3B6FC

Nucleosome core particle treated with cisplatin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
106
structure length
106
Chain Sequence
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 147-MER DNA
publication title Site selectivity of platinum anticancer therapeutics
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 29
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b6fC00
3NQUA 3LELB 4WNNB 3O62A 1KX4A 5BS7A 3WAAD 3AZMB 4NE5A 1TZYA 2F8NB 3LJAB 5B0YB 4KGCB 3AZGD 2YFVB 4Z5TB 4YM6C 4J8VC 5B0ZB 1WWIA 1P3OA 5DNNA 5F99C 3AYWD 1M1AA 3W97D 3LELA 4WNNA 4LD9C 3AZJD 4XUJB 5AY8C 5AVCB 5GT3D 5B2IB 1ULYA 3MGQD 1P34B 3LZ1B 5B0YA 1P3MC 3NQJA 3W99B 2YFVA 3VH6T 1S32A 4X23B 1HQ3C 1R4VA 1F1EA 3MVDC 1P3KA 4QLCC 3REHB 3B0BA 5CPIC 5CPKB 1P3GB 5B2IA 3MGPC 4H9PB 3LZ1A 1P3AB 3AFAB 4YM6D 3AZHC 5F99D 4X23A 1KX3C 5AY8D 5B31C 3REHA 3AZIC 3MGRA 1P3MD 5GT0C 1JFIA 3W98B 1P3BD 4WU8D 3AFAA 1HQ3D 5KDMA 5AV8C 1BFMA 4EO5B 5FUGB 5GSUC 4QLCD 5CPID 3B0CW 4ZUXB 5B1LD 1U35B 3B0DC 5B32C 3UTAB 3AZHD 5B40C 5GXQC 4WU9C 4J8XC 3RELA 1KX3D 2NQBC 1P3PC 3MGSA 5FUGA 5B31D 3WKJB 3AZID 5B2JB 4ZUXA 3AV2D 3C1CC 5GT0D 1U35A 4ZBJB 5CPJB 5BNVB 1WWSA 5GSUD 4G92C 3KUYC 3AZFB 4G91C 1M19A 3REJA 3WTPC 3AZKA 3WKJA 1F66A 5B2JA 3KSYA 5B32D 3KXBB 5AV5B 5CPJA 5GXQD 2NQBD 4J8XD 4H9OB 1P3PD 4XUJD 3REKC 5JRGB 3WA9B 3AZFA 3C1CD 3W96C 3AZEA 3KXBA 3REIB 2AROC 4H9OA 3KUYD 1AOIC 5JRGA 4H9SC 3WTPD 1KX5B 3X1TC 4R8PB 1M18C 3B6GC 2FJ7C 4UUZA 5AVBC 5B24B 3X1UB 1P3FA 4KUDC 2YFWB 4XZQB 5G49B 3REIA 4CSRA 2BYKB 3W97A 3AZLC 4J8UC 3VH5A 2HIOC 5GT3A 1KX5A 3W96D 4NFTA 4R8PA 3X1VB 4Z66B 3NQUB 5B24A 3O62B 1KX4B 2YFWA 2AROD 1TZYB 1AOID 5G49A 4AWLB 3AZJC 3AN2B 3X1TD 3LZ0B 3MGQC 1M18D 3B6GD 2FJ7D 2HUEC 4KUDD 4KHAA 3X1VA 4J8VA 4J8WC 1EQZC 1BH8B 4LD9A 5F99A 3AZLD 4J8UD 1ZLAC 2HIOD 3AN2A 3NQJB 3LZ0A 2PYOC 1P3MA 5BT1C 3MNNB 3UT9C 1S32B 1P3KB 3AZNB 3A6NC 3MVDA 1BH8A 4HGAC 4DRBA 3C1BC 3VH5W 5B1MC 3MGPA 5C3IC 1P3BC 4WU8C 4J8WD 5AV8B 3MNNA 2CV5C 3AZHA 1EQZD 3WA9D 5AV9C 3AV1C 5DNMC 3AZNA 1ZLAD 4JJNC 3MGRB 2NZDC 3TU4C 5B1LC 1JFIB 2PYOD 3UTBC 4H9RB 5CP6D 5BT1D 3UT9D 5KDMB 5B40B 5BS7C 1ID3B 4WU9B 5AV8A 3A6ND 3C1BD 3KWQC 5B33C 5B1MD 3AV2C 4H9RA 1P3LB 3V9RA 1P3OC 5DNNC 2CV5D 1M1AC 3LELC 5B40A 5E5AB 3RELB 1ID3A 5AV9D 3MGSB 4J8XA 3AZMC 4WU9A 3AV1D 5DNMD 1P3IB 2NQBA 3LJAC 4JJND 5B0YC 2NZDD 3TU4D 4KGCC 3UTBD 3VH6W 4Z5TC 3O62D 1KX4D 5B0ZC 1P3LA 3X1SB 3REKB 4YS3B 5E5AA 4XUJC 5B2IC 5AVCC 1P3IA 1M19B 3KUYA 3REJB 3AZKB 3KWQD 5B33D 1F66B 1P34C 3LZ1C 3W99C 1P3OD 5DNND 1M1AD 4X23C 5B31G 3LELD 3AZMD 2F8ND 3X1SA 3LJAD 1KU5A 3REKA 4YS3A 5CPKC 1P3GC 5B0YD 2BYMB 4KGCD 3AZEB 3B6FB 1P3AC 3W96A 3AFAC 4Z5TD 5AVBB 1B6WA 5B0ZD 1P3KD 5AV6B 3WAAB 5B2ID 5AVCD 5B32G 2IO5B 1P34D 4H9SA 3LZ1D 2BYMA 3W99D 3AZGB 4UUZB 3B6GA 3W98C 1P3FB 3B6FA 4X23D 2JSSA 1BH9B 5AVBA 4CSRB 4EO5C 5AV6A 3AYWB 4E44A 3REHD 3W97B 3WAAA 5CPKD 1P3GD 4ZUXC 3MGRD 5GT3B 1TAFB 3MGQB 2HIOA 1U35C 1P3AD 3AFAD 4NE6A 3UTAC 3AZGA 1BH9A 4WV4B 3AYWA 3WKJC 2CWEA 5B2JC 3AZJA 1TAFA 3MGQA 3W98D 4ZBJC 5CPJC 1N1JA 4KHAB 4YM6B 4J8VB 3MGSD 4J8WA 5F99B 4LD9B 1EQZA 3R45B 4ZUXD 5AY8B 3AZFC 1ZLAA 1U35D 1M1AB 1P3MB 3UTAD 5AV5C 4YM6A 1HQ3B 3MVDB 5JRGC 3REJD 4QLCB 3AZKD 3A6NA 3R45A 3WA9C 3WKJD 5CPIB 5B2JD 5AY8A 3C1BA 5B1LB 3MGPB 3VH5T 5CPJD 5B1MA 2F8NK 5CP6C 1P3BA 4WU8A 3AZHB 3REIC 1HQ3A 1KX3B 3AZFD 5AV9A 4QLCA 5B31B 5DNMA 3AZIB 1KX5C 5CPIA 4H9QB 4R8PC 5JA4B 3AV2B 5GT0B 2NZDA 3KXBD 3TU4A 3VH6A 5B1LA 1A7WA 4H9NA 5AV5D 3UTBA 5B24C 3X1UC 4XZQC 5CHLB 5GSUB 5JRGD 4Z2MG 1KX3A 5B31A 3KWQA 5B33A 3AZIA 4H9QA 5JA4A 3AV2A 1P3FD 3B0DB 5GT0A 5B32B 3X1VC 3V9RB 4Z66C 5BO0A 3REID 3O62C 1KX4C 5GXQB 2NQBB 4J8XB 1TZYC 4AWLC 1P3PB 3AZMA 2F8NA 5GSUA 1KX5D 3LJAA 3B0CT 3AN2C 4R8PD 3LZ0C 3C1CB 4KGCA 5B24D 3X1UD 4Z5TA 5B32A 4XZQD 5B0ZA 4G92B 5GXQA 3KUYB 1P3PA 4XUJA 5AVCA 4G91B 3WTPB 1P34A 3C1CA 3W99A 3X1VD 4J8VD 1S32C 3MNNC 4Z66D 4LD9D 1P3KC 1TZYD 3AZNC 1HTAA 3AN2D 3LZ0D 5CPKA 1P3GA 3WTPA 4H9PA 3W96B 1P3AA 3MVDD 2AROB 1AOIB 3REHC 3MGPD 3MGRC 3X1TB 1M18B 3B6GB 2FJ7B 2F8NG 1S32D 3MNND 3W98A 4KUDB 1ID3C 3AZND 3AZLB 2AROA 1AOIA 4J8UB 4Z2MH 2HIOB 1Q9CA 3X1TA 2RVQC 1M18A 2FJ7A 1P3LC 3UTAA 5BNXB 5AV8D 4KUDA 3RELC 5E5AC 1P3IC 3MGSC 3AZJB 3AZLA 4J8UA 1B67A 1H3OB 1N1JB 2HUEB 5B40D 1ID3D 4WU9D 2L5AA 5BNXA 5BNVA 4J8WB 3X1SC 1EQZB 4YS3C 1M19C 3REJC 1ZLAB 3AZKC 1F66C 2RVQD 2PYOB 5CP6B 1P3LD 1H3OA 5AV5A 3UT9B 4E45A 3RELD 5E5AD 1P3ID 3A6NB 3WA9A 4CAYB 4HGAB 4DRAA 3C1BB 3AZEC 5B1MB 3B6FC 3KXBC 5C3IB 2PYOA 1P3BB 4WU8B 5CP6A 3X1SD 5AV6C 3UT9A 2CV5B 4YS3D 3REKD 3WAAC 5AV9B 1M19D 3AV1B 5DNMB 4NE3A 1F66D 2IO5C 4JJNB 3WTPE 4CAYA 2NZDB 3TU4B 4H9NB 3AZGC 3UTBB 1P3FC 3X1UA 2F8NH 4M6BA 4XZQA 3AYWC 2CV5A 3W97C 2BYKA 5GT3C 3AV1A 3KWQB 5B33B 3AZED 4JJNA 3B6FD 5AVBD 4WZSB 5BO0B 5AV6D 1P3OB 5DNNB 2LY8A 4Z66A
chains in the Genus database with same CATH superfamily
3NQUA 3LELB 4WNNB 3O62A 1KX4A 2DF4C 5BS7A 3WAAD 3AZMB 4NE5A 1TZYA 2F8NB 3LJAB 5B0YB 4KGCB 3AZGD 2YFVB 3EPHA 4Z5TB 4YM6C 4J8VC 5B0ZB 1WWIA 2Y2MA 5DNNA 5F99C 3AYWD 1P3OA 1M1AA 3LELA 4WNNA 3W97D 4LD9C 3AZJD 4XUJB 5AY8C 5AVCB 3EG5B 5B2IB 5GT3D 1ULYA 3MGQD 1P34B 3P5JB 3LZ1B 5B0YA 1P3MC 3NQJA 3W99B 2YFVA 3VH6T 2Y2QA 1S32A 4X23B 1HQ3C 1R4VA 1F1EA 3MVDC 1P3KA 4QLCC 3REHB 3B0BA 5CPIC 5CPKB 1P3GB 5B2IA 3MGPC 4H9PB 3LZ1A 1P3AB 3AFAB 2BG1A 4YM6D 3AZHC 5F99D 4X23A 1KX3C 5AY8D 5B31C 3REHA 3AZIC 2DQNC 3MGRA 1P3MD 5GT0C 1JFIA 3W98B 1P3BD 4WU8D 3H0MC 3AFAA 1HQ3D 5KDMA 5AV8C 1BFMA 4EO5B 5FUGB 5GSUC 4QLCD 5CPID 3B0CW 4ZUXB 5B1LD 1U35B 3B0DC 5B32C 3UTAB 3AZHD 5B40C 5GXQC 4WU9C 4J8XC 3RELA 1KX3D 2NQBC 1P3PC 3MGSA 5FUGA 5B31D 3WKJB 3AZID 5B2JB 4ZUXA 3AV2D 2G5IC 5GT0D 3C1CC 1U35A 4ZBJB 5CPJB 5BNVB 1WWSA 5GSUD 4G92C 3KUYC 3AZFB 4G91C 1M19A 3REJA 3WTPC 3AZKA 3WKJA 1F66A 4UPKA 5B2JA 3KSYA 5B32D 3KXBB 5AV5B 5CPJA 3AL0C 5GXQD 2NQBD 4J8XD 4H9OB 1P3PD 4XUJD 3REKC 5JRGB 3WA9B 3AZFA 3C1CD 2Y2IA 3W96C 3A1KA 3AZEA 2Y2LA 2Y2HA 3KXBA 3REIB 2AROC 4H9OA 3KUYD 1AOIC 5JRGA 4H9SC 3WTPD 2ZM5A 1KX5B 3X1TC 4R8PB 1M18C 3B6GC 2FJ7C 3IP4C 4UUZA 5AVBC 5B24B 3X1UB 1P3FA 4KUDC 2YFWB 4XZQB 5G49B 3REIA 4CSRA 2BYKB 3W97A 3AZLC 4J8UC 3VH5A 2HIOC 5GT3A 1KX5A 3W96D 4NFTA 4R8PA 3X1VB 4WJ3C 4Z66B 3NQUB 5B24A 3O62B 1KX4B 2YFWA 2AROD 1TZYB 1AOID 5G49A 4AWLB 3AZJC 3AN2B 3X1TD 3LZ0B 3MGQC 1M18D 3B6GD 2FJ7D 2HUEC 4KUDD 4KHAA 3X1VA 4J8VA 4J8WC 1EQZC 1BH8B 4LD9A 5F99A 3AZLD 4J8UD 1ZLAC 2HIOD 3AN2A 3NQJB 3LZ0A 1PZRA 2G5HC 2PYOC 1P3MA 3KFUG 3F6TA 5BT1C 3MNNB 3UT9C 1S32B 1P3KB 3AZNB 3A6NC 3MVDA 1BH8A 4HGAC 4DRBA 3C1BC 3VH5W 5B1MC 3MGPA 2UWXA 5C3IC 1P3BC 4WU8C 4J8WD 5AV8B 3MNNA 2CV5C 3AZHA 1EQZD 3WA9D 5AV9C 3AV1C 5DNMC 3AZNA 1ZLAD 4JJNC 3MGRB 2NZDC 3TU4C 5B1LC 1JFIB 2PYOD 3UTBC 4H9RB 5CP6D 5BT1D 3UT9D 5KDMB 5B40B 5BS7C 1ID3B 4WU9B 5AV8A 3A6ND 3C1BD 3KWQC 5B33C 5B1MD 3AV2C 3FDDA 4H9RA 1P3LB 3V9RA 1P3OC 5DNNC 2CV5D 1M1AC 3LELC 5B40A 5E5AB 3RELB 1ID3A 5AV9D 3MGSB 4J8XA 3AZMC 4WU9A 3AV1D 5DNMD 1P3IB 2NQBA 3LJAC 4JJND 5B0YC 2NZDD 3TU4D 4KGCC 3UTBD 2JCHA 3VH6W 4Z5TC 3O62D 1KX4D 5B0ZC 1P3LA 3X1SB 3REKB 4YS3B 5E5AA 4XUJC 5B2IC 5AVCC 1P3IA 1M19B 3KUYA 3REJB 3AZKB 3KWQD 5B33D 2Y2NA 1F66B 1P34C 3LZ1C 3W99C 2RIQA 1P3OD 5DNND 1M1AD 4X23C 5B31G 3LELD 3AZMD 2F8ND 3X1SA 3LJAD 1KU5A 3REKA 4YS3A 5CPKC 1P3GC 5B0YD 2BYMB 4KGCD 3AZEB 3B6FB 1P3AC 3W96A 3AFAC 4Z5TD 5AVBB 1B6WA 5B0ZD 1P3KD 5AV6B 1W2EA 3WAAB 5B2ID 5AVCD 1Z2CB 5B32G 2IO5B 1P34D 2Y2OA 4H9SA 3LZ1D 2BYMA 3W99D 3AZGB 4UUZB 3B6GA 3W98C 2ZY3A 1P3FB 3B6FA 4X23D 2JSSA 1BH9B 5AVBA 4CSRB 4EO5C 5AV6A 3AYWB 4E44A 3REHD 3W97B 3WAAA 5CPKD 1P3GD 4ZUXC 3MGRD 5GT3B 1TAFB 3MGQB 2HIOA 1U35C 1P3AD 3AFAD 4NE6A 3UTAC 3AZGA 2Y2KA 2F2AC 1BH9A 4WV4B 3AYWA 3WKJC 2CWEA 5B2JC 3AZJA 1TAFA 3MGQA 3W98D 4ZBJC 5CPJC 1N1JA 4KHAB 4YM6B 4J8VB 3MGSD 4J8WA 5F99B 4LD9B 1EQZA 3R45B 4ZUXD 5AY8B 3AZFC 4DQYB 1ZLAA 1U35D 1M1AB 1P3MB 2Y2JA 3UTAD 5AV5C 4YM6A 1HQ3B 3MVDB 5JRGC 3REJD 4QLCB 3AZKD 3A6NA 3R45A 3WA9C 3WKJD 5CPIB 5B2JD 5AY8A 3C1BA 3A1IA 5B1LB 3MGPB 3VH5T 5CPJD 5B1MA 2F8NK 5CP6C 3EPJA 1P3BA 1T3UA 4WU8A 3REIC 3AZHB 1HQ3A 1KX3B 3AZFD 5AV9A 4QLCA 5B31B 5DNMA 3AZIB 1KX5C 3H0LC 5CPIA 4H9QB 4R8PC 2XD5A 5JA4B 5GT0B 3AV2B 3KXBD 3TU4A 3VH6A 5B1LA 1A7WA 4H9NA 5AV5D 2NZDA 3UTBA 5B24C 3X1UC 4XZQC 5CHLB 5GSUB 5JRGD 4Z2MG 1KX3A 5B31A 3KWQA 2ZY4A 5B33A 3AZIA 4H9QA 5JA4A 3AV2A 1P3FD 3B0DB 5GT0A 5B32B 3X1VC 3V9RB 4Z66C 5BO0A 3REID 3O62C 1KX4C 5GXQB 2NQBB 4J8XB 1TZYC 4AWLC 1P3PB 3AZMA 2F8NA 5GSUA 1KX5D 3LJAA 3B0CT 3AN2C 4R8PD 3LZ0C 3C1CB 4KGCA 5B24D 3X1UD 4Z5TA 5B32A 2Y2GA 4XZQD 5B0ZA 4G92B 5GXQA 3KUYB 2Y2PA 4XUJA 1P3PA 5AVCA 4G91B 3WTPB 1P34A 3C1CA 3W99A 3X1VD 4J8VD 1S32C 2FFFB 3MNNC 4Z66D 4LD9D 1P3KC 1TZYD 3AZNC 1HTAA 3AN2D 3LZ0D 5CPKA 1P3GA 2W8SA 3WTPA 3H0RC 4H9PA 3W96B 1P3AA 3EPKA 3MVDD 2AROB 1AOIB 3REHC 3MGPD 3MGRC 2J8PA 3X1TB 1M18B 3B6GB 2FJ7B 2F8NG 1S32D 3MNND 3W98A 4KUDB 1ID3C 3AZND 3AZLB 2AROA 1AOIA 4J8UB 4Z2MH 2HIOB 1Q9CA 3X1TA 2RVQC 1M18A 2FJ7A 1P3LC 3UTAA 5BNXB 5AV8D 4KUDA 3RELC 5E5AC 1P3IC 3MGSC 2JE5A 3AZJB 3AZLA 2XD1A 1B67A 4J8UA 1H3OB 1N1JB 2VQRA 2HUEB 5B40D 1ID3D 4WU9D 2L5AA 5BNXA 5BNVA 4J8WB 3X1SC 1EQZB 4YS3C 1M19C 2ZY2A 3REJC 1ZLAB 3AZKC 1F66C 2RVQD 2PYOB 5CP6B 1P3LD 1H3OA 5AV5A 3UT9B 4E45A 3RELD 5E5AD 1P3ID 3A6NB 3WA9A 4CAYB 4HGAB 4DRAA 3C1BB 3AZEC 5B1MB 3B6FC 3KXBC 5C3IB 2PYOA 1P3BB 4WU8B 5CP6A 3X1SD 5AV6C 3UT9A 2CV5B 4YS3D 3REKD 3WAAC 5AV9B 1M19D 3AV1B 5DNMB 4NE3A 1F66D 2IO5C 4JJNB 3WTPE 4CAYA 2NZDB 3TU4B 4H9NB 3AZGC 3UTBB 1P3FC 3X1UA 2F8NH 4M6BA 4XZQA 3AYWC 2CV5A 3W97C 2BYKA 5GT3C 3AV1A 3KWQB 5B33B 3EPLA 3AZED 4JJNA 3B6FD 5AVBD 4WZSB 2ZY5A 5BO0B 5AV6D 1P3OB 5DNNB 2LY8A 4Z66A
chains in the Genus database with same CATH topology
3NQUA 3LELB 4WNNB 3O62A 1KX4A 2DF4C 5BS7A 3WAAD 3AZMB 4NE5A 1TZYA 2F8NB 3LJAB 5B0YB 4KGCB 3AZGD 2YFVB 3EPHA 4Z5TB 4YM6C 4J8VC 5B0ZB 1WWIA 2Y2MA 5DNNA 5F99C 3AYWD 1P3OA 1M1AA 3LELA 4WNNA 3W97D 4LD9C 3AZJD 4XUJB 5AY8C 5AVCB 3EG5B 5B2IB 5GT3D 1ULYA 3MGQD 1P34B 3P5JB 3LZ1B 5B0YA 1P3MC 3NQJA 3W99B 2YFVA 3VH6T 2Y2QA 1S32A 4X23B 1HQ3C 1R4VA 1F1EA 3MVDC 1P3KA 4QLCC 3REHB 3B0BA 5CPIC 5CPKB 1P3GB 5B2IA 3MGPC 4H9PB 3LZ1A 1P3AB 3AFAB 2BG1A 4YM6D 3AZHC 5F99D 4X23A 1KX3C 5AY8D 5B31C 3REHA 3AZIC 2DQNC 3MGRA 1P3MD 5GT0C 1JFIA 3W98B 1P3BD 4WU8D 3H0MC 3AFAA 1HQ3D 5KDMA 5AV8C 1BFMA 4EO5B 5FUGB 5GSUC 4QLCD 5CPID 3B0CW 4ZUXB 5B1LD 1U35B 3B0DC 5B32C 3UTAB 3AZHD 5B40C 5GXQC 4WU9C 4J8XC 3RELA 1KX3D 2NQBC 1P3PC 3MGSA 5FUGA 5B31D 3WKJB 3AZID 5B2JB 4ZUXA 3AV2D 2G5IC 5GT0D 3C1CC 1U35A 4ZBJB 5CPJB 5BNVB 1WWSA 5GSUD 4G92C 3KUYC 3AZFB 4G91C 1M19A 3REJA 3WTPC 3AZKA 3WKJA 1F66A 4UPKA 5B2JA 3KSYA 5B32D 3KXBB 5AV5B 5CPJA 3AL0C 5GXQD 2NQBD 4J8XD 4H9OB 1P3PD 4XUJD 3REKC 5JRGB 3WA9B 3AZFA 3C1CD 2Y2IA 3W96C 3A1KA 3AZEA 2Y2LA 2Y2HA 3KXBA 3REIB 2AROC 4H9OA 3KUYD 1AOIC 5JRGA 4H9SC 3WTPD 2ZM5A 1KX5B 3X1TC 4R8PB 1M18C 3B6GC 2FJ7C 3IP4C 4UUZA 5AVBC 5B24B 3X1UB 1P3FA 4KUDC 2YFWB 4XZQB 5G49B 3REIA 4CSRA 2BYKB 3W97A 3AZLC 4J8UC 3VH5A 2HIOC 5GT3A 1KX5A 3W96D 4NFTA 4R8PA 3X1VB 4WJ3C 4Z66B 3NQUB 5B24A 3O62B 1KX4B 2YFWA 2AROD 1TZYB 1AOID 5G49A 4AWLB 3AZJC 3AN2B 3X1TD 3LZ0B 3MGQC 1M18D 3B6GD 2FJ7D 2HUEC 4KUDD 4KHAA 3X1VA 4J8VA 4J8WC 1EQZC 1BH8B 4LD9A 5F99A 3AZLD 4J8UD 1ZLAC 2HIOD 3AN2A 3NQJB 3LZ0A 1PZRA 2G5HC 2PYOC 1P3MA 3KFUG 3F6TA 5BT1C 3MNNB 3UT9C 1S32B 1P3KB 3AZNB 3A6NC 3MVDA 1BH8A 4HGAC 4DRBA 3C1BC 3VH5W 5B1MC 3MGPA 2UWXA 5C3IC 1P3BC 4WU8C 4J8WD 5AV8B 3MNNA 2CV5C 3AZHA 1EQZD 3WA9D 5AV9C 3AV1C 5DNMC 3AZNA 1ZLAD 4JJNC 3MGRB 2NZDC 3TU4C 5B1LC 1JFIB 2PYOD 3UTBC 4H9RB 5CP6D 5BT1D 3UT9D 5KDMB 5B40B 5BS7C 1ID3B 4WU9B 5AV8A 3A6ND 3C1BD 3KWQC 5B33C 5B1MD 3AV2C 3FDDA 4H9RA 1P3LB 3V9RA 1P3OC 5DNNC 2CV5D 1M1AC 3LELC 5B40A 5E5AB 3RELB 1ID3A 5AV9D 3MGSB 4J8XA 3AZMC 4WU9A 3AV1D 5DNMD 1P3IB 2NQBA 3LJAC 4JJND 5B0YC 2NZDD 3TU4D 4KGCC 3UTBD 2JCHA 3VH6W 4Z5TC 3O62D 1KX4D 5B0ZC 1P3LA 3X1SB 3REKB 4YS3B 5E5AA 4XUJC 5B2IC 5AVCC 1P3IA 1M19B 3KUYA 3REJB 3AZKB 3KWQD 5B33D 2Y2NA 1F66B 1P34C 3LZ1C 3W99C 2RIQA 1P3OD 5DNND 1M1AD 4X23C 5B31G 3LELD 3AZMD 2F8ND 3X1SA 3LJAD 1KU5A 3REKA 4YS3A 5CPKC 1P3GC 5B0YD 2BYMB 4KGCD 3AZEB 3B6FB 1P3AC 3W96A 3AFAC 4Z5TD 5AVBB 1B6WA 5B0ZD 1P3KD 5AV6B 1W2EA 3WAAB 5B2ID 5AVCD 1Z2CB 5B32G 2IO5B 1P34D 2Y2OA 4H9SA 3LZ1D 2BYMA 3W99D 3AZGB 4UUZB 3B6GA 3W98C 2ZY3A 1P3FB 3B6FA 4X23D 2JSSA 1BH9B 5AVBA 4CSRB 4EO5C 5AV6A 3AYWB 4E44A 3REHD 3W97B 3WAAA 5CPKD 1P3GD 4ZUXC 3MGRD 5GT3B 1TAFB 3MGQB 2HIOA 1U35C 1P3AD 3AFAD 4NE6A 3UTAC 3AZGA 2Y2KA 2F2AC 1BH9A 4WV4B 3AYWA 3WKJC 2CWEA 5B2JC 3AZJA 1TAFA 3MGQA 3W98D 4ZBJC 5CPJC 1N1JA 4KHAB 4YM6B 4J8VB 3MGSD 4J8WA 5F99B 4LD9B 1EQZA 3R45B 4ZUXD 5AY8B 3AZFC 4DQYB 1ZLAA 1U35D 1M1AB 1P3MB 2Y2JA 3UTAD 5AV5C 4YM6A 1HQ3B 3MVDB 5JRGC 3REJD 4QLCB 3AZKD 3A6NA 3R45A 3WA9C 3WKJD 5CPIB 5B2JD 5AY8A 3C1BA 3A1IA 5B1LB 3MGPB 3VH5T 5CPJD 5B1MA 2F8NK 5CP6C 3EPJA 1P3BA 1T3UA 4WU8A 3REIC 3AZHB 1HQ3A 1KX3B 3AZFD 5AV9A 4QLCA 5B31B 5DNMA 3AZIB 1KX5C 3H0LC 5CPIA 4H9QB 4R8PC 2XD5A 5JA4B 5GT0B 3AV2B 3KXBD 3TU4A 3VH6A 5B1LA 1A7WA 4H9NA 5AV5D 2NZDA 3UTBA 5B24C 3X1UC 4XZQC 5CHLB 5GSUB 5JRGD 4Z2MG 1KX3A 5B31A 3KWQA 2ZY4A 5B33A 3AZIA 4H9QA 5JA4A 3AV2A 1P3FD 3B0DB 5GT0A 5B32B 3X1VC 3V9RB 4Z66C 5BO0A 3REID 3O62C 1KX4C 5GXQB 2NQBB 4J8XB 1TZYC 4AWLC 1P3PB 3AZMA 2F8NA 5GSUA 1KX5D 3LJAA 3B0CT 3AN2C 4R8PD 3LZ0C 3C1CB 4KGCA 5B24D 3X1UD 4Z5TA 5B32A 2Y2GA 4XZQD 5B0ZA 4G92B 5GXQA 3KUYB 2Y2PA 4XUJA 1P3PA 5AVCA 4G91B 3WTPB 1P34A 3C1CA 3W99A 3X1VD 4J8VD 1S32C 2FFFB 3MNNC 4Z66D 4LD9D 1P3KC 1TZYD 3AZNC 1HTAA 3AN2D 3LZ0D 5CPKA 1P3GA 2W8SA 3WTPA 3H0RC 4H9PA 3W96B 1P3AA 3EPKA 3MVDD 2AROB 1AOIB 3REHC 3MGPD 3MGRC 2J8PA 3X1TB 1M18B 3B6GB 2FJ7B 2F8NG 1S32D 3MNND 3W98A 4KUDB 1ID3C 3AZND 3AZLB 2AROA 1AOIA 4J8UB 4Z2MH 2HIOB 1Q9CA 3X1TA 2RVQC 1M18A 2FJ7A 1P3LC 3UTAA 5BNXB 5AV8D 4KUDA 3RELC 5E5AC 1P3IC 3MGSC 2JE5A 3AZJB 3AZLA 2XD1A 1B67A 4J8UA 1H3OB 1N1JB 2VQRA 2HUEB 5B40D 1ID3D 4WU9D 2L5AA 5BNXA 5BNVA 4J8WB 3X1SC 1EQZB 4YS3C 1M19C 2ZY2A 3REJC 1ZLAB 3AZKC 1F66C 2RVQD 2PYOB 5CP6B 1P3LD 1H3OA 5AV5A 3UT9B 4E45A 3RELD 5E5AD 1P3ID 3A6NB 3WA9A 4CAYB 4HGAB 4DRAA 3C1BB 3AZEC 5B1MB 3B6FC 3KXBC 5C3IB 2PYOA 1P3BB 4WU8B 5CP6A 3X1SD 5AV6C 3UT9A 2CV5B 4YS3D 3REKD 3WAAC 5AV9B 1M19D 3AV1B 5DNMB 4NE3A 1F66D 2IO5C 4JJNB 3WTPE 4CAYA 2NZDB 3TU4B 4H9NB 3AZGC 3UTBB 1P3FC 3X1UA 2F8NH 4M6BA 4XZQA 3AYWC 2CV5A 3W97C 2BYKA 5GT3C 3AV1A 3KWQB 5B33B 3EPLA 3AZED 4JJNA 3B6FD 5AVBD 4WZSB 2ZY5A 5BO0B 5AV6D 1P3OB 5DNNB 2LY8A 4Z66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NQU A;  3LEL B;  4WNN B;  3O62 A;  1KX4 A;  5BS7 A;  3WAA D;  3AZM B;  4NE5 A;  1TZY A;  2F8N B;  3LJA B;  5B0Y B;  4KGC B;  3AZG D;  2YFV B;  4Z5T B;  4YM6 C;  4J8V C;  5B0Z B;  1WWI A;  1P3O A;  5DNN A;  5F99 C;  3AYW D;  1M1A A;  3W97 D;  3LEL A;  4WNN A;  4LD9 C;  3AZJ D;  4XUJ B;  5AY8 C;  5AVC B;  5GT3 D;  5B2I B;  1ULY A;  3MGQ D;  1P34 B;  3LZ1 B;  5B0Y A;  1P3M C;  3NQJ A;  3W99 B;  2YFV A;  3VH6 T;  1S32 A;  4X23 B;  1HQ3 C;  1R4V A;  1F1E A;  3MVD C;  1P3K A;  4QLC C;  3REH B;  3B0B A;  5CPI C;  5CPK B;  1P3G B;  5B2I A;  3MGP C;  4H9P B;  3LZ1 A;  1P3A B;  3AFA B;  4YM6 D;  3AZH C;  5F99 D;  4X23 A;  1KX3 C;  5AY8 D;  5B31 C;  3REH A;  3AZI C;  3MGR A;  1P3M D;  5GT0 C;  1JFI A;  3W98 B;  1P3B D;  4WU8 D;  3AFA A;  1HQ3 D;  5KDM A;  5AV8 C;  1BFM A;  4EO5 B;  5FUG B;  5GSU C;  4QLC D;  5CPI D;  3B0C W;  4ZUX B;  5B1L D;  1U35 B;  3B0D C;  5B32 C;  3UTA B;  3AZH D;  5B40 C;  5GXQ C;  4WU9 C;  4J8X C;  3REL A;  1KX3 D;  2NQB C;  1P3P C;  3MGS A;  5FUG A;  5B31 D;  3WKJ B;  3AZI D;  5B2J B;  4ZUX A;  3AV2 D;  3C1C C;  5GT0 D;  1U35 A;  4ZBJ B;  5CPJ B;  5BNV B;  1WWS A;  5GSU D;  4G92 C;  3KUY C;  3AZF B;  4G91 C;  1M19 A;  3REJ A;  3WTP C;  3AZK A;  3WKJ A;  1F66 A;  5B2J A;  3KSY A;  5B32 D;  3KXB B;  5AV5 B;  5CPJ A;  5GXQ D;  2NQB D;  4J8X D;  4H9O B;  1P3P D;  4XUJ D;  3REK C;  5JRG B;  3WA9 B;  3AZF A;  3C1C D;  3W96 C;  3AZE A;  3KXB A;  3REI B;  2ARO C;  4H9O A;  3KUY D;  1AOI C;  5JRG A;  4H9S C;  3WTP D;  1KX5 B;  3X1T C;  4R8P B;  1M18 C;  3B6G C;  2FJ7 C;  4UUZ A;  5AVB C;  5B24 B;  3X1U B;  1P3F A;  4KUD C;  2YFW B;  4XZQ B;  5G49 B;  3REI A;  4CSR A;  2BYK B;  3W97 A;  3AZL C;  4J8U C;  3VH5 A;  2HIO C;  5GT3 A;  1KX5 A;  3W96 D;  4NFT A;  4R8P A;  3X1V B;  4Z66 B;  3NQU B;  5B24 A;  3O62 B;  1KX4 B;  2YFW A;  2ARO D;  1TZY B;  1AOI D;  5G49 A;  4AWL B;  3AZJ C;  3AN2 B;  3X1T D;  3LZ0 B;  3MGQ C;  1M18 D;  3B6G D;  2FJ7 D;  2HUE C;  4KUD D;  4KHA A;  3X1V A;  4J8V A;  4J8W C;  1EQZ C;  1BH8 B;  4LD9 A;  5F99 A;  3AZL D;  4J8U D;  1ZLA C;  2HIO D;  3AN2 A;  3NQJ B;  3LZ0 A;  2PYO C;  1P3M A;  5BT1 C;  3MNN B;  3UT9 C;  1S32 B;  1P3K B;  3AZN B;  3A6N C;  3MVD A;  1BH8 A;  4HGA C;  4DRB A;  3C1B C;  3VH5 W;  5B1M C;  3MGP A;  5C3I C;  1P3B C;  4WU8 C;  4J8W D;  5AV8 B;  3MNN A;  2CV5 C;  3AZH A;  1EQZ D;  3WA9 D;  5AV9 C;  3AV1 C;  5DNM C;  3AZN A;  1ZLA D;  4JJN C;  3MGR B;  2NZD C;  3TU4 C;  5B1L C;  1JFI B;  2PYO D;  3UTB C;  4H9R B;  5CP6 D;  5BT1 D;  3UT9 D;  5KDM B;  5B40 B;  5BS7 C;  1ID3 B;  4WU9 B;  5AV8 A;  3A6N D;  3C1B D;  3KWQ C;  5B33 C;  5B1M D;  3AV2 C;  4H9R A;  1P3L B;  3V9R A;  1P3O C;  5DNN C;  2CV5 D;  1M1A C;  3LEL C;  5B40 A;  5E5A B;  3REL B;  1ID3 A;  5AV9 D;  3MGS B;  4J8X A;  3AZM C;  4WU9 A;  3AV1 D;  5DNM D;  1P3I B;  2NQB A;  3LJA C;  4JJN D;  5B0Y C;  2NZD D;  3TU4 D;  4KGC C;  3UTB D;  3VH6 W;  4Z5T C;  3O62 D;  1KX4 D;  5B0Z C;  1P3L A;  3X1S B;  3REK B;  4YS3 B;  5E5A A;  4XUJ C;  5B2I C;  5AVC C;  1P3I A;  1M19 B;  3KUY A;  3REJ B;  3AZK B;  3KWQ D;  5B33 D;  1F66 B;  1P34 C;  3LZ1 C;  3W99 C;  1P3O D;  5DNN D;  1M1A D;  4X23 C;  5B31 G;  3LEL D;  3AZM D;  2F8N D;  3X1S A;  3LJA D;  1KU5 A;  3REK A;  4YS3 A;  5CPK C;  1P3G C;  5B0Y D;  2BYM B;  4KGC D;  3AZE B;  3B6F B;  1P3A C;  3W96 A;  3AFA C;  4Z5T D;  5AVB B;  1B6W A;  5B0Z D;  1P3K D;  5AV6 B;  3WAA B;  5B2I D;  5AVC D;  5B32 G;  2IO5 B;  1P34 D;  4H9S A;  3LZ1 D;  2BYM A;  3W99 D;  3AZG B;  4UUZ B;  3B6G A;  3W98 C;  1P3F B;  3B6F A;  4X23 D;  2JSS A;  1BH9 B;  5AVB A;  4CSR B;  4EO5 C;  5AV6 A;  3AYW B;  4E44 A;  3REH D;  3W97 B;  3WAA A;  5CPK D;  1P3G D;  4ZUX C;  3MGR D;  5GT3 B;  1TAF B;  3MGQ B;  2HIO A;  1U35 C;  1P3A D;  3AFA D;  4NE6 A;  3UTA C;  3AZG A;  1BH9 A;  4WV4 B;  3AYW A;  3WKJ C;  2CWE A;  5B2J C;  3AZJ A;  1TAF A;  3MGQ A;  3W98 D;  4ZBJ C;  5CPJ C;  1N1J A;  4KHA B;  4YM6 B;  4J8V B;  3MGS D;  4J8W A;  5F99 B;  4LD9 B;  1EQZ A;  3R45 B;  4ZUX D;  5AY8 B;  3AZF C;  1ZLA A;  1U35 D;  1M1A B;  1P3M B;  3UTA D;  5AV5 C;  4YM6 A;  1HQ3 B;  3MVD B;  5JRG C;  3REJ D;  4QLC B;  3AZK D;  3A6N A;  3R45 A;  3WA9 C;  3WKJ D;  5CPI B;  5B2J D;  5AY8 A;  3C1B A;  5B1L B;  3MGP B;  3VH5 T;  5CPJ D;  5B1M A;  2F8N K;  5CP6 C;  1P3B A;  4WU8 A;  3AZH B;  3REI C;  1HQ3 A;  1KX3 B;  3AZF D;  5AV9 A;  4QLC A;  5B31 B;  5DNM A;  3AZI B;  1KX5 C;  5CPI A;  4H9Q B;  4R8P C;  5JA4 B;  3AV2 B;  5GT0 B;  2NZD A;  3KXB D;  3TU4 A;  3VH6 A;  5B1L A;  1A7W A;  4H9N A;  5AV5 D;  3UTB A;  5B24 C;  3X1U C;  4XZQ C;  5CHL B;  5GSU B;  5JRG D;  4Z2M G;  1KX3 A;  5B31 A;  3KWQ A;  5B33 A;  3AZI A;  4H9Q A;  5JA4 A;  3AV2 A;  1P3F D;  3B0D B;  5GT0 A;  5B32 B;  3X1V C;  3V9R B;  4Z66 C;  5BO0 A;  3REI D;  3O62 C;  1KX4 C;  5GXQ B;  2NQB B;  4J8X B;  1TZY C;  4AWL C;  1P3P B;  3AZM A;  2F8N A;  5GSU A;  1KX5 D;  3LJA A;  3B0C T;  3AN2 C;  4R8P D;  3LZ0 C;  3C1C B;  4KGC A;  5B24 D;  3X1U D;  4Z5T A;  5B32 A;  4XZQ D;  5B0Z A;  4G92 B;  5GXQ A;  3KUY B;  1P3P A;  4XUJ A;  5AVC A;  4G91 B;  3WTP B;  1P34 A;  3C1C A;  3W99 A;  3X1V D;  4J8V D;  1S32 C;  3MNN C;  4Z66 D;  4LD9 D;  1P3K C;  1TZY D;  3AZN C;  1HTA A;  3AN2 D;  3LZ0 D;  5CPK A;  1P3G A;  3WTP A;  4H9P A;  3W96 B;  1P3A A;  3MVD D;  2ARO B;  1AOI B;  3REH C;  3MGP D;  3MGR C;  3X1T B;  1M18 B;  3B6G B;  2FJ7 B;  2F8N G;  1S32 D;  3MNN D;  3W98 A;  4KUD B;  1ID3 C;  3AZN D;  3AZL B;  2ARO A;  1AOI A;  4J8U B;  4Z2M H;  2HIO B;  1Q9C A;  3X1T A;  2RVQ C;  1M18 A;  2FJ7 A;  1P3L C;  3UTA A;  5BNX B;  5AV8 D;  4KUD A;  3REL C;  5E5A C;  1P3I C;  3MGS C;  3AZJ B;  3AZL A;  4J8U A;  1B67 A;  1H3O B;  1N1J B;  2HUE B;  5B40 D;  1ID3 D;  4WU9 D;  2L5A A;  5BNX A;  5BNV A;  4J8W B;  3X1S C;  1EQZ B;  4YS3 C;  1M19 C;  3REJ C;  1ZLA B;  3AZK C;  1F66 C;  2RVQ D;  2PYO B;  5CP6 B;  1P3L D;  1H3O A;  5AV5 A;  3UT9 B;  4E45 A;  3REL D;  5E5A D;  1P3I D;  3A6N B;  3WA9 A;  4CAY B;  4HGA B;  4DRA A;  3C1B B;  3AZE C;  5B1M B;  3B6F C;  3KXB C;  5C3I B;  2PYO A;  1P3B B;  4WU8 B;  5CP6 A;  3X1S D;  5AV6 C;  3UT9 A;  2CV5 B;  4YS3 D;  3REK D;  3WAA C;  5AV9 B;  1M19 D;  3AV1 B;  5DNM B;  4NE3 A;  1F66 D;  2IO5 C;  4JJN B;  3WTP E;  4CAY A;  2NZD B;  3TU4 B;  4H9N B;  3AZG C;  3UTB B;  1P3F C;  3X1U A;  2F8N H;  4M6B A;  4XZQ A;  3AYW C;  2CV5 A;  3W97 C;  2BYK A;  5GT3 C;  3AV1 A;  3KWQ B;  5B33 B;  3AZE D;  4JJN A;  3B6F D;  5AVB D;  4WZS B;  5BO0 B;  5AV6 D;  1P3O B;  5DNN B;  2LY8 A;  4Z66 A; 
#chains in the Genus database with same CATH topology
 3NQU A;  3LEL B;  4WNN B;  3O62 A;  1KX4 A;  2DF4 C;  5BS7 A;  3WAA D;  3AZM B;  4NE5 A;  1TZY A;  2F8N B;  3LJA B;  5B0Y B;  4KGC B;  3AZG D;  2YFV B;  3EPH A;  4Z5T B;  4YM6 C;  4J8V C;  5B0Z B;  1WWI A;  2Y2M A;  5DNN A;  5F99 C;  3AYW D;  1P3O A;  1M1A A;  3LEL A;  4WNN A;  3W97 D;  4LD9 C;  3AZJ D;  4XUJ B;  5AY8 C;  5AVC B;  3EG5 B;  5B2I B;  5GT3 D;  1ULY A;  3MGQ D;  1P34 B;  3P5J B;  3LZ1 B;  5B0Y A;  1P3M C;  3NQJ A;  3W99 B;  2YFV A;  3VH6 T;  2Y2Q A;  1S32 A;  4X23 B;  1HQ3 C;  1R4V A;  1F1E A;  3MVD C;  1P3K A;  4QLC C;  3REH B;  3B0B A;  5CPI C;  5CPK B;  1P3G B;  5B2I A;  3MGP C;  4H9P B;  3LZ1 A;  1P3A B;  3AFA B;  2BG1 A;  4YM6 D;  3AZH C;  5F99 D;  4X23 A;  1KX3 C;  5AY8 D;  5B31 C;  3REH A;  3AZI C;  2DQN C;  3MGR A;  1P3M D;  5GT0 C;  1JFI A;  3W98 B;  1P3B D;  4WU8 D;  3H0M C;  3AFA A;  1HQ3 D;  5KDM A;  5AV8 C;  1BFM A;  4EO5 B;  5FUG B;  5GSU C;  4QLC D;  5CPI D;  3B0C W;  4ZUX B;  5B1L D;  1U35 B;  3B0D C;  5B32 C;  3UTA B;  3AZH D;  5B40 C;  5GXQ C;  4WU9 C;  4J8X C;  3REL A;  1KX3 D;  2NQB C;  1P3P C;  3MGS A;  5FUG A;  5B31 D;  3WKJ B;  3AZI D;  5B2J B;  4ZUX A;  3AV2 D;  2G5I C;  5GT0 D;  3C1C C;  1U35 A;  4ZBJ B;  5CPJ B;  5BNV B;  1WWS A;  5GSU D;  4G92 C;  3KUY C;  3AZF B;  4G91 C;  1M19 A;  3REJ A;  3WTP C;  3AZK A;  3WKJ A;  1F66 A;  4UPK A;  5B2J A;  3KSY A;  5B32 D;  3KXB B;  5AV5 B;  5CPJ A;  3AL0 C;  5GXQ D;  2NQB D;  4J8X D;  4H9O B;  1P3P D;  4XUJ D;  3REK C;  5JRG B;  3WA9 B;  3AZF A;  3C1C D;  2Y2I A;  3W96 C;  3A1K A;  3AZE A;  2Y2L A;  2Y2H A;  3KXB A;  3REI B;  2ARO C;  4H9O A;  3KUY D;  1AOI C;  5JRG A;  4H9S C;  3WTP D;  2ZM5 A;  1KX5 B;  3X1T C;  4R8P B;  1M18 C;  3B6G C;  2FJ7 C;  3IP4 C;  4UUZ A;  5AVB C;  5B24 B;  3X1U B;  1P3F A;  4KUD C;  2YFW B;  4XZQ B;  5G49 B;  3REI A;  4CSR A;  2BYK B;  3W97 A;  3AZL C;  4J8U C;  3VH5 A;  2HIO C;  5GT3 A;  1KX5 A;  3W96 D;  4NFT A;  4R8P A;  3X1V B;  4WJ3 C;  4Z66 B;  3NQU B;  5B24 A;  3O62 B;  1KX4 B;  2YFW A;  2ARO D;  1TZY B;  1AOI D;  5G49 A;  4AWL B;  3AZJ C;  3AN2 B;  3X1T D;  3LZ0 B;  3MGQ C;  1M18 D;  3B6G D;  2FJ7 D;  2HUE C;  4KUD D;  4KHA A;  3X1V A;  4J8V A;  4J8W C;  1EQZ C;  1BH8 B;  4LD9 A;  5F99 A;  3AZL D;  4J8U D;  1ZLA C;  2HIO D;  3AN2 A;  3NQJ B;  3LZ0 A;  1PZR A;  2G5H C;  2PYO C;  1P3M A;  3KFU G;  3F6T A;  5BT1 C;  3MNN B;  3UT9 C;  1S32 B;  1P3K B;  3AZN B;  3A6N C;  3MVD A;  1BH8 A;  4HGA C;  4DRB A;  3C1B C;  3VH5 W;  5B1M C;  3MGP A;  2UWX A;  5C3I C;  1P3B C;  4WU8 C;  4J8W D;  5AV8 B;  3MNN A;  2CV5 C;  3AZH A;  1EQZ D;  3WA9 D;  5AV9 C;  3AV1 C;  5DNM C;  3AZN A;  1ZLA D;  4JJN C;  3MGR B;  2NZD C;  3TU4 C;  5B1L C;  1JFI B;  2PYO D;  3UTB C;  4H9R B;  5CP6 D;  5BT1 D;  3UT9 D;  5KDM B;  5B40 B;  5BS7 C;  1ID3 B;  4WU9 B;  5AV8 A;  3A6N D;  3C1B D;  3KWQ C;  5B33 C;  5B1M D;  3AV2 C;  3FDD A;  4H9R A;  1P3L B;  3V9R A;  1P3O C;  5DNN C;  2CV5 D;  1M1A C;  3LEL C;  5B40 A;  5E5A B;  3REL B;  1ID3 A;  5AV9 D;  3MGS B;  4J8X A;  3AZM C;  4WU9 A;  3AV1 D;  5DNM D;  1P3I B;  2NQB A;  3LJA C;  4JJN D;  5B0Y C;  2NZD D;  3TU4 D;  4KGC C;  3UTB D;  2JCH A;  3VH6 W;  4Z5T C;  3O62 D;  1KX4 D;  5B0Z C;  1P3L A;  3X1S B;  3REK B;  4YS3 B;  5E5A A;  4XUJ C;  5B2I C;  5AVC C;  1P3I A;  1M19 B;  3KUY A;  3REJ B;  3AZK B;  3KWQ D;  5B33 D;  2Y2N A;  1F66 B;  1P34 C;  3LZ1 C;  3W99 C;  2RIQ A;  1P3O D;  5DNN D;  1M1A D;  4X23 C;  5B31 G;  3LEL D;  3AZM D;  2F8N D;  3X1S A;  3LJA D;  1KU5 A;  3REK A;  4YS3 A;  5CPK C;  1P3G C;  5B0Y D;  2BYM B;  4KGC D;  3AZE B;  3B6F B;  1P3A C;  3W96 A;  3AFA C;  4Z5T D;  5AVB B;  1B6W A;  5B0Z D;  1P3K D;  5AV6 B;  1W2E A;  3WAA B;  5B2I D;  5AVC D;  1Z2C B;  5B32 G;  2IO5 B;  1P34 D;  2Y2O A;  4H9S A;  3LZ1 D;  2BYM A;  3W99 D;  3AZG B;  4UUZ B;  3B6G A;  3W98 C;  2ZY3 A;  1P3F B;  3B6F A;  4X23 D;  2JSS A;  1BH9 B;  5AVB A;  4CSR B;  4EO5 C;  5AV6 A;  3AYW B;  4E44 A;  3REH D;  3W97 B;  3WAA A;  5CPK D;  1P3G D;  4ZUX C;  3MGR D;  5GT3 B;  1TAF B;  3MGQ B;  2HIO A;  1U35 C;  1P3A D;  3AFA D;  4NE6 A;  3UTA C;  3AZG A;  2Y2K A;  2F2A C;  1BH9 A;  4WV4 B;  3AYW A;  3WKJ C;  2CWE A;  5B2J C;  3AZJ A;  1TAF A;  3MGQ A;  3W98 D;  4ZBJ C;  5CPJ C;  1N1J A;  4KHA B;  4YM6 B;  4J8V B;  3MGS D;  4J8W A;  5F99 B;  4LD9 B;  1EQZ A;  3R45 B;  4ZUX D;  5AY8 B;  3AZF C;  4DQY B;  1ZLA A;  1U35 D;  1M1A B;  1P3M B;  2Y2J A;  3UTA D;  5AV5 C;  4YM6 A;  1HQ3 B;  3MVD B;  5JRG C;  3REJ D;  4QLC B;  3AZK D;  3A6N A;  3R45 A;  3WA9 C;  3WKJ D;  5CPI B;  5B2J D;  5AY8 A;  3C1B A;  3A1I A;  5B1L B;  3MGP B;  3VH5 T;  5CPJ D;  5B1M A;  2F8N K;  5CP6 C;  3EPJ A;  1P3B A;  1T3U A;  4WU8 A;  3REI C;  3AZH B;  1HQ3 A;  1KX3 B;  3AZF D;  5AV9 A;  4QLC A;  5B31 B;  5DNM A;  3AZI B;  1KX5 C;  3H0L C;  5CPI A;  4H9Q B;  4R8P C;  2XD5 A;  5JA4 B;  5GT0 B;  3AV2 B;  3KXB D;  3TU4 A;  3VH6 A;  5B1L A;  1A7W A;  4H9N A;  5AV5 D;  2NZD A;  3UTB A;  5B24 C;  3X1U C;  4XZQ C;  5CHL B;  5GSU B;  5JRG D;  4Z2M G;  1KX3 A;  5B31 A;  3KWQ A;  2ZY4 A;  5B33 A;  3AZI A;  4H9Q A;  5JA4 A;  3AV2 A;  1P3F D;  3B0D B;  5GT0 A;  5B32 B;  3X1V C;  3V9R B;  4Z66 C;  5BO0 A;  3REI D;  3O62 C;  1KX4 C;  5GXQ B;  2NQB B;  4J8X B;  1TZY C;  4AWL C;  1P3P B;  3AZM A;  2F8N A;  5GSU A;  1KX5 D;  3LJA A;  3B0C T;  3AN2 C;  4R8P D;  3LZ0 C;  3C1C B;  4KGC A;  5B24 D;  3X1U D;  4Z5T A;  5B32 A;  2Y2G A;  4XZQ D;  5B0Z A;  4G92 B;  5GXQ A;  3KUY B;  2Y2P A;  4XUJ A;  1P3P A;  5AVC A;  4G91 B;  3WTP B;  1P34 A;  3C1C A;  3W99 A;  3X1V D;  4J8V D;  1S32 C;  2FFF B;  3MNN C;  4Z66 D;  4LD9 D;  1P3K C;  1TZY D;  3AZN C;  1HTA A;  3AN2 D;  3LZ0 D;  5CPK A;  1P3G A;  2W8S A;  3WTP A;  3H0R C;  4H9P A;  3W96 B;  1P3A A;  3EPK A;  3MVD D;  2ARO B;  1AOI B;  3REH C;  3MGP D;  3MGR C;  2J8P A;  3X1T B;  1M18 B;  3B6G B;  2FJ7 B;  2F8N G;  1S32 D;  3MNN D;  3W98 A;  4KUD B;  1ID3 C;  3AZN D;  3AZL B;  2ARO A;  1AOI A;  4J8U B;  4Z2M H;  2HIO B;  1Q9C A;  3X1T A;  2RVQ C;  1M18 A;  2FJ7 A;  1P3L C;  3UTA A;  5BNX B;  5AV8 D;  4KUD A;  3REL C;  5E5A C;  1P3I C;  3MGS C;  2JE5 A;  3AZJ B;  3AZL A;  2XD1 A;  1B67 A;  4J8U A;  1H3O B;  1N1J B;  2VQR A;  2HUE B;  5B40 D;  1ID3 D;  4WU9 D;  2L5A A;  5BNX A;  5BNV A;  4J8W B;  3X1S C;  1EQZ B;  4YS3 C;  1M19 C;  2ZY2 A;  3REJ C;  1ZLA B;  3AZK C;  1F66 C;  2RVQ D;  2PYO B;  5CP6 B;  1P3L D;  1H3O A;  5AV5 A;  3UT9 B;  4E45 A;  3REL D;  5E5A D;  1P3I D;  3A6N B;  3WA9 A;  4CAY B;  4HGA B;  4DRA A;  3C1B B;  3AZE C;  5B1M B;  3B6F C;  3KXB C;  5C3I B;  2PYO A;  1P3B B;  4WU8 B;  5CP6 A;  3X1S D;  5AV6 C;  3UT9 A;  2CV5 B;  4YS3 D;  3REK D;  3WAA C;  5AV9 B;  1M19 D;  3AV1 B;  5DNM B;  4NE3 A;  1F66 D;  2IO5 C;  4JJN B;  3WTP E;  4CAY A;  2NZD B;  3TU4 B;  4H9N B;  3AZG C;  3UTB B;  1P3F C;  3X1U A;  2F8N H;  4M6B A;  4XZQ A;  3AYW C;  2CV5 A;  3W97 C;  2BYK A;  5GT3 C;  3AV1 A;  3KWQ B;  5B33 B;  3EPL A;  3AZE D;  4JJN A;  3B6F D;  5AVB D;  4WZS B;  2ZY5 A;  5BO0 B;  5AV6 D;  1P3O B;  5DNN B;  2LY8 A;  4Z66 A; 
#chains in the Genus database with same CATH homology
 3NQU A;  3LEL B;  4WNN B;  3O62 A;  1KX4 A;  2DF4 C;  5BS7 A;  3WAA D;  3AZM B;  4NE5 A;  1TZY A;  2F8N B;  3LJA B;  5B0Y B;  4KGC B;  3AZG D;  2YFV B;  3EPH A;  4Z5T B;  4YM6 C;  4J8V C;  5B0Z B;  1WWI A;  2Y2M A;  5DNN A;  5F99 C;  3AYW D;  1P3O A;  1M1A A;  3LEL A;  4WNN A;  3W97 D;  4LD9 C;  3AZJ D;  4XUJ B;  5AY8 C;  5AVC B;  3EG5 B;  5B2I B;  5GT3 D;  1ULY A;  3MGQ D;  1P34 B;  3P5J B;  3LZ1 B;  5B0Y A;  1P3M C;  3NQJ A;  3W99 B;  2YFV A;  3VH6 T;  2Y2Q A;  1S32 A;  4X23 B;  1HQ3 C;  1R4V A;  1F1E A;  3MVD C;  1P3K A;  4QLC C;  3REH B;  3B0B A;  5CPI C;  5CPK B;  1P3G B;  5B2I A;  3MGP C;  4H9P B;  3LZ1 A;  1P3A B;  3AFA B;  2BG1 A;  4YM6 D;  3AZH C;  5F99 D;  4X23 A;  1KX3 C;  5AY8 D;  5B31 C;  3REH A;  3AZI C;  2DQN C;  3MGR A;  1P3M D;  5GT0 C;  1JFI A;  3W98 B;  1P3B D;  4WU8 D;  3H0M C;  3AFA A;  1HQ3 D;  5KDM A;  5AV8 C;  1BFM A;  4EO5 B;  5FUG B;  5GSU C;  4QLC D;  5CPI D;  3B0C W;  4ZUX B;  5B1L D;  1U35 B;  3B0D C;  5B32 C;  3UTA B;  3AZH D;  5B40 C;  5GXQ C;  4WU9 C;  4J8X C;  3REL A;  1KX3 D;  2NQB C;  1P3P C;  3MGS A;  5FUG A;  5B31 D;  3WKJ B;  3AZI D;  5B2J B;  4ZUX A;  3AV2 D;  2G5I C;  5GT0 D;  3C1C C;  1U35 A;  4ZBJ B;  5CPJ B;  5BNV B;  1WWS A;  5GSU D;  4G92 C;  3KUY C;  3AZF B;  4G91 C;  1M19 A;  3REJ A;  3WTP C;  3AZK A;  3WKJ A;  1F66 A;  4UPK A;  5B2J A;  3KSY A;  5B32 D;  3KXB B;  5AV5 B;  5CPJ A;  3AL0 C;  5GXQ D;  2NQB D;  4J8X D;  4H9O B;  1P3P D;  4XUJ D;  3REK C;  5JRG B;  3WA9 B;  3AZF A;  3C1C D;  2Y2I A;  3W96 C;  3A1K A;  3AZE A;  2Y2L A;  2Y2H A;  3KXB A;  3REI B;  2ARO C;  4H9O A;  3KUY D;  1AOI C;  5JRG A;  4H9S C;  3WTP D;  2ZM5 A;  1KX5 B;  3X1T C;  4R8P B;  1M18 C;  3B6G C;  2FJ7 C;  3IP4 C;  4UUZ A;  5AVB C;  5B24 B;  3X1U B;  1P3F A;  4KUD C;  2YFW B;  4XZQ B;  5G49 B;  3REI A;  4CSR A;  2BYK B;  3W97 A;  3AZL C;  4J8U C;  3VH5 A;  2HIO C;  5GT3 A;  1KX5 A;  3W96 D;  4NFT A;  4R8P A;  3X1V B;  4WJ3 C;  4Z66 B;  3NQU B;  5B24 A;  3O62 B;  1KX4 B;  2YFW A;  2ARO D;  1TZY B;  1AOI D;  5G49 A;  4AWL B;  3AZJ C;  3AN2 B;  3X1T D;  3LZ0 B;  3MGQ C;  1M18 D;  3B6G D;  2FJ7 D;  2HUE C;  4KUD D;  4KHA A;  3X1V A;  4J8V A;  4J8W C;  1EQZ C;  1BH8 B;  4LD9 A;  5F99 A;  3AZL D;  4J8U D;  1ZLA C;  2HIO D;  3AN2 A;  3NQJ B;  3LZ0 A;  1PZR A;  2G5H C;  2PYO C;  1P3M A;  3KFU G;  3F6T A;  5BT1 C;  3MNN B;  3UT9 C;  1S32 B;  1P3K B;  3AZN B;  3A6N C;  3MVD A;  1BH8 A;  4HGA C;  4DRB A;  3C1B C;  3VH5 W;  5B1M C;  3MGP A;  2UWX A;  5C3I C;  1P3B C;  4WU8 C;  4J8W D;  5AV8 B;  3MNN A;  2CV5 C;  3AZH A;  1EQZ D;  3WA9 D;  5AV9 C;  3AV1 C;  5DNM C;  3AZN A;  1ZLA D;  4JJN C;  3MGR B;  2NZD C;  3TU4 C;  5B1L C;  1JFI B;  2PYO D;  3UTB C;  4H9R B;  5CP6 D;  5BT1 D;  3UT9 D;  5KDM B;  5B40 B;  5BS7 C;  1ID3 B;  4WU9 B;  5AV8 A;  3A6N D;  3C1B D;  3KWQ C;  5B33 C;  5B1M D;  3AV2 C;  3FDD A;  4H9R A;  1P3L B;  3V9R A;  1P3O C;  5DNN C;  2CV5 D;  1M1A C;  3LEL C;  5B40 A;  5E5A B;  3REL B;  1ID3 A;  5AV9 D;  3MGS B;  4J8X A;  3AZM C;  4WU9 A;  3AV1 D;  5DNM D;  1P3I B;  2NQB A;  3LJA C;  4JJN D;  5B0Y C;  2NZD D;  3TU4 D;  4KGC C;  3UTB D;  2JCH A;  3VH6 W;  4Z5T C;  3O62 D;  1KX4 D;  5B0Z C;  1P3L A;  3X1S B;  3REK B;  4YS3 B;  5E5A A;  4XUJ C;  5B2I C;  5AVC C;  1P3I A;  1M19 B;  3KUY A;  3REJ B;  3AZK B;  3KWQ D;  5B33 D;  2Y2N A;  1F66 B;  1P34 C;  3LZ1 C;  3W99 C;  2RIQ A;  1P3O D;  5DNN D;  1M1A D;  4X23 C;  5B31 G;  3LEL D;  3AZM D;  2F8N D;  3X1S A;  3LJA D;  1KU5 A;  3REK A;  4YS3 A;  5CPK C;  1P3G C;  5B0Y D;  2BYM B;  4KGC D;  3AZE B;  3B6F B;  1P3A C;  3W96 A;  3AFA C;  4Z5T D;  5AVB B;  1B6W A;  5B0Z D;  1P3K D;  5AV6 B;  1W2E A;  3WAA B;  5B2I D;  5AVC D;  1Z2C B;  5B32 G;  2IO5 B;  1P34 D;  2Y2O A;  4H9S A;  3LZ1 D;  2BYM A;  3W99 D;  3AZG B;  4UUZ B;  3B6G A;  3W98 C;  2ZY3 A;  1P3F B;  3B6F A;  4X23 D;  2JSS A;  1BH9 B;  5AVB A;  4CSR B;  4EO5 C;  5AV6 A;  3AYW B;  4E44 A;  3REH D;  3W97 B;  3WAA A;  5CPK D;  1P3G D;  4ZUX C;  3MGR D;  5GT3 B;  1TAF B;  3MGQ B;  2HIO A;  1U35 C;  1P3A D;  3AFA D;  4NE6 A;  3UTA C;  3AZG A;  2Y2K A;  2F2A C;  1BH9 A;  4WV4 B;  3AYW A;  3WKJ C;  2CWE A;  5B2J C;  3AZJ A;  1TAF A;  3MGQ A;  3W98 D;  4ZBJ C;  5CPJ C;  1N1J A;  4KHA B;  4YM6 B;  4J8V B;  3MGS D;  4J8W A;  5F99 B;  4LD9 B;  1EQZ A;  3R45 B;  4ZUX D;  5AY8 B;  3AZF C;  4DQY B;  1ZLA A;  1U35 D;  1M1A B;  1P3M B;  2Y2J A;  3UTA D;  5AV5 C;  4YM6 A;  1HQ3 B;  3MVD B;  5JRG C;  3REJ D;  4QLC B;  3AZK D;  3A6N A;  3R45 A;  3WA9 C;  3WKJ D;  5CPI B;  5B2J D;  5AY8 A;  3C1B A;  3A1I A;  5B1L B;  3MGP B;  3VH5 T;  5CPJ D;  5B1M A;  2F8N K;  5CP6 C;  3EPJ A;  1P3B A;  1T3U A;  4WU8 A;  3REI C;  3AZH B;  1HQ3 A;  1KX3 B;  3AZF D;  5AV9 A;  4QLC A;  5B31 B;  5DNM A;  3AZI B;  1KX5 C;  3H0L C;  5CPI A;  4H9Q B;  4R8P C;  2XD5 A;  5JA4 B;  5GT0 B;  3AV2 B;  3KXB D;  3TU4 A;  3VH6 A;  5B1L A;  1A7W A;  4H9N A;  5AV5 D;  2NZD A;  3UTB A;  5B24 C;  3X1U C;  4XZQ C;  5CHL B;  5GSU B;  5JRG D;  4Z2M G;  1KX3 A;  5B31 A;  3KWQ A;  2ZY4 A;  5B33 A;  3AZI A;  4H9Q A;  5JA4 A;  3AV2 A;  1P3F D;  3B0D B;  5GT0 A;  5B32 B;  3X1V C;  3V9R B;  4Z66 C;  5BO0 A;  3REI D;  3O62 C;  1KX4 C;  5GXQ B;  2NQB B;  4J8X B;  1TZY C;  4AWL C;  1P3P B;  3AZM A;  2F8N A;  5GSU A;  1KX5 D;  3LJA A;  3B0C T;  3AN2 C;  4R8P D;  3LZ0 C;  3C1C B;  4KGC A;  5B24 D;  3X1U D;  4Z5T A;  5B32 A;  2Y2G A;  4XZQ D;  5B0Z A;  4G92 B;  5GXQ A;  3KUY B;  2Y2P A;  4XUJ A;  1P3P A;  5AVC A;  4G91 B;  3WTP B;  1P34 A;  3C1C A;  3W99 A;  3X1V D;  4J8V D;  1S32 C;  2FFF B;  3MNN C;  4Z66 D;  4LD9 D;  1P3K C;  1TZY D;  3AZN C;  1HTA A;  3AN2 D;  3LZ0 D;  5CPK A;  1P3G A;  2W8S A;  3WTP A;  3H0R C;  4H9P A;  3W96 B;  1P3A A;  3EPK A;  3MVD D;  2ARO B;  1AOI B;  3REH C;  3MGP D;  3MGR C;  2J8P A;  3X1T B;  1M18 B;  3B6G B;  2FJ7 B;  2F8N G;  1S32 D;  3MNN D;  3W98 A;  4KUD B;  1ID3 C;  3AZN D;  3AZL B;  2ARO A;  1AOI A;  4J8U B;  4Z2M H;  2HIO B;  1Q9C A;  3X1T A;  2RVQ C;  1M18 A;  2FJ7 A;  1P3L C;  3UTA A;  5BNX B;  5AV8 D;  4KUD A;  3REL C;  5E5A C;  1P3I C;  3MGS C;  2JE5 A;  3AZJ B;  3AZL A;  2XD1 A;  1B67 A;  4J8U A;  1H3O B;  1N1J B;  2VQR A;  2HUE B;  5B40 D;  1ID3 D;  4WU9 D;  2L5A A;  5BNX A;  5BNV A;  4J8W B;  3X1S C;  1EQZ B;  4YS3 C;  1M19 C;  2ZY2 A;  3REJ C;  1ZLA B;  3AZK C;  1F66 C;  2RVQ D;  2PYO B;  5CP6 B;  1P3L D;  1H3O A;  5AV5 A;  3UT9 B;  4E45 A;  3REL D;  5E5A D;  1P3I D;  3A6N B;  3WA9 A;  4CAY B;  4HGA B;  4DRA A;  3C1B B;  3AZE C;  5B1M B;  3B6F C;  3KXB C;  5C3I B;  2PYO A;  1P3B B;  4WU8 B;  5CP6 A;  3X1S D;  5AV6 C;  3UT9 A;  2CV5 B;  4YS3 D;  3REK D;  3WAA C;  5AV9 B;  1M19 D;  3AV1 B;  5DNM B;  4NE3 A;  1F66 D;  2IO5 C;  4JJN B;  3WTP E;  4CAY A;  2NZD B;  3TU4 B;  4H9N B;  3AZG C;  3UTB B;  1P3F C;  3X1U A;  2F8N H;  4M6B A;  4XZQ A;  3AYW C;  2CV5 A;  3W97 C;  2BYK A;  5GT3 C;  3AV1 A;  3KWQ B;  5B33 B;  3EPL A;  3AZE D;  4JJN A;  3B6F D;  5AVB D;  4WZS B;  2ZY5 A;  5BO0 B;  5AV6 D;  1P3O B;  5DNN B;  2LY8 A;  4Z66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...