T;  3LZ0 A;  4J8U D;  1AOI A;  1KX5 C;  5AV6 B;  3EPJ A;  3W97 D;  2W8S A;  4X23 B;  3KUY D;  2NQB D;  2NZD D;  5C3I C;  5B24 C;  4WU8 B;  5AVB B;  5AV6 A;  5E5A D;  3NQJ B;  4X23 A;  3AZI D;  3AZN A;  5B1L B;  4WU8 A;  3X1T B;  5AVB A;  3B6G B;  2DF4 C;  3NQJ A;  2HIO C;  3LJA B;  5BNV B;  2Y2Q A;  4J8W D;  5B1L A;  3UTB D;  4R8P D;  3X1T A;  3B6G A;  3WA9 C;  3AZM C;  3B0D B;  3MGQ B;  5B1M C;  3LJA A;  5BNV A;  3W98 D;  5CHL B;  2Y2J A;  1P3F B;  4H9R B;  2XD1 A;  3W96 C;  3EPK A;  5B2J B;  3AZL D;  5AV5 C;  3AZJ D;  1P34 D;  1P3F A;  4H9R A;  2Y2H A;  5B2J A;  5AV9 C;  3KUY B;  2NQB B;  3TU4 D;  3B0C T;  1P3A D;  2YFV B;  3REK D;  3KUY A;  3AZI B;  2NQB A;  1N1J B;  3C1B C;  4YM6 D;  3WTP C;  4J8V B;  5CPI D;  2YFV A;  5BT1 C;  1P3M D;  1JFI B;  3AZI A;  1A7W A;  1N1J A;  3MGR D;  3UTB B;  4KGC B;  1KX3 C;  4J8V A;  2CV5 D;  1M1A D;  1JFI A;  2FFF B;  3UTB A;  1BFM A;  4KGC A;  1P3G D;  2DQN C;  3O62 C;  4Z66 B;  2CWE A;  3AZE B;  2Y2N A;  3NQU B;  2Y2I A;  4H9O B;  4Z66 A;  1P3K B;  5CP6 D;  3AZE A;  3X1U C;  4WV4 B;  5GT3 D;  1P3L C;  1F66 C;  1M18 C;  3NQU A;  1TZY C;  3TU4 B;  4H9O A;  1P3A B;  5B32 D;  4AWL B;  3REI C;  1P3K A;  2F8N H;  3LEL D;  3A1K A;  3TU4 A;  1P3A A;  4G92 B;  3AV2 D;  2VQR A;  4NE5 A;  4WNN B;  2YFW B;  5DNM D;  3AZH C;  2F2A C;  2LY8 A;  3X1S D;  5GT0 D;  1KX5 B;  4WNN A;  2F8N D;  4J8X C;  2YFW A;  1BH8 B;  5F99 C;  1M1A B;  5GXQ D;  1ID3 D;  3LZ0 D;  5C3I B;  5B24 B;  3AZG D;  1KX5 A;  1AOI D;  1HTA A;  1BH8 A;  3AV1 D;  1M1A A;  3MGP C;  5B24 A;  5CPK C;  5AV6 D;  3F6T A;  3MGS C;  2HIO B;  3R45 B;  5B31 C;  4JJN C;  4WU8 D;  2Y2O A;  5AVB D;  3AZF D;  3WA9 B;  3AZM B;  2HIO A;  3R45 A;  5B1M B;  5GT3 B;  2UWX A;  4KHA B;  3WA9 A;  5E5A C;  3AZM A;  5B1M A;  5GT3 A;  3LJA D;  5JRG C;  5GSU D;  4KHA A;  5B33 D;  5DNM B;  4XZQ D;  3MGQ D;  3EPH A;  4UUZ B;  3X1S B;  3KWQ C;  4ZBJ C;  3KXB C;  3REH C;  4QLC C;  4H9Q B;  5DNM A;  3X1V C;  2BYK B;  4UUZ A;  3W98 C;  3X1S A;  1KX4 C;  3AZG B;  3AYW C;  1F1E A;  1P3F D;  5AVC D;  3VH6 T;  4H9Q A;  3WKJ C;  3AV1 B;  2BYK A;  3AN2 C;  3W99 D;  3H0M C;  5B2J D;  3AZG A;  3WTP B;  4H9P B;  3MNN C;  3AV1 A;  4ZUX C;  1ZLA C;  4YS3 C;  4NE3 A;  3WTP A;  3AZF B;  4H9P A;  4NFT A;  3A1I A; 
#chains in the Genus database with same CATH homology
 4G91 C;  2IO5 C;  5DNN D;  4XUJ C;  4DQY B;  5B0Y C;  3C1C D;  3AZF A;  1P3O D;  1W2E A;  4E45 A;  4J8V D;  1EQZ C;  5AY8 B;  5GSU B;  3EG5 B;  5B33 B;  2HUE C;  3B0C W;  2ZY4 A;  3P5J B;  4Z5T C;  5AV8 D;  4KGC D;  4XZQ B;  4Z2M G;  4LD9 C;  5AY8 A;  5GSU A;  5B33 A;  1M19 C;  4XZQ A;  3X1U B;  3MGQ A;  1P3L B;  1M18 B;  1TZY B;  3REI B;  5AVC B;  5CPJ C;  4Z66 D;  3X1U A;  3AZE D;  5B40 C;  1P3P C;  1P3L A;  1M18 A;  3W99 B;  1TZY A;  3REJ D;  3REI A;  1P3B C;  5AVC A;  3AZK D;  3AZH B;  1P3K D;  3UTA D;  3W99 A;  1P3I D;  5B0Z C;  3UT9 C;  2ARO C;  1WWS A;  5F99 B;  5DNN B;  3AZH A;  2Y2L A;  5B2I C;  3C1C B;  1P3O B;  4H9N B;  5F99 A;  5JA4 B;  2BG1 A;  5DNN A;  3LZ1 C;  3C1C A;  3MGP B;  1KX5 D;  5CPK B;  1P3O A;  5AV8 B;  4H9N A;  5JA4 A;  1S32 C;  3MGP A;  4JJN B;  1HQ3 C;  5B24 D;  2RVQ C;  3AFA C;  5CPK A;  5AV8 A;  3B6F C;  3REL C;  4WU9 C;  1ID3 C;  4JJN A;  5BNX B;  1Q9C A;  1B6W A;  2HIO D;  4H9S A;  5JRG B;  5BNX A;  3REJ B;  2FJ7 C;  5AV6 C;  3WA9 D;  3AZM D;  2ZY5 A;  3AZK B;  5B1M D;  3UTA B;  1P3I B;  4X23 C;  5JRG A;  3KWQ B;  3REJ A;  4ZBJ B;  3KXB B;  3AZN C;  2PYO C;  1Z2C B;  4QLC B;  3EPL A;  3AZK A;  3X1V B;  3UTA A;  4UPK A;  3KFU G;  1P3I A;  1KX4 B;  3KWQ A;  3KXB A;  5B1L C;  3X1T C;  4QLC A;  3B6G C;  3X1V A;  3W96 D;  1KX4 A;  5AV5 D;  3KSY A;  3B0D C;  4ZUX B;  4YS3 B;  2Y2K A;  5AV9 D;  1U35 C;  4G91 B;  3WAA C;  4XUJ B;  4ZUX A;  4YS3 A;  5B0Y B;  3C1B D;  3A6N C;  1P3F C;  3WTP D;  4XUJ A;  4KUD C;  5BT1 D;  5B0Y A;  3MVD C;  3B0B A;  4J8U C;  2HUE B;  4Z5T B;  2JCH A;  1KX3 D;  3VH6 W;  1ULY A;  3W97 C;  4LD9 B;  4DRA A;  3KUY C;  2NQB C;  2NZD C;  3VH5 W;  4E44 A;  1M19 B;  4DRB A;  1B67 A;  4Z5T A;  4CSR B;  4LD9 A;  3AZI C;  5AY8 D;  3O62 D;  1M19 A;  4CSR A;  5B40 B;  3W96 B;  4J8W C;  5AV5 B;  2BYM B;  3UTB C;  1P3B B;  4R8P C;  5B40 A;  3W96 A;  3X1U D;  2JE5 A;  1F66 D;  5AV9 B;  1P3L D;  1M18 D;  5AV5 A;  2BYM A;  1TZY D;  2ARO B;  3UT9 B;  1P3B A;  3REI D;  2L5A A;  1PZR A;  5B2I B;  5AV9 A;  3C1B B;  3UT9 A;  2ARO A;  5BO0 B;  1KU5 A;  4Z66 C;  3LZ1 B;  5B2I A;  3AZH D;  5B31 G;  2G5H C;  3AZL C;  3AZJ C;  3C1B A;  1P34 C;  5BO0 A;  1BH9 B;  3VH5 A;  1KX3 B;  4J8X D;  5F99 D;  3LZ1 A;  1S32 B;  1HQ3 B;  3TU4 C;  1P3A C;  1BH9 A;  1KX3 A;  3REK C;  1S32 A;  4WU9 B;  5BS7 C;  1HQ3 A;  3MGP D;  4YM6 C;  3O62 B;  4G92 C;  5CPK D;  2ZY2 A;  3H0R C;  4EO5 C;  5CPI C;  3MGS D;  1P3M C;  5B31 D;  4WU9 A;  4JJN D;  3MGR C;  3O62 A;  2FJ7 B;  4M6B A;  2CV5 C;  1M1A C;  1F66 B;  2PYO B;  3AZN B;  4Z2M H;  2FJ7 A;  1P3G C;  1F66 A;  2PYO A;  5JRG D;  4CAY B;  2ZM5 A;  3KWQ D;  3KXB D;  3REH D;  4QLC D;  4CAY A;  4J8X B;  5CP6 C;  3X1V D;  2Y2M A;  5GT3 C;  1KX4 D;  3AYW D;  5B32 C;  1U35 B;  3WAA B;  4J8X A;  3WKJ D;  3AN2 D;  3LEL C;  3A6N B;  3AV2 C;  1U35 A;  3IP4 C;  3WAA A;  3MNN D;  3MGS B;  5DNM C;  4KUD B;  2F8N K;  3MVD B;  4ZUX D;  5B31 B;  4YS3 D;  3X1S C;  1ZLA D;  4J8U B;  3A6N A;  5GT0 C;  3MGS A;  4KUD A;  3W97 B;  4XUJ D;  3MVD A;  5GXQ C;  5B31 A;  5B0Y D;  1H3O B;  4J8U A;  3LZ0 C;  2NZD B;  3AZG C;  1AOI C;  5E5A B;  3AV1 C;  3W97 A;  1EQZ D;  4HGA C;  1H3O A;  2NZD A;  1WWI A;  5E5A A;  4Z5T D;  4J8W B;  4LD9 D;  1TAF B;  4R8P B;  3REH B;  4WU8 C;  3AZF C;  5AVB C;  1M19 D;  3W98 B;  4J8W A;  1TAF A;  4R8P A;  3REH A;  3AYW B;  5B32 G;  5CPJ D;  3WKJ B;  3AN2 B;  5B40 D;  1P3P D;  3LJA C;  3W98 A;  5AY8 C;  3FDD A;  5GSU C;  5B33 C;  3AYW A;  1P3B D;  3MNN B;  3WKJ A;  4XZQ C;  3MGQ C;  3AN2 A;  1ZLA B;  3AZL B;  3AZJ B;  5B0Z D;  1P34 B;  3UT9 D;  2ARO D;  5G49 B;  3MNN A;  2F8N G;  2IO5 B;  5B2I D;  3AZL A;  1ZLA A;  3AZJ A;  1P34 A;  5G49 A;  5AVC C;  3REK B;  1EQZ B;  1T3U A;  3W99 C;  3LZ1 D;  5B2J C;  4YM6 B;  2JSS A;  4EO5 B;  5CPI B;  3REK A;  1EQZ A;  1P3M B;  5BS7 A;  1S32 D;  3MGR B;  1HQ3 D;  4YM6 A;  2RVQ D;  3AFA D;  5CPI A;  2CV5 B;  3B6F D;  5DNN C;  1P3M A;  3REL D;  3C1C C;  4WU9 D;  3MGR A;  2XD5 A;  5CPJ B;  1P3O C;  2CV5 A;  4J8V C;  2G5I C;  1P3G B;  1P3P B;  5KDM B;  5CPJ A;  2FJ7 D;  5AV8 C;  4KGC C;  1P3G A;  1P3P A;  4X23 D;  5B0Z B;  2PYO D;  5KDM A;  1R4V A;  3AZN D;  5CP6 B;  4H9S C;  4WZS B;  5B0Z A;  5B1L D;  5B32 B;  3X1T D;  3B6G D;  4WJ3 C;  5CP6 A;  3AZE C;  3VH6 A;  5FUG B;  3LEL B;  3REJ C;  3AV2 B;  5B32 A;  3AL0 C;  4NE6 A;  3AZK C;  1P3K C;  3UTA C;  1P3I C;  2RIQ A;  5FUG A;  3V9R B;  5GT0 B;  3LEL A;  3AV2 A;  3WTP E;  3AFA B;  1U35 D;  4AWL C;  2F8N B;  3WAA D;  3B6F B;  2Y2P A;  5GXQ B;  3REL B;  2ZY3 A;  1ID3 B;  3LZ0 B;  3V9R A;  5GT0 A;  3A6N D;  1AOI B;  3AFA A;  3H0L C;  2F8N A;  3B6F A;  4KUD D;  5GXQ A;  3REL A;  4HGA B;  3MVD D;  1ID3 A;  2J8P A;  2Y2G A;  3VH5 T;  3LZ0 A;  4J8U D;  1AOI A;  1KX5 C;  5AV6 B;  3EPJ A;  3W97 D;  2W8S A;  4X23 B;  3KUY D;  2NQB D;  2NZD D;  5C3I C;  5B24 C;  4WU8 B;  5AVB B;  5AV6 A;  5E5A D;  3NQJ B;  4X23 A;  3AZI D;  3AZN A;  5B1L B;  4WU8 A;  3X1T B;  5AVB A;  3B6G B;  2DF4 C;  3NQJ A;  2HIO C;  3LJA B;  5BNV B;  2Y2Q A;  4J8W D;  5B1L A;  3UTB D;  4R8P D;  3X1T A;  3B6G A;  3WA9 C;  3AZM C;  3B0D B;  3MGQ B;  5B1M C;  3LJA A;  5BNV A;  3W98 D;  5CHL B;  2Y2J A;  1P3F B;  4H9R B;  2XD1 A;  3W96 C;  3EPK A;  5B2J B;  3AZL D;  5AV5 C;  3AZJ D;  1P34 D;  1P3F A;  4H9R A;  2Y2H A;  5B2J A;  5AV9 C;  3KUY B;  2NQB B;  3TU4 D;  3B0C T;  1P3A D;  2YFV B;  3REK D;  3KUY A;  3AZI B;  2NQB A;  1N1J B;  3C1B C;  4YM6 D;  3WTP C;  4J8V B;  5CPI D;  2YFV A;  5BT1 C;  1P3M D;  1JFI B;  3AZI A;  1A7W A;  1N1J A;  3MGR D;  3UTB B;  4KGC B;  1KX3 C;  4J8V A;  2CV5 D;  1M1A D;  1JFI A;  2FFF B;  3UTB A;  1BFM A;  4KGC A;  1P3G D;  2DQN C;  3O62 C;  4Z66 B;  2CWE A;  3AZE B;  2Y2N A;  3NQU B;  2Y2I A;  4H9O B;  4Z66 A;  1P3K B;  5CP6 D;  3AZE A;  3X1U C;  4WV4 B;  5GT3 D;  1P3L C;  1F66 C;  1M18 C;  3NQU A;  1TZY C;  3TU4 B;  4H9O A;  1P3A B;  5B32 D;  4AWL B;  3REI C;  1P3K A;  2F8N H;  3LEL D;  3A1K A;  3TU4 A;  1P3A A;  4G92 B;  3AV2 D;  2VQR A;  4NE5 A;  4WNN B;  2YFW B;  5DNM D;  3AZH C;  2F2A C;  2LY8 A;  3X1S D;  5GT0 D;  1KX5 B;  4WNN A;  2F8N D;  4J8X C;  2YFW A;  1BH8 B;  5F99 C;  1M1A B;  5GXQ D;  1ID3 D;  3LZ0 D;  5C3I B;  5B24 B;  3AZG D;  1KX5 A;  1AOI D;  1HTA A;  1BH8 A;  3AV1 D;  1M1A A;  3MGP C;  5B24 A;  5CPK C;  5AV6 D;  3F6T A;  3MGS C;  2HIO B;  3R45 B;  5B31 C;  4JJN C;  4WU8 D;  2Y2O A;  5AVB D;  3AZF D;  3WA9 B;  3AZM B;  2HIO A;  3R45 A;  5B1M B;  5GT3 B;  2UWX A;  4KHA B;  3WA9 A;  5E5A C;  3AZM A;  5B1M A;  5GT3 A;  3LJA D;  5JRG C;  5GSU D;  4KHA A;  5B33 D;  5DNM B;  4XZQ D;  3MGQ D;  3EPH A;  4UUZ B;  3X1S B;  3KWQ C;  4ZBJ C;  3KXB C;  3REH C;  4QLC C;  4H9Q B;  5DNM A;  3X1V C;  2BYK B;  4UUZ A;  3W98 C;  3X1S A;  1KX4 C;  3AZG B;  3AYW C;  1F1E A;  1P3F D;  5AVC D;  3VH6 T;  4H9Q A;  3WKJ C;  3AV1 B;  2BYK A;  3AN2 C;  3W99 D;  3H0M C;  5B2J D;  3AZG A;  3WTP B;  4H9P B;  3MNN C;  3AV1 A;  4ZUX C;  1ZLA C;  4YS3 C;  4NE3 A;  3WTP A;  3AZF B;  4H9P A;  4NFT A;  3A1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...