5DNMD

Nucleosome core particle containing adducts of ruthenium(ii)-toluene pta complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
95
structure length
95
Chain Sequence
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Allosteric cross-talk in chromatin can mediate drug-drug synergy
pubmed doi rcsb
source organism Xenopus laevis
total genus 34
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5dnmD00
4DRAA 1B6WA 3X1SB 3AYWD 3B0CW 5AV5B 3UTAA 4AWLC 4EO5B 3KSYA 3NQUA 3WAAA 3WKJC 5AY8B 5AV8A 1S32C 5B1LB 5F99A 3MGPC 4CAYA 2RVQC 2IO5C 1P3ID 5CP6B 4H9SC 4YS3C 3REJA 1KX3C 1P3LD 1M19A 3REKC 3W98D 5DNNB 3X1VB 1P3KA 5BNVB 5AVBB 1P3FD 5B40B 4Z66A 4J8VA 1BH8B 3AZGA 1P34B 3VH5A 1KX4C 5CPJD 5CPIA 2YFVB 5B1MA 5G49B 3AZIA 2NQBB 1HTAA 3KXBA 1AOIC 4H9RA 4R8PD 4JJND 1F66D 4NFTA 5B2ID 5AVCC 3MGSD 4WU9A 1HQ3D 4YM6B 4QLCD 5B2JA 3AZLD 1ID3D 3NQUB 3WTPC 3B6FD 5B0YC 3AZED 1P3AD 5AV8B 4KUDB 2YFVA 5F99B 5CPJA 3MVDB 3AV1C 5JA4A 3AZFB 1Q9CA 5AV6D 4WZSB 3UTAC 5B33D 1F66A 2F8NA 3AYWB 5B2IA 4NE3A 3TU4D 3WAAC 2NZDC 4ZUXC 4QLCA 1ID3A 4KGCA 4M6BA 3LJAD 5GT3C 3REJC 3AZEA 1ZLAD 1M19C 5GXQA 1P3GA 1P3IB 1P3KC 5AV6A 3MGRD 3AV2D 4Z66C 1P3LB 4LD9A 5B33A 3LELC 3W98B 4J8VC 1P3FB 1EQZD 5C3IB 5KDMB 4X23A 3O62A 4XZQD 3AZGC 1M1AC 4Z2MG 5CPKA 5CPIC 5B1MC 3AZIC 3VH5W 2BYMB 3MGRA 3AV2A 3KXBC 1B67A 5CPJB 5JA4B 3AZHC 1P3OD 1BH9B 4R8PB 4JJNB 4WU9C 1F66B 5B2IB 5B2JC 3MGSB 1TZYD 3AN2C 1HQ3B 3AFAD 4QLCB 3AZLB 3X1UD 1ID3B 3MGQD 3B6FB 3AZEB 1P3AB 2HIOD 5BNXA 1P3GB 5FUGB 5AV6B 3LZ0A 3W97A 5B31A 5B33B 4H9NB 4H9PB 5CHLB 3V9RA 3TU4B 3C1BD 4KGCC 3AZJD 4H9QB 5GXQC 3C1CD 3X1SA 1P3GC 3UTBD 3LJAB 4E44A 2HIOA 1ZLAB 4LD9C 3MGRB 2PYOD 3AV2B 4X23C 3O62C 5B1LA 1EQZB 4XZQB 1TAFB 5B0ZD 1P3BD 3C1CA 5CPKC 3AZMC 5DNNA 2CWEA 5E5AD 5BNVA 5AVBA 1P3MD 4HGAB 1P3PD 3UT9D 5GSUD 1P3OB 4G92B 4G91B 1KX5D 3KUYC 5B0ZA 3V9RB 4XUJC 1TZYB 2NQBA 3AFAB 1P3MA 3WA9D 3X1UB 3MNND 1P3PA 4J8UC 3UT9A 3LZ0C 2HIOB 2LY8A 3W97C 5B31C 1U35C 4YM6A 4WV4B 1KX5A 4KUDA 3MVDA 3X1SC 3C1BB 2BYKB 3AZFA 5AV5C 3WA9A 2AROD 3C1CB 3B6GD 3AZKD 3AYWA 3MNNA 4EO5C 3UTBB 5AY8C 5B1LC 2PYOB 5CP6C 1JFIA 1P3IA 5DNNC 3X1VC 5AVBC 5B0ZB 5B40C 1P3BB 1P3LA 3AZKA 3W98A 1P3FA 5E5AB 1P3MB 3W96D 5DNMD 5KDMA 2FJ7D 4J8WD 3KWQD 2CV5D 1P3PB 4Z5TD 3UT9B 1P34C 5BT1C 5GSUB 3A6ND 3VH6T 1KX5B 2BYMA 2NQBC 2JSSA 3UT9C 3WA9B 1BH9A 2FJ7A 4R8PA 3LZ1D 4JJNA 3KWQA 5AV9D 4YM6C 3MNNB 3X1TD 3RELD 3MGSA 1HQ3A 4KUDC 5AV8C 3AZLA 5F99C 3MVDC 1ULYA 1M18D 3AZFC 3NQJA 3REHD 3B6FA 1P3AA 1JFIB 3AYWC 5FUGA 2AROB 4H9NA 4H9PA 3AZKB 3B6GB 3REID 1N1JA 3X1TA 3TU4A 4H9QA 1M18A 1P3IC 3LJAA 4WU8D 1ZLAA 1P3LC 1F1EA 3B0DB 3B0CT 3W98C 1P3FC 5C3IC 2YFWB 3REIA 5B32D 1EQZA 3W96B 5DNMB 4ZBJB 3W99D 2FJ7B 4J8WB 5JRGD 4XZQA 1TAFA 3KWQB 2CV5B 4Z5TB 3AZND 5GT0D 5B24D 5CPJC 3R45A 3A6NB 3NQJB 4J8XD 4R8PC 4JJNC 1F66C 5B2IC 1P3OA 3MGSC 2HUEB 3W99A 3LZ1B 1HQ3C 5AV9B 1N1JB 4QLCC 3AZLC 3X1TB 3RELB 1ID3C 1TZYA 3B6FC 3AFAA 3AZEC 5B24A 1P3AC 3X1UA 1WWIA 1M18B 3MGQA 5AV6C 4J8XA 3REHB 5B33C 3WKJD 4WNNA 1S32D 3MGPD 3TU4C 2RVQD 4YS3D 3REIB 1KX3D 3C1BA 2BYKA 3REKD 3LJAC 3AZJA 1ZLAC 1BFMA 3UTBA 3MGRC 3AV2C 4WU8B 3R45B 3WKJA 1EQZC 2PYOA 1H3OB 1S32A 3MGPA 4CSRB 4XZQC 5B32B 1KX4D 1KU5A 3W99B 5JRGB 1P3BA 1AOID 4HGAC 3AZNB 5E5AA 5GT0B 5B24B 5AVCD 3MGQB 4J8XB 1P3OC 4G92C 4G91C 3WTPD 4WNNB 5B0YD 5GSUA 1KX4A 1TZYC 3AV1D 3AFAC 3X1UC 3VH5T 3UTAD 3MGQC 3AZJB 2HIOC 5AVCA 3WAAD 2NZDD 4ZUXD 4AWLB 3WKJB 5GT3D 3REJD 1S32B 4H9OB 3MGPB 1M19D 3C1BC 3AV1A 2IO5B 3AZJC 4YS3B 1P3KD 3C1CC 2L5AA 4Z66D 1KX3B 3LELD 3REKB 3UTBC 4J8VD 2AROA 3B6GA 2NZDA 2PYOC 3AZGD 4ZUXA 5B32G 1M1AD 4DRBA 4UUZB 5GT3A 5CPID 5B1MD 3AZID 5B0ZC 1P3BC 3KXBD 1KX4B 3LELA 5E5AC 1P3MC 3AZHD 4NE5A 2YFWA 1AOIB 1P3PC 4WU9D 3W96A 5AVCB 5B2JD 5DNMA 2F8NK 1M1AA 4J8WA 3AN2D 2CV5A 5GSUC 4Z5TA 1KX5C 5BO0A 3WTPB 5B0YB 3A6NA 4NE6A 3AV1B 2F8ND 5B31G 3WA9C 3AZHA 3UTAB 3B0BA 3MNNC 4E45A 3LZ1A 4KGCD 3WAAB 5AV9A 3AN2A 2NZDB 3RELA 4ZUXB 5GXQD 2F8NH 4CAYB 1P3GD 5GT3B 3REJB 1M19B 4LD9D 3REHA 1P3KB 2AROC 4Z66B 3B6GC 3AZKC 3LELB 4X23D 3O62D 4J8VB 1A7WA 3VH6A 3AZGB 5CPKD 1M1AB 3AZMD 3AZFD 3B0DC 5BO0B 5CPIB 5B1MB 4WU8A 3AZIB 3KXBB 4H9RB 1H3OA 3W96C 4CSRA 5DNMC 4ZBJC 3AZHB 2FJ7C 4J8WC 3KWQC 3KUYD 5BS7A 5B32A 4WU9B 2CV5C 4Z5TC 5B2JB 4XUJD 5JRGA 3AZMA 3AN2B 3A6NC 3AZNA 5GT0A 4J8UD 3LZ0D 3W97D 5B31D 1U35D 1WWSA 2F8NB 2HUEC 3LZ1C 5AV9C 3KUYA 3X1TC 3RELC 4XUJA 3X1SD 4KGCB 5AV5D 5GXQB 1M18C 3REHC 4J8UA 4LD9B 1U35A 5AY8D 4KHAA 5B1LD 5CP6D 3REIC 4X23B 3O62B 4H9OA 5DNND 3X1VD 4H9SA 3VH6W 5AVBD 4YS3A 5AV5A 5B40D 3WTPE 1KX3A 3REKA 5CPKB 3AZMB 4WU8C 5AY8A 1P34D 5CP6A 4UUZA 5BS7C 5BT1D 5B32C 3W99C 5JRGC 3X1VA 3KUYB 2NQBD 5B40A 4XUJB 3AZNC 5GT0C 5B24C 2F8NG 1AOIA 5BNXB 1BH8A 4J8XC 4YM6D 4J8UB 1R4VA 3LZ0B 3W97B 4Z2MH 5B31B 1U35B 1P34A 4KHAB 4KUDD 5AV8D 5F99D 3MVDD 3WTPA 5G49A 5B0YA
chains in the Genus database with same CATH superfamily
4DRAA 1B6WA 3X1SB 3AYWD 3B0CW 5AV5B 3UTAA 2G5IC 2ZY4A 4AWLC 4EO5B 4DQYB 3KSYA 3NQUA 3WAAA 3WKJC 5AY8B 5AV8A 1S32C 5B1LB 5F99A 3MGPC 4CAYA 2RVQC 2IO5C 1P3ID 5CP6B 4H9SC 4YS3C 3REJA 1PZRA 1KX3C 1P3LD 1M19A 3REKC 3W98D 5DNNB 3X1VB 1P3KA 5BNVB 5AVBB 1P3FD 5B40B 4Z66A 4J8VA 1BH8B 3AZGA 1P34B 2Y2JA 3VH5A 1KX4C 5CPJD 2F2AC 5CPIA 2YFVB 5B1MA 5G49B 3AZIA 2NQBB 1HTAA 3KXBA 1AOIC 4H9RA 4R8PD 4JJND 1F66D 4NFTA 3H0LC 5B2ID 5AVCC 3MGSD 3EPLA 4WU9A 1HQ3D 4YM6B 4QLCD 5B2JA 3AZLD 1ID3D 3NQUB 3WTPC 3B6FD 5B0YC 3AZED 1P3AD 5AV8B 4KUDB 5F99B 5CPJA 3MVDB 3AV1C 5JA4A 3AZFB 1Q9CA 5AV6D 4WZSB 2BG1A 3UTAC 5B33D 1F66A 2F8NA 3AYWB 5B2IA 4NE3A 3TU4D 3WAAC 2NZDC 4ZUXC 4QLCA 1ID3A 4KGCA 4M6BA 2Y2QA 5GT3C 3LJAD 3REJC 3AZEA 1M19C 5GXQA 1ZLAD 1P3GA 1P3IB 1P3KC 5AV6A 3MGRD 3AV2D 4Z66C 1P3LB 4LD9A 5B33A 3LELC 3W98B 4J8VC 1P3FB 1EQZD 5C3IB 5KDMB 4X23A 3O62A 4XZQD 3AZGC 1T3UA 1M1AC 3H0MC 4Z2MG 5CPKA 5CPIC 5B1MC 3AZIC 3VH5W 2BYMB 3MGRA 3AV2A 3KXBC 1B67A 3A1IA 5CPJB 5JA4B 3AZHC 1P3OD 2Y2OA 1BH9B 4R8PB 4JJNB 4WU9C 1F66B 5B2IB 5B2JC 3MGSB 2Y2LA 1TZYD 3AN2C 1HQ3B 3AFAD 4QLCB 3AZLB 3X1UD 1ID3B 3MGQD 3B6FB 3AZEB 1P3AB 2HIOD 3EG5B 5BNXA 2Y2HA 1P3GB 5FUGB 5AV6B 3LZ0A 3W97A 5B31A 5B33B 4H9NB 4H9PB 5CHLB 3V9RA 3TU4B 3C1BD 4KGCC 3AZJD 4H9QB 5GXQC 3C1CD 3X1SA 1P3GC 3UTBD 3LJAB 4E44A 2HIOA 1ZLAB 4LD9C 3MGRB 2PYOD 3AV2B 4X23C 3O62C 5B1LA 1EQZB 4XZQB 1TAFB 5B0ZD 1P3BD 3C1CA 5CPKC 3AZMC 5DNNA 2CWEA 5E5AD 5BNVA 5AVBA 1P3MD 4HGAB 1P3PD 3UT9D 5GSUD 1P3OB 4G92B 4G91B 1KX5D 3KUYC 5B0ZA 3V9RB 4XUJC 1TZYB 2NQBA 3AFAB 1P3MA 3WA9D 3X1UB 2Y2NA 3MNND 1P3PA 4J8UC 3UT9A 3LZ0C 2HIOB 2LY8A 3W97C 5B31C 1U35C 2DQNC 4YM6A 4WV4B 3P5JB 1KX5A 4KUDA 3MVDA 3X1SC 3C1BB 2BYKB 2G5HC 3AZFA 5AV5C 3WA9A 2AROD 3C1CB 3B6GD 3AZKD 3AYWA 3MNNA 2W8SA 4EO5C 3UTBB 5AY8C 5B1LC 2PYOB 5CP6C 1JFIA 1P3IA 5DNNC 3X1VC 5AVBC 5B0ZB 5B40C 2ZM5A 1P3BB 1P3LA 3AZKA 3W98A 1P3FA 5E5AB 1P3MB 3W96D 5DNMD 5KDMA 2FJ7D 4J8WD 3KWQD 2CV5D 1P3PB 4Z5TD 3UT9B 1P34C 5BT1C 5GSUB 2Y2KA 2JE5A 3VH6T 3A6ND 1KX5B 2BYMA 2NQBC 2JSSA 2ZY2A 3UT9C 3WA9B 1BH9A 2FJ7A 4R8PA 3LZ1D 4JJNA 3KWQA 5AV9D 4YM6C 3MNNB 3X1TD 3RELD 3MGSA 1HQ3A 4KUDC 5AV8C 3AZLA 5F99C 3MVDC 1ULYA 1M18D 3AZFC 3NQJA 3REHD 3B6FA 1P3AA 1JFIB 3AYWC 5FUGA 2VQRA 2XD5A 2AROB 4H9NA 4H9PA 3AZKB 3B6GB 3REID 1N1JA 3X1TA 3TU4A 4H9QA 2JCHA 1M18A 1P3IC 1Z2CB 3LJAA 4WU8D 1ZLAA 1P3LC 1F1EA 3B0DB 3B0CT 3W98C 1P3FC 5C3IC 2YFWB 3REIA 5B32D 1EQZA 3W96B 5DNMB 4ZBJB 3W99D 2FJ7B 4J8WB 5JRGD 4XZQA 1TAFA 3KWQB 2CV5B 4Z5TB 3AZND 5GT0D 5B24D 5CPJC 3R45A 3A6NB 3NQJB 4J8XD 4R8PC 4JJNC 1F66C 2Y2IA 5B2IC 1P3OA 3MGSC 2HUEB 3W99A 3LZ1B 1HQ3C 5AV9B 1N1JB 4QLCC 3AZLC 3X1TB 3RELB 1ID3C 4WJ3C 1TZYA 3B6FC 3AFAA 3AZEC 5B24A 1P3AC 3X1UA 1WWIA 1M18B 3MGQA 5AV6C 4J8XA 3REHB 5B33C 3WKJD 4WNNA 1S32D 3MGPD 3TU4C 3EPHA 2RVQD 4YS3D 3REIB 2XD1A 1KX3D 3C1BA 2BYKA 3REKD 3LJAC 3AZJA 1ZLAC 1BFMA 3UTBA 3MGRC 3AV2C 4WU8B 2RIQA 3R45B 3WKJA 1EQZC 2PYOA 1H3OB 1S32A 3MGPA 4CSRB 2J8PA 4XZQC 3EPJA 5B32B 1KX4D 1KU5A 3W99B 5JRGB 1P3BA 1AOID 4HGAC 3AZNB 5E5AA 5GT0B 5B24B 5AVCD 3MGQB 4J8XB 1P3OC 3H0RC 4G92C 4G91C 2ZY3A 3WTPD 4WNNB 5B0YD 5GSUA 1KX4A 1TZYC 3AV1D 3AFAC 3X1UC 3VH5T 3UTAD 3MGQC 3IP4C 3AZJB 3WTPA 2HIOC 5AVCA 3WAAD 2NZDD 4ZUXD 4AWLB 3WKJB 5GT3D 3REJD 1S32B 4H9OB 3MGPB 1M19D 3C1BC 3AV1A 2ZY5A 2IO5B 3AZJC 4YS3B 1P3KD 3C1CC 2L5AA 4Z66D 1KX3B 3LELD 3REKB 3UTBC 4J8VD 2AROA 3B6GA 2NZDA 4UPKA 2PYOC 3AZGD 4ZUXA 5B32G 1M1AD 4DRBA 4UUZB 5GT3A 5CPID 5B1MD 3AZID 3AL0C 5B0ZC 1P3BC 3KXBD 1KX4B 3LELA 5E5AC 1P3MC 3AZHD 4NE5A 2YFWA 1AOIB 1P3PC 4WU9D 3W96A 5AVCB 5B2JD 5DNMA 2F8NK 1M1AA 4J8WA 3AN2D 2CV5A 5GSUC 4Z5TA 1KX5C 5BO0A 3WTPB 5B0YB 3A6NA 4NE6A 3AV1B 2F8ND 5B31G 3WA9C 3AZHA 3UTAB 3B0BA 3MNNC 4E45A 3LZ1A 4KGCD 3WAAB 5AV9A 3AN2A 2NZDB 3RELA 4ZUXB 5GXQD 2F8NH 4CAYB 1P3GD 5GT3B 3EPKA 2Y2PA 3REJB 1M19B 4LD9D 3FDDA 3REHA 1P3KB 2AROC 4Z66B 3B6GC 3AZKC 3LELB 4X23D 3O62D 4J8VB 1A7WA 3VH6A 3AZGB 5CPKD 1M1AB 3AZMD 3AZFD 3B0DC 5BO0B 5CPIB 5B1MB 4WU8A 3AZIB 3KXBB 4H9RB 1H3OA 3W96C 4CSRA 5DNMC 4ZBJC 3AZHB 2FJ7C 4J8WC 3KWQC 3KUYD 5BS7A 5B32A 4WU9B 2CV5C 4Z5TC 5B2JB 4XUJD 5JRGA 3AZMA 3AN2B 3A6NC 3A1KA 3AZNA 5GT0A 4J8UD 3LZ0D 3W97D 5B31D 1U35D 1WWSA 2F8NB 2HUEC 3LZ1C 2UWXA 5AV9C 3KUYA 3X1TC 3RELC 1W2EA 4XUJA 3X1SD 4KGCB 5AV5D 5GXQB 1M18C 3REHC 4J8UA 4LD9B 1U35A 5AY8D 4KHAA 5B1LD 5CP6D 3REIC 2Y2MA 4X23B 3O62B 4H9OA 5DNND 3X1VD 4H9SA 3VH6W 5AVBD 4YS3A 5AV5A 5B40D 3WTPE 1KX3A 3REKA 5CPKB 3F6TA 3AZMB 4WU8C 5AY8A 1P34D 5CP6A 4UUZA 5BS7C 5BT1D 5B32C 3W99C 5JRGC 2Y2GA 3X1VA 3KUYB 2NQBD 5B40A 2FFFB 4XUJB 3AZNC 2DF4C 5GT0C 5B24C 2F8NG 1AOIA 5BNXB 1BH8A 4J8XC 4YM6D 4J8UB 1R4VA 3LZ0B 3W97B 4Z2MH 5B31B 1U35B 1P34A 4KHAB 4KUDD 5AV8D 5F99D 3MVDD 2YFVA 5G49A 5B0YA 3KFUG
chains in the Genus database with same CATH topology
4DRAA 1B6WA 3X1SB 3AYWD 3B0CW 5AV5B 3UTAA 2G5IC 2ZY4A 4AWLC 4EO5B 4DQYB 3KSYA 3NQUA 3WAAA 3WKJC 5AY8B 5AV8A 1S32C 5B1LB 5F99A 3MGPC 4CAYA 2RVQC 2IO5C 1P3ID 5CP6B 4H9SC 4YS3C 3REJA 1PZRA 1KX3C 1P3LD 1M19A 3REKC 3W98D 5DNNB 3X1VB 1P3KA 5BNVB 5AVBB 1P3FD 5B40B 4Z66A 4J8VA 1BH8B 3AZGA 1P34B 2Y2JA 3VH5A 1KX4C 5CPJD 2F2AC 5CPIA 2YFVB 5B1MA 5G49B 3AZIA 2NQBB 1HTAA 3KXBA 1AOIC 4H9RA 4R8PD 4JJND 1F66D 4NFTA 3H0LC 5B2ID 5AVCC 3MGSD 3EPLA 4WU9A 1HQ3D 4YM6B 4QLCD 5B2JA 3AZLD 1ID3D 3NQUB 3WTPC 3B6FD 5B0YC 3AZED 1P3AD 5AV8B 4KUDB 5F99B 5CPJA 3MVDB 3AV1C 5JA4A 3AZFB 1Q9CA 5AV6D 4WZSB 2BG1A 3UTAC 5B33D 1F66A 2F8NA 3AYWB 5B2IA 4NE3A 3TU4D 3WAAC 2NZDC 4ZUXC 4QLCA 1ID3A 4KGCA 4M6BA 2Y2QA 5GT3C 3LJAD 3REJC 3AZEA 1M19C 5GXQA 1ZLAD 1P3GA 1P3IB 1P3KC 5AV6A 3MGRD 3AV2D 4Z66C 1P3LB 4LD9A 5B33A 3LELC 3W98B 4J8VC 1P3FB 1EQZD 5C3IB 5KDMB 4X23A 3O62A 4XZQD 3AZGC 1T3UA 1M1AC 3H0MC 4Z2MG 5CPKA 5CPIC 5B1MC 3AZIC 3VH5W 2BYMB 3MGRA 3AV2A 3KXBC 1B67A 3A1IA 5CPJB 5JA4B 3AZHC 1P3OD 2Y2OA 1BH9B 4R8PB 4JJNB 4WU9C 1F66B 5B2IB 5B2JC 3MGSB 2Y2LA 1TZYD 3AN2C 1HQ3B 3AFAD 4QLCB 3AZLB 3X1UD 1ID3B 3MGQD 3B6FB 3AZEB 1P3AB 2HIOD 3EG5B 5BNXA 2Y2HA 1P3GB 5FUGB 5AV6B 3LZ0A 3W97A 5B31A 5B33B 4H9NB 4H9PB 5CHLB 3V9RA 3TU4B 3C1BD 4KGCC 3AZJD 4H9QB 5GXQC 3C1CD 3X1SA 1P3GC 3UTBD 3LJAB 4E44A 2HIOA 1ZLAB 4LD9C 3MGRB 2PYOD 3AV2B 4X23C 3O62C 5B1LA 1EQZB 4XZQB 1TAFB 5B0ZD 1P3BD 3C1CA 5CPKC 3AZMC 5DNNA 2CWEA 5E5AD 5BNVA 5AVBA 1P3MD 4HGAB 1P3PD 3UT9D 5GSUD 1P3OB 4G92B 4G91B 1KX5D 3KUYC 5B0ZA 3V9RB 4XUJC 1TZYB 2NQBA 3AFAB 1P3MA 3WA9D 3X1UB 2Y2NA 3MNND 1P3PA 4J8UC 3UT9A 3LZ0C 2HIOB 2LY8A 3W97C 5B31C 1U35C 2DQNC 4YM6A 4WV4B 3P5JB 1KX5A 4KUDA 3MVDA 3X1SC 3C1BB 2BYKB 2G5HC 3AZFA 5AV5C 3WA9A 2AROD 3C1CB 3B6GD 3AZKD 3AYWA 3MNNA 2W8SA 4EO5C 3UTBB 5AY8C 5B1LC 2PYOB 5CP6C 1JFIA 1P3IA 5DNNC 3X1VC 5AVBC 5B0ZB 5B40C 2ZM5A 1P3BB 1P3LA 3AZKA 3W98A 1P3FA 5E5AB 1P3MB 3W96D 5DNMD 5KDMA 2FJ7D 4J8WD 3KWQD 2CV5D 1P3PB 4Z5TD 3UT9B 1P34C 5BT1C 5GSUB 2Y2KA 2JE5A 3VH6T 3A6ND 1KX5B 2BYMA 2NQBC 2JSSA 2ZY2A 3UT9C 3WA9B 1BH9A 2FJ7A 4R8PA 3LZ1D 4JJNA 3KWQA 5AV9D 4YM6C 3MNNB 3X1TD 3RELD 3MGSA 1HQ3A 4KUDC 5AV8C 3AZLA 5F99C 3MVDC 1ULYA 1M18D 3AZFC 3NQJA 3REHD 3B6FA 1P3AA 1JFIB 3AYWC 5FUGA 2VQRA 2XD5A 2AROB 4H9NA 4H9PA 3AZKB 3B6GB 3REID 1N1JA 3X1TA 3TU4A 4H9QA 2JCHA 1M18A 1P3IC 1Z2CB 3LJAA 4WU8D 1ZLAA 1P3LC 1F1EA 3B0DB 3B0CT 3W98C 1P3FC 5C3IC 2YFWB 3REIA 5B32D 1EQZA 3W96B 5DNMB 4ZBJB 3W99D 2FJ7B 4J8WB 5JRGD 4XZQA 1TAFA 3KWQB 2CV5B 4Z5TB 3AZND 5GT0D 5B24D 5CPJC 3R45A 3A6NB 3NQJB 4J8XD 4R8PC 4JJNC 1F66C 2Y2IA 5B2IC 1P3OA 3MGSC 2HUEB 3W99A 3LZ1B 1HQ3C 5AV9B 1N1JB 4QLCC 3AZLC 3X1TB 3RELB 1ID3C 4WJ3C 1TZYA 3B6FC 3AFAA 3AZEC 5B24A 1P3AC 3X1UA 1WWIA 1M18B 3MGQA 5AV6C 4J8XA 3REHB 5B33C 3WKJD 4WNNA 1S32D 3MGPD 3TU4C 3EPHA 2RVQD 4YS3D 3REIB 2XD1A 1KX3D 3C1BA 2BYKA 3REKD 3LJAC 3AZJA 1ZLAC 1BFMA 3UTBA 3MGRC 3AV2C 4WU8B 2RIQA 3R45B 3WKJA 1EQZC 2PYOA 1H3OB 1S32A 3MGPA 4CSRB 2J8PA 4XZQC 3EPJA 5B32B 1KX4D 1KU5A 3W99B 5JRGB 1P3BA 1AOID 4HGAC 3AZNB 5E5AA 5GT0B 5B24B 5AVCD 3MGQB 4J8XB 1P3OC 3H0RC 4G92C 4G91C 2ZY3A 3WTPD 4WNNB 5B0YD 5GSUA 1KX4A 1TZYC 3AV1D 3AFAC 3X1UC 3VH5T 3UTAD 3MGQC 3IP4C 3AZJB 3WTPA 2HIOC 5AVCA 3WAAD 2NZDD 4ZUXD 4AWLB 3WKJB 5GT3D 3REJD 1S32B 4H9OB 3MGPB 1M19D 3C1BC 3AV1A 2ZY5A 2IO5B 3AZJC 4YS3B 1P3KD 3C1CC 2L5AA 4Z66D 1KX3B 3LELD 3REKB 3UTBC 4J8VD 2AROA 3B6GA 2NZDA 4UPKA 2PYOC 3AZGD 4ZUXA 5B32G 1M1AD 4DRBA 4UUZB 5GT3A 5CPID 5B1MD 3AZID 3AL0C 5B0ZC 1P3BC 3KXBD 1KX4B 3LELA 5E5AC 1P3MC 3AZHD 4NE5A 2YFWA 1AOIB 1P3PC 4WU9D 3W96A 5AVCB 5B2JD 5DNMA 2F8NK 1M1AA 4J8WA 3AN2D 2CV5A 5GSUC 4Z5TA 1KX5C 5BO0A 3WTPB 5B0YB 3A6NA 4NE6A 3AV1B 2F8ND 5B31G 3WA9C 3AZHA 3UTAB 3B0BA 3MNNC 4E45A 3LZ1A 4KGCD 3WAAB 5AV9A 3AN2A 2NZDB 3RELA 4ZUXB 5GXQD 2F8NH 4CAYB 1P3GD 5GT3B 3EPKA 2Y2PA 3REJB 1M19B 4LD9D 3FDDA 3REHA 1P3KB 2AROC 4Z66B 3B6GC 3AZKC 3LELB 4X23D 3O62D 4J8VB 1A7WA 3VH6A 3AZGB 5CPKD 1M1AB 3AZMD 3AZFD 3B0DC 5BO0B 5CPIB 5B1MB 4WU8A 3AZIB 3KXBB 4H9RB 1H3OA 3W96C 4CSRA 5DNMC 4ZBJC 3AZHB 2FJ7C 4J8WC 3KWQC 3KUYD 5BS7A 5B32A 4WU9B 2CV5C 4Z5TC 5B2JB 4XUJD 5JRGA 3AZMA 3AN2B 3A6NC 3A1KA 3AZNA 5GT0A 4J8UD 3LZ0D 3W97D 5B31D 1U35D 1WWSA 2F8NB 2HUEC 3LZ1C 2UWXA 5AV9C 3KUYA 3X1TC 3RELC 1W2EA 4XUJA 3X1SD 4KGCB 5AV5D 5GXQB 1M18C 3REHC 4J8UA 4LD9B 1U35A 5AY8D 4KHAA 5B1LD 5CP6D 3REIC 2Y2MA 4X23B 3O62B 4H9OA 5DNND 3X1VD 4H9SA 3VH6W 5AVBD 4YS3A 5AV5A 5B40D 3WTPE 1KX3A 3REKA 5CPKB 3F6TA 3AZMB 4WU8C 5AY8A 1P34D 5CP6A 4UUZA 5BS7C 5BT1D 5B32C 3W99C 5JRGC 2Y2GA 3X1VA 3KUYB 2NQBD 5B40A 2FFFB 4XUJB 3AZNC 2DF4C 5GT0C 5B24C 2F8NG 1AOIA 5BNXB 1BH8A 4J8XC 4YM6D 4J8UB 1R4VA 3LZ0B 3W97B 4Z2MH 5B31B 1U35B 1P34A 4KHAB 4KUDD 5AV8D 5F99D 3MVDD 2YFVA 5G49A 5B0YA 3KFUG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRA A;  1B6W A;  3X1S B;  3AYW D;  3B0C W;  5AV5 B;  3UTA A;  4AWL C;  4EO5 B;  3KSY A;  3NQU A;  3WAA A;  3WKJ C;  5AY8 B;  5AV8 A;  1S32 C;  5B1L B;  5F99 A;  3MGP C;  4CAY A;  2RVQ C;  2IO5 C;  1P3I D;  5CP6 B;  4H9S C;  4YS3 C;  3REJ A;  1KX3 C;  1P3L D;  1M19 A;  3REK C;  3W98 D;  5DNN B;  3X1V B;  1P3K A;  5BNV B;  5AVB B;  1P3F D;  5B40 B;  4Z66 A;  4J8V A;  1BH8 B;  3AZG A;  1P34 B;  3VH5 A;  1KX4 C;  5CPJ D;  5CPI A;  2YFV B;  5B1M A;  5G49 B;  3AZI A;  2NQB B;  1HTA A;  3KXB A;  1AOI C;  4H9R A;  4R8P D;  4JJN D;  1F66 D;  4NFT A;  5B2I D;  5AVC C;  3MGS D;  4WU9 A;  1HQ3 D;  4YM6 B;  4QLC D;  5B2J A;  3AZL D;  1ID3 D;  3NQU B;  3WTP C;  3B6F D;  5B0Y C;  3AZE D;  1P3A D;  5AV8 B;  4KUD B;  2YFV A;  5F99 B;  5CPJ A;  3MVD B;  3AV1 C;  5JA4 A;  3AZF B;  1Q9C A;  5AV6 D;  4WZS B;  3UTA C;  5B33 D;  1F66 A;  2F8N A;  3AYW B;  5B2I A;  4NE3 A;  3TU4 D;  3WAA C;  2NZD C;  4ZUX C;  4QLC A;  1ID3 A;  4KGC A;  4M6B A;  3LJA D;  5GT3 C;  3REJ C;  3AZE A;  1ZLA D;  1M19 C;  5GXQ A;  1P3G A;  1P3I B;  1P3K C;  5AV6 A;  3MGR D;  3AV2 D;  4Z66 C;  1P3L B;  4LD9 A;  5B33 A;  3LEL C;  3W98 B;  4J8V C;  1P3F B;  1EQZ D;  5C3I B;  5KDM B;  4X23 A;  3O62 A;  4XZQ D;  3AZG C;  1M1A C;  4Z2M G;  5CPK A;  5CPI C;  5B1M C;  3AZI C;  3VH5 W;  2BYM B;  3MGR A;  3AV2 A;  3KXB C;  1B67 A;  5CPJ B;  5JA4 B;  3AZH C;  1P3O D;  1BH9 B;  4R8P B;  4JJN B;  4WU9 C;  1F66 B;  5B2I B;  5B2J C;  3MGS B;  1TZY D;  3AN2 C;  1HQ3 B;  3AFA D;  4QLC B;  3AZL B;  3X1U D;  1ID3 B;  3MGQ D;  3B6F B;  3AZE B;  1P3A B;  2HIO D;  5BNX A;  1P3G B;  5FUG B;  5AV6 B;  3LZ0 A;  3W97 A;  5B31 A;  5B33 B;  4H9N B;  4H9P B;  5CHL B;  3V9R A;  3TU4 B;  3C1B D;  4KGC C;  3AZJ D;  4H9Q B;  5GXQ C;  3C1C D;  3X1S A;  1P3G C;  3UTB D;  3LJA B;  4E44 A;  2HIO A;  1ZLA B;  4LD9 C;  3MGR B;  2PYO D;  3AV2 B;  4X23 C;  3O62 C;  5B1L A;  1EQZ B;  4XZQ B;  1TAF B;  5B0Z D;  1P3B D;  3C1C A;  5CPK C;  3AZM C;  5DNN A;  2CWE A;  5E5A D;  5BNV A;  5AVB A;  1P3M D;  4HGA B;  1P3P D;  3UT9 D;  5GSU D;  1P3O B;  4G92 B;  4G91 B;  1KX5 D;  3KUY C;  5B0Z A;  3V9R B;  4XUJ C;  1TZY B;  2NQB A;  3AFA B;  1P3M A;  3WA9 D;  3X1U B;  3MNN D;  1P3P A;  4J8U C;  3UT9 A;  3LZ0 C;  2HIO B;  2LY8 A;  3W97 C;  5B31 C;  1U35 C;  4YM6 A;  4WV4 B;  1KX5 A;  4KUD A;  3MVD A;  3X1S C;  3C1B B;  2BYK B;  3AZF A;  5AV5 C;  3WA9 A;  2ARO D;  3C1C B;  3B6G D;  3AZK D;  3AYW A;  3MNN A;  4EO5 C;  3UTB B;  5AY8 C;  5B1L C;  2PYO B;  5CP6 C;  1JFI A;  1P3I A;  5DNN C;  3X1V C;  5AVB C;  5B0Z B;  5B40 C;  1P3B B;  1P3L A;  3AZK A;  3W98 A;  1P3F A;  5E5A B;  1P3M B;  3W96 D;  5DNM D;  5KDM A;  2FJ7 D;  4J8W D;  3KWQ D;  2CV5 D;  1P3P B;  4Z5T D;  3UT9 B;  1P34 C;  5BT1 C;  5GSU B;  3A6N D;  3VH6 T;  1KX5 B;  2BYM A;  2NQB C;  2JSS A;  3UT9 C;  3WA9 B;  1BH9 A;  2FJ7 A;  4R8P A;  3LZ1 D;  4JJN A;  3KWQ A;  5AV9 D;  4YM6 C;  3MNN B;  3X1T D;  3REL D;  3MGS A;  1HQ3 A;  4KUD C;  5AV8 C;  3AZL A;  5F99 C;  3MVD C;  1ULY A;  1M18 D;  3AZF C;  3NQJ A;  3REH D;  3B6F A;  1P3A A;  1JFI B;  3AYW C;  5FUG A;  2ARO B;  4H9N A;  4H9P A;  3AZK B;  3B6G B;  3REI D;  1N1J A;  3X1T A;  3TU4 A;  4H9Q A;  1M18 A;  1P3I C;  3LJA A;  4WU8 D;  1ZLA A;  1P3L C;  1F1E A;  3B0D B;  3B0C T;  3W98 C;  1P3F C;  5C3I C;  2YFW B;  3REI A;  5B32 D;  1EQZ A;  3W96 B;  5DNM B;  4ZBJ B;  3W99 D;  2FJ7 B;  4J8W B;  5JRG D;  4XZQ A;  1TAF A;  3KWQ B;  2CV5 B;  4Z5T B;  3AZN D;  5GT0 D;  5B24 D;  5CPJ C;  3R45 A;  3A6N B;  3NQJ B;  4J8X D;  4R8P C;  4JJN C;  1F66 C;  5B2I C;  1P3O A;  3MGS C;  2HUE B;  3W99 A;  3LZ1 B;  1HQ3 C;  5AV9 B;  1N1J B;  4QLC C;  3AZL C;  3X1T B;  3REL B;  1ID3 C;  1TZY A;  3B6F C;  3AFA A;  3AZE C;  5B24 A;  1P3A C;  3X1U A;  1WWI A;  1M18 B;  3MGQ A;  5AV6 C;  4J8X A;  3REH B;  5B33 C;  3WKJ D;  4WNN A;  1S32 D;  3MGP D;  3TU4 C;  2RVQ D;  4YS3 D;  3REI B;  1KX3 D;  3C1B A;  2BYK A;  3REK D;  3LJA C;  3AZJ A;  1ZLA C;  1BFM A;  3UTB A;  3MGR C;  3AV2 C;  4WU8 B;  3R45 B;  3WKJ A;  1EQZ C;  2PYO A;  1H3O B;  1S32 A;  3MGP A;  4CSR B;  4XZQ C;  5B32 B;  1KX4 D;  1KU5 A;  3W99 B;  5JRG B;  1P3B A;  1AOI D;  4HGA C;  3AZN B;  5E5A A;  5GT0 B;  5B24 B;  5AVC D;  3MGQ B;  4J8X B;  1P3O C;  4G92 C;  4G91 C;  3WTP D;  4WNN B;  5B0Y D;  5GSU A;  1KX4 A;  1TZY C;  3AV1 D;  3AFA C;  3X1U C;  3VH5 T;  3UTA D;  3MGQ C;  3AZJ B;  2HIO C;  5AVC A;  3WAA D;  2NZD D;  4ZUX D;  4AWL B;  3WKJ B;  5GT3 D;  3REJ D;  1S32 B;  4H9O B;  3MGP B;  1M19 D;  3C1B C;  3AV1 A;  2IO5 B;  3AZJ C;  4YS3 B;  1P3K D;  3C1C C;  2L5A A;  4Z66 D;  1KX3 B;  3LEL D;  3REK B;  3UTB C;  4J8V D;  2ARO A;  3B6G A;  2NZD A;  2PYO C;  3AZG D;  4ZUX A;  5B32 G;  1M1A D;  4DRB A;  4UUZ B;  5GT3 A;  5CPI D;  5B1M D;  3AZI D;  5B0Z C;  1P3B C;  3KXB D;  1KX4 B;  3LEL A;  5E5A C;  1P3M C;  3AZH D;  4NE5 A;  2YFW A;  1AOI B;  1P3P C;  4WU9 D;  3W96 A;  5AVC B;  5B2J D;  5DNM A;  2F8N K;  1M1A A;  4J8W A;  3AN2 D;  2CV5 A;  5GSU C;  4Z5T A;  1KX5 C;  5BO0 A;  3WTP B;  5B0Y B;  3A6N A;  4NE6 A;  3AV1 B;  2F8N D;  5B31 G;  3WA9 C;  3AZH A;  3UTA B;  3B0B A;  3MNN C;  4E45 A;  3LZ1 A;  4KGC D;  3WAA B;  5AV9 A;  3AN2 A;  2NZD B;  3REL A;  4ZUX B;  5GXQ D;  2F8N H;  4CAY B;  1P3G D;  5GT3 B;  3REJ B;  1M19 B;  4LD9 D;  3REH A;  1P3K B;  2ARO C;  4Z66 B;  3B6G C;  3AZK C;  3LEL B;  4X23 D;  3O62 D;  4J8V B;  1A7W A;  3VH6 A;  3AZG B;  5CPK D;  1M1A B;  3AZM D;  3AZF D;  3B0D C;  5BO0 B;  5CPI B;  5B1M B;  4WU8 A;  3AZI B;  3KXB B;  4H9R B;  1H3O A;  3W96 C;  4CSR A;  5DNM C;  4ZBJ C;  3AZH B;  2FJ7 C;  4J8W C;  3KWQ C;  3KUY D;  5BS7 A;  5B32 A;  4WU9 B;  2CV5 C;  4Z5T C;  5B2J B;  4XUJ D;  5JRG A;  3AZM A;  3AN2 B;  3A6N C;  3AZN A;  5GT0 A;  4J8U D;  3LZ0 D;  3W97 D;  5B31 D;  1U35 D;  1WWS A;  2F8N B;  2HUE C;  3LZ1 C;  5AV9 C;  3KUY A;  3X1T C;  3REL C;  4XUJ A;  3X1S D;  4KGC B;  5AV5 D;  5GXQ B;  1M18 C;  3REH C;  4J8U A;  4LD9 B;  1U35 A;  5AY8 D;  4KHA A;  5B1L D;  5CP6 D;  3REI C;  4X23 B;  3O62 B;  4H9O A;  5DNN D;  3X1V D;  4H9S A;  3VH6 W;  5AVB D;  4YS3 A;  5AV5 A;  5B40 D;  3WTP E;  1KX3 A;  3REK A;  5CPK B;  3AZM B;  4WU8 C;  5AY8 A;  1P34 D;  5CP6 A;  4UUZ A;  5BS7 C;  5BT1 D;  5B32 C;  3W99 C;  5JRG C;  3X1V A;  3KUY B;  2NQB D;  5B40 A;  4XUJ B;  3AZN C;  5GT0 C;  5B24 C;  2F8N G;  1AOI A;  5BNX B;  1BH8 A;  4J8X C;  4YM6 D;  4J8U B;  1R4V A;  3LZ0 B;  3W97 B;  4Z2M H;  5B31 B;  1U35 B;  1P34 A;  4KHA B;  4KUD D;  5AV8 D;  5F99 D;  3MVD D;  3WTP A;  5G49 A;  5B0Y A; 
#chains in the Genus database with same CATH topology
 4DRA A;  1B6W A;  3X1S B;  3AYW D;  3B0C W;  5AV5 B;  3UTA A;  2G5I C;  2ZY4 A;  4AWL C;  4EO5 B;  4DQY B;  3KSY A;  3NQU A;  3WAA A;  3WKJ C;  5AY8 B;  5AV8 A;  1S32 C;  5B1L B;  5F99 A;  3MGP C;  4CAY A;  2RVQ C;  2IO5 C;  1P3I D;  5CP6 B;  4H9S C;  4YS3 C;  3REJ A;  1PZR A;  1KX3 C;  1P3L D;  1M19 A;  3REK C;  3W98 D;  5DNN B;  3X1V B;  1P3K A;  5BNV B;  5AVB B;  1P3F D;  5B40 B;  4Z66 A;  4J8V A;  1BH8 B;  3AZG A;  1P34 B;  2Y2J A;  3VH5 A;  1KX4 C;  5CPJ D;  2F2A C;  5CPI A;  2YFV B;  5B1M A;  5G49 B;  3AZI A;  2NQB B;  1HTA A;  3KXB A;  1AOI C;  4H9R A;  4R8P D;  4JJN D;  1F66 D;  4NFT A;  3H0L C;  5B2I D;  5AVC C;  3MGS D;  3EPL A;  4WU9 A;  1HQ3 D;  4YM6 B;  4QLC D;  5B2J A;  3AZL D;  1ID3 D;  3NQU B;  3WTP C;  3B6F D;  5B0Y C;  3AZE D;  1P3A D;  5AV8 B;  4KUD B;  5F99 B;  5CPJ A;  3MVD B;  3AV1 C;  5JA4 A;  3AZF B;  1Q9C A;  5AV6 D;  4WZS B;  2BG1 A;  3UTA C;  5B33 D;  1F66 A;  2F8N A;  3AYW B;  5B2I A;  4NE3 A;  3TU4 D;  3WAA C;  2NZD C;  4ZUX C;  4QLC A;  1ID3 A;  4KGC A;  4M6B A;  2Y2Q A;  5GT3 C;  3LJA D;  3REJ C;  3AZE A;  1M19 C;  5GXQ A;  1ZLA D;  1P3G A;  1P3I B;  1P3K C;  5AV6 A;  3MGR D;  3AV2 D;  4Z66 C;  1P3L B;  4LD9 A;  5B33 A;  3LEL C;  3W98 B;  4J8V C;  1P3F B;  1EQZ D;  5C3I B;  5KDM B;  4X23 A;  3O62 A;  4XZQ D;  3AZG C;  1T3U A;  1M1A C;  3H0M C;  4Z2M G;  5CPK A;  5CPI C;  5B1M C;  3AZI C;  3VH5 W;  2BYM B;  3MGR A;  3AV2 A;  3KXB C;  1B67 A;  3A1I A;  5CPJ B;  5JA4 B;  3AZH C;  1P3O D;  2Y2O A;  1BH9 B;  4R8P B;  4JJN B;  4WU9 C;  1F66 B;  5B2I B;  5B2J C;  3MGS B;  2Y2L A;  1TZY D;  3AN2 C;  1HQ3 B;  3AFA D;  4QLC B;  3AZL B;  3X1U D;  1ID3 B;  3MGQ D;  3B6F B;  3AZE B;  1P3A B;  2HIO D;  3EG5 B;  5BNX A;  2Y2H A;  1P3G B;  5FUG B;  5AV6 B;  3LZ0 A;  3W97 A;  5B31 A;  5B33 B;  4H9N B;  4H9P B;  5CHL B;  3V9R A;  3TU4 B;  3C1B D;  4KGC C;  3AZJ D;  4H9Q B;  5GXQ C;  3C1C D;  3X1S A;  1P3G C;  3UTB D;  3LJA B;  4E44 A;  2HIO A;  1ZLA B;  4LD9 C;  3MGR B;  2PYO D;  3AV2 B;  4X23 C;  3O62 C;  5B1L A;  1EQZ B;  4XZQ B;  1TAF B;  5B0Z D;  1P3B D;  3C1C A;  5CPK C;  3AZM C;  5DNN A;  2CWE A;  5E5A D;  5BNV A;  5AVB A;  1P3M D;  4HGA B;  1P3P D;  3UT9 D;  5GSU D;  1P3O B;  4G92 B;  4G91 B;  1KX5 D;  3KUY C;  5B0Z A;  3V9R B;  4XUJ C;  1TZY B;  2NQB A;  3AFA B;  1P3M A;  3WA9 D;  3X1U B;  2Y2N A;  3MNN D;  1P3P A;  4J8U C;  3UT9 A;  3LZ0 C;  2HIO B;  2LY8 A;  3W97 C;  5B31 C;  1U35 C;  2DQN C;  4YM6 A;  4WV4 B;  3P5J B;  1KX5 A;  4KUD A;  3MVD A;  3X1S C;  3C1B B;  2BYK B;  2G5H C;  3AZF A;  5AV5 C;  3WA9 A;  2ARO D;  3C1C B;  3B6G D;  3AZK D;  3AYW A;  3MNN A;  2W8S A;  4EO5 C;  3UTB B;  5AY8 C;  5B1L C;  2PYO B;  5CP6 C;  1JFI A;  1P3I A;  5DNN C;  3X1V C;  5AVB C;  5B0Z B;  5B40 C;  2ZM5 A;  1P3B B;  1P3L A;  3AZK A;  3W98 A;  1P3F A;  5E5A B;  1P3M B;  3W96 D;  5DNM D;  5KDM A;  2FJ7 D;  4J8W D;  3KWQ D;  2CV5 D;  1P3P B;  4Z5T D;  3UT9 B;  1P34 C;  5BT1 C;  5GSU B;  2Y2K A;  2JE5 A;  3VH6 T;  3A6N D;  1KX5 B;  2BYM A;  2NQB C;  2JSS A;  2ZY2 A;  3UT9 C;  3WA9 B;  1BH9 A;  2FJ7 A;  4R8P A;  3LZ1 D;  4JJN A;  3KWQ A;  5AV9 D;  4YM6 C;  3MNN B;  3X1T D;  3REL D;  3MGS A;  1HQ3 A;  4KUD C;  5AV8 C;  3AZL A;  5F99 C;  3MVD C;  1ULY A;  1M18 D;  3AZF C;  3NQJ A;  3REH D;  3B6F A;  1P3A A;  1JFI B;  3AYW C;  5FUG A;  2VQR A;  2XD5 A;  2ARO B;  4H9N A;  4H9P A;  3AZK B;  3B6G B;  3REI D;  1N1J A;  3X1T A;  3TU4 A;  4H9Q A;  2JCH A;  1M18 A;  1P3I C;  1Z2C B;  3LJA A;  4WU8 D;  1ZLA A;  1P3L C;  1F1E A;  3B0D B;  3B0C T;  3W98 C;  1P3F C;  5C3I C;  2YFW B;  3REI A;  5B32 D;  1EQZ A;  3W96 B;  5DNM B;  4ZBJ B;  3W99 D;  2FJ7 B;  4J8W B;  5JRG D;  4XZQ A;  1TAF A;  3KWQ B;  2CV5 B;  4Z5T B;  3AZN D;  5GT0 D;  5B24 D;  5CPJ C;  3R45 A;  3A6N B;  3NQJ B;  4J8X D;  4R8P C;  4JJN C;  1F66 C;  2Y2I A;  5B2I C;  1P3O A;  3MGS C;  2HUE B;  3W99 A;  3LZ1 B;  1HQ3 C;  5AV9 B;  1N1J B;  4QLC C;  3AZL C;  3X1T B;  3REL B;  1ID3 C;  4WJ3 C;  1TZY A;  3B6F C;  3AFA A;  3AZE C;  5B24 A;  1P3A C;  3X1U A;  1WWI A;  1M18 B;  3MGQ A;  5AV6 C;  4J8X A;  3REH B;  5B33 C;  3WKJ D;  4WNN A;  1S32 D;  3MGP D;  3TU4 C;  3EPH A;  2RVQ D;  4YS3 D;  3REI B;  2XD1 A;  1KX3 D;  3C1B A;  2BYK A;  3REK D;  3LJA C;  3AZJ A;  1ZLA C;  1BFM A;  3UTB A;  3MGR C;  3AV2 C;  4WU8 B;  2RIQ A;  3R45 B;  3WKJ A;  1EQZ C;  2PYO A;  1H3O B;  1S32 A;  3MGP A;  4CSR B;  2J8P A;  4XZQ C;  3EPJ A;  5B32 B;  1KX4 D;  1KU5 A;  3W99 B;  5JRG B;  1P3B A;  1AOI D;  4HGA C;  3AZN B;  5E5A A;  5GT0 B;  5B24 B;  5AVC D;  3MGQ B;  4J8X B;  1P3O C;  3H0R C;  4G92 C;  4G91 C;  2ZY3 A;  3WTP D;  4WNN B;  5B0Y D;  5GSU A;  1KX4 A;  1TZY C;  3AV1 D;  3AFA C;  3X1U C;  3VH5 T;  3UTA D;  3MGQ C;  3IP4 C;  3AZJ B;  3WTP A;  2HIO C;  5AVC A;  3WAA D;  2NZD D;  4ZUX D;  4AWL B;  3WKJ B;  5GT3 D;  3REJ D;  1S32 B;  4H9O B;  3MGP B;  1M19 D;  3C1B C;  3AV1 A;  2ZY5 A;  2IO5 B;  3AZJ C;  4YS3 B;  1P3K D;  3C1C C;  2L5A A;  4Z66 D;  1KX3 B;  3LEL D;  3REK B;  3UTB C;  4J8V D;  2ARO A;  3B6G A;  2NZD A;  4UPK A;  2PYO C;  3AZG D;  4ZUX A;  5B32 G;  1M1A D;  4DRB A;  4UUZ B;  5GT3 A;  5CPI D;  5B1M D;  3AZI D;  3AL0 C;  5B0Z C;  1P3B C;  3KXB D;  1KX4 B;  3LEL A;  5E5A C;  1P3M C;  3AZH D;  4NE5 A;  2YFW A;  1AOI B;  1P3P C;  4WU9 D;  3W96 A;  5AVC B;  5B2J D;  5DNM A;  2F8N K;  1M1A A;  4J8W A;  3AN2 D;  2CV5 A;  5GSU C;  4Z5T A;  1KX5 C;  5BO0 A;  3WTP B;  5B0Y B;  3A6N A;  4NE6 A;  3AV1 B;  2F8N D;  5B31 G;  3WA9 C;  3AZH A;  3UTA B;  3B0B A;  3MNN C;  4E45 A;  3LZ1 A;  4KGC D;  3WAA B;  5AV9 A;  3AN2 A;  2NZD B;  3REL A;  4ZUX B;  5GXQ D;  2F8N H;  4CAY B;  1P3G D;  5GT3 B;  3EPK A;  2Y2P A;  3REJ B;  1M19 B;  4LD9 D;  3FDD A;  3REH A;  1P3K B;  2ARO C;  4Z66 B;  3B6G C;  3AZK C;  3LEL B;  4X23 D;  3O62 D;  4J8V B;  1A7W A;  3VH6 A;  3AZG B;  5CPK D;  1M1A B;  3AZM D;  3AZF D;  3B0D C;  5BO0 B;  5CPI B;  5B1M B;  4WU8 A;  3AZI B;  3KXB B;  4H9R B;  1H3O A;  3W96 C;  4CSR A;  5DNM C;  4ZBJ C;  3AZH B;  2FJ7 C;  4J8W C;  3KWQ C;  3KUY D;  5BS7 A;  5B32 A;  4WU9 B;  2CV5 C;  4Z5T C;  5B2J B;  4XUJ D;  5JRG A;  3AZM A;  3AN2 B;  3A6N C;  3A1K A;  3AZN A;  5GT0 A;  4J8U D;  3LZ0 D;  3W97 D;  5B31 D;  1U35 D;  1WWS A;  2F8N B;  2HUE C;  3LZ1 C;  2UWX A;  5AV9 C;  3KUY A;  3X1T C;  3REL C;  1W2E A;  4XUJ A;  3X1S D;  4KGC B;  5AV5 D;  5GXQ B;  1M18 C;  3REH C;  4J8U A;  4LD9 B;  1U35 A;  5AY8 D;  4KHA A;  5B1L D;  5CP6 D;  3REI C;  2Y2M A;  4X23 B;  3O62 B;  4H9O A;  5DNN D;  3X1V D;  4H9S A;  3VH6 W;  5AVB D;  4YS3 A;  5AV5 A;  5B40 D;  3WTP E;  1KX3 A;  3REK A;  5CPK B;  3F6T A;  3AZM B;  4WU8 C;  5AY8 A;  1P34 D;  5CP6 A;  4UUZ A;  5BS7 C;  5BT1 D;  5B32 C;  3W99 C;  5JRG C;  2Y2G A;  3X1V A;  3KUY B;  2NQB D;  5B40 A;  2FFF B;  4XUJ B;  3AZN C;  2DF4 C;  5GT0 C;  5B24 C;  2F8N G;  1AOI A;  5BNX B;  1BH8 A;  4J8X C;  4YM6 D;  4J8U B;  1R4V A;  3LZ0 B;  3W97 B;  4Z2M H;  5B31 B;  1U35 B;  1P34 A;  4KHA B;  4KUD D;  5AV8 D;  5F99 D;  3MVD D;  2YFV A;  5G49 A;  5B0Y A;  3KFU G; 
#chains in the Genus database with same CATH homology
 4DRA A;  1B6W A;  3X1S B;  3AYW D;  3B0C W;  5AV5 B;  3UTA A;  2G5I C;  2ZY4 A;  4AWL C;  4EO5 B;  4DQY B;  3KSY A;  3NQU A;  3WAA A;  3WKJ C;  5AY8 B;  5AV8 A;  1S32 C;  5B1L B;  5F99 A;  3MGP C;  4CAY A;  2RVQ C;  2IO5 C;  1P3I D;  5CP6 B;  4H9S C;  4YS3 C;  3REJ A;  1PZR A;  1KX3 C;  1P3L D;  1M19 A;  3REK C;  3W98 D;  5DNN B;  3X1V B;  1P3K A;  5BNV B;  5AVB B;  1P3F D;  5B40 B;  4Z66 A;  4J8V A;  1BH8 B;  3AZG A;  1P34 B;  2Y2J A;  3VH5 A;  1KX4 C;  5CPJ D;  2F2A C;  5CPI A;  2YFV B;  5B1M A;  5G49 B;  3AZI A;  2NQB B;  1HTA A;  3KXB A;  1AOI C;  4H9R A;  4R8P D;  4JJN D;  1F66 D;  4NFT A;  3H0L C;  5B2I D;  5AVC C;  3MGS D;  3EPL A;  4WU9 A;  1HQ3 D;  4YM6 B;  4QLC D;  5B2J A;  3AZL D;  1ID3 D;  3NQU B;  3WTP C;  3B6F D;  5B0Y C;  3AZE D;  1P3A D;  5AV8 B;  4KUD B;  5F99 B;  5CPJ A;  3MVD B;  3AV1 C;  5JA4 A;  3AZF B;  1Q9C A;  5AV6 D;  4WZS B;  2BG1 A;  3UTA C;  5B33 D;  1F66 A;  2F8N A;  3AYW B;  5B2I A;  4NE3 A;  3TU4 D;  3WAA C;  2NZD C;  4ZUX C;  4QLC A;  1ID3 A;  4KGC A;  4M6B A;  2Y2Q A;  5GT3 C;  3LJA D;  3REJ C;  3AZE A;  1M19 C;  5GXQ A;  1ZLA D;  1P3G A;  1P3I B;  1P3K C;  5AV6 A;  3MGR D;  3AV2 D;  4Z66 C;  1P3L B;  4LD9 A;  5B33 A;  3LEL C;  3W98 B;  4J8V C;  1P3F B;  1EQZ D;  5C3I B;  5KDM B;  4X23 A;  3O62 A;  4XZQ D;  3AZG C;  1T3U A;  1M1A C;  3H0M C;  4Z2M G;  5CPK A;  5CPI C;  5B1M C;  3AZI C;  3VH5 W;  2BYM B;  3MGR A;  3AV2 A;  3KXB C;  1B67 A;  3A1I A;  5CPJ B;  5JA4 B;  3AZH C;  1P3O D;  2Y2O A;  1BH9 B;  4R8P B;  4JJN B;  4WU9 C;  1F66 B;  5B2I B;  5B2J C;  3MGS B;  2Y2L A;  1TZY D;  3AN2 C;  1HQ3 B;  3AFA D;  4QLC B;  3AZL B;  3X1U D;  1ID3 B;  3MGQ D;  3B6F B;  3AZE B;  1P3A B;  2HIO D;  3EG5 B;  5BNX A;  2Y2H A;  1P3G B;  5FUG B;  5AV6 B;  3LZ0 A;  3W97 A;  5B31 A;  5B33 B;  4H9N B;  4H9P B;  5CHL B;  3V9R A;  3TU4 B;  3C1B D;  4KGC C;  3AZJ D;  4H9Q B;  5GXQ C;  3C1C D;  3X1S A;  1P3G C;  3UTB D;  3LJA B;  4E44 A;  2HIO A;  1ZLA B;  4LD9 C;  3MGR B;  2PYO D;  3AV2 B;  4X23 C;  3O62 C;  5B1L A;  1EQZ B;  4XZQ B;  1TAF B;  5B0Z D;  1P3B D;  3C1C A;  5CPK C;  3AZM C;  5DNN A;  2CWE A;  5E5A D;  5BNV A;  5AVB A;  1P3M D;  4HGA B;  1P3P D;  3UT9 D;  5GSU D;  1P3O B;  4G92 B;  4G91 B;  1KX5 D;  3KUY C;  5B0Z A;  3V9R B;  4XUJ C;  1TZY B;  2NQB A;  3AFA B;  1P3M A;  3WA9 D;  3X1U B;  2Y2N A;  3MNN D;  1P3P A;  4J8U C;  3UT9 A;  3LZ0 C;  2HIO B;  2LY8 A;  3W97 C;  5B31 C;  1U35 C;  2DQN C;  4YM6 A;  4WV4 B;  3P5J B;  1KX5 A;  4KUD A;  3MVD A;  3X1S C;  3C1B B;  2BYK B;  2G5H C;  3AZF A;  5AV5 C;  3WA9 A;  2ARO D;  3C1C B;  3B6G D;  3AZK D;  3AYW A;  3MNN A;  2W8S A;  4EO5 C;  3UTB B;  5AY8 C;  5B1L C;  2PYO B;  5CP6 C;  1JFI A;  1P3I A;  5DNN C;  3X1V C;  5AVB C;  5B0Z B;  5B40 C;  2ZM5 A;  1P3B B;  1P3L A;  3AZK A;  3W98 A;  1P3F A;  5E5A B;  1P3M B;  3W96 D;  5DNM D;  5KDM A;  2FJ7 D;  4J8W D;  3KWQ D;  2CV5 D;  1P3P B;  4Z5T D;  3UT9 B;  1P34 C;  5BT1 C;  5GSU B;  2Y2K A;  2JE5 A;  3VH6 T;  3A6N D;  1KX5 B;  2BYM A;  2NQB C;  2JSS A;  2ZY2 A;  3UT9 C;  3WA9 B;  1BH9 A;  2FJ7 A;  4R8P A;  3LZ1 D;  4JJN A;  3KWQ A;  5AV9 D;  4YM6 C;  3MNN B;  3X1T D;  3REL D;  3MGS A;  1HQ3 A;  4KUD C;  5AV8 C;  3AZL A;  5F99 C;  3MVD C;  1ULY A;  1M18 D;  3AZF C;  3NQJ A;  3REH D;  3B6F A;  1P3A A;  1JFI B;  3AYW C;  5FUG A;  2VQR A;  2XD5 A;  2ARO B;  4H9N A;  4H9P A;  3AZK B;  3B6G B;  3REI D;  1N1J A;  3X1T A;  3TU4 A;  4H9Q A;  2JCH A;  1M18 A;  1P3I C;  1Z2C B;  3LJA A;  4WU8 D;  1ZLA A;  1P3L C;  1F1E A;  3B0D B;  3B0C T;  3W98 C;  1P3F C;  5C3I C;  2YFW B;  3REI A;  5B32 D;  1EQZ A;  3W96 B;  5DNM B;  4ZBJ B;  3W99 D;  2FJ7 B;  4J8W B;  5JRG D;  4XZQ A;  1TAF A;  3KWQ B;  2CV5 B;  4Z5T B;  3AZN D;  5GT0 D;  5B24 D;  5CPJ C;  3R45 A;  3A6N B;  3NQJ B;  4J8X D;  4R8P C;  4JJN C;  1F66 C;  2Y2I A;  5B2I C;  1P3O A;  3MGS C;  2HUE B;  3W99 A;  3LZ1 B;  1HQ3 C;  5AV9 B;  1N1J B;  4QLC C;  3AZL C;  3X1T B;  3REL B;  1ID3 C;  4WJ3 C;  1TZY A;  3B6F C;  3AFA A;  3AZE C;  5B24 A;  1P3A C;  3X1U A;  1WWI A;  1M18 B;  3MGQ A;  5AV6 C;  4J8X A;  3REH B;  5B33 C;  3WKJ D;  4WNN A;  1S32 D;  3MGP D;  3TU4 C;  3EPH A;  2RVQ D;  4YS3 D;  3REI B;  2XD1 A;  1KX3 D;  3C1B A;  2BYK A;  3REK D;  3LJA C;  3AZJ A;  1ZLA C;  1BFM A;  3UTB A;  3MGR C;  3AV2 C;  4WU8 B;  2RIQ A;  3R45 B;  3WKJ A;  1EQZ C;  2PYO A;  1H3O B;  1S32 A;  3MGP A;  4CSR B;  2J8P A;  4XZQ C;  3EPJ A;  5B32 B;  1KX4 D;  1KU5 A;  3W99 B;  5JRG B;  1P3B A;  1AOI D;  4HGA C;  3AZN B;  5E5A A;  5GT0 B;  5B24 B;  5AVC D;  3MGQ B;  4J8X B;  1P3O C;  3H0R C;  4G92 C;  4G91 C;  2ZY3 A;  3WTP D;  4WNN B;  5B0Y D;  5GSU A;  1KX4 A;  1TZY C;  3AV1 D;  3AFA C;  3X1U C;  3VH5 T;  3UTA D;  3MGQ C;  3IP4 C;  3AZJ B;  3WTP A;  2HIO C;  5AVC A;  3WAA D;  2NZD D;  4ZUX D;  4AWL B;  3WKJ B;  5GT3 D;  3REJ D;  1S32 B;  4H9O B;  3MGP B;  1M19 D;  3C1B C;  3AV1 A;  2ZY5 A;  2IO5 B;  3AZJ C;  4YS3 B;  1P3K D;  3C1C C;  2L5A A;  4Z66 D;  1KX3 B;  3LEL D;  3REK B;  3UTB C;  4J8V D;  2ARO A;  3B6G A;  2NZD A;  4UPK A;  2PYO C;  3AZG D;  4ZUX A;  5B32 G;  1M1A D;  4DRB A;  4UUZ B;  5GT3 A;  5CPI D;  5B1M D;  3AZI D;  3AL0 C;  5B0Z C;  1P3B C;  3KXB D;  1KX4 B;  3LEL A;  5E5A C;  1P3M C;  3AZH D;  4NE5 A;  2YFW A;  1AOI B;  1P3P C;  4WU9 D;  3W96 A;  5AVC B;  5B2J D;  5DNM A;  2F8N K;  1M1A A;  4J8W A;  3AN2 D;  2CV5 A;  5GSU C;  4Z5T A;  1KX5 C;  5BO0 A;  3WTP B;  5B0Y B;  3A6N A;  4NE6 A;  3AV1 B;  2F8N D;  5B31 G;  3WA9 C;  3AZH A;  3UTA B;  3B0B A;  3MNN C;  4E45 A;  3LZ1 A;  4KGC D;  3WAA B;  5AV9 A;  3AN2 A;  2NZD B;  3REL A;  4ZUX B;  5GXQ D;  2F8N H;  4CAY B;  1P3G D;  5GT3 B;  3EPK A;  2Y2P A;  3REJ B;  1M19 B;  4LD9 D;  3FDD A;  3REH A;  1P3K B;  2ARO C;  4Z66 B;  3B6G C;  3AZK C;  3LEL B;  4X23 D;  3O62 D;  4J8V B;  1A7W A;  3VH6 A;  3AZG B;  5CPK D;  1M1A B;  3AZM D;  3AZF D;  3B0D C;  5BO0 B;  5CPI B;  5B1M B;  4WU8 A;  3AZI B;  3KXB B;  4H9R B;  1H3O A;  3W96 C;  4CSR A;  5DNM C;  4ZBJ C;  3AZH B;  2FJ7 C;  4J8W C;  3KWQ C;  3KUY D;  5BS7 A;  5B32 A;  4WU9 B;  2CV5 C;  4Z5T C;  5B2J B;  4XUJ D;  5JRG A;  3AZM A;  3AN2 B;  3A6N C;  3A1K A;  3AZN A;  5GT0 A;  4J8U D;  3LZ0 D;  3W97 D;  5B31 D;  1U35 D;  1WWS A;  2F8N B;  2HUE C;  3LZ1 C;  2UWX A;  5AV9 C;  3KUY A;  3X1T C;  3REL C;  1W2E A;  4XUJ A;  3X1S D;  4KGC B;  5AV5 D;  5GXQ B;  1M18 C;  3REH C;  4J8U A;  4LD9 B;  1U35 A;  5AY8 D;  4KHA A;  5B1L D;  5CP6 D;  3REI C;  2Y2M A;  4X23 B;  3O62 B;  4H9O A;  5DNN D;  3X1V D;  4H9S A;  3VH6 W;  5AVB D;  4YS3 A;  5AV5 A;  5B40 D;  3WTP E;  1KX3 A;  3REK A;  5CPK B;  3F6T A;  3AZM B;  4WU8 C;  5AY8 A;  1P34 D;  5CP6 A;  4UUZ A;  5BS7 C;  5BT1 D;  5B32 C;  3W99 C;  5JRG C;  2Y2G A;  3X1V A;  3KUY B;  2NQB D;  5B40 A;  2FFF B;  4XUJ B;  3AZN C;  2DF4 C;  5GT0 C;  5B24 C;  2F8N G;  1AOI A;  5BNX B;  1BH8 A;  4J8X C;  4YM6 D;  4J8U B;  1R4V A;  3LZ0 B;  3W97 B;  4Z2M H;  5B31 B;  1U35 B;  1P34 A;  4KHA B;  4KUD D;  5AV8 D;  5F99 D;  3MVD D;  2YFV A;  5G49 A;  5B0Y A;  3KFU G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...