5DNMD

Nucleosome core particle containing adducts of ruthenium(ii)-toluene pta complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
95
structure length
95
Chain Sequence
b'KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
molecule tags Structural protein/dna
source organism Xenopus laevis
publication title Allosteric cross-talk in chromatin can mediate drug-drug synergy
pubmed doi rcsb
total genus 34
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5dnmD00
5B0ZA 3MGQC 4WV4B 3R45B 3B6FD 1KX4A 4HGAC 1M1AB 4KGCA 4KUDC 1P3PA 1WWSA 3AZIB 5F99D 1AOID 5G49B 3TU4B 3B0DB 1KX4B 1ZLAB 5JRGC 2PYOC 3AZIC 3W97D 2BYMA 1BFMA 1HQ3C 3AZLC 3WAAC 2NQBC 5B1MD 4J8UA 3C1BB 5E5AD 2YFWA 4YM6B 2F8NG 3A6NC 5B40B 1JFIB 3W99A 3AV1C 1ID3C 3MGSD 3LZ0C 3X1SA 4NE6A 3AZKC 5BNVB 3X1UA 2F8NK 3AZED 3LZ0B 1EQZC 4H9SA 5GT0C 3W97B 3AYWB 5B1MC 3X1UB 1KX5B 4JJNA 1P3GB 1H3OB 3MNNB 1P3AD 5G49A 3UT9C 3AV2D 3W98B 1HQ3B 3AZLB 3AN2D 2CV5B 1P3MD 3REHA 3NQUA 4J8XC 3C1CD 1P3KB 4J8VC 3LELD 1M1AC 4Z2MG 5B2JC 5B0YC 3AZGD 1ID3D 3LJAB 1KX5A 5B40A 1KX3D 3V9RA 2HUEB 5AVBA 4WU9B 1P3PC 3KUYD 5AV6D 5AVCA 5AV5C 1KX5D 3MGPA 2HIOD 5BNVA 3MGQD 3AYWC 4QLCC 5GT0B 4YM6C 5DNNB 3REJA 3MGRC 1S32D 3AZID 1P3MA 2FJ7A 5AV5D 3X1VC 3MVDA 3WA9B 3LELB 5CPKB 1BH9B 4KGCB 3LJAD 1P3KC 3LZ1A 1M19B 3KSYA 3AZKA 3X1SC 4UUZB 1BH9A 2JSSA 4Z66C 4X23D 4H9SC 5GT0A 4ZBJC 3MGSC 3AZEA 1U35D 3MGQB 4XUJD 3KXBC 3X1TC 2HUEC 4WU9C 1S32A 3AZMB 3WA9A 5GT3C 3RELA 5B0ZC 3MGQA 5AV5B 5C3IC 5AY8B 4QLCD 3MGPD 4J8VB 1P3LB 4J8XB 4R8PD 5AY8C 3REHC 5BO0A 5CPKC 4J8UD 5B2IA 3AZKD 2PYOA 3LJAA 2IO5B 4CAYA 4YS3B 3LELA 5B31G 4H9NB 4H9OA 5B1LA 3C1CA 3AZFC 1AOIA 3REHD 4JJNB 1P3GA 3B6GA 5JRGD 2NZDC 5B32D 1KX4D 3W96A 5FUGA 5B1LD 1P3FB 1U35C 5B0ZD 3AN2C 3B6GB 5BT1C 3MGRB 2HIOA 5B1MB 5CPKD 3LZ0A 5KDMB 3O62C 3AZMC 2YFVB 4Z5TC 3AZNA 1M1AD 1M18A 3W99B 1F66A 4J8WA 4ZUXC 3X1VD 3X1SB 5CPJC 1F66B 1EQZB 4XUJA 3B0DC 5B31C 3AFAA 3AYWD 5B0YB 4CAYB 4KHAB 3MGRD 1S32C 1P3AA 4WNNA 3C1BA 3AV2C 5CP6B 3W97A 5GXQC 4E45A 5B31D 1TZYD 3REIA 1P34D 5CP6A 5AV5A 4NE3A 3REJD 5CPIC 4LD9A 4H9RB 3V9RB 5GSUC 2BYKB 3MVDB 3KUYC 4J8XD 4WU8D 1P3OC 5B33A 5CPJB 5AV9B 5AVCD 1WWIA 5AV8A 1HQ3D 3AZLD 3AN2B 1P3IB 2BYKA 5B40D 3AV1D 3KWQB 3UTAB 1AOIB 3AZGA 1M19A 4Z66B 4ZBJB 3MGSB 5GXQD 4H9QB 5AVBB 3AZNB 3AZEB 5F99A 1KX4C 5AV6B 2AROB 1EQZA 2F8NA 2AROC 3O62D 5AVCB 5AV9D 1P3ID 3W98D 4J8WB 4G92C 5B0YA 5B40C 3AV1B 5KDMA 5GT3D 3X1SD 5B24D 5AV9C 1P3IC 3B0CW 5B24A 3WAAB 1ZLAD 3B6FC 1A7WA 4WU9D 3W96B 3REKB 3B6GC 5B2JA 2NZDA 3C1BD 2HIOB 1F1EA 5B1MA 1R4VA 4XUJB 3REIB 4G91B 3TU4D 5AV6C 3WTPD 3UT9B 3AZJD 3W98C 4M6BA 5B2IB 4DRAA 3AYWA 2NQBA 3UT9A 3MGPB 3UTBD 5B24B 2F8NH 1ULYA 1M18C 1ZLAA 3X1UC 3AZHC 3REKA 1M19D 5GT3A 3AV1A 1N1JA 5DNMC 3UTAA 3REJC 3B0CT 5DNND 1P3KA 2YFWB 4AWLB 3UTAD 4WU8A 1P3BD 5JA4B 4H9PB 5CPKA 3A6NB 1P3AC 3AZMD 4G92B 4H9NA 5B1LB 3LZ1B 2YFVA 2F8ND 3WKJC 4LD9D 1EQZD 3MNNA 4Z5TB 5DNMD 3KXBA 3C1BC 5B2JB 4CSRB 5JRGA 3NQJA 4YM6A 4J8VD 3REIC 1P3FA 1KX3C 1P3MC 4KGCC 3WKJD 1KX3B 3UTBC 1U35B 4HGAB 5B31B 5DNNC 4R8PA 1HQ3A 3AZLA 2NZDD 3W99C 4Z5TA 3KWQA 1KX5C 4Z66A 5AVBC 4LD9B 4R8PB 4AWLC 3RELD 5E5AB 3WA9D 5GSUB 4WZSB 4ZUXA 3MVDC 3X1VA 1P3BC 1HTAA 5B33B 3AZFD 5CPJA 1P3LC 1U35A 5GT0D 3AZHB 1M18B 1S32B 3WTPC 3AZJC 3KXBB 3LZ0D 4H9QA 3AZNC 3AZEC 2NZDB 4JJNC 5B32A 2CWEA 4WU8B 3MVDD 4X23C 1AOIC 5CPJD 4KHAA 1P3AB 1P3GC 5AY8D 3X1TD 4KUDD 4ZUXD 4XZQA 3W96C 2RVQD 3O62B 2PYOD 4J8WD 3VH6A 3WA9C 1M18D 1M1AA 5AV8D 1P3BB 5BO0B 4YS3D 2CV5A 4J8UC 5CPID 3B0BA 4J8WC 3MGPC 5BS7C 4KUDA 1P3OD 3LJAC 4XZQB 1P3FD 3W96D 3B6GD 5CP6D 1BH8A 1P3GD 2HIOC 5FUGB 5B31A 3REHB 3WAAA 4DRBA 5B33C 4EO5C 1ZLAC 2PYOB 5AV8C 4X23B 1P3BA 1Q9CA 4YS3A 5B2ID 1F66C 5F99B 4H9OB 3C1CB 1P3KD 3LZ1C 5CPIB 3X1UD 1P3PB 2IO5C 3AZGB 4NE5A 3MGSA 2LY8A 1JFIA 3KUYB 5AY8A 4Z66D 3B6FB 2BYMB 3AZKB 5E5AA 4X23A 3AZND 3KUYA 1P3FC 1KX3A 3AFAC 5GT3B 3LELC 4XZQC 4CSRA 3WAAD 5B2JD 3R45A 1TZYC 5JA4A 1P34C 4YM6D 4J8VA 5B1LC 3AZFA 1B6WA 3B6FA 3WKJB 1P3OA 3MNND 3TU4C 5BNXB 4H9RA 5JRGB 3VH5T 3WTPB 3AZJB 1BH8B 5CPIA 1TAFA 3REJB 1H3OA 5C3IB 2CV5D 4Z5TD 5DNMB 5B0ZB 3A6NA 1B67A 5AVBD 5BT1D 4QLCA 3VH5A 5GSUD 4WNNB 5F99C 4WU8C 3C1CC 1P3LD 4XZQD 1N1JB 3W99D 3WTPE 2AROD 3X1TA 3MNNC 3UT9D 2NQBD 3RELC 1P3MB 4G91C 4XUJC 3KXBD 3NQUB 5GXQA 3W97C 3UTBB 1TZYB 3LZ1D 4Z2MH 1P34B 2F8NB 5B2IC 4QLCB 5B32B 3VH5W 4WU9A 1P3PD 4LD9C 3UTAC 3AFAB 4KGCD 3X1TB 3AZIA 2FJ7D 3REKD 3VH6W 2L5AA 5BS7A 2NQBB 3UTBA 3KWQD 5AVCC 1TZYA 5AV8B 3REID 1P34A 4UUZA 4EO5B 5AV6A 3W98A 2RVQC 3O62A 3WTPA 3AZJA 1ID3A 3TU4A 1TAFB 4KUDB 3MGRA 3NQJB 4NFTA 5B32G 2FJ7C 3AZFB 3WKJA 5CP6C 1M19C 4YS3C 3AFAD 3AV2B 3AZHA 2FJ7B 5GXQB 3AZHD 1KU5A 2AROA 3AN2A 1P3LA 3AV2A 3KWQC 5DNMA 5GSUA 3X1VB 3AZMA 1F66D 3RELB 4JJND 3REKC 1ID3B 3A6ND 1P3OB 4E44A 5CHLB 5BNXA 5B33D 5DNNA 5E5AC 5B0YD 3AZGC 4J8XA 4R8PC 5AV9A 1P3IA 3VH6T 4J8UB 5B24C 4ZUXB 4H9PA 2CV5C 5B32C
chains in the Genus database with same CATH superfamily
5B0ZA 3MGQC 4WV4B 3R45B 3B6FD 1KX4A 4HGAC 1M1AB 4KGCA 4KUDC 1P3PA 1WWSA 3AZIB 5F99D 1AOID 5G49B 3TU4B 3B0DB 1KX4B 1ZLAB 5JRGC 2PYOC 3AZIC 3W97D 2BYMA 1BFMA 1HQ3C 3AZLC 3WAAC 2NQBC 5B1MD 4J8UA 2RIQA 3C1BB 5E5AD 2YFWA 3IP4C 4YM6B 2F8NG 3A6NC 5B40B 1JFIB 3W99A 3AV1C 1ID3C 3MGSD 2DF4C 3LZ0C 4DQYB 3X1SA 4NE6A 3AZKC 5BNVB 2Y2MA 3X1UA 2F8NK 3AZED 3LZ0B 1EQZC 4H9SA 5GT0C 3W97B 3AYWB 5B1MC 3X1UB 1KX5B 4JJNA 1P3GB 1H3OB 3MNNB 1P3AD 2Y2HA 5G49A 3UT9C 3AV2D 2UWXA 3W98B 1HQ3B 3AZLB 3AN2D 2Y2LA 2CV5B 1P3MD 3FDDA 3REHA 3NQUA 4J8XC 3C1CD 1P3KB 4J8VC 3LELD 3EPKA 1M1AC 2Y2PA 4Z2MG 5B2JC 5B0YC 3EPJA 3AZGD 3LJAB 2Y2KA 1ID3D 1KX5A 5B40A 1KX3D 3V9RA 2HUEB 5AVBA 4WU9B 1P3PC 3KUYD 5AV6D 5AVCA 5AV5C 1KX5D 3MGPA 2JCHA 2HIOD 5BNVA 3MGQD 3AYWC 4QLCC 5GT0B 4YM6C 5DNNB 3REJA 3MGRC 1S32D 3AZID 1P3MA 2FJ7A 5AV5D 3X1VC 3MVDA 3WA9B 3LELB 5CPKB 1BH9B 4KGCB 3LJAD 1P3KC 3LZ1A 1M19B 3KSYA 3AZKA 3X1SC 4UUZB 1BH9A 2JSSA 4Z66C 4X23D 4H9SC 5GT0A 4ZBJC 3MGSC 3AZEA 1U35D 3MGQB 4XUJD 3KXBC 3X1TC 2HUEC 4WU9C 1S32A 2W8SA 3AZMB 3WA9A 5GT3C 3RELA 5B0ZC 3MGQA 5AV5B 5C3IC 5AY8B 4QLCD 3MGPD 4J8VB 1P3LB 4J8XB 4R8PD 5AY8C 3REHC 5BO0A 2ZY2A 5CPKC 4J8UD 5B2IA 3AZKD 2PYOA 3A1IA 3LJAA 2IO5B 4CAYA 4YS3B 3LELA 5B31G 4H9NB 4H9OA 5B1LA 3C1CA 3AZFC 1AOIA 3REHD 4JJNB 1P3GA 3B6GA 5JRGD 2NZDC 5B32D 1KX4D 3W96A 2F2AC 5FUGA 5B1LD 1P3FB 1U35C 5B0ZD 3AN2C 3B6GB 5BT1C 3MGRB 2HIOA 5B1MB 5CPKD 3LZ0A 2ZM5A 5KDMB 3O62C 3AZMC 2YFVB 4Z5TC 3AZNA 1M1AD 1M18A 3W99B 1W2EA 1F66A 4J8WA 4ZUXC 3X1VD 3X1SB 5CPJC 3P5JB 1F66B 1EQZB 4XUJA 2Y2OA 3B0DC 5B31C 3AFAA 3AYWD 5B0YB 4CAYB 4KHAB 3MGRD 1S32C 1P3AA 1PZRA 4WNNA 3C1BA 3AV2C 5CP6B 3W97A 5GXQC 4E45A 5B31D 1TZYD 3REIA 1P34D 5CP6A 2Y2JA 5AV5A 4NE3A 3REJD 5CPIC 4LD9A 4H9RB 4WJ3C 3V9RB 5GSUC 2BYKB 3MVDB 3KUYC 4J8XD 4WU8D 1P3OC 5B33A 5CPJB 2XD1A 5AVCD 5AV9B 1WWIA 5AV8A 1HQ3D 3AZLD 3AN2B 1P3IB 2BYKA 5B40D 3AV1D 3KWQB 3UTAB 1AOIB 3AZGA 1M19A 4Z66B 4ZBJB 3MGSB 5GXQD 4H9QB 5AVBB 3AZNB 3AZEB 5F99A 1KX4C 5AV6B 2AROB 1EQZA 2F8NA 2AROC 3O62D 2DQNC 5AVCB 5AV9D 1P3ID 4J8WB 4G92C 5B0YA 3W98D 2Y2NA 5B40C 3AV1B 5KDMA 3H0RC 5GT3D 5B24D 3X1SD 5AV9C 1P3IC 2JE5A 3B0CW 5B24A 3WAAB 1ZLAD 3B6FC 1A7WA 4WU9D 3W96B 3REKB 2VQRA 3B6GC 5B2JA 2NZDA 2G5HC 2Y2GA 3C1BD 2HIOB 1F1EA 5B1MA 1R4VA 4XUJB 3REIB 4G91B 3TU4D 5AV6C 3WTPD 3UT9B 3AZJD 3W98C 2FFFB 4M6BA 5B2IB 4DRAA 3AYWA 2NQBA 3UT9A 3MGPB 3UTBD 5B24B 2F8NH 1ULYA 1M18C 1ZLAA 3X1UC 3AZHC 3REKA 1M19D 5GT3A 3AV1A 1N1JA 5DNMC 2ZY5A 3UTAA 3REJC 3B0CT 5DNND 1P3KA 2YFWB 4AWLB 3UTAD 4WU8A 1P3BD 5JA4B 4H9PB 5CPKA 3A6NB 1P3AC 3AZMD 4G92B 4H9NA 5B1LB 3LZ1B 2YFVA 2F8ND 3WKJC 4LD9D 1EQZD 3MNNA 4Z5TB 5DNMD 3KXBA 3C1BC 5B2JB 4CSRB 5JRGA 3NQJA 4YM6A 4J8VD 3REIC 1P3FA 1KX3C 1P3MC 4KGCC 3WKJD 1KX3B 3UTBC 1U35B 3EPLA 2Y2QA 4HGAB 5B31B 5DNNC 1T3UA 4R8PA 1HQ3A 3AZLA 2NZDD 3W99C 4Z5TA 3KWQA 1KX5C 4Z66A 5AVBC 4LD9B 4R8PB 4AWLC 3RELD 5E5AB 3WA9D 5GSUB 4WZSB 4ZUXA 3MVDC 3X1VA 1P3BC 1HTAA 5B33B 3AZFD 5CPJA 1P3LC 1U35A 5GT0D 3AZHB 1M18B 1S32B 3WTPC 3AZJC 3KXBB 3LZ0D 4H9QA 3AZNC 3AZEC 2NZDB 4JJNC 5B32A 2CWEA 4WU8B 3MVDD 4X23C 1AOIC 5CPJD 4KHAA 1P3AB 1P3GC 5AY8D 3X1TD 4KUDD 4ZUXD 4XZQA 3W96C 2RVQD 2ZY4A 3O62B 2PYOD 4J8WD 3VH6A 2XD5A 3WA9C 1M18D 1M1AA 5AV8D 1P3BB 5BO0B 2J8PA 3F6TA 4YS3D 2CV5A 4J8UC 5CPID 3B0BA 4J8WC 3MGPC 5BS7C 4KUDA 1P3OD 3LJAC 4XZQB 1P3FD 3W96D 3B6GD 5CP6D 1BH8A 1P3GD 2HIOC 5FUGB 5B31A 3REHB 3WAAA 4DRBA 5B33C 4EO5C 1ZLAC 2PYOB 5AV8C 3EPHA 4X23B 1P3BA 1Q9CA 4YS3A 5B2ID 1F66C 5F99B 4H9OB 3C1CB 1P3KD 3LZ1C 5CPIB 3X1UD 1P3PB 2IO5C 3AZGB 4NE5A 3MGSA 2LY8A 1JFIA 3KUYB 5AY8A 4Z66D 3B6FB 2BYMB 3AZKB 5E5AA 4X23A 3AZND 3KUYA 1P3FC 1KX3A 3AFAC 5GT3B 3LELC 4XZQC 4CSRA 3WAAD 5B2JD 3R45A 1Z2CB 1TZYC 5JA4A 1P34C 4YM6D 4J8VA 5B1LC 3AZFA 1B6WA 3B6FA 3WKJB 1P3OA 3MNND 3TU4C 5BNXB 4H9RA 5JRGB 3VH5T 3WTPB 3AZJB 1BH8B 5CPIA 1TAFA 3REJB 1H3OA 5C3IB 2CV5D 4Z5TD 5DNMB 5B0ZB 2BG1A 3A6NA 1B67A 5AVBD 3AL0C 5BT1D 4QLCA 3VH5A 5GSUD 4WNNB 5F99C 4WU8C 3C1CC 1P3LD 4XZQD 1N1JB 3W99D 3WTPE 2AROD 3X1TA 3MNNC 2G5IC 3UT9D 2NQBD 3RELC 3H0LC 1P3MB 4G91C 4XUJC 3KXBD 3NQUB 5GXQA 3W97C 3UTBB 1TZYB 3LZ1D 4Z2MH 1P34B 2F8NB 5B2IC 4QLCB 5B32B 3VH5W 4WU9A 1P3PD 4LD9C 3UTAC 3AFAB 4KGCD 3X1TB 3AZIA 2FJ7D 3REKD 3VH6W 2L5AA 5BS7A 2NQBB 3UTBA 4UPKA 3KWQD 5AVCC 1TZYA 5AV8B 3REID 1P34A 4UUZA 4EO5B 2Y2IA 5AV6A 3W98A 2RVQC 3O62A 3WTPA 3AZJA 1ID3A 3A1KA 3TU4A 1TAFB 4KUDB 3MGRA 3NQJB 4NFTA 5B32G 2FJ7C 3AZFB 3WKJA 5CP6C 1M19C 4YS3C 3AFAD 3AV2B 3AZHA 2FJ7B 5GXQB 3AZHD 1KU5A 2ZY3A 2AROA 3AN2A 1P3LA 3AV2A 3KWQC 5DNMA 5GSUA 3X1VB 3KFUG 3AZMA 1F66D 3RELB 4JJND 3REKC 3H0MC 1ID3B 3A6ND 1P3OB 4E44A 5CHLB 5BNXA 3EG5B 5DNNA 5E5AC 5B33D 5B0YD 3AZGC 4J8XA 4R8PC 5AV9A 1P3IA 3VH6T 4J8UB 5B24C 4ZUXB 4H9PA 2CV5C 5B32C
chains in the Genus database with same CATH topology
5B0ZA 3MGQC 4WV4B 3R45B 3B6FD 1KX4A 4HGAC 1M1AB 4KGCA 4KUDC 1P3PA 1WWSA 3AZIB 5F99D 1AOID 5G49B 3TU4B 3B0DB 1KX4B 1ZLAB 5JRGC 2PYOC 3AZIC 3W97D 2BYMA 1BFMA 1HQ3C 3AZLC 3WAAC 2NQBC 5B1MD 4J8UA 2RIQA 3C1BB 5E5AD 2YFWA 3IP4C 4YM6B 2F8NG 3A6NC 5B40B 1JFIB 3W99A 3AV1C 1ID3C 3MGSD 2DF4C 3LZ0C 4DQYB 3X1SA 4NE6A 3AZKC 5BNVB 2Y2MA 3X1UA 2F8NK 3AZED 3LZ0B 1EQZC 4H9SA 5GT0C 3W97B 3AYWB 5B1MC 3X1UB 1KX5B 4JJNA 1P3GB 1H3OB 3MNNB 1P3AD 2Y2HA 5G49A 3UT9C 3AV2D 2UWXA 3W98B 1HQ3B 3AZLB 3AN2D 2Y2LA 2CV5B 1P3MD 3FDDA 3REHA 3NQUA 4J8XC 3C1CD 1P3KB 4J8VC 3LELD 3EPKA 1M1AC 2Y2PA 4Z2MG 5B2JC 5B0YC 3EPJA 3AZGD 3LJAB 2Y2KA 1ID3D 1KX5A 5B40A 1KX3D 3V9RA 2HUEB 5AVBA 4WU9B 1P3PC 3KUYD 5AV6D 5AVCA 5AV5C 1KX5D 3MGPA 2JCHA 2HIOD 5BNVA 3MGQD 3AYWC 4QLCC 5GT0B 4YM6C 5DNNB 3REJA 3MGRC 1S32D 3AZID 1P3MA 2FJ7A 5AV5D 3X1VC 3MVDA 3WA9B 3LELB 5CPKB 1BH9B 4KGCB 3LJAD 1P3KC 3LZ1A 1M19B 3KSYA 3AZKA 3X1SC 4UUZB 1BH9A 2JSSA 4Z66C 4X23D 4H9SC 5GT0A 4ZBJC 3MGSC 3AZEA 1U35D 3MGQB 4XUJD 3KXBC 3X1TC 2HUEC 4WU9C 1S32A 2W8SA 3AZMB 3WA9A 5GT3C 3RELA 5B0ZC 3MGQA 5AV5B 5C3IC 5AY8B 4QLCD 3MGPD 4J8VB 1P3LB 4J8XB 4R8PD 5AY8C 3REHC 5BO0A 2ZY2A 5CPKC 4J8UD 5B2IA 3AZKD 2PYOA 3A1IA 3LJAA 2IO5B 4CAYA 4YS3B 3LELA 5B31G 4H9NB 4H9OA 5B1LA 3C1CA 3AZFC 1AOIA 3REHD 4JJNB 1P3GA 3B6GA 5JRGD 2NZDC 5B32D 1KX4D 3W96A 2F2AC 5FUGA 5B1LD 1P3FB 1U35C 5B0ZD 3AN2C 3B6GB 5BT1C 3MGRB 2HIOA 5B1MB 5CPKD 3LZ0A 2ZM5A 5KDMB 3O62C 3AZMC 2YFVB 4Z5TC 3AZNA 1M1AD 1M18A 3W99B 1W2EA 1F66A 4J8WA 4ZUXC 3X1VD 3X1SB 5CPJC 3P5JB 1F66B 1EQZB 4XUJA 2Y2OA 3B0DC 5B31C 3AFAA 3AYWD 5B0YB 4CAYB 4KHAB 3MGRD 1S32C 1P3AA 1PZRA 4WNNA 3C1BA 3AV2C 5CP6B 3W97A 5GXQC 4E45A 5B31D 1TZYD 3REIA 1P34D 5CP6A 2Y2JA 5AV5A 4NE3A 3REJD 5CPIC 4LD9A 4H9RB 4WJ3C 3V9RB 5GSUC 2BYKB 3MVDB 3KUYC 4J8XD 4WU8D 1P3OC 5B33A 5CPJB 2XD1A 5AVCD 5AV9B 1WWIA 5AV8A 1HQ3D 3AZLD 3AN2B 1P3IB 2BYKA 5B40D 3AV1D 3KWQB 3UTAB 1AOIB 3AZGA 1M19A 4Z66B 4ZBJB 3MGSB 5GXQD 4H9QB 5AVBB 3AZNB 3AZEB 5F99A 1KX4C 5AV6B 2AROB 1EQZA 2F8NA 2AROC 3O62D 2DQNC 5AVCB 5AV9D 1P3ID 4J8WB 4G92C 5B0YA 3W98D 2Y2NA 5B40C 3AV1B 5KDMA 3H0RC 5GT3D 5B24D 3X1SD 5AV9C 1P3IC 2JE5A 3B0CW 5B24A 3WAAB 1ZLAD 3B6FC 1A7WA 4WU9D 3W96B 3REKB 2VQRA 3B6GC 5B2JA 2NZDA 2G5HC 2Y2GA 3C1BD 2HIOB 1F1EA 5B1MA 1R4VA 4XUJB 3REIB 4G91B 3TU4D 5AV6C 3WTPD 3UT9B 3AZJD 3W98C 2FFFB 4M6BA 5B2IB 4DRAA 3AYWA 2NQBA 3UT9A 3MGPB 3UTBD 5B24B 2F8NH 1ULYA 1M18C 1ZLAA 3X1UC 3AZHC 3REKA 1M19D 5GT3A 3AV1A 1N1JA 5DNMC 2ZY5A 3UTAA 3REJC 3B0CT 5DNND 1P3KA 2YFWB 4AWLB 3UTAD 4WU8A 1P3BD 5JA4B 4H9PB 5CPKA 3A6NB 1P3AC 3AZMD 4G92B 4H9NA 5B1LB 3LZ1B 2YFVA 2F8ND 3WKJC 4LD9D 1EQZD 3MNNA 4Z5TB 5DNMD 3KXBA 3C1BC 5B2JB 4CSRB 5JRGA 3NQJA 4YM6A 4J8VD 3REIC 1P3FA 1KX3C 1P3MC 4KGCC 3WKJD 1KX3B 3UTBC 1U35B 3EPLA 2Y2QA 4HGAB 5B31B 5DNNC 1T3UA 4R8PA 1HQ3A 3AZLA 2NZDD 3W99C 4Z5TA 3KWQA 1KX5C 4Z66A 5AVBC 4LD9B 4R8PB 4AWLC 3RELD 5E5AB 3WA9D 5GSUB 4WZSB 4ZUXA 3MVDC 3X1VA 1P3BC 1HTAA 5B33B 3AZFD 5CPJA 1P3LC 1U35A 5GT0D 3AZHB 1M18B 1S32B 3WTPC 3AZJC 3KXBB 3LZ0D 4H9QA 3AZNC 3AZEC 2NZDB 4JJNC 5B32A 2CWEA 4WU8B 3MVDD 4X23C 1AOIC 5CPJD 4KHAA 1P3AB 1P3GC 5AY8D 3X1TD 4KUDD 4ZUXD 4XZQA 3W96C 2RVQD 2ZY4A 3O62B 2PYOD 4J8WD 3VH6A 2XD5A 3WA9C 1M18D 1M1AA 5AV8D 1P3BB 5BO0B 2J8PA 3F6TA 4YS3D 2CV5A 4J8UC 5CPID 3B0BA 4J8WC 3MGPC 5BS7C 4KUDA 1P3OD 3LJAC 4XZQB 1P3FD 3W96D 3B6GD 5CP6D 1BH8A 1P3GD 2HIOC 5FUGB 5B31A 3REHB 3WAAA 4DRBA 5B33C 4EO5C 1ZLAC 2PYOB 5AV8C 3EPHA 4X23B 1P3BA 1Q9CA 4YS3A 5B2ID 1F66C 5F99B 4H9OB 3C1CB 1P3KD 3LZ1C 5CPIB 3X1UD 1P3PB 2IO5C 3AZGB 4NE5A 3MGSA 2LY8A 1JFIA 3KUYB 5AY8A 4Z66D 3B6FB 2BYMB 3AZKB 5E5AA 4X23A 3AZND 3KUYA 1P3FC 1KX3A 3AFAC 5GT3B 3LELC 4XZQC 4CSRA 3WAAD 5B2JD 3R45A 1Z2CB 1TZYC 5JA4A 1P34C 4YM6D 4J8VA 5B1LC 3AZFA 1B6WA 3B6FA 3WKJB 1P3OA 3MNND 3TU4C 5BNXB 4H9RA 5JRGB 3VH5T 3WTPB 3AZJB 1BH8B 5CPIA 1TAFA 3REJB 1H3OA 5C3IB 2CV5D 4Z5TD 5DNMB 5B0ZB 2BG1A 3A6NA 1B67A 5AVBD 3AL0C 5BT1D 4QLCA 3VH5A 5GSUD 4WNNB 5F99C 4WU8C 3C1CC 1P3LD 4XZQD 1N1JB 3W99D 3WTPE 2AROD 3X1TA 3MNNC 2G5IC 3UT9D 2NQBD 3RELC 3H0LC 1P3MB 4G91C 4XUJC 3KXBD 3NQUB 5GXQA 3W97C 3UTBB 1TZYB 3LZ1D 4Z2MH 1P34B 2F8NB 5B2IC 4QLCB 5B32B 3VH5W 4WU9A 1P3PD 4LD9C 3UTAC 3AFAB 4KGCD 3X1TB 3AZIA 2FJ7D 3REKD 3VH6W 2L5AA 5BS7A 2NQBB 3UTBA 4UPKA 3KWQD 5AVCC 1TZYA 5AV8B 3REID 1P34A 4UUZA 4EO5B 2Y2IA 5AV6A 3W98A 2RVQC 3O62A 3WTPA 3AZJA 1ID3A 3A1KA 3TU4A 1TAFB 4KUDB 3MGRA 3NQJB 4NFTA 5B32G 2FJ7C 3AZFB 3WKJA 5CP6C 1M19C 4YS3C 3AFAD 3AV2B 3AZHA 2FJ7B 5GXQB 3AZHD 1KU5A 2ZY3A 2AROA 3AN2A 1P3LA 3AV2A 3KWQC 5DNMA 5GSUA 3X1VB 3KFUG 3AZMA 1F66D 3RELB 4JJND 3REKC 3H0MC 1ID3B 3A6ND 1P3OB 4E44A 5CHLB 5BNXA 3EG5B 5DNNA 5E5AC 5B33D 5B0YD 3AZGC 4J8XA 4R8PC 5AV9A 1P3IA 3VH6T 4J8UB 5B24C 4ZUXB 4H9PA 2CV5C 5B32C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0Z A;  3MGQ C;  4WV4 B;  3R45 B;  3B6F D;  1KX4 A;  4HGA C;  1M1A B;  4KGC A;  4KUD C;  1P3P A;  1WWS A;  3AZI B;  5F99 D;  1AOI D;  5G49 B;  3TU4 B;  3B0D B;  1KX4 B;  1ZLA B;  5JRG C;  2PYO C;  3AZI C;  3W97 D;  2BYM A;  1BFM A;  1HQ3 C;  3AZL C;  3WAA C;  2NQB C;  5B1M D;  4J8U A;  3C1B B;  5E5A D;  2YFW A;  4YM6 B;  2F8N G;  3A6N C;  5B40 B;  1JFI B;  3W99 A;  3AV1 C;  1ID3 C;  3MGS D;  3LZ0 C;  3X1S A;  4NE6 A;  3AZK C;  5BNV B;  3X1U A;  2F8N K;  3AZE D;  3LZ0 B;  1EQZ C;  4H9S A;  5GT0 C;  3W97 B;  3AYW B;  5B1M C;  3X1U B;  1KX5 B;  4JJN A;  1P3G B;  1H3O B;  3MNN B;  1P3A D;  5G49 A;  3UT9 C;  3AV2 D;  3W98 B;  1HQ3 B;  3AZL B;  3AN2 D;  2CV5 B;  1P3M D;  3REH A;  3NQU A;  4J8X C;  3C1C D;  1P3K B;  4J8V C;  3LEL D;  1M1A C;  4Z2M G;  5B2J C;  5B0Y C;  3AZG D;  1ID3 D;  3LJA B;  1KX5 A;  5B40 A;  1KX3 D;  3V9R A;  2HUE B;  5AVB A;  4WU9 B;  1P3P C;  3KUY D;  5AV6 D;  5AVC A;  5AV5 C;  1KX5 D;  3MGP A;  2HIO D;  5BNV A;  3MGQ D;  3AYW C;  4QLC C;  5GT0 B;  4YM6 C;  5DNN B;  3REJ A;  3MGR C;  1S32 D;  3AZI D;  1P3M A;  2FJ7 A;  5AV5 D;  3X1V C;  3MVD A;  3WA9 B;  3LEL B;  5CPK B;  1BH9 B;  4KGC B;  3LJA D;  1P3K C;  3LZ1 A;  1M19 B;  3KSY A;  3AZK A;  3X1S C;  4UUZ B;  1BH9 A;  2JSS A;  4Z66 C;  4X23 D;  4H9S C;  5GT0 A;  4ZBJ C;  3MGS C;  3AZE A;  1U35 D;  3MGQ B;  4XUJ D;  3KXB C;  3X1T C;  2HUE C;  4WU9 C;  1S32 A;  3AZM B;  3WA9 A;  5GT3 C;  3REL A;  5B0Z C;  3MGQ A;  5AV5 B;  5C3I C;  5AY8 B;  4QLC D;  3MGP D;  4J8V B;  1P3L B;  4J8X B;  4R8P D;  5AY8 C;  3REH C;  5BO0 A;  5CPK C;  4J8U D;  5B2I A;  3AZK D;  2PYO A;  3LJA A;  2IO5 B;  4CAY A;  4YS3 B;  3LEL A;  5B31 G;  4H9N B;  4H9O A;  5B1L A;  3C1C A;  3AZF C;  1AOI A;  3REH D;  4JJN B;  1P3G A;  3B6G A;  5JRG D;  2NZD C;  5B32 D;  1KX4 D;  3W96 A;  5FUG A;  5B1L D;  1P3F B;  1U35 C;  5B0Z D;  3AN2 C;  3B6G B;  5BT1 C;  3MGR B;  2HIO A;  5B1M B;  5CPK D;  3LZ0 A;  5KDM B;  3O62 C;  3AZM C;  2YFV B;  4Z5T C;  3AZN A;  1M1A D;  1M18 A;  3W99 B;  1F66 A;  4J8W A;  4ZUX C;  3X1V D;  3X1S B;  5CPJ C;  1F66 B;  1EQZ B;  4XUJ A;  3B0D C;  5B31 C;  3AFA A;  3AYW D;  5B0Y B;  4CAY B;  4KHA B;  3MGR D;  1S32 C;  1P3A A;  4WNN A;  3C1B A;  3AV2 C;  5CP6 B;  3W97 A;  5GXQ C;  4E45 A;  5B31 D;  1TZY D;  3REI A;  1P34 D;  5CP6 A;  5AV5 A;  4NE3 A;  3REJ D;  5CPI C;  4LD9 A;  4H9R B;  3V9R B;  5GSU C;  2BYK B;  3MVD B;  3KUY C;  4J8X D;  4WU8 D;  1P3O C;  5B33 A;  5CPJ B;  5AV9 B;  5AVC D;  1WWI A;  5AV8 A;  1HQ3 D;  3AZL D;  3AN2 B;  1P3I B;  2BYK A;  5B40 D;  3AV1 D;  3KWQ B;  3UTA B;  1AOI B;  3AZG A;  1M19 A;  4Z66 B;  4ZBJ B;  3MGS B;  5GXQ D;  4H9Q B;  5AVB B;  3AZN B;  3AZE B;  5F99 A;  1KX4 C;  5AV6 B;  2ARO B;  1EQZ A;  2F8N A;  2ARO C;  3O62 D;  5AVC B;  5AV9 D;  1P3I D;  3W98 D;  4J8W B;  4G92 C;  5B0Y A;  5B40 C;  3AV1 B;  5KDM A;  5GT3 D;  3X1S D;  5B24 D;  5AV9 C;  1P3I C;  3B0C W;  5B24 A;  3WAA B;  1ZLA D;  3B6F C;  1A7W A;  4WU9 D;  3W96 B;  3REK B;  3B6G C;  5B2J A;  2NZD A;  3C1B D;  2HIO B;  1F1E A;  5B1M A;  1R4V A;  4XUJ B;  3REI B;  4G91 B;  3TU4 D;  5AV6 C;  3WTP D;  3UT9 B;  3AZJ D;  3W98 C;  4M6B A;  5B2I B;  4DRA A;  3AYW A;  2NQB A;  3UT9 A;  3MGP B;  3UTB D;  5B24 B;  2F8N H;  1ULY A;  1M18 C;  1ZLA A;  3X1U C;  3AZH C;  3REK A;  1M19 D;  5GT3 A;  3AV1 A;  1N1J A;  5DNM C;  3UTA A;  3REJ C;  3B0C T;  5DNN D;  1P3K A;  2YFW B;  4AWL B;  3UTA D;  4WU8 A;  1P3B D;  5JA4 B;  4H9P B;  5CPK A;  3A6N B;  1P3A C;  3AZM D;  4G92 B;  4H9N A;  5B1L B;  3LZ1 B;  2YFV A;  2F8N D;  3WKJ C;  4LD9 D;  1EQZ D;  3MNN A;  4Z5T B;  5DNM D;  3KXB A;  3C1B C;  5B2J B;  4CSR B;  5JRG A;  3NQJ A;  4YM6 A;  4J8V D;  3REI C;  1P3F A;  1KX3 C;  1P3M C;  4KGC C;  3WKJ D;  1KX3 B;  3UTB C;  1U35 B;  4HGA B;  5B31 B;  5DNN C;  4R8P A;  1HQ3 A;  3AZL A;  2NZD D;  3W99 C;  4Z5T A;  3KWQ A;  1KX5 C;  4Z66 A;  5AVB C;  4LD9 B;  4R8P B;  4AWL C;  3REL D;  5E5A B;  3WA9 D;  5GSU B;  4WZS B;  4ZUX A;  3MVD C;  3X1V A;  1P3B C;  1HTA A;  5B33 B;  3AZF D;  5CPJ A;  1P3L C;  1U35 A;  5GT0 D;  3AZH B;  1M18 B;  1S32 B;  3WTP C;  3AZJ C;  3KXB B;  3LZ0 D;  4H9Q A;  3AZN C;  3AZE C;  2NZD B;  4JJN C;  5B32 A;  2CWE A;  4WU8 B;  3MVD D;  4X23 C;  1AOI C;  5CPJ D;  4KHA A;  1P3A B;  1P3G C;  5AY8 D;  3X1T D;  4KUD D;  4ZUX D;  4XZQ A;  3W96 C;  2RVQ D;  3O62 B;  2PYO D;  4J8W D;  3VH6 A;  3WA9 C;  1M18 D;  1M1A A;  5AV8 D;  1P3B B;  5BO0 B;  4YS3 D;  2CV5 A;  4J8U C;  5CPI D;  3B0B A;  4J8W C;  3MGP C;  5BS7 C;  4KUD A;  1P3O D;  3LJA C;  4XZQ B;  1P3F D;  3W96 D;  3B6G D;  5CP6 D;  1BH8 A;  1P3G D;  2HIO C;  5FUG B;  5B31 A;  3REH B;  3WAA A;  4DRB A;  5B33 C;  4EO5 C;  1ZLA C;  2PYO B;  5AV8 C;  4X23 B;  1P3B A;  1Q9C A;  4YS3 A;  5B2I D;  1F66 C;  5F99 B;  4H9O B;  3C1C B;  1P3K D;  3LZ1 C;  5CPI B;  3X1U D;  1P3P B;  2IO5 C;  3AZG B;  4NE5 A;  3MGS A;  2LY8 A;  1JFI A;  3KUY B;  5AY8 A;  4Z66 D;  3B6F B;  2BYM B;  3AZK B;  5E5A A;  4X23 A;  3AZN D;  3KUY A;  1P3F C;  1KX3 A;  3AFA C;  5GT3 B;  3LEL C;  4XZQ C;  4CSR A;  3WAA D;  5B2J D;  3R45 A;  1TZY C;  5JA4 A;  1P34 C;  4YM6 D;  4J8V A;  5B1L C;  3AZF A;  1B6W A;  3B6F A;  3WKJ B;  1P3O A;  3MNN D;  3TU4 C;  5BNX B;  4H9R A;  5JRG B;  3VH5 T;  3WTP B;  3AZJ B;  1BH8 B;  5CPI A;  1TAF A;  3REJ B;  1H3O A;  5C3I B;  2CV5 D;  4Z5T D;  5DNM B;  5B0Z B;  3A6N A;  1B67 A;  5AVB D;  5BT1 D;  4QLC A;  3VH5 A;  5GSU D;  4WNN B;  5F99 C;  4WU8 C;  3C1C C;  1P3L D;  4XZQ D;  1N1J B;  3W99 D;  3WTP E;  2ARO D;  3X1T A;  3MNN C;  3UT9 D;  2NQB D;  3REL C;  1P3M B;  4G91 C;  4XUJ C;  3KXB D;  3NQU B;  5GXQ A;  3W97 C;  3UTB B;  1TZY B;  3LZ1 D;  4Z2M H;  1P34 B;  2F8N B;  5B2I C;  4QLC B;  5B32 B;  3VH5 W;  4WU9 A;  1P3P D;  4LD9 C;  3UTA C;  3AFA B;  4KGC D;  3X1T B;  3AZI A;  2FJ7 D;  3REK D;  3VH6 W;  2L5A A;  5BS7 A;  2NQB B;  3UTB A;  3KWQ D;  5AVC C;  1TZY A;  5AV8 B;  3REI D;  1P34 A;  4UUZ A;  4EO5 B;  5AV6 A;  3W98 A;  2RVQ C;  3O62 A;  3WTP A;  3AZJ A;  1ID3 A;  3TU4 A;  1TAF B;  4KUD B;  3MGR A;  3NQJ B;  4NFT A;  5B32 G;  2FJ7 C;  3AZF B;  3WKJ A;  5CP6 C;  1M19 C;  4YS3 C;  3AFA D;  3AV2 B;  3AZH A;  2FJ7 B;  5GXQ B;  3AZH D;  1KU5 A;  2ARO A;  3AN2 A;  1P3L A;  3AV2 A;  3KWQ C;  5DNM A;  5GSU A;  3X1V B;  3AZM A;  1F66 D;  3REL B;  4JJN D;  3REK C;  1ID3 B;  3A6N D;  1P3O B;  4E44 A;  5CHL B;  5BNX A;  5B33 D;  5DNN A;  5E5A C;  5B0Y D;  3AZG C;  4J8X A;  4R8P C;  5AV9 A;  1P3I A;  3VH6 T;  4J8U B;  5B24 C;  4ZUX B;  4H9P A;  2CV5 C;  5B32 C; 
#chains in the Genus database with same CATH topology
 5B0Z A;  3MGQ C;  4WV4 B;  3R45 B;  3B6F D;  1KX4 A;  4HGA C;  1M1A B;  4KGC A;  4KUD C;  1P3P A;  1WWS A;  3AZI B;  5F99 D;  1AOI D;  5G49 B;  3TU4 B;  3B0D B;  1KX4 B;  1ZLA B;  5JRG C;  2PYO C;  3AZI C;  3W97 D;  2BYM A;  1BFM A;  1HQ3 C;  3AZL C;  3WAA C;  2NQB C;  5B1M D;  4J8U A;  2RIQ A;  3C1B B;  5E5A D;  2YFW A;  3IP4 C;  4YM6 B;  2F8N G;  3A6N C;  5B40 B;  1JFI B;  3W99 A;  3AV1 C;  1ID3 C;  3MGS D;  2DF4 C;  3LZ0 C;  4DQY B;  3X1S A;  4NE6 A;  3AZK C;  5BNV B;  2Y2M A;  3X1U A;  2F8N K;  3AZE D;  3LZ0 B;  1EQZ C;  4H9S A;  5GT0 C;  3W97 B;  3AYW B;  5B1M C;  3X1U B;  1KX5 B;  4JJN A;  1P3G B;  1H3O B;  3MNN B;  1P3A D;  2Y2H A;  5G49 A;  3UT9 C;  3AV2 D;  2UWX A;  3W98 B;  1HQ3 B;  3AZL B;  3AN2 D;  2Y2L A;  2CV5 B;  1P3M D;  3FDD A;  3REH A;  3NQU A;  4J8X C;  3C1C D;  1P3K B;  4J8V C;  3LEL D;  3EPK A;  1M1A C;  2Y2P A;  4Z2M G;  5B2J C;  5B0Y C;  3EPJ A;  3AZG D;  3LJA B;  2Y2K A;  1ID3 D;  1KX5 A;  5B40 A;  1KX3 D;  3V9R A;  2HUE B;  5AVB A;  4WU9 B;  1P3P C;  3KUY D;  5AV6 D;  5AVC A;  5AV5 C;  1KX5 D;  3MGP A;  2JCH A;  2HIO D;  5BNV A;  3MGQ D;  3AYW C;  4QLC C;  5GT0 B;  4YM6 C;  5DNN B;  3REJ A;  3MGR C;  1S32 D;  3AZI D;  1P3M A;  2FJ7 A;  5AV5 D;  3X1V C;  3MVD A;  3WA9 B;  3LEL B;  5CPK B;  1BH9 B;  4KGC B;  3LJA D;  1P3K C;  3LZ1 A;  1M19 B;  3KSY A;  3AZK A;  3X1S C;  4UUZ B;  1BH9 A;  2JSS A;  4Z66 C;  4X23 D;  4H9S C;  5GT0 A;  4ZBJ C;  3MGS C;  3AZE A;  1U35 D;  3MGQ B;  4XUJ D;  3KXB C;  3X1T C;  2HUE C;  4WU9 C;  1S32 A;  2W8S A;  3AZM B;  3WA9 A;  5GT3 C;  3REL A;  5B0Z C;  3MGQ A;  5AV5 B;  5C3I C;  5AY8 B;  4QLC D;  3MGP D;  4J8V B;  1P3L B;  4J8X B;  4R8P D;  5AY8 C;  3REH C;  5BO0 A;  2ZY2 A;  5CPK C;  4J8U D;  5B2I A;  3AZK D;  2PYO A;  3A1I A;  3LJA A;  2IO5 B;  4CAY A;  4YS3 B;  3LEL A;  5B31 G;  4H9N B;  4H9O A;  5B1L A;  3C1C A;  3AZF C;  1AOI A;  3REH D;  4JJN B;  1P3G A;  3B6G A;  5JRG D;  2NZD C;  5B32 D;  1KX4 D;  3W96 A;  2F2A C;  5FUG A;  5B1L D;  1P3F B;  1U35 C;  5B0Z D;  3AN2 C;  3B6G B;  5BT1 C;  3MGR B;  2HIO A;  5B1M B;  5CPK D;  3LZ0 A;  2ZM5 A;  5KDM B;  3O62 C;  3AZM C;  2YFV B;  4Z5T C;  3AZN A;  1M1A D;  1M18 A;  3W99 B;  1W2E A;  1F66 A;  4J8W A;  4ZUX C;  3X1V D;  3X1S B;  5CPJ C;  3P5J B;  1F66 B;  1EQZ B;  4XUJ A;  2Y2O A;  3B0D C;  5B31 C;  3AFA A;  3AYW D;  5B0Y B;  4CAY B;  4KHA B;  3MGR D;  1S32 C;  1P3A A;  1PZR A;  4WNN A;  3C1B A;  3AV2 C;  5CP6 B;  3W97 A;  5GXQ C;  4E45 A;  5B31 D;  1TZY D;  3REI A;  1P34 D;  5CP6 A;  2Y2J A;  5AV5 A;  4NE3 A;  3REJ D;  5CPI C;  4LD9 A;  4H9R B;  4WJ3 C;  3V9R B;  5GSU C;  2BYK B;  3MVD B;  3KUY C;  4J8X D;  4WU8 D;  1P3O C;  5B33 A;  5CPJ B;  2XD1 A;  5AVC D;  5AV9 B;  1WWI A;  5AV8 A;  1HQ3 D;  3AZL D;  3AN2 B;  1P3I B;  2BYK A;  5B40 D;  3AV1 D;  3KWQ B;  3UTA B;  1AOI B;  3AZG A;  1M19 A;  4Z66 B;  4ZBJ B;  3MGS B;  5GXQ D;  4H9Q B;  5AVB B;  3AZN B;  3AZE B;  5F99 A;  1KX4 C;  5AV6 B;  2ARO B;  1EQZ A;  2F8N A;  2ARO C;  3O62 D;  2DQN C;  5AVC B;  5AV9 D;  1P3I D;  4J8W B;  4G92 C;  5B0Y A;  3W98 D;  2Y2N A;  5B40 C;  3AV1 B;  5KDM A;  3H0R C;  5GT3 D;  5B24 D;  3X1S D;  5AV9 C;  1P3I C;  2JE5 A;  3B0C W;  5B24 A;  3WAA B;  1ZLA D;  3B6F C;  1A7W A;  4WU9 D;  3W96 B;  3REK B;  2VQR A;  3B6G C;  5B2J A;  2NZD A;  2G5H C;  2Y2G A;  3C1B D;  2HIO B;  1F1E A;  5B1M A;  1R4V A;  4XUJ B;  3REI B;  4G91 B;  3TU4 D;  5AV6 C;  3WTP D;  3UT9 B;  3AZJ D;  3W98 C;  2FFF B;  4M6B A;  5B2I B;  4DRA A;  3AYW A;  2NQB A;  3UT9 A;  3MGP B;  3UTB D;  5B24 B;  2F8N H;  1ULY A;  1M18 C;  1ZLA A;  3X1U C;  3AZH C;  3REK A;  1M19 D;  5GT3 A;  3AV1 A;  1N1J A;  5DNM C;  2ZY5 A;  3UTA A;  3REJ C;  3B0C T;  5DNN D;  1P3K A;  2YFW B;  4AWL B;  3UTA D;  4WU8 A;  1P3B D;  5JA4 B;  4H9P B;  5CPK A;  3A6N B;  1P3A C;  3AZM D;  4G92 B;  4H9N A;  5B1L B;  3LZ1 B;  2YFV A;  2F8N D;  3WKJ C;  4LD9 D;  1EQZ D;  3MNN A;  4Z5T B;  5DNM D;  3KXB A;  3C1B C;  5B2J B;  4CSR B;  5JRG A;  3NQJ A;  4YM6 A;  4J8V D;  3REI C;  1P3F A;  1KX3 C;  1P3M C;  4KGC C;  3WKJ D;  1KX3 B;  3UTB C;  1U35 B;  3EPL A;  2Y2Q A;  4HGA B;  5B31 B;  5DNN C;  1T3U A;  4R8P A;  1HQ3 A;  3AZL A;  2NZD D;  3W99 C;  4Z5T A;  3KWQ A;  1KX5 C;  4Z66 A;  5AVB C;  4LD9 B;  4R8P B;  4AWL C;  3REL D;  5E5A B;  3WA9 D;  5GSU B;  4WZS B;  4ZUX A;  3MVD C;  3X1V A;  1P3B C;  1HTA A;  5B33 B;  3AZF D;  5CPJ A;  1P3L C;  1U35 A;  5GT0 D;  3AZH B;  1M18 B;  1S32 B;  3WTP C;  3AZJ C;  3KXB B;  3LZ0 D;  4H9Q A;  3AZN C;  3AZE C;  2NZD B;  4JJN C;  5B32 A;  2CWE A;  4WU8 B;  3MVD D;  4X23 C;  1AOI C;  5CPJ D;  4KHA A;  1P3A B;  1P3G C;  5AY8 D;  3X1T D;  4KUD D;  4ZUX D;  4XZQ A;  3W96 C;  2RVQ D;  2ZY4 A;  3O62 B;  2PYO D;  4J8W D;  3VH6 A;  2XD5 A;  3WA9 C;  1M18 D;  1M1A A;  5AV8 D;  1P3B B;  5BO0 B;  2J8P A;  3F6T A;  4YS3 D;  2CV5 A;  4J8U C;  5CPI D;  3B0B A;  4J8W C;  3MGP C;  5BS7 C;  4KUD A;  1P3O D;  3LJA C;  4XZQ B;  1P3F D;  3W96 D;  3B6G D;  5CP6 D;  1BH8 A;  1P3G D;  2HIO C;  5FUG B;  5B31 A;  3REH B;  3WAA A;  4DRB A;  5B33 C;  4EO5 C;  1ZLA C;  2PYO B;  5AV8 C;  3EPH A;  4X23 B;  1P3B A;  1Q9C A;  4YS3 A;  5B2I D;  1F66 C;  5F99 B;  4H9O B;  3C1C B;  1P3K D;  3LZ1 C;  5CPI B;  3X1U D;  1P3P B;  2IO5 C;  3AZG B;  4NE5 A;  3MGS A;  2LY8 A;  1JFI A;  3KUY B;  5AY8 A;  4Z66 D;  3B6F B;  2BYM B;  3AZK B;  5E5A A;  4X23 A;  3AZN D;  3KUY A;  1P3F C;  1KX3 A;  3AFA C;  5GT3 B;  3LEL C;  4XZQ C;  4CSR A;  3WAA D;  5B2J D;  3R45 A;  1Z2C B;  1TZY C;  5JA4 A;  1P34 C;  4YM6 D;  4J8V A;  5B1L C;  3AZF A;  1B6W A;  3B6F A;  3WKJ B;  1P3O A;  3MNN D;  3TU4 C;  5BNX B;  4H9R A;  5JRG B;  3VH5 T;  3WTP B;  3AZJ B;  1BH8 B;  5CPI A;  1TAF A;  3REJ B;  1H3O A;  5C3I B;  2CV5 D;  4Z5T D;  5DNM B;  5B0Z B;  2BG1 A;  3A6N A;  1B67 A;  5AVB D;  3AL0 C;  5BT1 D;  4QLC A;  3VH5 A;  5GSU D;  4WNN B;  5F99 C;  4WU8 C;  3C1C C;  1P3L D;  4XZQ D;  1N1J B;  3W99 D;  3WTP E;  2ARO D;  3X1T A;  3MNN C;  2G5I C;  3UT9 D;  2NQB D;  3REL C;  3H0L C;  1P3M B;  4G91 C;  4XUJ C;  3KXB D;  3NQU B;  5GXQ A;  3W97 C;  3UTB B;  1TZY B;  3LZ1 D;  4Z2M H;  1P34 B;  2F8N B;  5B2I C;  4QLC B;  5B32 B;  3VH5 W;  4WU9 A;  1P3P D;  4LD9 C;  3UTA C;  3AFA B;  4KGC D;  3X1T B;  3AZI A;  2FJ7 D;  3REK D;  3VH6 W;  2L5A A;  5BS7 A;  2NQB B;  3UTB A;  4UPK A;  3KWQ D;  5AVC C;  1TZY A;  5AV8 B;  3REI D;  1P34 A;  4UUZ A;  4EO5 B;  2Y2I A;  5AV6 A;  3W98 A;  2RVQ C;  3O62 A;  3WTP A;  3AZJ A;  1ID3 A;  3A1K A;  3TU4 A;  1TAF B;  4KUD B;  3MGR A;  3NQJ B;  4NFT A;  5B32 G;  2FJ7 C;  3AZF B;  3WKJ A;  5CP6 C;  1M19 C;  4YS3 C;  3AFA D;  3AV2 B;  3AZH A;  2FJ7 B;  5GXQ B;  3AZH D;  1KU5 A;  2ZY3 A;  2ARO A;  3AN2 A;  1P3L A;  3AV2 A;  3KWQ C;  5DNM A;  5GSU A;  3X1V B;  3KFU G;  3AZM A;  1F66 D;  3REL B;  4JJN D;  3REK C;  3H0M C;  1ID3 B;  3A6N D;  1P3O B;  4E44 A;  5CHL B;  5BNX A;  3EG5 B;  5DNN A;  5E5A C;  5B33 D;  5B0Y D;  3AZG C;  4J8X A;  4R8P C;  5AV9 A;  1P3I A;  3VH6 T;  4J8U B;  5B24 C;  4ZUX B;  4H9P A;  2CV5 C;  5B32 C; 
#chains in the Genus database with same CATH homology
 5B0Z A;  3MGQ C;  4WV4 B;  3R45 B;  3B6F D;  1KX4 A;  4HGA C;  1M1A B;  4KGC A;  4KUD C;  1P3P A;  1WWS A;  3AZI B;  5F99 D;  1AOI D;  5G49 B;  3TU4 B;  3B0D B;  1KX4 B;  1ZLA B;  5JRG C;  2PYO C;  3AZI C;  3W97 D;  2BYM A;  1BFM A;  1HQ3 C;  3AZL C;  3WAA C;  2NQB C;  5B1M D;  4J8U A;  2RIQ A;  3C1B B;  5E5A D;  2YFW A;  3IP4 C;  4YM6 B;  2F8N G;  3A6N C;  5B40 B;  1JFI B;  3W99 A;  3AV1 C;  1ID3 C;  3MGS D;  2DF4 C;  3LZ0 C;  4DQY B;  3X1S A;  4NE6 A;  3AZK C;  5BNV B;  2Y2M A;  3X1U A;  2F8N K;  3AZE D;  3LZ0 B;  1EQZ C;  4H9S A;  5GT0 C;  3W97 B;  3AYW B;  5B1M C;  3X1U B;  1KX5 B;  4JJN A;  1P3G B;  1H3O B;  3MNN B;  1P3A D;  2Y2H A;  5G49 A;  3UT9 C;  3AV2 D;  2UWX A;  3W98 B;  1HQ3 B;  3AZL B;  3AN2 D;  2Y2L A;  2CV5 B;  1P3M D;  3FDD A;  3REH A;  3NQU A;  4J8X C;  3C1C D;  1P3K B;  4J8V C;  3LEL D;  3EPK A;  1M1A C;  2Y2P A;  4Z2M G;  5B2J C;  5B0Y C;  3EPJ A;  3AZG D;  3LJA B;  2Y2K A;  1ID3 D;  1KX5 A;  5B40 A;  1KX3 D;  3V9R A;  2HUE B;  5AVB A;  4WU9 B;  1P3P C;  3KUY D;  5AV6 D;  5AVC A;  5AV5 C;  1KX5 D;  3MGP A;  2JCH A;  2HIO D;  5BNV A;  3MGQ D;  3AYW C;  4QLC C;  5GT0 B;  4YM6 C;  5DNN B;  3REJ A;  3MGR C;  1S32 D;  3AZI D;  1P3M A;  2FJ7 A;  5AV5 D;  3X1V C;  3MVD A;  3WA9 B;  3LEL B;  5CPK B;  1BH9 B;  4KGC B;  3LJA D;  1P3K C;  3LZ1 A;  1M19 B;  3KSY A;  3AZK A;  3X1S C;  4UUZ B;  1BH9 A;  2JSS A;  4Z66 C;  4X23 D;  4H9S C;  5GT0 A;  4ZBJ C;  3MGS C;  3AZE A;  1U35 D;  3MGQ B;  4XUJ D;  3KXB C;  3X1T C;  2HUE C;  4WU9 C;  1S32 A;  2W8S A;  3AZM B;  3WA9 A;  5GT3 C;  3REL A;  5B0Z C;  3MGQ A;  5AV5 B;  5C3I C;  5AY8 B;  4QLC D;  3MGP D;  4J8V B;  1P3L B;  4J8X B;  4R8P D;  5AY8 C;  3REH C;  5BO0 A;  2ZY2 A;  5CPK C;  4J8U D;  5B2I A;  3AZK D;  2PYO A;  3A1I A;  3LJA A;  2IO5 B;  4CAY A;  4YS3 B;  3LEL A;  5B31 G;  4H9N B;  4H9O A;  5B1L A;  3C1C A;  3AZF C;  1AOI A;  3REH D;  4JJN B;  1P3G A;  3B6G A;  5JRG D;  2NZD C;  5B32 D;  1KX4 D;  3W96 A;  2F2A C;  5FUG A;  5B1L D;  1P3F B;  1U35 C;  5B0Z D;  3AN2 C;  3B6G B;  5BT1 C;  3MGR B;  2HIO A;  5B1M B;  5CPK D;  3LZ0 A;  2ZM5 A;  5KDM B;  3O62 C;  3AZM C;  2YFV B;  4Z5T C;  3AZN A;  1M1A D;  1M18 A;  3W99 B;  1W2E A;  1F66 A;  4J8W A;  4ZUX C;  3X1V D;  3X1S B;  5CPJ C;  3P5J B;  1F66 B;  1EQZ B;  4XUJ A;  2Y2O A;  3B0D C;  5B31 C;  3AFA A;  3AYW D;  5B0Y B;  4CAY B;  4KHA B;  3MGR D;  1S32 C;  1P3A A;  1PZR A;  4WNN A;  3C1B A;  3AV2 C;  5CP6 B;  3W97 A;  5GXQ C;  4E45 A;  5B31 D;  1TZY D;  3REI A;  1P34 D;  5CP6 A;  2Y2J A;  5AV5 A;  4NE3 A;  3REJ D;  5CPI C;  4LD9 A;  4H9R B;  4WJ3 C;  3V9R B;  5GSU C;  2BYK B;  3MVD B;  3KUY C;  4J8X D;  4WU8 D;  1P3O C;  5B33 A;  5CPJ B;  2XD1 A;  5AVC D;  5AV9 B;  1WWI A;  5AV8 A;  1HQ3 D;  3AZL D;  3AN2 B;  1P3I B;  2BYK A;  5B40 D;  3AV1 D;  3KWQ B;  3UTA B;  1AOI B;  3AZG A;  1M19 A;  4Z66 B;  4ZBJ B;  3MGS B;  5GXQ D;  4H9Q B;  5AVB B;  3AZN B;  3AZE B;  5F99 A;  1KX4 C;  5AV6 B;  2ARO B;  1EQZ A;  2F8N A;  2ARO C;  3O62 D;  2DQN C;  5AVC B;  5AV9 D;  1P3I D;  4J8W B;  4G92 C;  5B0Y A;  3W98 D;  2Y2N A;  5B40 C;  3AV1 B;  5KDM A;  3H0R C;  5GT3 D;  5B24 D;  3X1S D;  5AV9 C;  1P3I C;  2JE5 A;  3B0C W;  5B24 A;  3WAA B;  1ZLA D;  3B6F C;  1A7W A;  4WU9 D;  3W96 B;  3REK B;  2VQR A;  3B6G C;  5B2J A;  2NZD A;  2G5H C;  2Y2G A;  3C1B D;  2HIO B;  1F1E A;  5B1M A;  1R4V A;  4XUJ B;  3REI B;  4G91 B;  3TU4 D;  5AV6 C;  3WTP D;  3UT9 B;  3AZJ D;  3W98 C;  2FFF B;  4M6B A;  5B2I B;  4DRA A;  3AYW A;  2NQB A;  3UT9 A;  3MGP B;  3UTB D;  5B24 B;  2F8N H;  1ULY A;  1M18 C;  1ZLA A;  3X1U C;  3AZH C;  3REK A;  1M19 D;  5GT3 A;  3AV1 A;  1N1J A;  5DNM C;  2ZY5 A;  3UTA A;  3REJ C;  3B0C T;  5DNN D;  1P3K A;  2YFW B;  4AWL B;  3UTA D;  4WU8 A;  1P3B D;  5JA4 B;  4H9P B;  5CPK A;  3A6N B;  1P3A C;  3AZM D;  4G92 B;  4H9N A;  5B1L B;  3LZ1 B;  2YFV A;  2F8N D;  3WKJ C;  4LD9 D;  1EQZ D;  3MNN A;  4Z5T B;  5DNM D;  3KXB A;  3C1B C;  5B2J B;  4CSR B;  5JRG A;  3NQJ A;  4YM6 A;  4J8V D;  3REI C;  1P3F A;  1KX3 C;  1P3M C;  4KGC C;  3WKJ D;  1KX3 B;  3UTB C;  1U35 B;  3EPL A;  2Y2Q A;  4HGA B;  5B31 B;  5DNN C;  1T3U A;  4R8P A;  1HQ3 A;  3AZL A;  2NZD D;  3W99 C;  4Z5T A;  3KWQ A;  1KX5 C;  4Z66 A;  5AVB C;  4LD9 B;  4R8P B;  4AWL C;  3REL D;  5E5A B;  3WA9 D;  5GSU B;  4WZS B;  4ZUX A;  3MVD C;  3X1V A;  1P3B C;  1HTA A;  5B33 B;  3AZF D;  5CPJ A;  1P3L C;  1U35 A;  5GT0 D;  3AZH B;  1M18 B;  1S32 B;  3WTP C;  3AZJ C;  3KXB B;  3LZ0 D;  4H9Q A;  3AZN C;  3AZE C;  2NZD B;  4JJN C;  5B32 A;  2CWE A;  4WU8 B;  3MVD D;  4X23 C;  1AOI C;  5CPJ D;  4KHA A;  1P3A B;  1P3G C;  5AY8 D;  3X1T D;  4KUD D;  4ZUX D;  4XZQ A;  3W96 C;  2RVQ D;  2ZY4 A;  3O62 B;  2PYO D;  4J8W D;  3VH6 A;  2XD5 A;  3WA9 C;  1M18 D;  1M1A A;  5AV8 D;  1P3B B;  5BO0 B;  2J8P A;  3F6T A;  4YS3 D;  2CV5 A;  4J8U C;  5CPI D;  3B0B A;  4J8W C;  3MGP C;  5BS7 C;  4KUD A;  1P3O D;  3LJA C;  4XZQ B;  1P3F D;  3W96 D;  3B6G D;  5CP6 D;  1BH8 A;  1P3G D;  2HIO C;  5FUG B;  5B31 A;  3REH B;  3WAA A;  4DRB A;  5B33 C;  4EO5 C;  1ZLA C;  2PYO B;  5AV8 C;  3EPH A;  4X23 B;  1P3B A;  1Q9C A;  4YS3 A;  5B2I D;  1F66 C;  5F99 B;  4H9O B;  3C1C B;  1P3K D;  3LZ1 C;  5CPI B;  3X1U D;  1P3P B;  2IO5 C;  3AZG B;  4NE5 A;  3MGS A;  2LY8 A;  1JFI A;  3KUY B;  5AY8 A;  4Z66 D;  3B6F B;  2BYM B;  3AZK B;  5E5A A;  4X23 A;  3AZN D;  3KUY A;  1P3F C;  1KX3 A;  3AFA C;  5GT3 B;  3LEL C;  4XZQ C;  4CSR A;  3WAA D;  5B2J D;  3R45 A;  1Z2C B;  1TZY C;  5JA4 A;  1P34 C;  4YM6 D;  4J8V A;  5B1L C;  3AZF A;  1B6W A;  3B6F A;  3WKJ B;  1P3O A;  3MNN D;  3TU4 C;  5BNX B;  4H9R A;  5JRG B;  3VH5 T;  3WTP B;  3AZJ B;  1BH8 B;  5CPI A;  1TAF A;  3REJ B;  1H3O A;  5C3I B;  2CV5 D;  4Z5T D;  5DNM B;  5B0Z B;  2BG1 A;  3A6N A;  1B67 A;  5AVB D;  3AL0 C;  5BT1 D;  4QLC A;  3VH5 A;  5GSU D;  4WNN B;  5F99 C;  4WU8 C;  3C1C C;  1P3L D;  4XZQ D;  1N1J B;  3W99 D;  3WTP E;  2ARO D;  3X1T A;  3MNN C;  2G5I C;  3UT9 D;  2NQB D;  3REL C;  3H0L C;  1P3M B;  4G91 C;  4XUJ C;  3KXB D;  3NQU B;  5GXQ A;  3W97 C;  3UTB B;  1TZY B;  3LZ1 D;  4Z2M H;  1P34 B;  2F8N B;  5B2I C;  4QLC B;  5B32 B;  3VH5 W;  4WU9 A;  1P3P D;  4LD9 C;  3UTA C;  3AFA B;  4KGC D;  3X1T B;  3AZI A;  2FJ7 D;  3REK D;  3VH6 W;  2L5A A;  5BS7 A;  2NQB B;  3UTB A;  4UPK A;  3KWQ D;  5AVC C;  1TZY A;  5AV8 B;  3REI D;  1P34 A;  4UUZ A;  4EO5 B;  2Y2I A;  5AV6 A;  3W98 A;  2RVQ C;  3O62 A;  3WTP A;  3AZJ A;  1ID3 A;  3A1K A;  3TU4 A;  1TAF B;  4KUD B;  3MGR A;  3NQJ B;  4NFT A;  5B32 G;  2FJ7 C;  3AZF B;  3WKJ A;  5CP6 C;  1M19 C;  4YS3 C;  3AFA D;  3AV2 B;  3AZH A;  2FJ7 B;  5GXQ B;  3AZH D;  1KU5 A;  2ZY3 A;  2ARO A;  3AN2 A;  1P3L A;  3AV2 A;  3KWQ C;  5DNM A;  5GSU A;  3X1V B;  3KFU G;  3AZM A;  1F66 D;  3REL B;  4JJN D;  3REK C;  3H0M C;  1ID3 B;  3A6N D;  1P3O B;  4E44 A;  5CHL B;  5BNX A;  3EG5 B;  5DNN A;  5E5A C;  5B33 D;  5B0Y D;  3AZG C;  4J8X A;  4R8P C;  5AV9 A;  1P3I A;  3VH6 T;  4J8U B;  5B24 C;  4ZUX B;  4H9P A;  2CV5 C;  5B32 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...