4H9PB

Complex structure 3 of daxx/h3.3(sub5,g90a)/h4
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/apoptosis
total genus 27
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2012-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4h9pB00
1KX3A 3REKC 5KDMA 3X1VC 3W97D 3MNNB 5GSUA 5AVCB 5B31G 1KX5C 4WU9D 4R8PA 3AZIC 3A6ND 5AV6C 3KWQC 1P3ID 3REHD 1ZLAC 3UT9B 3X1TB 1P3AD 3AZED 5BT1C 1P3KA 4WU8C 3WKJD 5AV5A 1H3OA 1KX4C 2FJ7D 3AZJA 3B6GC 3MVDD 4J8XA 4YS3C 3NQUA 4LD9D 3AZFA 1P34B 3LELD 5E5AC 1P3FC 5DNNA 3REKB 1P3BC 4YM6C 3AZNA 3W98C 5B2JD 5B0ZD 1P3GB 2AROC 4ZBJC 3REIA 1AOIA 4H9QA 3R45B 4CSRB 3AZMA 3KXBC 4QLCA 1S32B 3TU4A 1KX3C 5CPJD 3UTBD 2NZDA 5GSUC 1P3MB 4J8WB 1TAFB 3LJAA 4R8PC 3B0BA 4Z66A 5B1LD 2CV5B 3KUYA 1BH8A 5JRGD 1N1JB 1EQZA 2F8NG 1P3KC 4H9PB 3B6FD 3WAAA 5E5AB 5AV5C 1P3FB 5AV8A 1WWSA 1BH9B 1U35D 4YM6B 3W98B 5GXQD 5B40A 5B2ID 3AZJC 2AROB 4ZBJB 3W99B 3B0DB 4J8XC 3WA9A 3W96A 5JA4A 3AZFC 3AZLB 1M19D 4Z5TD 3MGQD 3WTPD 5DNNC 4H9RB 1M1AD 3AZNC 5B31D 3MNNA 3REIC 1AOIC 5AVCA 3AZMC 1P3PB 4QLCC 3TU4C 5AV9B 3UT9A 5CPKD 2NZDC 3X1TA 5AV5B 4JJNC 4AWLC 4X23B 3AN2B 5B0YD 4Z66C 3MGSB 4KGCB 3KUYC 4CAYB 2IO5C 3LZ0D 1EQZC 5B33A 3WAAC 2BYMB 5AV8C 5DNNB 1P34A 5B40C 5CPID 4KHAA 1P3GA 5CP6A 2CWEA 3WA9C 4NE6A 3W96C 4KUDD 4J8UB 1TZYA 3R45A 4CSRA 1ID3D 5B1MB 4UUZB 4JJNB 1S32A 3B0CW 4HGAB 1P3LD 3MNNC 2PYOD 5AVCC 1P3MA 4J8WA 4Z66B 1TAFA 3AYWD 2HIOA 2NQBB 3AV1B 4Z2MH 2CV5A 2F8ND 5GT0C 4J8VD 1EQZB 3UT9C 4EO5B 3X1TC 4XUJA 1N1JA 3AFAA 4H9NA 4H9PA 5F99B 1P3FA 3AZGC 1BH9A 2RVQC 2AROA 3AZKB 3WA9B 3W96B 5B33C 3LJAD 3W99A 1HQ3B 3REJC 3KUYD 1P34C 3AZLA 3VH6T 1WWIA 5DNMD 1P3OD 4H9RA 4M6BA 1P3GC 5CP6C 3MGRA 3X1SA 1TZYC 4NFTA 3V9RA 1F66A 5GT0B 1P3PA 4G92C 1P3IB 3REHB 1S32C 5AV9A 3VH5T 1P3AB 3AZEB 1P3MC 3AZGB 4J8WC 3WKJB 4X23A 2HIOC 3AN2A 2CV5C 3MGSA 4KGCA 2FJ7B 4ZUXD 4CAYA 5B33B 4E44A 3LZ1D 4XUJC 4DRBA 3AFAC 4WNNB 3REJB 5B24D 2BYMA 4XZQD 4LD9B 5AY8A 3LELB 4KHAB 5CP6B 3RELA 3O62A 2LY8A 4NE3A 5B0ZB 3AV2A 1TZYB 3W99C 3B0DC 5AVBD 3MGPD 3AZHD 4J8UA 3AZLC 1ULYA 4G92B 5B1MA 4UUZA 4JJNA 3MGRC 1M18A 3UTBB 2YFVB 5CPJB 3X1SC 2HIOB 4Z2MG 1F66C 3VH6A 4H9OB 3REKD 3AV1A 3X1VD 1P3PC 3NQJA 5B1LB 2NQBA 1JFIB 4XUJB 3X1UA 4H9NB 3AFAB 5AV9C 5JRGB 1KX5D 5BO0B 3AZID 5BNVB 4X23C 5AV6D 5F99A 3KWQD 3B6FB 3AN2C 1ZLAD 3MGSC 4E45A 1U35B 4KGCC 5BT1D 5B2IB 4WU8D 3AZKA 1R4VA 1KX4D 1HQ3A 3B6GD 5G49B 5AY8C 1M19B 4Z5TB 3WTPB 4H9SA 5GT3A 5FUGA 5B32C 3O62C 3MGRB 3RELC 3X1SB 4YS3D 5B31B 3AV2C 5E5AD 3V9RB 1P3FD 1F66B 3UTAC 4J8UC 4YM6D 1P3BD 3W98D 5GT0A 2AROD 5B1MC 3A6NA 1P3IA 3REHA 1M18C 4HGAC 5CPKB 3KXBD 1P3AA 3AZEA 3AZGA 3WKJA 5B0YB 1KX3D 2NQBC 3AV1C 5GSUD 3X1UC 2FJ7A 5BNXB 2L5AA 4EO5C 4R8PD 3C1CC 4WNNA 5AY8B 3REJA 5F99C 1HTAA 3RELB 5B32B 3O62B 4LD9A 3LELA 1P3KD 3AV2B 5CPIB 5C3IC 5AV5D 3AZKC 3UTAB 5B2JA 5B0ZA 3AZJD 1HQ3C 4KUDB 1ID3B 4H9SC 5GT3C 3C1BC 1M18B 4J8XD 2F8NK 3AZFD 1P3LB 3UTBA 2YFVA 5CPJA 3W97C 2PYOB 5DNND 3AZND 3NQJB 3AYWB 3X1UB 4H9OA 4WU9C 1KU5A 3REID 3A6NC 5B1LA 2F8NB 1AOID 1JFIA 1P3IC 3C1CB 3REHC 3AZMD 5JRGA 3WTPE 1P3AC 3AZEC 5BO0A 3WKJC 5BNVA 3B6FA 4QLCD 3TU4D 2NZDD 5C3IB 4JJND 1U35A 5GXQA 2FJ7C 3B0CT 5B2IA 3MVDC 4Z66D 4LD9C 5GT3B 5FUGB 5G49A 3LELC 3C1BB 1EQZD 1M19A 4Z5TA 4DRAA 3WTPA 3WAAD 1P3OB 3W97B 5AV8D 5B2JC 5B0ZC 5B31A 5B40D 4WU9B 3A6NB 3WA9D 3W96D 3UTBC 5CPJC 5CPKA 2HUEB 5B0YA 3MNND 5B1LC 1A7WA 5AVCD 4ZUXB 3MVDB 3LZ1B 5BNXA 3LZ0A 5JRGC 5B24B 5GT0D 3B6FC 4XZQB 5B32A 3UT9D 3X1TD 1U35C 5GXQC 5B2JB 5B2IC 5CPIA 3UTAA 3AZGD 5AVBB 3MGPB 3AZHB 2RVQD 4KUDA 1M19C 4Z5TC 5B33D 1ID3A 3MGQC 3WTPC 1M1AC 3REJD 5B31C 1P34D 1P3LA 2BYKB 2PYOA 5BS7A 1P3GD 5CP6D 3AYWA 3X1VB 5B32G 2F8NA 4J8VA 1TZYD 3C1CA 5CPKC 1KX5B 3AZIB 5AV6B 3KWQB 4WV4B 5GXQB 5B0YC 1S32D 1ZLAB 1P3MD 4J8WD 4WU8B 3VH5A 2HIOD 3LZ0C 5CHLB 2YFWB 2CV5D 1KX4B 3MGQB 3B6GB 3C1BA 4XUJD 1M1AB 3AFAD 5DNMA 4G91C 5CPIC 1P3OA 3W97A 4YS3B 4KUDC 1P3BB 4WU9A 1ID3C 3W99D 4WZSB 3AZLD 1P3LC 3KXBB 2PYOC 3KSYA 5BS7C 3AYWC 1KX3B 3MGRD 5KDMB 4NE5A 3X1SD 5GSUB 3LZ0B 4J8VC 4ZUXA 3MVDA 1F66D 3LZ1A 4R8PB 1P3PD 5B24A 4G91B 4XZQA 5AV9D 1P3KB 4X23D 1F1EA 3AN2D 3MGSD 3LJAC 1H3OB 4KGCD 5AVBA 3MGPA 3AZHA 2JSSA 3AZJB 5DNMC 1P3OC 4J8XB 3NQUB 3AZFB 5AY8D 1B6WA 3RELD 2BYKA 5B32D 3O62D 1BFMA 3AZNB 4J8VB 3AV2D 3REKA 3X1VA 3REIB 3UTAD 1AOIB 4J8UD 4H9QB 3AZMB 5B1MD 1KX5A 3AZIA 2HUEC 1B67A 5AV6A 3KWQA 4QLCB 3TU4B 1M18D 1ZLAA 2NZDB 4AWLB 4ZUXC 4WU8A 3LJAB 3LZ1C 2NQBD 3AV1D 2YFWA 3KUYB 5B24C 1KX4A 3VH6W 1BH8B 3X1UD 5DNMB 4XZQC 2IO5B 3MGQA 3B6GA 1M1AA 3C1CD 3WAAB 5F99D 2F8NH 5AV8B 4YS3A 1Q9CA 5E5AA 5AVBC 5B40B 3MGPC 3AZHC 1P3BA 4YM6A 3AZKD 3W98A 5JA4B 1HQ3D 3VH5W 5GT3D 3KXBA 3C1BD
chains in the Genus database with same CATH superfamily
3EG5B 1KX3A 3REKC 5KDMA 3X1VC 3W97D 3MNNB 5GSUA 5AVCB 5B31G 1KX5C 4WU9D 4R8PA 3AZIC 3A6ND 5AV6C 3KWQC 1P3ID 3REHD 1ZLAC 3UT9B 3X1TB 1P3AD 3AZED 5BT1C 1P3KA 2RIQA 4WU8C 3H0RC 2VQRA 3WKJD 1Z2CB 5AV5A 1H3OA 1KX4C 2FJ7D 3AZJA 3B6GC 3MVDD 2ZY2A 4J8XA 4YS3C 3NQUA 4LD9D 3AZFA 1P34B 3LELD 5E5AC 1P3FC 5DNNA 2Y2MA 3REKB 1P3BC 4YM6C 3AZNA 3W98C 5B2JD 5B0ZD 1P3GB 2AROC 2F2AC 4ZBJC 2XD5A 3REIA 1AOIA 3R45B 4H9QA 4CSRB 3AZMA 3KXBC 4QLCA 1S32B 3TU4A 1KX3C 5CPJD 3UTBD 3H0LC 2NZDA 5GSUC 1P3MB 4J8WB 1TAFB 3LJAA 4R8PC 3B0BA 4Z66A 5B1LD 2CV5B 3KUYA 1BH8A 5JRGD 1N1JB 1EQZA 2F8NG 1P3KC 4H9PB 3B6FD 3WAAA 5E5AB 5AV5C 1P3FB 5AV8A 1WWSA 1BH9B 1U35D 4YM6B 3W98B 5GXQD 5B40A 5B2ID 3AZJC 2AROB 4ZBJB 3W99B 3B0DB 4J8XC 3WA9A 3W96A 5JA4A 3AZFC 3AZLB 1M19D 4Z5TD 3MGQD 3WTPD 2BG1A 5DNNC 4H9RB 1M1AD 3AZNC 5B31D 3MNNA 3REIC 1AOIC 5AVCA 3AZMC 1P3PB 4QLCC 3TU4C 5AV9B 3UT9A 5CPKD 2NZDC 3X1TA 5AV5B 4JJNC 4AWLC 1T3UA 4X23B 3EPJA 3AN2B 5B0YD 4Z66C 3MGSB 4KGCB 3KUYC 4CAYB 2IO5C 3LZ0D 2Y2KA 1EQZC 5B33A 3WAAC 2BYMB 5AV8C 5DNNB 1P34A 5B40C 5CPID 4KHAA 2Y2LA 1P3GA 5CP6A 2XD1A 2CWEA 3WA9C 4NE6A 3W96C 4KUDD 4J8UB 1TZYA 2Y2OA 3R45A 4CSRA 1ID3D 5B1MB 4UUZB 4JJNB 1S32A 3B0CW 4HGAB 1P3LD 3MNNC 2PYOD 5AVCC 1P3MA 4J8WA 4Z66B 1TAFA 3AYWD 2HIOA 2Y2PA 2NQBB 2J8PA 3AV1B 4Z2MH 2CV5A 2F8ND 5GT0C 4J8VD 1EQZB 3UT9C 2Y2JA 4EO5B 3X1TC 4XUJA 1N1JA 3AFAA 4H9NA 4H9PA 5F99B 1P3FA 3AZGC 1BH9A 3H0MC 2RVQC 2AROA 3AZKB 3WA9B 3W96B 5B33C 3LJAD 3W99A 1HQ3B 3F6TA 3KUYD 3REJC 1P34C 3AZLA 3VH6T 1WWIA 5DNMD 1P3OD 4H9RA 4M6BA 2ZY4A 1P3GC 5CP6C 3MGRA 3EPKA 3X1SA 1TZYC 4NFTA 3V9RA 1F66A 5GT0B 1P3PA 4G92C 1P3IB 3REHB 1S32C 5AV9A 3VH5T 1P3AB 3AZEB 1P3MC 3AZGB 4J8WC 3WKJB 4X23A 2HIOC 3AN2A 2CV5C 3MGSA 4KGCA 2FJ7B 4ZUXD 4CAYA 5B33B 4E44A 3LZ1D 4XUJC 4DRBA 3AFAC 4WNNB 3REJB 5B24D 2BYMA 4XZQD 4LD9B 5AY8A 3LELB 4KHAB 5CP6B 3RELA 3O62A 2LY8A 4NE3A 5B0ZB 3AV2A 1TZYB 3W99C 3B0DC 5AVBD 3MGPD 3AZHD 4WJ3C 4J8UA 3AZLC 1ULYA 4G92B 5B1MA 4UUZA 2ZY3A 4JJNA 3MGRC 1M18A 3UTBB 2YFVB 2Y2IA 3X1SC 5CPJB 2HIOB 4Z2MG 1F66C 3EPLA 2G5HC 4H9OB 3VH6A 4DQYB 3REKD 3AV1A 3NQJA 5B1LB 3X1VD 1P3PC 1JFIB 4XUJB 3X1UA 4H9NB 3AFAB 5AV9C 5JRGB 1KX5D 5BO0B 3AZID 5BNVB 4X23C 5AV6D 5F99A 3KWQD 3B6FB 3AN2C 1ZLAD 3MGSC 4E45A 1U35B 4KGCC 5BT1D 5B2IB 4WU8D 3AL0C 3AZKA 1R4VA 1KX4D 3P5JB 1HQ3A 3B6GD 5G49B 5AY8C 1M19B 4Z5TB 3WTPB 4H9SA 5GT3A 5FUGA 5B32C 3O62C 3MGRB 3RELC 3X1SB 4YS3D 5B31B 3AV2C 5E5AD 3V9RB 1P3FD 1F66B 3UTAC 4J8UC 4YM6D 1P3BD 3W98D 5GT0A 2AROD 5B1MC 3A6NA 2G5IC 1P3IA 3REHA 1M18C 4HGAC 5CPKB 3KXBD 2JE5A 1P3AA 3AZEA 3AZGA 3WKJA 5B0YB 1KX3D 2NQBC 3AV1C 3A1KA 5GSUD 2FFFB 3X1UC 2FJ7A 5BNXB 2L5AA 4EO5C 4R8PD 3C1CC 4WNNA 2ZM5A 5AY8B 3REJA 5F99C 1HTAA 3RELB 3A1IA 5B32B 3O62B 3LELA 4LD9A 1P3KD 3AV2B 5CPIB 5C3IC 5AV5D 3AZKC 3UTAB 5B2JA 5B0ZA 2Y2HA 3AZJD 1HQ3C 4KUDB 1ID3B 4H9SC 5GT3C 3C1BC 1M18B 4J8XD 2F8NK 3AZFD 1P3LB 3UTBA 2YFVA 5CPJA 3W97C 2PYOB 5DNND 3AZND 3NQJB 3AYWB 3X1UB 4H9OA 4WU9C 1KU5A 3REID 3A6NC 5B1LA 2F8NB 1AOID 1JFIA 1P3IC 3C1CB 3REHC 3AZMD 5JRGA 3WTPE 1P3AC 3AZEC 5BO0A 3WKJC 5BNVA 3B6FA 4QLCD 3TU4D 2NZDD 5C3IB 4JJND 1U35A 5GXQA 2FJ7C 3B0CT 5B2IA 3KFUG 2W8SA 2UWXA 3MVDC 4Z66D 4LD9C 5GT3B 5FUGB 5G49A 3LELC 3C1BB 1EQZD 1M19A 4Z5TA 4DRAA 3WTPA 3WAAD 1P3OB 3W97B 5AV8D 5B2JC 5B31A 5B0ZC 5B40D 2DQNC 4WU9B 3A6NB 3WA9D 3W96D 3UTBC 5CPJC 5CPKA 2HUEB 1W2EA 5B0YA 3MNND 5B1LC 1A7WA 5AVCD 4ZUXB 3MVDB 2Y2GA 3LZ1B 5BNXA 3LZ0A 5JRGC 5B24B 5GT0D 3B6FC 4XZQB 5B32A 3UT9D 3X1TD 1U35C 5GXQC 5B2JB 5B2IC 5CPIA 3UTAA 3AZGD 5AVBB 3MGPB 3AZHB 2RVQD 4KUDA 3IP4C 1M19C 4Z5TC 5B33D 1ID3A 3MGQC 3WTPC 1M1AC 3REJD 5B31C 1P34D 1P3LA 2BYKB 2JCHA 2PYOA 5BS7A 1P3GD 5CP6D 3AYWA 3X1VB 5B32G 2F8NA 4J8VA 1TZYD 3C1CA 5CPKC 1KX5B 3AZIB 5AV6B 3KWQB 2Y2NA 4WV4B 5GXQB 5B0YC 1S32D 1ZLAB 2ZY5A 1P3MD 4J8WD 4WU8B 3VH5A 2HIOD 3LZ0C 5CHLB 2YFWB 2CV5D 1KX4B 3MGQB 3B6GB 3C1BA 4XUJD 1M1AB 3AFAD 5DNMA 4G91C 5CPIC 1P3OA 3W97A 4YS3B 2Y2QA 4KUDC 1P3BB 4WU9A 2DF4C 1ID3C 3W99D 4WZSB 3AZLD 1P3LC 3KXBB 2PYOC 3KSYA 5BS7C 3AYWC 1KX3B 3MGRD 5KDMB 4NE5A 3X1SD 5GSUB 3LZ0B 4J8VC 4ZUXA 3MVDA 1F66D 3LZ1A 4R8PB 1P3PD 5B24A 4G91B 4XZQA 5AV9D 1P3KB 4X23D 1F1EA 3AN2D 3MGSD 3LJAC 1H3OB 4KGCD 5AVBA 3MGPA 3AZHA 2JSSA 3AZJB 4UPKA 5DNMC 1P3OC 4J8XB 3NQUB 3AZFB 5AY8D 1B6WA 3RELD 2BYKA 5B32D 3O62D 1BFMA 3AZNB 4J8VB 3AV2D 3REKA 3X1VA 3REIB 3UTAD 1AOIB 4J8UD 4H9QB 3AZMB 3FDDA 5B1MD 1KX5A 3AZIA 2HUEC 1B67A 5AV6A 3KWQA 1PZRA 4QLCB 3TU4B 1M18D 1ZLAA 2NZDB 4AWLB 4ZUXC 4WU8A 3EPHA 3LJAB 3LZ1C 2NQBD 3AV1D 2YFWA 2NQBA 3KUYB 5B24C 1KX4A 3VH6W 1BH8B 3X1UD 5DNMB 4XZQC 2IO5B 3MGQA 3B6GA 1M1AA 3C1CD 3WAAB 5F99D 2F8NH 5AV8B 4YS3A 1Q9CA 5E5AA 5AVBC 5B40B 3MGPC 3AZHC 1P3BA 4YM6A 3AZKD 3W98A 5JA4B 1HQ3D 3VH5W 5GT3D 3KXBA 3C1BD
chains in the Genus database with same CATH topology
3EG5B 1KX3A 3REKC 5KDMA 3X1VC 3W97D 3MNNB 5GSUA 5AVCB 5B31G 1KX5C 4WU9D 4R8PA 3AZIC 3A6ND 5AV6C 3KWQC 1P3ID 3REHD 1ZLAC 3UT9B 3X1TB 1P3AD 3AZED 5BT1C 1P3KA 2RIQA 4WU8C 3H0RC 2VQRA 3WKJD 1Z2CB 5AV5A 1H3OA 1KX4C 2FJ7D 3AZJA 3B6GC 3MVDD 2ZY2A 4J8XA 4YS3C 3NQUA 4LD9D 3AZFA 1P34B 3LELD 5E5AC 1P3FC 5DNNA 2Y2MA 3REKB 1P3BC 4YM6C 3AZNA 3W98C 5B2JD 5B0ZD 1P3GB 2AROC 2F2AC 4ZBJC 2XD5A 3REIA 1AOIA 3R45B 4H9QA 4CSRB 3AZMA 3KXBC 4QLCA 1S32B 3TU4A 1KX3C 5CPJD 3UTBD 3H0LC 2NZDA 5GSUC 1P3MB 4J8WB 1TAFB 3LJAA 4R8PC 3B0BA 4Z66A 5B1LD 2CV5B 3KUYA 1BH8A 5JRGD 1N1JB 1EQZA 2F8NG 1P3KC 4H9PB 3B6FD 3WAAA 5E5AB 5AV5C 1P3FB 5AV8A 1WWSA 1BH9B 1U35D 4YM6B 3W98B 5GXQD 5B40A 5B2ID 3AZJC 2AROB 4ZBJB 3W99B 3B0DB 4J8XC 3WA9A 3W96A 5JA4A 3AZFC 3AZLB 1M19D 4Z5TD 3MGQD 3WTPD 2BG1A 5DNNC 4H9RB 1M1AD 3AZNC 5B31D 3MNNA 3REIC 1AOIC 5AVCA 3AZMC 1P3PB 4QLCC 3TU4C 5AV9B 3UT9A 5CPKD 2NZDC 3X1TA 5AV5B 4JJNC 4AWLC 1T3UA 4X23B 3EPJA 3AN2B 5B0YD 4Z66C 3MGSB 4KGCB 3KUYC 4CAYB 2IO5C 3LZ0D 2Y2KA 1EQZC 5B33A 3WAAC 2BYMB 5AV8C 5DNNB 1P34A 5B40C 5CPID 4KHAA 2Y2LA 1P3GA 5CP6A 2XD1A 2CWEA 3WA9C 4NE6A 3W96C 4KUDD 4J8UB 1TZYA 2Y2OA 3R45A 4CSRA 1ID3D 5B1MB 4UUZB 4JJNB 1S32A 3B0CW 4HGAB 1P3LD 3MNNC 2PYOD 5AVCC 1P3MA 4J8WA 4Z66B 1TAFA 3AYWD 2HIOA 2Y2PA 2NQBB 2J8PA 3AV1B 4Z2MH 2CV5A 2F8ND 5GT0C 4J8VD 1EQZB 3UT9C 2Y2JA 4EO5B 3X1TC 4XUJA 1N1JA 3AFAA 4H9NA 4H9PA 5F99B 1P3FA 3AZGC 1BH9A 3H0MC 2RVQC 2AROA 3AZKB 3WA9B 3W96B 5B33C 3LJAD 3W99A 1HQ3B 3F6TA 3KUYD 3REJC 1P34C 3AZLA 3VH6T 1WWIA 5DNMD 1P3OD 4H9RA 4M6BA 2ZY4A 1P3GC 5CP6C 3MGRA 3EPKA 3X1SA 1TZYC 4NFTA 3V9RA 1F66A 5GT0B 1P3PA 4G92C 1P3IB 3REHB 1S32C 5AV9A 3VH5T 1P3AB 3AZEB 1P3MC 3AZGB 4J8WC 3WKJB 4X23A 2HIOC 3AN2A 2CV5C 3MGSA 4KGCA 2FJ7B 4ZUXD 4CAYA 5B33B 4E44A 3LZ1D 4XUJC 4DRBA 3AFAC 4WNNB 3REJB 5B24D 2BYMA 4XZQD 4LD9B 5AY8A 3LELB 4KHAB 5CP6B 3RELA 3O62A 2LY8A 4NE3A 5B0ZB 3AV2A 1TZYB 3W99C 3B0DC 5AVBD 3MGPD 3AZHD 4WJ3C 4J8UA 3AZLC 1ULYA 4G92B 5B1MA 4UUZA 2ZY3A 4JJNA 3MGRC 1M18A 3UTBB 2YFVB 2Y2IA 3X1SC 5CPJB 2HIOB 4Z2MG 1F66C 3EPLA 2G5HC 4H9OB 3VH6A 4DQYB 3REKD 3AV1A 3NQJA 5B1LB 3X1VD 1P3PC 1JFIB 4XUJB 3X1UA 4H9NB 3AFAB 5AV9C 5JRGB 1KX5D 5BO0B 3AZID 5BNVB 4X23C 5AV6D 5F99A 3KWQD 3B6FB 3AN2C 1ZLAD 3MGSC 4E45A 1U35B 4KGCC 5BT1D 5B2IB 4WU8D 3AL0C 3AZKA 1R4VA 1KX4D 3P5JB 1HQ3A 3B6GD 5G49B 5AY8C 1M19B 4Z5TB 3WTPB 4H9SA 5GT3A 5FUGA 5B32C 3O62C 3MGRB 3RELC 3X1SB 4YS3D 5B31B 3AV2C 5E5AD 3V9RB 1P3FD 1F66B 3UTAC 4J8UC 4YM6D 1P3BD 3W98D 5GT0A 2AROD 5B1MC 3A6NA 2G5IC 1P3IA 3REHA 1M18C 4HGAC 5CPKB 3KXBD 2JE5A 1P3AA 3AZEA 3AZGA 3WKJA 5B0YB 1KX3D 2NQBC 3AV1C 3A1KA 5GSUD 2FFFB 3X1UC 2FJ7A 5BNXB 2L5AA 4EO5C 4R8PD 3C1CC 4WNNA 2ZM5A 5AY8B 3REJA 5F99C 1HTAA 3RELB 3A1IA 5B32B 3O62B 3LELA 4LD9A 1P3KD 3AV2B 5CPIB 5C3IC 5AV5D 3AZKC 3UTAB 5B2JA 5B0ZA 2Y2HA 3AZJD 1HQ3C 4KUDB 1ID3B 4H9SC 5GT3C 3C1BC 1M18B 4J8XD 2F8NK 3AZFD 1P3LB 3UTBA 2YFVA 5CPJA 3W97C 2PYOB 5DNND 3AZND 3NQJB 3AYWB 3X1UB 4H9OA 4WU9C 1KU5A 3REID 3A6NC 5B1LA 2F8NB 1AOID 1JFIA 1P3IC 3C1CB 3REHC 3AZMD 5JRGA 3WTPE 1P3AC 3AZEC 5BO0A 3WKJC 5BNVA 3B6FA 4QLCD 3TU4D 2NZDD 5C3IB 4JJND 1U35A 5GXQA 2FJ7C 3B0CT 5B2IA 3KFUG 2W8SA 2UWXA 3MVDC 4Z66D 4LD9C 5GT3B 5FUGB 5G49A 3LELC 3C1BB 1EQZD 1M19A 4Z5TA 4DRAA 3WTPA 3WAAD 1P3OB 3W97B 5AV8D 5B2JC 5B31A 5B0ZC 5B40D 2DQNC 4WU9B 3A6NB 3WA9D 3W96D 3UTBC 5CPJC 5CPKA 2HUEB 1W2EA 5B0YA 3MNND 5B1LC 1A7WA 5AVCD 4ZUXB 3MVDB 2Y2GA 3LZ1B 5BNXA 3LZ0A 5JRGC 5B24B 5GT0D 3B6FC 4XZQB 5B32A 3UT9D 3X1TD 1U35C 5GXQC 5B2JB 5B2IC 5CPIA 3UTAA 3AZGD 5AVBB 3MGPB 3AZHB 2RVQD 4KUDA 3IP4C 1M19C 4Z5TC 5B33D 1ID3A 3MGQC 3WTPC 1M1AC 3REJD 5B31C 1P34D 1P3LA 2BYKB 2JCHA 2PYOA 5BS7A 1P3GD 5CP6D 3AYWA 3X1VB 5B32G 2F8NA 4J8VA 1TZYD 3C1CA 5CPKC 1KX5B 3AZIB 5AV6B 3KWQB 2Y2NA 4WV4B 5GXQB 5B0YC 1S32D 1ZLAB 2ZY5A 1P3MD 4J8WD 4WU8B 3VH5A 2HIOD 3LZ0C 5CHLB 2YFWB 2CV5D 1KX4B 3MGQB 3B6GB 3C1BA 4XUJD 1M1AB 3AFAD 5DNMA 4G91C 5CPIC 1P3OA 3W97A 4YS3B 2Y2QA 4KUDC 1P3BB 4WU9A 2DF4C 1ID3C 3W99D 4WZSB 3AZLD 1P3LC 3KXBB 2PYOC 3KSYA 5BS7C 3AYWC 1KX3B 3MGRD 5KDMB 4NE5A 3X1SD 5GSUB 3LZ0B 4J8VC 4ZUXA 3MVDA 1F66D 3LZ1A 4R8PB 1P3PD 5B24A 4G91B 4XZQA 5AV9D 1P3KB 4X23D 1F1EA 3AN2D 3MGSD 3LJAC 1H3OB 4KGCD 5AVBA 3MGPA 3AZHA 2JSSA 3AZJB 4UPKA 5DNMC 1P3OC 4J8XB 3NQUB 3AZFB 5AY8D 1B6WA 3RELD 2BYKA 5B32D 3O62D 1BFMA 3AZNB 4J8VB 3AV2D 3REKA 3X1VA 3REIB 3UTAD 1AOIB 4J8UD 4H9QB 3AZMB 3FDDA 5B1MD 1KX5A 3AZIA 2HUEC 1B67A 5AV6A 3KWQA 1PZRA 4QLCB 3TU4B 1M18D 1ZLAA 2NZDB 4AWLB 4ZUXC 4WU8A 3EPHA 3LJAB 3LZ1C 2NQBD 3AV1D 2YFWA 2NQBA 3KUYB 5B24C 1KX4A 3VH6W 1BH8B 3X1UD 5DNMB 4XZQC 2IO5B 3MGQA 3B6GA 1M1AA 3C1CD 3WAAB 5F99D 2F8NH 5AV8B 4YS3A 1Q9CA 5E5AA 5AVBC 5B40B 3MGPC 3AZHC 1P3BA 4YM6A 3AZKD 3W98A 5JA4B 1HQ3D 3VH5W 5GT3D 3KXBA 3C1BD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KX3 A;  3REK C;  5KDM A;  3X1V C;  3W97 D;  3MNN B;  5GSU A;  5AVC B;  5B31 G;  1KX5 C;  4WU9 D;  4R8P A;  3AZI C;  3A6N D;  5AV6 C;  3KWQ C;  1P3I D;  3REH D;  1ZLA C;  3UT9 B;  3X1T B;  1P3A D;  3AZE D;  5BT1 C;  1P3K A;  4WU8 C;  3WKJ D;  5AV5 A;  1H3O A;  1KX4 C;  2FJ7 D;  3AZJ A;  3B6G C;  3MVD D;  4J8X A;  4YS3 C;  3NQU A;  4LD9 D;  3AZF A;  1P34 B;  3LEL D;  5E5A C;  1P3F C;  5DNN A;  3REK B;  1P3B C;  4YM6 C;  3AZN A;  3W98 C;  5B2J D;  5B0Z D;  1P3G B;  2ARO C;  4ZBJ C;  3REI A;  1AOI A;  4H9Q A;  3R45 B;  4CSR B;  3AZM A;  3KXB C;  4QLC A;  1S32 B;  3TU4 A;  1KX3 C;  5CPJ D;  3UTB D;  2NZD A;  5GSU C;  1P3M B;  4J8W B;  1TAF B;  3LJA A;  4R8P C;  3B0B A;  4Z66 A;  5B1L D;  2CV5 B;  3KUY A;  1BH8 A;  5JRG D;  1N1J B;  1EQZ A;  2F8N G;  1P3K C;  4H9P B;  3B6F D;  3WAA A;  5E5A B;  5AV5 C;  1P3F B;  5AV8 A;  1WWS A;  1BH9 B;  1U35 D;  4YM6 B;  3W98 B;  5GXQ D;  5B40 A;  5B2I D;  3AZJ C;  2ARO B;  4ZBJ B;  3W99 B;  3B0D B;  4J8X C;  3WA9 A;  3W96 A;  5JA4 A;  3AZF C;  3AZL B;  1M19 D;  4Z5T D;  3MGQ D;  3WTP D;  5DNN C;  4H9R B;  1M1A D;  3AZN C;  5B31 D;  3MNN A;  3REI C;  1AOI C;  5AVC A;  3AZM C;  1P3P B;  4QLC C;  3TU4 C;  5AV9 B;  3UT9 A;  5CPK D;  2NZD C;  3X1T A;  5AV5 B;  4JJN C;  4AWL C;  4X23 B;  3AN2 B;  5B0Y D;  4Z66 C;  3MGS B;  4KGC B;  3KUY C;  4CAY B;  2IO5 C;  3LZ0 D;  1EQZ C;  5B33 A;  3WAA C;  2BYM B;  5AV8 C;  5DNN B;  1P34 A;  5B40 C;  5CPI D;  4KHA A;  1P3G A;  5CP6 A;  2CWE A;  3WA9 C;  4NE6 A;  3W96 C;  4KUD D;  4J8U B;  1TZY A;  3R45 A;  4CSR A;  1ID3 D;  5B1M B;  4UUZ B;  4JJN B;  1S32 A;  3B0C W;  4HGA B;  1P3L D;  3MNN C;  2PYO D;  5AVC C;  1P3M A;  4J8W A;  4Z66 B;  1TAF A;  3AYW D;  2HIO A;  2NQB B;  3AV1 B;  4Z2M H;  2CV5 A;  2F8N D;  5GT0 C;  4J8V D;  1EQZ B;  3UT9 C;  4EO5 B;  3X1T C;  4XUJ A;  1N1J A;  3AFA A;  4H9N A;  4H9P A;  5F99 B;  1P3F A;  3AZG C;  1BH9 A;  2RVQ C;  2ARO A;  3AZK B;  3WA9 B;  3W96 B;  5B33 C;  3LJA D;  3W99 A;  1HQ3 B;  3REJ C;  3KUY D;  1P34 C;  3AZL A;  3VH6 T;  1WWI A;  5DNM D;  1P3O D;  4H9R A;  4M6B A;  1P3G C;  5CP6 C;  3MGR A;  3X1S A;  1TZY C;  4NFT A;  3V9R A;  1F66 A;  5GT0 B;  1P3P A;  4G92 C;  1P3I B;  3REH B;  1S32 C;  5AV9 A;  3VH5 T;  1P3A B;  3AZE B;  1P3M C;  3AZG B;  4J8W C;  3WKJ B;  4X23 A;  2HIO C;  3AN2 A;  2CV5 C;  3MGS A;  4KGC A;  2FJ7 B;  4ZUX D;  4CAY A;  5B33 B;  4E44 A;  3LZ1 D;  4XUJ C;  4DRB A;  3AFA C;  4WNN B;  3REJ B;  5B24 D;  2BYM A;  4XZQ D;  4LD9 B;  5AY8 A;  3LEL B;  4KHA B;  5CP6 B;  3REL A;  3O62 A;  2LY8 A;  4NE3 A;  5B0Z B;  3AV2 A;  1TZY B;  3W99 C;  3B0D C;  5AVB D;  3MGP D;  3AZH D;  4J8U A;  3AZL C;  1ULY A;  4G92 B;  5B1M A;  4UUZ A;  4JJN A;  3MGR C;  1M18 A;  3UTB B;  2YFV B;  5CPJ B;  3X1S C;  2HIO B;  4Z2M G;  1F66 C;  3VH6 A;  4H9O B;  3REK D;  3AV1 A;  3X1V D;  1P3P C;  3NQJ A;  5B1L B;  2NQB A;  1JFI B;  4XUJ B;  3X1U A;  4H9N B;  3AFA B;  5AV9 C;  5JRG B;  1KX5 D;  5BO0 B;  3AZI D;  5BNV B;  4X23 C;  5AV6 D;  5F99 A;  3KWQ D;  3B6F B;  3AN2 C;  1ZLA D;  3MGS C;  4E45 A;  1U35 B;  4KGC C;  5BT1 D;  5B2I B;  4WU8 D;  3AZK A;  1R4V A;  1KX4 D;  1HQ3 A;  3B6G D;  5G49 B;  5AY8 C;  1M19 B;  4Z5T B;  3WTP B;  4H9S A;  5GT3 A;  5FUG A;  5B32 C;  3O62 C;  3MGR B;  3REL C;  3X1S B;  4YS3 D;  5B31 B;  3AV2 C;  5E5A D;  3V9R B;  1P3F D;  1F66 B;  3UTA C;  4J8U C;  4YM6 D;  1P3B D;  3W98 D;  5GT0 A;  2ARO D;  5B1M C;  3A6N A;  1P3I A;  3REH A;  1M18 C;  4HGA C;  5CPK B;  3KXB D;  1P3A A;  3AZE A;  3AZG A;  3WKJ A;  5B0Y B;  1KX3 D;  2NQB C;  3AV1 C;  5GSU D;  3X1U C;  2FJ7 A;  5BNX B;  2L5A A;  4EO5 C;  4R8P D;  3C1C C;  4WNN A;  5AY8 B;  3REJ A;  5F99 C;  1HTA A;  3REL B;  5B32 B;  3O62 B;  4LD9 A;  3LEL A;  1P3K D;  3AV2 B;  5CPI B;  5C3I C;  5AV5 D;  3AZK C;  3UTA B;  5B2J A;  5B0Z A;  3AZJ D;  1HQ3 C;  4KUD B;  1ID3 B;  4H9S C;  5GT3 C;  3C1B C;  1M18 B;  4J8X D;  2F8N K;  3AZF D;  1P3L B;  3UTB A;  2YFV A;  5CPJ A;  3W97 C;  2PYO B;  5DNN D;  3AZN D;  3NQJ B;  3AYW B;  3X1U B;  4H9O A;  4WU9 C;  1KU5 A;  3REI D;  3A6N C;  5B1L A;  2F8N B;  1AOI D;  1JFI A;  1P3I C;  3C1C B;  3REH C;  3AZM D;  5JRG A;  3WTP E;  1P3A C;  3AZE C;  5BO0 A;  3WKJ C;  5BNV A;  3B6F A;  4QLC D;  3TU4 D;  2NZD D;  5C3I B;  4JJN D;  1U35 A;  5GXQ A;  2FJ7 C;  3B0C T;  5B2I A;  3MVD C;  4Z66 D;  4LD9 C;  5GT3 B;  5FUG B;  5G49 A;  3LEL C;  3C1B B;  1EQZ D;  1M19 A;  4Z5T A;  4DRA A;  3WTP A;  3WAA D;  1P3O B;  3W97 B;  5AV8 D;  5B2J C;  5B0Z C;  5B31 A;  5B40 D;  4WU9 B;  3A6N B;  3WA9 D;  3W96 D;  3UTB C;  5CPJ C;  5CPK A;  2HUE B;  5B0Y A;  3MNN D;  5B1L C;  1A7W A;  5AVC D;  4ZUX B;  3MVD B;  3LZ1 B;  5BNX A;  3LZ0 A;  5JRG C;  5B24 B;  5GT0 D;  3B6F C;  4XZQ B;  5B32 A;  3UT9 D;  3X1T D;  1U35 C;  5GXQ C;  5B2J B;  5B2I C;  5CPI A;  3UTA A;  3AZG D;  5AVB B;  3MGP B;  3AZH B;  2RVQ D;  4KUD A;  1M19 C;  4Z5T C;  5B33 D;  1ID3 A;  3MGQ C;  3WTP C;  1M1A C;  3REJ D;  5B31 C;  1P34 D;  1P3L A;  2BYK B;  2PYO A;  5BS7 A;  1P3G D;  5CP6 D;  3AYW A;  3X1V B;  5B32 G;  2F8N A;  4J8V A;  1TZY D;  3C1C A;  5CPK C;  1KX5 B;  3AZI B;  5AV6 B;  3KWQ B;  4WV4 B;  5GXQ B;  5B0Y C;  1S32 D;  1ZLA B;  1P3M D;  4J8W D;  4WU8 B;  3VH5 A;  2HIO D;  3LZ0 C;  5CHL B;  2YFW B;  2CV5 D;  1KX4 B;  3MGQ B;  3B6G B;  3C1B A;  4XUJ D;  1M1A B;  3AFA D;  5DNM A;  4G91 C;  5CPI C;  1P3O A;  3W97 A;  4YS3 B;  4KUD C;  1P3B B;  4WU9 A;  1ID3 C;  3W99 D;  4WZS B;  3AZL D;  1P3L C;  3KXB B;  2PYO C;  3KSY A;  5BS7 C;  3AYW C;  1KX3 B;  3MGR D;  5KDM B;  4NE5 A;  3X1S D;  5GSU B;  3LZ0 B;  4J8V C;  4ZUX A;  3MVD A;  1F66 D;  3LZ1 A;  4R8P B;  1P3P D;  5B24 A;  4G91 B;  4XZQ A;  5AV9 D;  1P3K B;  4X23 D;  1F1E A;  3AN2 D;  3MGS D;  3LJA C;  1H3O B;  4KGC D;  5AVB A;  3MGP A;  3AZH A;  2JSS A;  3AZJ B;  5DNM C;  1P3O C;  4J8X B;  3NQU B;  3AZF B;  5AY8 D;  1B6W A;  3REL D;  2BYK A;  5B32 D;  3O62 D;  1BFM A;  3AZN B;  4J8V B;  3AV2 D;  3REK A;  3X1V A;  3REI B;  3UTA D;  1AOI B;  4J8U D;  4H9Q B;  3AZM B;  5B1M D;  1KX5 A;  3AZI A;  2HUE C;  1B67 A;  5AV6 A;  3KWQ A;  4QLC B;  3TU4 B;  1M18 D;  1ZLA A;  2NZD B;  4AWL B;  4ZUX C;  4WU8 A;  3LJA B;  3LZ1 C;  2NQB D;  3AV1 D;  2YFW A;  3KUY B;  5B24 C;  1KX4 A;  3VH6 W;  1BH8 B;  3X1U D;  5DNM B;  4XZQ C;  2IO5 B;  3MGQ A;  3B6G A;  1M1A A;  3C1C D;  3WAA B;  5F99 D;  2F8N H;  5AV8 B;  4YS3 A;  1Q9C A;  5E5A A;  5AVB C;  5B40 B;  3MGP C;  3AZH C;  1P3B A;  4YM6 A;  3AZK D;  3W98 A;  5JA4 B;  1HQ3 D;  3VH5 W;  5GT3 D;  3KXB A;  3C1B D; 
#chains in the Genus database with same CATH topology
 3EG5 B;  1KX3 A;  3REK C;  5KDM A;  3X1V C;  3W97 D;  3MNN B;  5GSU A;  5AVC B;  5B31 G;  1KX5 C;  4WU9 D;  4R8P A;  3AZI C;  3A6N D;  5AV6 C;  3KWQ C;  1P3I D;  3REH D;  1ZLA C;  3UT9 B;  3X1T B;  1P3A D;  3AZE D;  5BT1 C;  1P3K A;  2RIQ A;  4WU8 C;  3H0R C;  2VQR A;  3WKJ D;  1Z2C B;  5AV5 A;  1H3O A;  1KX4 C;  2FJ7 D;  3AZJ A;  3B6G C;  3MVD D;  2ZY2 A;  4J8X A;  4YS3 C;  3NQU A;  4LD9 D;  3AZF A;  1P34 B;  3LEL D;  5E5A C;  1P3F C;  5DNN A;  2Y2M A;  3REK B;  1P3B C;  4YM6 C;  3AZN A;  3W98 C;  5B2J D;  5B0Z D;  1P3G B;  2ARO C;  2F2A C;  4ZBJ C;  2XD5 A;  3REI A;  1AOI A;  3R45 B;  4H9Q A;  4CSR B;  3AZM A;  3KXB C;  4QLC A;  1S32 B;  3TU4 A;  1KX3 C;  5CPJ D;  3UTB D;  3H0L C;  2NZD A;  5GSU C;  1P3M B;  4J8W B;  1TAF B;  3LJA A;  4R8P C;  3B0B A;  4Z66 A;  5B1L D;  2CV5 B;  3KUY A;  1BH8 A;  5JRG D;  1N1J B;  1EQZ A;  2F8N G;  1P3K C;  4H9P B;  3B6F D;  3WAA A;  5E5A B;  5AV5 C;  1P3F B;  5AV8 A;  1WWS A;  1BH9 B;  1U35 D;  4YM6 B;  3W98 B;  5GXQ D;  5B40 A;  5B2I D;  3AZJ C;  2ARO B;  4ZBJ B;  3W99 B;  3B0D B;  4J8X C;  3WA9 A;  3W96 A;  5JA4 A;  3AZF C;  3AZL B;  1M19 D;  4Z5T D;  3MGQ D;  3WTP D;  2BG1 A;  5DNN C;  4H9R B;  1M1A D;  3AZN C;  5B31 D;  3MNN A;  3REI C;  1AOI C;  5AVC A;  3AZM C;  1P3P B;  4QLC C;  3TU4 C;  5AV9 B;  3UT9 A;  5CPK D;  2NZD C;  3X1T A;  5AV5 B;  4JJN C;  4AWL C;  1T3U A;  4X23 B;  3EPJ A;  3AN2 B;  5B0Y D;  4Z66 C;  3MGS B;  4KGC B;  3KUY C;  4CAY B;  2IO5 C;  3LZ0 D;  2Y2K A;  1EQZ C;  5B33 A;  3WAA C;  2BYM B;  5AV8 C;  5DNN B;  1P34 A;  5B40 C;  5CPI D;  4KHA A;  2Y2L A;  1P3G A;  5CP6 A;  2XD1 A;  2CWE A;  3WA9 C;  4NE6 A;  3W96 C;  4KUD D;  4J8U B;  1TZY A;  2Y2O A;  3R45 A;  4CSR A;  1ID3 D;  5B1M B;  4UUZ B;  4JJN B;  1S32 A;  3B0C W;  4HGA B;  1P3L D;  3MNN C;  2PYO D;  5AVC C;  1P3M A;  4J8W A;  4Z66 B;  1TAF A;  3AYW D;  2HIO A;  2Y2P A;  2NQB B;  2J8P A;  3AV1 B;  4Z2M H;  2CV5 A;  2F8N D;  5GT0 C;  4J8V D;  1EQZ B;  3UT9 C;  2Y2J A;  4EO5 B;  3X1T C;  4XUJ A;  1N1J A;  3AFA A;  4H9N A;  4H9P A;  5F99 B;  1P3F A;  3AZG C;  1BH9 A;  3H0M C;  2RVQ C;  2ARO A;  3AZK B;  3WA9 B;  3W96 B;  5B33 C;  3LJA D;  3W99 A;  1HQ3 B;  3F6T A;  3KUY D;  3REJ C;  1P34 C;  3AZL A;  3VH6 T;  1WWI A;  5DNM D;  1P3O D;  4H9R A;  4M6B A;  2ZY4 A;  1P3G C;  5CP6 C;  3MGR A;  3EPK A;  3X1S A;  1TZY C;  4NFT A;  3V9R A;  1F66 A;  5GT0 B;  1P3P A;  4G92 C;  1P3I B;  3REH B;  1S32 C;  5AV9 A;  3VH5 T;  1P3A B;  3AZE B;  1P3M C;  3AZG B;  4J8W C;  3WKJ B;  4X23 A;  2HIO C;  3AN2 A;  2CV5 C;  3MGS A;  4KGC A;  2FJ7 B;  4ZUX D;  4CAY A;  5B33 B;  4E44 A;  3LZ1 D;  4XUJ C;  4DRB A;  3AFA C;  4WNN B;  3REJ B;  5B24 D;  2BYM A;  4XZQ D;  4LD9 B;  5AY8 A;  3LEL B;  4KHA B;  5CP6 B;  3REL A;  3O62 A;  2LY8 A;  4NE3 A;  5B0Z B;  3AV2 A;  1TZY B;  3W99 C;  3B0D C;  5AVB D;  3MGP D;  3AZH D;  4WJ3 C;  4J8U A;  3AZL C;  1ULY A;  4G92 B;  5B1M A;  4UUZ A;  2ZY3 A;  4JJN A;  3MGR C;  1M18 A;  3UTB B;  2YFV B;  2Y2I A;  3X1S C;  5CPJ B;  2HIO B;  4Z2M G;  1F66 C;  3EPL A;  2G5H C;  4H9O B;  3VH6 A;  4DQY B;  3REK D;  3AV1 A;  3NQJ A;  5B1L B;  3X1V D;  1P3P C;  1JFI B;  4XUJ B;  3X1U A;  4H9N B;  3AFA B;  5AV9 C;  5JRG B;  1KX5 D;  5BO0 B;  3AZI D;  5BNV B;  4X23 C;  5AV6 D;  5F99 A;  3KWQ D;  3B6F B;  3AN2 C;  1ZLA D;  3MGS C;  4E45 A;  1U35 B;  4KGC C;  5BT1 D;  5B2I B;  4WU8 D;  3AL0 C;  3AZK A;  1R4V A;  1KX4 D;  3P5J B;  1HQ3 A;  3B6G D;  5G49 B;  5AY8 C;  1M19 B;  4Z5T B;  3WTP B;  4H9S A;  5GT3 A;  5FUG A;  5B32 C;  3O62 C;  3MGR B;  3REL C;  3X1S B;  4YS3 D;  5B31 B;  3AV2 C;  5E5A D;  3V9R B;  1P3F D;  1F66 B;  3UTA C;  4J8U C;  4YM6 D;  1P3B D;  3W98 D;  5GT0 A;  2ARO D;  5B1M C;  3A6N A;  2G5I C;  1P3I A;  3REH A;  1M18 C;  4HGA C;  5CPK B;  3KXB D;  2JE5 A;  1P3A A;  3AZE A;  3AZG A;  3WKJ A;  5B0Y B;  1KX3 D;  2NQB C;  3AV1 C;  3A1K A;  5GSU D;  2FFF B;  3X1U C;  2FJ7 A;  5BNX B;  2L5A A;  4EO5 C;  4R8P D;  3C1C C;  4WNN A;  2ZM5 A;  5AY8 B;  3REJ A;  5F99 C;  1HTA A;  3REL B;  3A1I A;  5B32 B;  3O62 B;  3LEL A;  4LD9 A;  1P3K D;  3AV2 B;  5CPI B;  5C3I C;  5AV5 D;  3AZK C;  3UTA B;  5B2J A;  5B0Z A;  2Y2H A;  3AZJ D;  1HQ3 C;  4KUD B;  1ID3 B;  4H9S C;  5GT3 C;  3C1B C;  1M18 B;  4J8X D;  2F8N K;  3AZF D;  1P3L B;  3UTB A;  2YFV A;  5CPJ A;  3W97 C;  2PYO B;  5DNN D;  3AZN D;  3NQJ B;  3AYW B;  3X1U B;  4H9O A;  4WU9 C;  1KU5 A;  3REI D;  3A6N C;  5B1L A;  2F8N B;  1AOI D;  1JFI A;  1P3I C;  3C1C B;  3REH C;  3AZM D;  5JRG A;  3WTP E;  1P3A C;  3AZE C;  5BO0 A;  3WKJ C;  5BNV A;  3B6F A;  4QLC D;  3TU4 D;  2NZD D;  5C3I B;  4JJN D;  1U35 A;  5GXQ A;  2FJ7 C;  3B0C T;  5B2I A;  3KFU G;  2W8S A;  2UWX A;  3MVD C;  4Z66 D;  4LD9 C;  5GT3 B;  5FUG B;  5G49 A;  3LEL C;  3C1B B;  1EQZ D;  1M19 A;  4Z5T A;  4DRA A;  3WTP A;  3WAA D;  1P3O B;  3W97 B;  5AV8 D;  5B2J C;  5B31 A;  5B0Z C;  5B40 D;  2DQN C;  4WU9 B;  3A6N B;  3WA9 D;  3W96 D;  3UTB C;  5CPJ C;  5CPK A;  2HUE B;  1W2E A;  5B0Y A;  3MNN D;  5B1L C;  1A7W A;  5AVC D;  4ZUX B;  3MVD B;  2Y2G A;  3LZ1 B;  5BNX A;  3LZ0 A;  5JRG C;  5B24 B;  5GT0 D;  3B6F C;  4XZQ B;  5B32 A;  3UT9 D;  3X1T D;  1U35 C;  5GXQ C;  5B2J B;  5B2I C;  5CPI A;  3UTA A;  3AZG D;  5AVB B;  3MGP B;  3AZH B;  2RVQ D;  4KUD A;  3IP4 C;  1M19 C;  4Z5T C;  5B33 D;  1ID3 A;  3MGQ C;  3WTP C;  1M1A C;  3REJ D;  5B31 C;  1P34 D;  1P3L A;  2BYK B;  2JCH A;  2PYO A;  5BS7 A;  1P3G D;  5CP6 D;  3AYW A;  3X1V B;  5B32 G;  2F8N A;  4J8V A;  1TZY D;  3C1C A;  5CPK C;  1KX5 B;  3AZI B;  5AV6 B;  3KWQ B;  2Y2N A;  4WV4 B;  5GXQ B;  5B0Y C;  1S32 D;  1ZLA B;  2ZY5 A;  1P3M D;  4J8W D;  4WU8 B;  3VH5 A;  2HIO D;  3LZ0 C;  5CHL B;  2YFW B;  2CV5 D;  1KX4 B;  3MGQ B;  3B6G B;  3C1B A;  4XUJ D;  1M1A B;  3AFA D;  5DNM A;  4G91 C;  5CPI C;  1P3O A;  3W97 A;  4YS3 B;  2Y2Q A;  4KUD C;  1P3B B;  4WU9 A;  2DF4 C;  1ID3 C;  3W99 D;  4WZS B;  3AZL D;  1P3L C;  3KXB B;  2PYO C;  3KSY A;  5BS7 C;  3AYW C;  1KX3 B;  3MGR D;  5KDM B;  4NE5 A;  3X1S D;  5GSU B;  3LZ0 B;  4J8V C;  4ZUX A;  3MVD A;  1F66 D;  3LZ1 A;  4R8P B;  1P3P D;  5B24 A;  4G91 B;  4XZQ A;  5AV9 D;  1P3K B;  4X23 D;  1F1E A;  3AN2 D;  3MGS D;  3LJA C;  1H3O B;  4KGC D;  5AVB A;  3MGP A;  3AZH A;  2JSS A;  3AZJ B;  4UPK A;  5DNM C;  1P3O C;  4J8X B;  3NQU B;  3AZF B;  5AY8 D;  1B6W A;  3REL D;  2BYK A;  5B32 D;  3O62 D;  1BFM A;  3AZN B;  4J8V B;  3AV2 D;  3REK A;  3X1V A;  3REI B;  3UTA D;  1AOI B;  4J8U D;  4H9Q B;  3AZM B;  3FDD A;  5B1M D;  1KX5 A;  3AZI A;  2HUE C;  1B67 A;  5AV6 A;  3KWQ A;  1PZR A;  4QLC B;  3TU4 B;  1M18 D;  1ZLA A;  2NZD B;  4AWL B;  4ZUX C;  4WU8 A;  3EPH A;  3LJA B;  3LZ1 C;  2NQB D;  3AV1 D;  2YFW A;  2NQB A;  3KUY B;  5B24 C;  1KX4 A;  3VH6 W;  1BH8 B;  3X1U D;  5DNM B;  4XZQ C;  2IO5 B;  3MGQ A;  3B6G A;  1M1A A;  3C1C D;  3WAA B;  5F99 D;  2F8N H;  5AV8 B;  4YS3 A;  1Q9C A;  5E5A A;  5AVB C;  5B40 B;  3MGP C;  3AZH C;  1P3B A;  4YM6 A;  3AZK D;  3W98 A;  5JA4 B;  1HQ3 D;  3VH5 W;  5GT3 D;  3KXB A;  3C1B D; 
#chains in the Genus database with same CATH homology
 3EG5 B;  1KX3 A;  3REK C;  5KDM A;  3X1V C;  3W97 D;  3MNN B;  5GSU A;  5AVC B;  5B31 G;  1KX5 C;  4WU9 D;  4R8P A;  3AZI C;  3A6N D;  5AV6 C;  3KWQ C;  1P3I D;  3REH D;  1ZLA C;  3UT9 B;  3X1T B;  1P3A D;  3AZE D;  5BT1 C;  1P3K A;  2RIQ A;  4WU8 C;  3H0R C;  2VQR A;  3WKJ D;  1Z2C B;  5AV5 A;  1H3O A;  1KX4 C;  2FJ7 D;  3AZJ A;  3B6G C;  3MVD D;  2ZY2 A;  4J8X A;  4YS3 C;  3NQU A;  4LD9 D;  3AZF A;  1P34 B;  3LEL D;  5E5A C;  1P3F C;  5DNN A;  2Y2M A;  3REK B;  1P3B C;  4YM6 C;  3AZN A;  3W98 C;  5B2J D;  5B0Z D;  1P3G B;  2ARO C;  2F2A C;  4ZBJ C;  2XD5 A;  3REI A;  1AOI A;  3R45 B;  4H9Q A;  4CSR B;  3AZM A;  3KXB C;  4QLC A;  1S32 B;  3TU4 A;  1KX3 C;  5CPJ D;  3UTB D;  3H0L C;  2NZD A;  5GSU C;  1P3M B;  4J8W B;  1TAF B;  3LJA A;  4R8P C;  3B0B A;  4Z66 A;  5B1L D;  2CV5 B;  3KUY A;  1BH8 A;  5JRG D;  1N1J B;  1EQZ A;  2F8N G;  1P3K C;  4H9P B;  3B6F D;  3WAA A;  5E5A B;  5AV5 C;  1P3F B;  5AV8 A;  1WWS A;  1BH9 B;  1U35 D;  4YM6 B;  3W98 B;  5GXQ D;  5B40 A;  5B2I D;  3AZJ C;  2ARO B;  4ZBJ B;  3W99 B;  3B0D B;  4J8X C;  3WA9 A;  3W96 A;  5JA4 A;  3AZF C;  3AZL B;  1M19 D;  4Z5T D;  3MGQ D;  3WTP D;  2BG1 A;  5DNN C;  4H9R B;  1M1A D;  3AZN C;  5B31 D;  3MNN A;  3REI C;  1AOI C;  5AVC A;  3AZM C;  1P3P B;  4QLC C;  3TU4 C;  5AV9 B;  3UT9 A;  5CPK D;  2NZD C;  3X1T A;  5AV5 B;  4JJN C;  4AWL C;  1T3U A;  4X23 B;  3EPJ A;  3AN2 B;  5B0Y D;  4Z66 C;  3MGS B;  4KGC B;  3KUY C;  4CAY B;  2IO5 C;  3LZ0 D;  2Y2K A;  1EQZ C;  5B33 A;  3WAA C;  2BYM B;  5AV8 C;  5DNN B;  1P34 A;  5B40 C;  5CPI D;  4KHA A;  2Y2L A;  1P3G A;  5CP6 A;  2XD1 A;  2CWE A;  3WA9 C;  4NE6 A;  3W96 C;  4KUD D;  4J8U B;  1TZY A;  2Y2O A;  3R45 A;  4CSR A;  1ID3 D;  5B1M B;  4UUZ B;  4JJN B;  1S32 A;  3B0C W;  4HGA B;  1P3L D;  3MNN C;  2PYO D;  5AVC C;  1P3M A;  4J8W A;  4Z66 B;  1TAF A;  3AYW D;  2HIO A;  2Y2P A;  2NQB B;  2J8P A;  3AV1 B;  4Z2M H;  2CV5 A;  2F8N D;  5GT0 C;  4J8V D;  1EQZ B;  3UT9 C;  2Y2J A;  4EO5 B;  3X1T C;  4XUJ A;  1N1J A;  3AFA A;  4H9N A;  4H9P A;  5F99 B;  1P3F A;  3AZG C;  1BH9 A;  3H0M C;  2RVQ C;  2ARO A;  3AZK B;  3WA9 B;  3W96 B;  5B33 C;  3LJA D;  3W99 A;  1HQ3 B;  3F6T A;  3KUY D;  3REJ C;  1P34 C;  3AZL A;  3VH6 T;  1WWI A;  5DNM D;  1P3O D;  4H9R A;  4M6B A;  2ZY4 A;  1P3G C;  5CP6 C;  3MGR A;  3EPK A;  3X1S A;  1TZY C;  4NFT A;  3V9R A;  1F66 A;  5GT0 B;  1P3P A;  4G92 C;  1P3I B;  3REH B;  1S32 C;  5AV9 A;  3VH5 T;  1P3A B;  3AZE B;  1P3M C;  3AZG B;  4J8W C;  3WKJ B;  4X23 A;  2HIO C;  3AN2 A;  2CV5 C;  3MGS A;  4KGC A;  2FJ7 B;  4ZUX D;  4CAY A;  5B33 B;  4E44 A;  3LZ1 D;  4XUJ C;  4DRB A;  3AFA C;  4WNN B;  3REJ B;  5B24 D;  2BYM A;  4XZQ D;  4LD9 B;  5AY8 A;  3LEL B;  4KHA B;  5CP6 B;  3REL A;  3O62 A;  2LY8 A;  4NE3 A;  5B0Z B;  3AV2 A;  1TZY B;  3W99 C;  3B0D C;  5AVB D;  3MGP D;  3AZH D;  4WJ3 C;  4J8U A;  3AZL C;  1ULY A;  4G92 B;  5B1M A;  4UUZ A;  2ZY3 A;  4JJN A;  3MGR C;  1M18 A;  3UTB B;  2YFV B;  2Y2I A;  3X1S C;  5CPJ B;  2HIO B;  4Z2M G;  1F66 C;  3EPL A;  2G5H C;  4H9O B;  3VH6 A;  4DQY B;  3REK D;  3AV1 A;  3NQJ A;  5B1L B;  3X1V D;  1P3P C;  1JFI B;  4XUJ B;  3X1U A;  4H9N B;  3AFA B;  5AV9 C;  5JRG B;  1KX5 D;  5BO0 B;  3AZI D;  5BNV B;  4X23 C;  5AV6 D;  5F99 A;  3KWQ D;  3B6F B;  3AN2 C;  1ZLA D;  3MGS C;  4E45 A;  1U35 B;  4KGC C;  5BT1 D;  5B2I B;  4WU8 D;  3AL0 C;  3AZK A;  1R4V A;  1KX4 D;  3P5J B;  1HQ3 A;  3B6G D;  5G49 B;  5AY8 C;  1M19 B;  4Z5T B;  3WTP B;  4H9S A;  5GT3 A;  5FUG A;  5B32 C;  3O62 C;  3MGR B;  3REL C;  3X1S B;  4YS3 D;  5B31 B;  3AV2 C;  5E5A D;  3V9R B;  1P3F D;  1F66 B;  3UTA C;  4J8U C;  4YM6 D;  1P3B D;  3W98 D;  5GT0 A;  2ARO D;  5B1M C;  3A6N A;  2G5I C;  1P3I A;  3REH A;  1M18 C;  4HGA C;  5CPK B;  3KXB D;  2JE5 A;  1P3A A;  3AZE A;  3AZG A;  3WKJ A;  5B0Y B;  1KX3 D;  2NQB C;  3AV1 C;  3A1K A;  5GSU D;  2FFF B;  3X1U C;  2FJ7 A;  5BNX B;  2L5A A;  4EO5 C;  4R8P D;  3C1C C;  4WNN A;  2ZM5 A;  5AY8 B;  3REJ A;  5F99 C;  1HTA A;  3REL B;  3A1I A;  5B32 B;  3O62 B;  3LEL A;  4LD9 A;  1P3K D;  3AV2 B;  5CPI B;  5C3I C;  5AV5 D;  3AZK C;  3UTA B;  5B2J A;  5B0Z A;  2Y2H A;  3AZJ D;  1HQ3 C;  4KUD B;  1ID3 B;  4H9S C;  5GT3 C;  3C1B C;  1M18 B;  4J8X D;  2F8N K;  3AZF D;  1P3L B;  3UTB A;  2YFV A;  5CPJ A;  3W97 C;  2PYO B;  5DNN D;  3AZN D;  3NQJ B;  3AYW B;  3X1U B;  4H9O A;  4WU9 C;  1KU5 A;  3REI D;  3A6N C;  5B1L A;  2F8N B;  1AOI D;  1JFI A;  1P3I C;  3C1C B;  3REH C;  3AZM D;  5JRG A;  3WTP E;  1P3A C;  3AZE C;  5BO0 A;  3WKJ C;  5BNV A;  3B6F A;  4QLC D;  3TU4 D;  2NZD D;  5C3I B;  4JJN D;  1U35 A;  5GXQ A;  2FJ7 C;  3B0C T;  5B2I A;  3KFU G;  2W8S A;  2UWX A;  3MVD C;  4Z66 D;  4LD9 C;  5GT3 B;  5FUG B;  5G49 A;  3LEL C;  3C1B B;  1EQZ D;  1M19 A;  4Z5T A;  4DRA A;  3WTP A;  3WAA D;  1P3O B;  3W97 B;  5AV8 D;  5B2J C;  5B31 A;  5B0Z C;  5B40 D;  2DQN C;  4WU9 B;  3A6N B;  3WA9 D;  3W96 D;  3UTB C;  5CPJ C;  5CPK A;  2HUE B;  1W2E A;  5B0Y A;  3MNN D;  5B1L C;  1A7W A;  5AVC D;  4ZUX B;  3MVD B;  2Y2G A;  3LZ1 B;  5BNX A;  3LZ0 A;  5JRG C;  5B24 B;  5GT0 D;  3B6F C;  4XZQ B;  5B32 A;  3UT9 D;  3X1T D;  1U35 C;  5GXQ C;  5B2J B;  5B2I C;  5CPI A;  3UTA A;  3AZG D;  5AVB B;  3MGP B;  3AZH B;  2RVQ D;  4KUD A;  3IP4 C;  1M19 C;  4Z5T C;  5B33 D;  1ID3 A;  3MGQ C;  3WTP C;  1M1A C;  3REJ D;  5B31 C;  1P34 D;  1P3L A;  2BYK B;  2JCH A;  2PYO A;  5BS7 A;  1P3G D;  5CP6 D;  3AYW A;  3X1V B;  5B32 G;  2F8N A;  4J8V A;  1TZY D;  3C1C A;  5CPK C;  1KX5 B;  3AZI B;  5AV6 B;  3KWQ B;  2Y2N A;  4WV4 B;  5GXQ B;  5B0Y C;  1S32 D;  1ZLA B;  2ZY5 A;  1P3M D;  4J8W D;  4WU8 B;  3VH5 A;  2HIO D;  3LZ0 C;  5CHL B;  2YFW B;  2CV5 D;  1KX4 B;  3MGQ B;  3B6G B;  3C1B A;  4XUJ D;  1M1A B;  3AFA D;  5DNM A;  4G91 C;  5CPI C;  1P3O A;  3W97 A;  4YS3 B;  2Y2Q A;  4KUD C;  1P3B B;  4WU9 A;  2DF4 C;  1ID3 C;  3W99 D;  4WZS B;  3AZL D;  1P3L C;  3KXB B;  2PYO C;  3KSY A;  5BS7 C;  3AYW C;  1KX3 B;  3MGR D;  5KDM B;  4NE5 A;  3X1S D;  5GSU B;  3LZ0 B;  4J8V C;  4ZUX A;  3MVD A;  1F66 D;  3LZ1 A;  4R8P B;  1P3P D;  5B24 A;  4G91 B;  4XZQ A;  5AV9 D;  1P3K B;  4X23 D;  1F1E A;  3AN2 D;  3MGS D;  3LJA C;  1H3O B;  4KGC D;  5AVB A;  3MGP A;  3AZH A;  2JSS A;  3AZJ B;  4UPK A;  5DNM C;  1P3O C;  4J8X B;  3NQU B;  3AZF B;  5AY8 D;  1B6W A;  3REL D;  2BYK A;  5B32 D;  3O62 D;  1BFM A;  3AZN B;  4J8V B;  3AV2 D;  3REK A;  3X1V A;  3REI B;  3UTA D;  1AOI B;  4J8U D;  4H9Q B;  3AZM B;  3FDD A;  5B1M D;  1KX5 A;  3AZI A;  2HUE C;  1B67 A;  5AV6 A;  3KWQ A;  1PZR A;  4QLC B;  3TU4 B;  1M18 D;  1ZLA A;  2NZD B;  4AWL B;  4ZUX C;  4WU8 A;  3EPH A;  3LJA B;  3LZ1 C;  2NQB D;  3AV1 D;  2YFW A;  2NQB A;  3KUY B;  5B24 C;  1KX4 A;  3VH6 W;  1BH8 B;  3X1U D;  5DNM B;  4XZQ C;  2IO5 B;  3MGQ A;  3B6G A;  1M1A A;  3C1C D;  3WAA B;  5F99 D;  2F8N H;  5AV8 B;  4YS3 A;  1Q9C A;  5E5A A;  5AVB C;  5B40 B;  3MGP C;  3AZH C;  1P3B A;  4YM6 A;  3AZK D;  3W98 A;  5JA4 B;  1HQ3 D;  3VH5 W;  5GT3 D;  3KXB A;  3C1B D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...