1P3PC

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3pC00
5CP6C 4XUJD 5AV8D 4WU9C 3AZNC 3AYWC 1P3BB 5BNVB 2IO5B 1M1AB 3VH6T 5AV9D 2F8ND 1EQZD 4M6BA 1M19B 4J8UD 5E5AC 3NQUA 4XZQB 3AV2B 2NZDB 4H9PB 1KX5C 4YM6C 2CWEA 3MVDA 3WAAC 2FJ7D 5B1MA 3AN2D 3UTBA 3REKB 3WTPE 4H9OA 2BYMB 1P3PD 3AZGB 4H9RA 4J8WD 1BH9B 3MGQB 4AWLB 3X1VB 5B33C 5GT3A 4Z5TB 3REIA 3AZLB 3WA9B 5AY8B 4QLCB 5G49A 5B2ID 5B24D 4CAYB 3MGRD 3WKJC 3B6FB 3AZKC 4KHAA 5GXQA 3AZIA 1P3OA 5B32A 2L5AA 3TU4C 4J8XB 1U35B 5CPIB 5B0YA 2NQBA 4XUJB 5AV8B 3MVDD 1P3MC 5B1MD 4G92C 2FJ7C 5B1LA 4LD9D 1ID3D 5AV9B 2F8NB 3MNNB 1EQZB 4KUDC 1P34A 1P3PC 3AV1C 4J8UB 3W99A 5AV5A 5AV6A 3LZ1A 3LELA 5BNXA 1S32A 5GT3D 3REID 1P3ID 3KXBC 3MGRC 5B31D 3AN2B 3X1SA 5GXQD 3AZID 5BT1D 3AV2A 5CP6A 4J8WB 5B32D 4WU9A 3AZNA 3AYWA 3B6GD 5B0YD 5B2IB 5B24B 2NQBD 5E5AA 3AZEC 5B1LD 1P3GC 1KX5A 4LD9C 4YM6A 5AY8A 1BH8A 1P34D 3W99D 5AV5D 1HQ3C 5AV6D 3NQUB 3LZ1D 3WAAA 1S32D 3B6FA 1ZLAC 4H9NA 4HGAB 5B40C 4Z2MG 4YS3C 3RELC 3MVDB 5B1MB 5AVCC 5B33A 5B31C 3UTBB 4NE5A 1ID3B 3A6ND 5CP6D 3WKJA 4H9RB 3C1BC 4E45A 4WU9D 3AZND 3AYWD 5GT3B 4WU8C 3REIB 5G49B 1P3IB 3B6GC 3KWQC 5B31B 5E5AD 4KHAB 5GXQB 3TU4A 3AZIB 5GSUC 1KX5D 1P3OB 2F8NG 4YM6D 5B32B 1P3MA 3WAAD 2YFWA 2FJ7A 5B0YB 4Z2MH 3WTPC 2NQBB 4KUDA 1P3PA 3AV1A 3AZMD 5B1LB 5B33D 2F8NK 4NE6A 3A6NC 1P34B 3KXBA 5AV5B 1A7WA 5AV6B 3LZ1B 3MGRA 3LELB 3AZKD 3W97C 5BNXB 5C3IB 1S32B 3UTAC 1TAFA 3X1SB 3TU4D 2CV5C 3LZ0D 5CP6B 1P3AC 4WU9B 3AZHD 3AZNB 1P3MD 3AYWB 3AZEA 1H3OA 1P3GA 4Z66C 4KUDD 1ID3A 3WKJD 4LD9A 3AV1D 5E5AB 1HQ3A 2HUEC 3AZMC 1KX5B 1ZLAA 5B40A 4YM6B 1AOIC 1BFMA 1BH8B 1P3IA 5KDMA 4YS3A 3RELA 3KXBD 3WAAB 5AVCA 5B31A 1HTAA 5GT0C 4H9NB 3REJC 1M18C 1R4VA 3C1BA 3AZFC 2JSSA 4H9SC 5B33B 4WU8A 3B0CW 4J8VC 3B6GA 5F99C 2HIOC 3LZ0C 3KWQA 3MGPC 3WKJB 5JA4A 5B32G 3AZKB 4H9QB 3AZJC 1F66C 3AZED 3AZHC 1P3GD 5GSUA 4R8PC 3TU4B 1HQ3D 3WTPA 3X1UD 5CHLB 1ZLAD 5B40D 1WWIA 5DNNC 4YS3D 3RELD 1P3MB 4JJNC 4G92B 5AVCD 2YFWB 5CPKC 2FJ7B 3AFAC 1TZYD 1P3LD 4KUDB 3A6NA 1P3PB 3AV1B 3LJAC 3W97A 3C1BD 4KGCC 5DNMC 4WU8D 5CPJD 3REHC 3MGSC 3KWQD 3KXBB 3B0CT 3UTAA 3MGRB 2AROC 1P3KC 2CV5A 5GSUD 1P3AA 1TAFB 3WTPD 4Z66A 3X1UC 5JRGC 1N1JA 2PYOC 4ZUXC 3AZEB 3V9RA 1H3OB 3AZMA 1P3GB 3W96C 3B0BA 4LD9B 1AOIA 1TZYC 1P3LC 3W97D 1HQ3B 3UT9C 1KX4C 3AZKA 4H9QA 5GT0A 1ZLAB 5B40B 5CPJC 3REJA 5KDMB 4YS3B 3RELB 1M18A 3UTAD 3KUYD 3AZFA 5AVCB 4X23C 5B2JC 4J8VA 2CV5D 1P3FC 5F99A 4NE3A 2RVQC 2HIOA 3LZ0A 3W98C 1P3AD 3MGPA 3C1BB 4G91C 1F66A 3AZJA 4ZBJC 4WU8B 3AZHA 1KX3C 3B6GB 5BS7C 3B0DC 4Z66D 3X1TC 4EO5C 4R8PA 3O62C 3KWQB 5JA4B 5BO0A 3C1CC 5GSUB 5B0ZC 1AOID 5AVBC 5DNNA 4JJNA 3AZGD 4WV4B 3WTPB 3AFAA 5GT0D 2YFVA 3REJD 4CSRA 3AZLD 1M18D 4QLCD 3AZFD 4KGCA 5DNMA 3KUYC 4WNNA 4J8VD 3REHA 5F99D 2HIOD 3A6NB 2F8NH 3MGSA 1P3BC 3MGPD 2IO5C 3W97B 1M1AC 2AROA 1F66D 3AZJD 3KSYA 1WWSA 1P3KA 1M19C 4J8XD 4R8PD 5CPID 4XZQC 3UTAB 3KUYB 3AV2C 2NZDC 2CV5B 3X1UA 5JRGA 1P3AB 3R45B 5DNND 2PYOA 4ZUXA 3MNND 4DRBA 4JJND 3REKC 5CPKD 3AFAD 4Z66B 3AZGC 2BYKA 3W96A 1TZYA 1P3LA 3X1VC 1N1JB 3MGQC 4AWLC 4Z5TC 3LJAD 3AZLC 3WA9C 5AY8C 3V9RB 4QLCC 4KGCD 2HUEB 5DNMD 3UT9A 1Q9CA 3AZMB 5B31G 1KX4A 5CPJA 3REHD 1AOIB 3B6FC 3MGSD 4NFTA 2AROD 4X23A 5GT0B 1P3KD 5B2JA 3REJB 1P3FA 4UUZA 3W98A 3NQJA 1M18B 4J8XC 2LY8A 1U35C 3AZFB 5CPIC 4XUJC 5AV8C 4J8VB 1KX3A 5F99B 5BS7A 3X1TA 2HIOB 3LZ0B 5JRGD 3O62A 3MGPB 2PYOD 4ZUXD 1F66B 3AZJB 5AV9C 3MNNC 3C1CA 3AZHB 1EQZC 3VH5A 1B6WA 5B0ZA 3W96D 4J8UC 4R8PB 5BO0B 5AVBA 3UT9D 1KX4D 3UTBD 5DNNB 1KU5A 3AN2C 4JJNB 1JFIB 5CPKB 4X23D 3KUYA 3AFAB 2YFVB 5B2JD 1P3FD 1ULYA 4CSRB 4J8WC 2RVQD 3W98D 1P3BA 3LJAB 5BNVA 3VH5W 1M1AA 3R45A 4KGCB 5B2IC 5DNMB 5B24C 3W99B 1B67A 4WNNB 1KX3D 3REHB 1M19A 3X1TD 3MGSB 3O62D 4XZQA 5FUGB 2AROB 1P3OD 2NZDA 4H9PA 3C1CD 1P3KB 5B0ZD 5AVBD 4HGAC 3REKA 2BYMA 3AZGA 3MVDC 3X1UB 5JRGB 5B1MC 1BH9A 3MGQA 3X1VA 2PYOB 3VH6A 4ZUXB 3UTBC 4Z5TA 1ID3C 3AZLA 3WA9A 4QLCA 4H9SA 2BYKB 4CAYA 3LELD 3W96B 1TZYB 1P3LB 5GT3C 1P3BD 3REIC 1M1AD 1P3IC 3UT9B 1KX4B 5CPJB 3VH5T 1M19D 3X1SD 5GXQC 4J8XA 1U35A 4XZQD 4H9OB 5CPIA 3AZIC 3AV2D 2NZDD 4X23B 5BT1C 1P3OC 5B2JB 4XUJA 5AV8A 1P3FB 3VH6W 5B32C 4UUZB 3W98B 3NQJB 4DRAA 4G91B 5B0YC 4ZBJB 5AV9A 2NQBC 2F8NA 3MNNA 1EQZA 3REKD 1KX3B 1JFIA 3X1TB 3B0DB 5CPKA 4EO5B 4J8UA 3O62B 3MGQD 3X1VD 1F1EA 5B1LC 4WZSB 4Z5TD 3WA9D 5AY8D 3C1CB 3LJAA 1P34C 5B0ZB 3W99C 5AV5C 5AV6C 4E44A 3LZ1C 3B6FD 3LELC 5AVBB 3AN2A 5C3IC 1S32C 5FUGA 4J8WA 3X1SC 1U35D 5B2IA 5B24A
chains in the Genus database with same CATH superfamily
5CP6C 4XUJD 5AV8D 4WU9C 3AZNC 3AYWC 1P3BB 5BNVB 2IO5B 1M1AB 3VH6T 5AV9D 2F8ND 1EQZD 4M6BA 1M19B 4J8UD 5E5AC 3NQUA 4XZQB 2FFFB 3AV2B 2NZDB 4H9PB 1KX5C 4YM6C 2CWEA 3MVDA 3WAAC 2FJ7D 5B1MA 3AN2D 3UTBA 3REKB 3WTPE 4H9OA 2BYMB 1P3PD 3AZGB 4H9RA 4J8WD 1BH9B 3MGQB 4AWLB 3X1VB 5B33C 5GT3A 4Z5TB 3REIA 3AZLB 3WA9B 5AY8B 4QLCB 5G49A 5B2ID 5B24D 4CAYB 3MGRD 3WKJC 3B6FB 3AZKC 4KHAA 5GXQA 3AZIA 1P3OA 5B32A 2L5AA 3TU4C 4J8XB 1U35B 5CPIB 5B0YA 2RIQA 2NQBA 4XUJB 5AV8B 2DQNC 3MVDD 1P3MC 5B1MD 4G92C 2FJ7C 5B1LA 3H0MC 4LD9D 1ID3D 5AV9B 2F8NB 3MNNB 1EQZB 4KUDC 2ZM5A 1P34A 1P3PC 3AV1C 4J8UB 3W99A 5AV5A 5AV6A 3LZ1A 3LELA 5BNXA 1S32A 5GT3D 3REID 1P3ID 2ZY2A 3A1KA 2Y2PA 3KXBC 3MGRC 5B31D 3AN2B 3X1SA 5GXQD 3AZID 5BT1D 3AV2A 5CP6A 2Y2LA 4J8WB 5B32D 4WU9A 3AZNA 3AYWA 3B6GD 5B0YD 5B2IB 2Y2IA 5B24B 2NQBD 2DF4C 5E5AA 3AZEC 5B1LD 1P3GC 1KX5A 4LD9C 4YM6A 5AY8A 1BH8A 1P34D 3W99D 5AV5D 1HQ3C 5AV6D 3NQUB 3LZ1D 3WAAA 1S32D 3B6FA 1ZLAC 4H9NA 4HGAB 5B40C 4Z2MG 3EPHA 4YS3C 3RELC 3MVDB 2JE5A 5B1MB 5AVCC 5B33A 5B31C 3UTBB 4NE5A 1ID3B 3EPKA 1W2EA 3A6ND 5CP6D 3WKJA 4H9RB 3C1BC 4E45A 4WU9D 3AZND 3AYWD 5GT3B 4WU8C 3REIB 5G49B 1P3IB 3B6GC 2BG1A 3KWQC 5B31B 5E5AD 4KHAB 5GXQB 3TU4A 3AZIB 5GSUC 1KX5D 1P3OB 2F8NG 4YM6D 5B32B 1P3MA 3WAAD 3EPJA 2YFWA 2FJ7A 5B0YB 4Z2MH 3WTPC 2NQBB 2Y2KA 4KUDA 1P3PA 3AV1A 3AZMD 3FDDA 5B1LB 5B33D 2F8NK 4NE6A 3A6NC 1P34B 3KXBA 5AV5B 1A7WA 5AV6B 3LZ1B 3MGRA 3LELB 3AZKD 3W97C 5BNXB 5C3IB 1S32B 4WJ3C 3UTAC 1TAFA 2G5HC 3X1SB 3TU4D 2CV5C 3LZ0D 5CP6B 1P3AC 2J8PA 4WU9B 3AZHD 3AZNB 1P3MD 3AYWB 3AZEA 1H3OA 1P3GA 4Z66C 4KUDD 1ID3A 3WKJD 4LD9A 3AV1D 2ZY3A 5E5AB 1HQ3A 2HUEC 3AZMC 1KX5B 1ZLAA 5B40A 4YM6B 1AOIC 1BFMA 1BH8B 1P3IA 5KDMA 4YS3A 3RELA 3KXBD 3WAAB 5AVCA 5B31A 1HTAA 5GT0C 4H9NB 3REJC 1M18C 1R4VA 3C1BA 3AZFC 2JSSA 3F6TA 4H9SC 5B33B 4WU8A 3B0CW 4J8VC 3B6GA 5F99C 2HIOC 3LZ0C 3KWQA 3MGPC 3WKJB 5JA4A 5B32G 3AZKB 2Y2MA 4H9QB 3AZJC 1F66C 3AZED 3AZHC 1P3GD 5GSUA 4R8PC 3TU4B 1HQ3D 3WTPA 3X1UD 5CHLB 1ZLAD 5B40D 1WWIA 5DNNC 4YS3D 3RELD 1P3MB 4JJNC 4G92B 5AVCD 2YFWB 5CPKC 2FJ7B 3AFAC 1TZYD 1P3LD 4KUDB 3A6NA 1P3PB 3AV1B 3LJAC 3W97A 3C1BD 2Y2JA 4KGCC 5DNMC 4WU8D 5CPJD 3KFUG 3REHC 3MGSC 3KWQD 3KXBB 3B0CT 3UTAA 3MGRB 2AROC 3IP4C 1P3KC 2CV5A 5GSUD 1P3AA 1TAFB 3WTPD 4Z66A 3X1UC 5JRGC 1N1JA 2PYOC 4ZUXC 3AZEB 3V9RA 1H3OB 3AZMA 1P3GB 3W96C 3B0BA 4LD9B 1AOIA 1TZYC 1P3LC 2Y2QA 3W97D 1HQ3B 3UT9C 1KX4C 3AZKA 4H9QA 5GT0A 1ZLAB 5B40B 5CPJC 3REJA 5KDMB 4YS3B 3RELB 1M18A 3UTAD 3KUYD 3AZFA 5AVCB 4X23C 5B2JC 4J8VA 2CV5D 1P3FC 5F99A 4NE3A 2RVQC 2HIOA 3LZ0A 3W98C 1P3AD 2F2AC 3MGPA 3C1BB 2VQRA 4G91C 1F66A 3AZJA 4ZBJC 4WU8B 3AZHA 3AL0C 3EG5B 1KX3C 3B6GB 5BS7C 3B0DC 4Z66D 3X1TC 4EO5C 4R8PA 3O62C 3KWQB 5JA4B 3P5JB 5BO0A 3C1CC 5GSUB 5B0ZC 1AOID 5AVBC 5DNNA 4JJNA 3AZGD 4WV4B 3WTPB 3AFAA 5GT0D 2YFVA 3REJD 4CSRA 3AZLD 1M18D 4QLCD 3EPLA 3AZFD 2G5IC 4KGCA 5DNMA 3KUYC 4WNNA 4J8VD 3REHA 5F99D 2HIOD 3A6NB 2F8NH 3MGSA 2Y2NA 1P3BC 3MGPD 2IO5C 3W97B 1M1AC 2AROA 1F66D 3AZJD 3KSYA 1WWSA 1P3KA 2Y2HA 1M19C 4J8XD 4R8PD 5CPID 4XZQC 3UTAB 3KUYB 3AV2C 2NZDC 2Y2OA 2CV5B 1Z2CB 2XD1A 2JCHA 3H0RC 4UPKA 3X1UA 5JRGA 1P3AB 3R45B 5DNND 2PYOA 4ZUXA 3MNND 2W8SA 4DRBA 4JJND 3REKC 5CPKD 3AFAD 4Z66B 3AZGC 1T3UA 2BYKA 3W96A 1TZYA 1P3LA 2UWXA 3X1VC 1N1JB 2ZY4A 3MGQC 4AWLC 4Z5TC 3LJAD 3AZLC 3WA9C 5AY8C 3V9RB 4QLCC 4KGCD 2HUEB 5DNMD 3UT9A 1Q9CA 3AZMB 5B31G 1KX4A 5CPJA 3REHD 1AOIB 3B6FC 3MGSD 4NFTA 2AROD 4X23A 5GT0B 1P3KD 5B2JA 3REJB 1P3FA 4UUZA 3W98A 3NQJA 1M18B 4J8XC 2LY8A 1U35C 3AZFB 5CPIC 4XUJC 5AV8C 4J8VB 1KX3A 5F99B 5BS7A 3X1TA 2HIOB 3LZ0B 5JRGD 3O62A 3MGPB 1PZRA 2PYOD 4ZUXD 1F66B 3AZJB 5AV9C 3MNNC 3C1CA 3AZHB 1EQZC 3VH5A 1B6WA 5B0ZA 3W96D 4J8UC 4R8PB 5BO0B 5AVBA 3UT9D 1KX4D 3UTBD 5DNNB 1KU5A 3AN2C 4JJNB 1JFIB 5CPKB 4X23D 3A1IA 3KUYA 3AFAB 2YFVB 5B2JD 1P3FD 1ULYA 4CSRB 4J8WC 2RVQD 3W98D 1P3BA 3LJAB 5BNVA 3VH5W 1M1AA 3R45A 4KGCB 5B2IC 5DNMB 5B24C 3W99B 1B67A 4WNNB 1KX3D 3REHB 1M19A 3X1TD 3MGSB 3O62D 4XZQA 5FUGB 2AROB 1P3OD 2NZDA 4H9PA 3C1CD 1P3KB 2Y2GA 5B0ZD 5AVBD 4HGAC 3REKA 2BYMA 3AZGA 3MVDC 3X1UB 5JRGB 5B1MC 1BH9A 3MGQA 3X1VA 2PYOB 3VH6A 4ZUXB 3UTBC 4Z5TA 1ID3C 3AZLA 3WA9A 4QLCA 2XD5A 4H9SA 2BYKB 4CAYA 3LELD 3W96B 1TZYB 1P3LB 5GT3C 1P3BD 3REIC 1M1AD 1P3IC 3UT9B 1KX4B 5CPJB 3VH5T 1M19D 3X1SD 5GXQC 4J8XA 1U35A 4XZQD 4H9OB 5CPIA 3AZIC 3AV2D 2NZDD 4X23B 5BT1C 1P3OC 5B2JB 4XUJA 5AV8A 1P3FB 3VH6W 5B32C 4UUZB 3W98B 3NQJB 3H0LC 4DRAA 4G91B 5B0YC 4ZBJB 5AV9A 2NQBC 2F8NA 3MNNA 1EQZA 3REKD 1KX3B 1JFIA 3X1TB 3B0DB 5CPKA 4EO5B 4J8UA 3O62B 3MGQD 3X1VD 1F1EA 5B1LC 4WZSB 4Z5TD 4DQYB 3WA9D 5AY8D 3C1CB 3LJAA 1P34C 5B0ZB 2ZY5A 3W99C 5AV5C 4E44A 5AV6C 3LZ1C 3LELC 3B6FD 5AVBB 3AN2A 5C3IC 1S32C 5FUGA 4J8WA 3X1SC 1U35D 5B2IA 5B24A
chains in the Genus database with same CATH topology
5CP6C 4XUJD 5AV8D 4WU9C 3AZNC 3AYWC 1P3BB 5BNVB 2IO5B 1M1AB 3VH6T 5AV9D 2F8ND 1EQZD 4M6BA 1M19B 4J8UD 5E5AC 3NQUA 4XZQB 2FFFB 3AV2B 2NZDB 4H9PB 1KX5C 4YM6C 2CWEA 3MVDA 3WAAC 2FJ7D 5B1MA 3AN2D 3UTBA 3REKB 3WTPE 4H9OA 2BYMB 1P3PD 3AZGB 4H9RA 4J8WD 1BH9B 3MGQB 4AWLB 3X1VB 5B33C 5GT3A 4Z5TB 3REIA 3AZLB 3WA9B 5AY8B 4QLCB 5G49A 5B2ID 5B24D 4CAYB 3MGRD 3WKJC 3B6FB 3AZKC 4KHAA 5GXQA 3AZIA 1P3OA 5B32A 2L5AA 3TU4C 4J8XB 1U35B 5CPIB 5B0YA 2RIQA 2NQBA 4XUJB 5AV8B 2DQNC 3MVDD 1P3MC 5B1MD 4G92C 2FJ7C 5B1LA 3H0MC 4LD9D 1ID3D 5AV9B 2F8NB 3MNNB 1EQZB 4KUDC 2ZM5A 1P34A 1P3PC 3AV1C 4J8UB 3W99A 5AV5A 5AV6A 3LZ1A 3LELA 5BNXA 1S32A 5GT3D 3REID 1P3ID 2ZY2A 3A1KA 2Y2PA 3KXBC 3MGRC 5B31D 3AN2B 3X1SA 5GXQD 3AZID 5BT1D 3AV2A 5CP6A 2Y2LA 4J8WB 5B32D 4WU9A 3AZNA 3AYWA 3B6GD 5B0YD 5B2IB 2Y2IA 5B24B 2NQBD 2DF4C 5E5AA 3AZEC 5B1LD 1P3GC 1KX5A 4LD9C 4YM6A 5AY8A 1BH8A 1P34D 3W99D 5AV5D 1HQ3C 5AV6D 3NQUB 3LZ1D 3WAAA 1S32D 3B6FA 1ZLAC 4H9NA 4HGAB 5B40C 4Z2MG 3EPHA 4YS3C 3RELC 3MVDB 2JE5A 5B1MB 5AVCC 5B33A 5B31C 3UTBB 4NE5A 1ID3B 3EPKA 1W2EA 3A6ND 5CP6D 3WKJA 4H9RB 3C1BC 4E45A 4WU9D 3AZND 3AYWD 5GT3B 4WU8C 3REIB 5G49B 1P3IB 3B6GC 2BG1A 3KWQC 5B31B 5E5AD 4KHAB 5GXQB 3TU4A 3AZIB 5GSUC 1KX5D 1P3OB 2F8NG 4YM6D 5B32B 1P3MA 3WAAD 3EPJA 2YFWA 2FJ7A 5B0YB 4Z2MH 3WTPC 2NQBB 2Y2KA 4KUDA 1P3PA 3AV1A 3AZMD 3FDDA 5B1LB 5B33D 2F8NK 4NE6A 3A6NC 1P34B 3KXBA 5AV5B 1A7WA 5AV6B 3LZ1B 3MGRA 3LELB 3AZKD 3W97C 5BNXB 5C3IB 1S32B 4WJ3C 3UTAC 1TAFA 2G5HC 3X1SB 3TU4D 2CV5C 3LZ0D 5CP6B 1P3AC 2J8PA 4WU9B 3AZHD 3AZNB 1P3MD 3AYWB 3AZEA 1H3OA 1P3GA 4Z66C 4KUDD 1ID3A 3WKJD 4LD9A 3AV1D 2ZY3A 5E5AB 1HQ3A 2HUEC 3AZMC 1KX5B 1ZLAA 5B40A 4YM6B 1AOIC 1BFMA 1BH8B 1P3IA 5KDMA 4YS3A 3RELA 3KXBD 3WAAB 5AVCA 5B31A 1HTAA 5GT0C 4H9NB 3REJC 1M18C 1R4VA 3C1BA 3AZFC 2JSSA 3F6TA 4H9SC 5B33B 4WU8A 3B0CW 4J8VC 3B6GA 5F99C 2HIOC 3LZ0C 3KWQA 3MGPC 3WKJB 5JA4A 5B32G 3AZKB 2Y2MA 4H9QB 3AZJC 1F66C 3AZED 3AZHC 1P3GD 5GSUA 4R8PC 3TU4B 1HQ3D 3WTPA 3X1UD 5CHLB 1ZLAD 5B40D 1WWIA 5DNNC 4YS3D 3RELD 1P3MB 4JJNC 4G92B 5AVCD 2YFWB 5CPKC 2FJ7B 3AFAC 1TZYD 1P3LD 4KUDB 3A6NA 1P3PB 3AV1B 3LJAC 3W97A 3C1BD 2Y2JA 4KGCC 5DNMC 4WU8D 5CPJD 3KFUG 3REHC 3MGSC 3KWQD 3KXBB 3B0CT 3UTAA 3MGRB 2AROC 3IP4C 1P3KC 2CV5A 5GSUD 1P3AA 1TAFB 3WTPD 4Z66A 3X1UC 5JRGC 1N1JA 2PYOC 4ZUXC 3AZEB 3V9RA 1H3OB 3AZMA 1P3GB 3W96C 3B0BA 4LD9B 1AOIA 1TZYC 1P3LC 2Y2QA 3W97D 1HQ3B 3UT9C 1KX4C 3AZKA 4H9QA 5GT0A 1ZLAB 5B40B 5CPJC 3REJA 5KDMB 4YS3B 3RELB 1M18A 3UTAD 3KUYD 3AZFA 5AVCB 4X23C 5B2JC 4J8VA 2CV5D 1P3FC 5F99A 4NE3A 2RVQC 2HIOA 3LZ0A 3W98C 1P3AD 2F2AC 3MGPA 3C1BB 2VQRA 4G91C 1F66A 3AZJA 4ZBJC 4WU8B 3AZHA 3AL0C 3EG5B 1KX3C 3B6GB 5BS7C 3B0DC 4Z66D 3X1TC 4EO5C 4R8PA 3O62C 3KWQB 5JA4B 3P5JB 5BO0A 3C1CC 5GSUB 5B0ZC 1AOID 5AVBC 5DNNA 4JJNA 3AZGD 4WV4B 3WTPB 3AFAA 5GT0D 2YFVA 3REJD 4CSRA 3AZLD 1M18D 4QLCD 3EPLA 3AZFD 2G5IC 4KGCA 5DNMA 3KUYC 4WNNA 4J8VD 3REHA 5F99D 2HIOD 3A6NB 2F8NH 3MGSA 2Y2NA 1P3BC 3MGPD 2IO5C 3W97B 1M1AC 2AROA 1F66D 3AZJD 3KSYA 1WWSA 1P3KA 2Y2HA 1M19C 4J8XD 4R8PD 5CPID 4XZQC 3UTAB 3KUYB 3AV2C 2NZDC 2Y2OA 2CV5B 1Z2CB 2XD1A 2JCHA 3H0RC 4UPKA 3X1UA 5JRGA 1P3AB 3R45B 5DNND 2PYOA 4ZUXA 3MNND 2W8SA 4DRBA 4JJND 3REKC 5CPKD 3AFAD 4Z66B 3AZGC 1T3UA 2BYKA 3W96A 1TZYA 1P3LA 2UWXA 3X1VC 1N1JB 2ZY4A 3MGQC 4AWLC 4Z5TC 3LJAD 3AZLC 3WA9C 5AY8C 3V9RB 4QLCC 4KGCD 2HUEB 5DNMD 3UT9A 1Q9CA 3AZMB 5B31G 1KX4A 5CPJA 3REHD 1AOIB 3B6FC 3MGSD 4NFTA 2AROD 4X23A 5GT0B 1P3KD 5B2JA 3REJB 1P3FA 4UUZA 3W98A 3NQJA 1M18B 4J8XC 2LY8A 1U35C 3AZFB 5CPIC 4XUJC 5AV8C 4J8VB 1KX3A 5F99B 5BS7A 3X1TA 2HIOB 3LZ0B 5JRGD 3O62A 3MGPB 1PZRA 2PYOD 4ZUXD 1F66B 3AZJB 5AV9C 3MNNC 3C1CA 3AZHB 1EQZC 3VH5A 1B6WA 5B0ZA 3W96D 4J8UC 4R8PB 5BO0B 5AVBA 3UT9D 1KX4D 3UTBD 5DNNB 1KU5A 3AN2C 4JJNB 1JFIB 5CPKB 4X23D 3A1IA 3KUYA 3AFAB 2YFVB 5B2JD 1P3FD 1ULYA 4CSRB 4J8WC 2RVQD 3W98D 1P3BA 3LJAB 5BNVA 3VH5W 1M1AA 3R45A 4KGCB 5B2IC 5DNMB 5B24C 3W99B 1B67A 4WNNB 1KX3D 3REHB 1M19A 3X1TD 3MGSB 3O62D 4XZQA 5FUGB 2AROB 1P3OD 2NZDA 4H9PA 3C1CD 1P3KB 2Y2GA 5B0ZD 5AVBD 4HGAC 3REKA 2BYMA 3AZGA 3MVDC 3X1UB 5JRGB 5B1MC 1BH9A 3MGQA 3X1VA 2PYOB 3VH6A 4ZUXB 3UTBC 4Z5TA 1ID3C 3AZLA 3WA9A 4QLCA 2XD5A 4H9SA 2BYKB 4CAYA 3LELD 3W96B 1TZYB 1P3LB 5GT3C 1P3BD 3REIC 1M1AD 1P3IC 3UT9B 1KX4B 5CPJB 3VH5T 1M19D 3X1SD 5GXQC 4J8XA 1U35A 4XZQD 4H9OB 5CPIA 3AZIC 3AV2D 2NZDD 4X23B 5BT1C 1P3OC 5B2JB 4XUJA 5AV8A 1P3FB 3VH6W 5B32C 4UUZB 3W98B 3NQJB 3H0LC 4DRAA 4G91B 5B0YC 4ZBJB 5AV9A 2NQBC 2F8NA 3MNNA 1EQZA 3REKD 1KX3B 1JFIA 3X1TB 3B0DB 5CPKA 4EO5B 4J8UA 3O62B 3MGQD 3X1VD 1F1EA 5B1LC 4WZSB 4Z5TD 4DQYB 3WA9D 5AY8D 3C1CB 3LJAA 1P34C 5B0ZB 2ZY5A 3W99C 5AV5C 4E44A 5AV6C 3LZ1C 3LELC 3B6FD 5AVBB 3AN2A 5C3IC 1S32C 5FUGA 4J8WA 3X1SC 1U35D 5B2IA 5B24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CP6 C;  4XUJ D;  5AV8 D;  4WU9 C;  3AZN C;  3AYW C;  1P3B B;  5BNV B;  2IO5 B;  1M1A B;  3VH6 T;  5AV9 D;  2F8N D;  1EQZ D;  4M6B A;  1M19 B;  4J8U D;  5E5A C;  3NQU A;  4XZQ B;  3AV2 B;  2NZD B;  4H9P B;  1KX5 C;  4YM6 C;  2CWE A;  3MVD A;  3WAA C;  2FJ7 D;  5B1M A;  3AN2 D;  3UTB A;  3REK B;  3WTP E;  4H9O A;  2BYM B;  1P3P D;  3AZG B;  4H9R A;  4J8W D;  1BH9 B;  3MGQ B;  4AWL B;  3X1V B;  5B33 C;  5GT3 A;  4Z5T B;  3REI A;  3AZL B;  3WA9 B;  5AY8 B;  4QLC B;  5G49 A;  5B2I D;  5B24 D;  4CAY B;  3MGR D;  3WKJ C;  3B6F B;  3AZK C;  4KHA A;  5GXQ A;  3AZI A;  1P3O A;  5B32 A;  2L5A A;  3TU4 C;  4J8X B;  1U35 B;  5CPI B;  5B0Y A;  2NQB A;  4XUJ B;  5AV8 B;  3MVD D;  1P3M C;  5B1M D;  4G92 C;  2FJ7 C;  5B1L A;  4LD9 D;  1ID3 D;  5AV9 B;  2F8N B;  3MNN B;  1EQZ B;  4KUD C;  1P34 A;  1P3P C;  3AV1 C;  4J8U B;  3W99 A;  5AV5 A;  5AV6 A;  3LZ1 A;  3LEL A;  5BNX A;  1S32 A;  5GT3 D;  3REI D;  1P3I D;  3KXB C;  3MGR C;  5B31 D;  3AN2 B;  3X1S A;  5GXQ D;  3AZI D;  5BT1 D;  3AV2 A;  5CP6 A;  4J8W B;  5B32 D;  4WU9 A;  3AZN A;  3AYW A;  3B6G D;  5B0Y D;  5B2I B;  5B24 B;  2NQB D;  5E5A A;  3AZE C;  5B1L D;  1P3G C;  1KX5 A;  4LD9 C;  4YM6 A;  5AY8 A;  1BH8 A;  1P34 D;  3W99 D;  5AV5 D;  1HQ3 C;  5AV6 D;  3NQU B;  3LZ1 D;  3WAA A;  1S32 D;  3B6F A;  1ZLA C;  4H9N A;  4HGA B;  5B40 C;  4Z2M G;  4YS3 C;  3REL C;  3MVD B;  5B1M B;  5AVC C;  5B33 A;  5B31 C;  3UTB B;  4NE5 A;  1ID3 B;  3A6N D;  5CP6 D;  3WKJ A;  4H9R B;  3C1B C;  4E45 A;  4WU9 D;  3AZN D;  3AYW D;  5GT3 B;  4WU8 C;  3REI B;  5G49 B;  1P3I B;  3B6G C;  3KWQ C;  5B31 B;  5E5A D;  4KHA B;  5GXQ B;  3TU4 A;  3AZI B;  5GSU C;  1KX5 D;  1P3O B;  2F8N G;  4YM6 D;  5B32 B;  1P3M A;  3WAA D;  2YFW A;  2FJ7 A;  5B0Y B;  4Z2M H;  3WTP C;  2NQB B;  4KUD A;  1P3P A;  3AV1 A;  3AZM D;  5B1L B;  5B33 D;  2F8N K;  4NE6 A;  3A6N C;  1P34 B;  3KXB A;  5AV5 B;  1A7W A;  5AV6 B;  3LZ1 B;  3MGR A;  3LEL B;  3AZK D;  3W97 C;  5BNX B;  5C3I B;  1S32 B;  3UTA C;  1TAF A;  3X1S B;  3TU4 D;  2CV5 C;  3LZ0 D;  5CP6 B;  1P3A C;  4WU9 B;  3AZH D;  3AZN B;  1P3M D;  3AYW B;  3AZE A;  1H3O A;  1P3G A;  4Z66 C;  4KUD D;  1ID3 A;  3WKJ D;  4LD9 A;  3AV1 D;  5E5A B;  1HQ3 A;  2HUE C;  3AZM C;  1KX5 B;  1ZLA A;  5B40 A;  4YM6 B;  1AOI C;  1BFM A;  1BH8 B;  1P3I A;  5KDM A;  4YS3 A;  3REL A;  3KXB D;  3WAA B;  5AVC A;  5B31 A;  1HTA A;  5GT0 C;  4H9N B;  3REJ C;  1M18 C;  1R4V A;  3C1B A;  3AZF C;  2JSS A;  4H9S C;  5B33 B;  4WU8 A;  3B0C W;  4J8V C;  3B6G A;  5F99 C;  2HIO C;  3LZ0 C;  3KWQ A;  3MGP C;  3WKJ B;  5JA4 A;  5B32 G;  3AZK B;  4H9Q B;  3AZJ C;  1F66 C;  3AZE D;  3AZH C;  1P3G D;  5GSU A;  4R8P C;  3TU4 B;  1HQ3 D;  3WTP A;  3X1U D;  5CHL B;  1ZLA D;  5B40 D;  1WWI A;  5DNN C;  4YS3 D;  3REL D;  1P3M B;  4JJN C;  4G92 B;  5AVC D;  2YFW B;  5CPK C;  2FJ7 B;  3AFA C;  1TZY D;  1P3L D;  4KUD B;  3A6N A;  1P3P B;  3AV1 B;  3LJA C;  3W97 A;  3C1B D;  4KGC C;  5DNM C;  4WU8 D;  5CPJ D;  3REH C;  3MGS C;  3KWQ D;  3KXB B;  3B0C T;  3UTA A;  3MGR B;  2ARO C;  1P3K C;  2CV5 A;  5GSU D;  1P3A A;  1TAF B;  3WTP D;  4Z66 A;  3X1U C;  5JRG C;  1N1J A;  2PYO C;  4ZUX C;  3AZE B;  3V9R A;  1H3O B;  3AZM A;  1P3G B;  3W96 C;  3B0B A;  4LD9 B;  1AOI A;  1TZY C;  1P3L C;  3W97 D;  1HQ3 B;  3UT9 C;  1KX4 C;  3AZK A;  4H9Q A;  5GT0 A;  1ZLA B;  5B40 B;  5CPJ C;  3REJ A;  5KDM B;  4YS3 B;  3REL B;  1M18 A;  3UTA D;  3KUY D;  3AZF A;  5AVC B;  4X23 C;  5B2J C;  4J8V A;  2CV5 D;  1P3F C;  5F99 A;  4NE3 A;  2RVQ C;  2HIO A;  3LZ0 A;  3W98 C;  1P3A D;  3MGP A;  3C1B B;  4G91 C;  1F66 A;  3AZJ A;  4ZBJ C;  4WU8 B;  3AZH A;  1KX3 C;  3B6G B;  5BS7 C;  3B0D C;  4Z66 D;  3X1T C;  4EO5 C;  4R8P A;  3O62 C;  3KWQ B;  5JA4 B;  5BO0 A;  3C1C C;  5GSU B;  5B0Z C;  1AOI D;  5AVB C;  5DNN A;  4JJN A;  3AZG D;  4WV4 B;  3WTP B;  3AFA A;  5GT0 D;  2YFV A;  3REJ D;  4CSR A;  3AZL D;  1M18 D;  4QLC D;  3AZF D;  4KGC A;  5DNM A;  3KUY C;  4WNN A;  4J8V D;  3REH A;  5F99 D;  2HIO D;  3A6N B;  2F8N H;  3MGS A;  1P3B C;  3MGP D;  2IO5 C;  3W97 B;  1M1A C;  2ARO A;  1F66 D;  3AZJ D;  3KSY A;  1WWS A;  1P3K A;  1M19 C;  4J8X D;  4R8P D;  5CPI D;  4XZQ C;  3UTA B;  3KUY B;  3AV2 C;  2NZD C;  2CV5 B;  3X1U A;  5JRG A;  1P3A B;  3R45 B;  5DNN D;  2PYO A;  4ZUX A;  3MNN D;  4DRB A;  4JJN D;  3REK C;  5CPK D;  3AFA D;  4Z66 B;  3AZG C;  2BYK A;  3W96 A;  1TZY A;  1P3L A;  3X1V C;  1N1J B;  3MGQ C;  4AWL C;  4Z5T C;  3LJA D;  3AZL C;  3WA9 C;  5AY8 C;  3V9R B;  4QLC C;  4KGC D;  2HUE B;  5DNM D;  3UT9 A;  1Q9C A;  3AZM B;  5B31 G;  1KX4 A;  5CPJ A;  3REH D;  1AOI B;  3B6F C;  3MGS D;  4NFT A;  2ARO D;  4X23 A;  5GT0 B;  1P3K D;  5B2J A;  3REJ B;  1P3F A;  4UUZ A;  3W98 A;  3NQJ A;  1M18 B;  4J8X C;  2LY8 A;  1U35 C;  3AZF B;  5CPI C;  4XUJ C;  5AV8 C;  4J8V B;  1KX3 A;  5F99 B;  5BS7 A;  3X1T A;  2HIO B;  3LZ0 B;  5JRG D;  3O62 A;  3MGP B;  2PYO D;  4ZUX D;  1F66 B;  3AZJ B;  5AV9 C;  3MNN C;  3C1C A;  3AZH B;  1EQZ C;  3VH5 A;  1B6W A;  5B0Z A;  3W96 D;  4J8U C;  4R8P B;  5BO0 B;  5AVB A;  3UT9 D;  1KX4 D;  3UTB D;  5DNN B;  1KU5 A;  3AN2 C;  4JJN B;  1JFI B;  5CPK B;  4X23 D;  3KUY A;  3AFA B;  2YFV B;  5B2J D;  1P3F D;  1ULY A;  4CSR B;  4J8W C;  2RVQ D;  3W98 D;  1P3B A;  3LJA B;  5BNV A;  3VH5 W;  1M1A A;  3R45 A;  4KGC B;  5B2I C;  5DNM B;  5B24 C;  3W99 B;  1B67 A;  4WNN B;  1KX3 D;  3REH B;  1M19 A;  3X1T D;  3MGS B;  3O62 D;  4XZQ A;  5FUG B;  2ARO B;  1P3O D;  2NZD A;  4H9P A;  3C1C D;  1P3K B;  5B0Z D;  5AVB D;  4HGA C;  3REK A;  2BYM A;  3AZG A;  3MVD C;  3X1U B;  5JRG B;  5B1M C;  1BH9 A;  3MGQ A;  3X1V A;  2PYO B;  3VH6 A;  4ZUX B;  3UTB C;  4Z5T A;  1ID3 C;  3AZL A;  3WA9 A;  4QLC A;  4H9S A;  2BYK B;  4CAY A;  3LEL D;  3W96 B;  1TZY B;  1P3L B;  5GT3 C;  1P3B D;  3REI C;  1M1A D;  1P3I C;  3UT9 B;  1KX4 B;  5CPJ B;  3VH5 T;  1M19 D;  3X1S D;  5GXQ C;  4J8X A;  1U35 A;  4XZQ D;  4H9O B;  5CPI A;  3AZI C;  3AV2 D;  2NZD D;  4X23 B;  5BT1 C;  1P3O C;  5B2J B;  4XUJ A;  5AV8 A;  1P3F B;  3VH6 W;  5B32 C;  4UUZ B;  3W98 B;  3NQJ B;  4DRA A;  4G91 B;  5B0Y C;  4ZBJ B;  5AV9 A;  2NQB C;  2F8N A;  3MNN A;  1EQZ A;  3REK D;  1KX3 B;  1JFI A;  3X1T B;  3B0D B;  5CPK A;  4EO5 B;  4J8U A;  3O62 B;  3MGQ D;  3X1V D;  1F1E A;  5B1L C;  4WZS B;  4Z5T D;  3WA9 D;  5AY8 D;  3C1C B;  3LJA A;  1P34 C;  5B0Z B;  3W99 C;  5AV5 C;  5AV6 C;  4E44 A;  3LZ1 C;  3B6F D;  3LEL C;  5AVB B;  3AN2 A;  5C3I C;  1S32 C;  5FUG A;  4J8W A;  3X1S C;  1U35 D;  5B2I A;  5B24 A; 
#chains in the Genus database with same CATH topology
 5CP6 C;  4XUJ D;  5AV8 D;  4WU9 C;  3AZN C;  3AYW C;  1P3B B;  5BNV B;  2IO5 B;  1M1A B;  3VH6 T;  5AV9 D;  2F8N D;  1EQZ D;  4M6B A;  1M19 B;  4J8U D;  5E5A C;  3NQU A;  4XZQ B;  2FFF B;  3AV2 B;  2NZD B;  4H9P B;  1KX5 C;  4YM6 C;  2CWE A;  3MVD A;  3WAA C;  2FJ7 D;  5B1M A;  3AN2 D;  3UTB A;  3REK B;  3WTP E;  4H9O A;  2BYM B;  1P3P D;  3AZG B;  4H9R A;  4J8W D;  1BH9 B;  3MGQ B;  4AWL B;  3X1V B;  5B33 C;  5GT3 A;  4Z5T B;  3REI A;  3AZL B;  3WA9 B;  5AY8 B;  4QLC B;  5G49 A;  5B2I D;  5B24 D;  4CAY B;  3MGR D;  3WKJ C;  3B6F B;  3AZK C;  4KHA A;  5GXQ A;  3AZI A;  1P3O A;  5B32 A;  2L5A A;  3TU4 C;  4J8X B;  1U35 B;  5CPI B;  5B0Y A;  2RIQ A;  2NQB A;  4XUJ B;  5AV8 B;  2DQN C;  3MVD D;  1P3M C;  5B1M D;  4G92 C;  2FJ7 C;  5B1L A;  3H0M C;  4LD9 D;  1ID3 D;  5AV9 B;  2F8N B;  3MNN B;  1EQZ B;  4KUD C;  2ZM5 A;  1P34 A;  1P3P C;  3AV1 C;  4J8U B;  3W99 A;  5AV5 A;  5AV6 A;  3LZ1 A;  3LEL A;  5BNX A;  1S32 A;  5GT3 D;  3REI D;  1P3I D;  2ZY2 A;  3A1K A;  2Y2P A;  3KXB C;  3MGR C;  5B31 D;  3AN2 B;  3X1S A;  5GXQ D;  3AZI D;  5BT1 D;  3AV2 A;  5CP6 A;  2Y2L A;  4J8W B;  5B32 D;  4WU9 A;  3AZN A;  3AYW A;  3B6G D;  5B0Y D;  5B2I B;  2Y2I A;  5B24 B;  2NQB D;  2DF4 C;  5E5A A;  3AZE C;  5B1L D;  1P3G C;  1KX5 A;  4LD9 C;  4YM6 A;  5AY8 A;  1BH8 A;  1P34 D;  3W99 D;  5AV5 D;  1HQ3 C;  5AV6 D;  3NQU B;  3LZ1 D;  3WAA A;  1S32 D;  3B6F A;  1ZLA C;  4H9N A;  4HGA B;  5B40 C;  4Z2M G;  3EPH A;  4YS3 C;  3REL C;  3MVD B;  2JE5 A;  5B1M B;  5AVC C;  5B33 A;  5B31 C;  3UTB B;  4NE5 A;  1ID3 B;  3EPK A;  1W2E A;  3A6N D;  5CP6 D;  3WKJ A;  4H9R B;  3C1B C;  4E45 A;  4WU9 D;  3AZN D;  3AYW D;  5GT3 B;  4WU8 C;  3REI B;  5G49 B;  1P3I B;  3B6G C;  2BG1 A;  3KWQ C;  5B31 B;  5E5A D;  4KHA B;  5GXQ B;  3TU4 A;  3AZI B;  5GSU C;  1KX5 D;  1P3O B;  2F8N G;  4YM6 D;  5B32 B;  1P3M A;  3WAA D;  3EPJ A;  2YFW A;  2FJ7 A;  5B0Y B;  4Z2M H;  3WTP C;  2NQB B;  2Y2K A;  4KUD A;  1P3P A;  3AV1 A;  3AZM D;  3FDD A;  5B1L B;  5B33 D;  2F8N K;  4NE6 A;  3A6N C;  1P34 B;  3KXB A;  5AV5 B;  1A7W A;  5AV6 B;  3LZ1 B;  3MGR A;  3LEL B;  3AZK D;  3W97 C;  5BNX B;  5C3I B;  1S32 B;  4WJ3 C;  3UTA C;  1TAF A;  2G5H C;  3X1S B;  3TU4 D;  2CV5 C;  3LZ0 D;  5CP6 B;  1P3A C;  2J8P A;  4WU9 B;  3AZH D;  3AZN B;  1P3M D;  3AYW B;  3AZE A;  1H3O A;  1P3G A;  4Z66 C;  4KUD D;  1ID3 A;  3WKJ D;  4LD9 A;  3AV1 D;  2ZY3 A;  5E5A B;  1HQ3 A;  2HUE C;  3AZM C;  1KX5 B;  1ZLA A;  5B40 A;  4YM6 B;  1AOI C;  1BFM A;  1BH8 B;  1P3I A;  5KDM A;  4YS3 A;  3REL A;  3KXB D;  3WAA B;  5AVC A;  5B31 A;  1HTA A;  5GT0 C;  4H9N B;  3REJ C;  1M18 C;  1R4V A;  3C1B A;  3AZF C;  2JSS A;  3F6T A;  4H9S C;  5B33 B;  4WU8 A;  3B0C W;  4J8V C;  3B6G A;  5F99 C;  2HIO C;  3LZ0 C;  3KWQ A;  3MGP C;  3WKJ B;  5JA4 A;  5B32 G;  3AZK B;  2Y2M A;  4H9Q B;  3AZJ C;  1F66 C;  3AZE D;  3AZH C;  1P3G D;  5GSU A;  4R8P C;  3TU4 B;  1HQ3 D;  3WTP A;  3X1U D;  5CHL B;  1ZLA D;  5B40 D;  1WWI A;  5DNN C;  4YS3 D;  3REL D;  1P3M B;  4JJN C;  4G92 B;  5AVC D;  2YFW B;  5CPK C;  2FJ7 B;  3AFA C;  1TZY D;  1P3L D;  4KUD B;  3A6N A;  1P3P B;  3AV1 B;  3LJA C;  3W97 A;  3C1B D;  2Y2J A;  4KGC C;  5DNM C;  4WU8 D;  5CPJ D;  3KFU G;  3REH C;  3MGS C;  3KWQ D;  3KXB B;  3B0C T;  3UTA A;  3MGR B;  2ARO C;  3IP4 C;  1P3K C;  2CV5 A;  5GSU D;  1P3A A;  1TAF B;  3WTP D;  4Z66 A;  3X1U C;  5JRG C;  1N1J A;  2PYO C;  4ZUX C;  3AZE B;  3V9R A;  1H3O B;  3AZM A;  1P3G B;  3W96 C;  3B0B A;  4LD9 B;  1AOI A;  1TZY C;  1P3L C;  2Y2Q A;  3W97 D;  1HQ3 B;  3UT9 C;  1KX4 C;  3AZK A;  4H9Q A;  5GT0 A;  1ZLA B;  5B40 B;  5CPJ C;  3REJ A;  5KDM B;  4YS3 B;  3REL B;  1M18 A;  3UTA D;  3KUY D;  3AZF A;  5AVC B;  4X23 C;  5B2J C;  4J8V A;  2CV5 D;  1P3F C;  5F99 A;  4NE3 A;  2RVQ C;  2HIO A;  3LZ0 A;  3W98 C;  1P3A D;  2F2A C;  3MGP A;  3C1B B;  2VQR A;  4G91 C;  1F66 A;  3AZJ A;  4ZBJ C;  4WU8 B;  3AZH A;  3AL0 C;  3EG5 B;  1KX3 C;  3B6G B;  5BS7 C;  3B0D C;  4Z66 D;  3X1T C;  4EO5 C;  4R8P A;  3O62 C;  3KWQ B;  5JA4 B;  3P5J B;  5BO0 A;  3C1C C;  5GSU B;  5B0Z C;  1AOI D;  5AVB C;  5DNN A;  4JJN A;  3AZG D;  4WV4 B;  3WTP B;  3AFA A;  5GT0 D;  2YFV A;  3REJ D;  4CSR A;  3AZL D;  1M18 D;  4QLC D;  3EPL A;  3AZF D;  2G5I C;  4KGC A;  5DNM A;  3KUY C;  4WNN A;  4J8V D;  3REH A;  5F99 D;  2HIO D;  3A6N B;  2F8N H;  3MGS A;  2Y2N A;  1P3B C;  3MGP D;  2IO5 C;  3W97 B;  1M1A C;  2ARO A;  1F66 D;  3AZJ D;  3KSY A;  1WWS A;  1P3K A;  2Y2H A;  1M19 C;  4J8X D;  4R8P D;  5CPI D;  4XZQ C;  3UTA B;  3KUY B;  3AV2 C;  2NZD C;  2Y2O A;  2CV5 B;  1Z2C B;  2XD1 A;  2JCH A;  3H0R C;  4UPK A;  3X1U A;  5JRG A;  1P3A B;  3R45 B;  5DNN D;  2PYO A;  4ZUX A;  3MNN D;  2W8S A;  4DRB A;  4JJN D;  3REK C;  5CPK D;  3AFA D;  4Z66 B;  3AZG C;  1T3U A;  2BYK A;  3W96 A;  1TZY A;  1P3L A;  2UWX A;  3X1V C;  1N1J B;  2ZY4 A;  3MGQ C;  4AWL C;  4Z5T C;  3LJA D;  3AZL C;  3WA9 C;  5AY8 C;  3V9R B;  4QLC C;  4KGC D;  2HUE B;  5DNM D;  3UT9 A;  1Q9C A;  3AZM B;  5B31 G;  1KX4 A;  5CPJ A;  3REH D;  1AOI B;  3B6F C;  3MGS D;  4NFT A;  2ARO D;  4X23 A;  5GT0 B;  1P3K D;  5B2J A;  3REJ B;  1P3F A;  4UUZ A;  3W98 A;  3NQJ A;  1M18 B;  4J8X C;  2LY8 A;  1U35 C;  3AZF B;  5CPI C;  4XUJ C;  5AV8 C;  4J8V B;  1KX3 A;  5F99 B;  5BS7 A;  3X1T A;  2HIO B;  3LZ0 B;  5JRG D;  3O62 A;  3MGP B;  1PZR A;  2PYO D;  4ZUX D;  1F66 B;  3AZJ B;  5AV9 C;  3MNN C;  3C1C A;  3AZH B;  1EQZ C;  3VH5 A;  1B6W A;  5B0Z A;  3W96 D;  4J8U C;  4R8P B;  5BO0 B;  5AVB A;  3UT9 D;  1KX4 D;  3UTB D;  5DNN B;  1KU5 A;  3AN2 C;  4JJN B;  1JFI B;  5CPK B;  4X23 D;  3A1I A;  3KUY A;  3AFA B;  2YFV B;  5B2J D;  1P3F D;  1ULY A;  4CSR B;  4J8W C;  2RVQ D;  3W98 D;  1P3B A;  3LJA B;  5BNV A;  3VH5 W;  1M1A A;  3R45 A;  4KGC B;  5B2I C;  5DNM B;  5B24 C;  3W99 B;  1B67 A;  4WNN B;  1KX3 D;  3REH B;  1M19 A;  3X1T D;  3MGS B;  3O62 D;  4XZQ A;  5FUG B;  2ARO B;  1P3O D;  2NZD A;  4H9P A;  3C1C D;  1P3K B;  2Y2G A;  5B0Z D;  5AVB D;  4HGA C;  3REK A;  2BYM A;  3AZG A;  3MVD C;  3X1U B;  5JRG B;  5B1M C;  1BH9 A;  3MGQ A;  3X1V A;  2PYO B;  3VH6 A;  4ZUX B;  3UTB C;  4Z5T A;  1ID3 C;  3AZL A;  3WA9 A;  4QLC A;  2XD5 A;  4H9S A;  2BYK B;  4CAY A;  3LEL D;  3W96 B;  1TZY B;  1P3L B;  5GT3 C;  1P3B D;  3REI C;  1M1A D;  1P3I C;  3UT9 B;  1KX4 B;  5CPJ B;  3VH5 T;  1M19 D;  3X1S D;  5GXQ C;  4J8X A;  1U35 A;  4XZQ D;  4H9O B;  5CPI A;  3AZI C;  3AV2 D;  2NZD D;  4X23 B;  5BT1 C;  1P3O C;  5B2J B;  4XUJ A;  5AV8 A;  1P3F B;  3VH6 W;  5B32 C;  4UUZ B;  3W98 B;  3NQJ B;  3H0L C;  4DRA A;  4G91 B;  5B0Y C;  4ZBJ B;  5AV9 A;  2NQB C;  2F8N A;  3MNN A;  1EQZ A;  3REK D;  1KX3 B;  1JFI A;  3X1T B;  3B0D B;  5CPK A;  4EO5 B;  4J8U A;  3O62 B;  3MGQ D;  3X1V D;  1F1E A;  5B1L C;  4WZS B;  4Z5T D;  4DQY B;  3WA9 D;  5AY8 D;  3C1C B;  3LJA A;  1P34 C;  5B0Z B;  2ZY5 A;  3W99 C;  5AV5 C;  4E44 A;  5AV6 C;  3LZ1 C;  3LEL C;  3B6F D;  5AVB B;  3AN2 A;  5C3I C;  1S32 C;  5FUG A;  4J8W A;  3X1S C;  1U35 D;  5B2I A;  5B24 A; 
#chains in the Genus database with same CATH homology
 5CP6 C;  4XUJ D;  5AV8 D;  4WU9 C;  3AZN C;  3AYW C;  1P3B B;  5BNV B;  2IO5 B;  1M1A B;  3VH6 T;  5AV9 D;  2F8N D;  1EQZ D;  4M6B A;  1M19 B;  4J8U D;  5E5A C;  3NQU A;  4XZQ B;  2FFF B;  3AV2 B;  2NZD B;  4H9P B;  1KX5 C;  4YM6 C;  2CWE A;  3MVD A;  3WAA C;  2FJ7 D;  5B1M A;  3AN2 D;  3UTB A;  3REK B;  3WTP E;  4H9O A;  2BYM B;  1P3P D;  3AZG B;  4H9R A;  4J8W D;  1BH9 B;  3MGQ B;  4AWL B;  3X1V B;  5B33 C;  5GT3 A;  4Z5T B;  3REI A;  3AZL B;  3WA9 B;  5AY8 B;  4QLC B;  5G49 A;  5B2I D;  5B24 D;  4CAY B;  3MGR D;  3WKJ C;  3B6F B;  3AZK C;  4KHA A;  5GXQ A;  3AZI A;  1P3O A;  5B32 A;  2L5A A;  3TU4 C;  4J8X B;  1U35 B;  5CPI B;  5B0Y A;  2RIQ A;  2NQB A;  4XUJ B;  5AV8 B;  2DQN C;  3MVD D;  1P3M C;  5B1M D;  4G92 C;  2FJ7 C;  5B1L A;  3H0M C;  4LD9 D;  1ID3 D;  5AV9 B;  2F8N B;  3MNN B;  1EQZ B;  4KUD C;  2ZM5 A;  1P34 A;  1P3P C;  3AV1 C;  4J8U B;  3W99 A;  5AV5 A;  5AV6 A;  3LZ1 A;  3LEL A;  5BNX A;  1S32 A;  5GT3 D;  3REI D;  1P3I D;  2ZY2 A;  3A1K A;  2Y2P A;  3KXB C;  3MGR C;  5B31 D;  3AN2 B;  3X1S A;  5GXQ D;  3AZI D;  5BT1 D;  3AV2 A;  5CP6 A;  2Y2L A;  4J8W B;  5B32 D;  4WU9 A;  3AZN A;  3AYW A;  3B6G D;  5B0Y D;  5B2I B;  2Y2I A;  5B24 B;  2NQB D;  2DF4 C;  5E5A A;  3AZE C;  5B1L D;  1P3G C;  1KX5 A;  4LD9 C;  4YM6 A;  5AY8 A;  1BH8 A;  1P34 D;  3W99 D;  5AV5 D;  1HQ3 C;  5AV6 D;  3NQU B;  3LZ1 D;  3WAA A;  1S32 D;  3B6F A;  1ZLA C;  4H9N A;  4HGA B;  5B40 C;  4Z2M G;  3EPH A;  4YS3 C;  3REL C;  3MVD B;  2JE5 A;  5B1M B;  5AVC C;  5B33 A;  5B31 C;  3UTB B;  4NE5 A;  1ID3 B;  3EPK A;  1W2E A;  3A6N D;  5CP6 D;  3WKJ A;  4H9R B;  3C1B C;  4E45 A;  4WU9 D;  3AZN D;  3AYW D;  5GT3 B;  4WU8 C;  3REI B;  5G49 B;  1P3I B;  3B6G C;  2BG1 A;  3KWQ C;  5B31 B;  5E5A D;  4KHA B;  5GXQ B;  3TU4 A;  3AZI B;  5GSU C;  1KX5 D;  1P3O B;  2F8N G;  4YM6 D;  5B32 B;  1P3M A;  3WAA D;  3EPJ A;  2YFW A;  2FJ7 A;  5B0Y B;  4Z2M H;  3WTP C;  2NQB B;  2Y2K A;  4KUD A;  1P3P A;  3AV1 A;  3AZM D;  3FDD A;  5B1L B;  5B33 D;  2F8N K;  4NE6 A;  3A6N C;  1P34 B;  3KXB A;  5AV5 B;  1A7W A;  5AV6 B;  3LZ1 B;  3MGR A;  3LEL B;  3AZK D;  3W97 C;  5BNX B;  5C3I B;  1S32 B;  4WJ3 C;  3UTA C;  1TAF A;  2G5H C;  3X1S B;  3TU4 D;  2CV5 C;  3LZ0 D;  5CP6 B;  1P3A C;  2J8P A;  4WU9 B;  3AZH D;  3AZN B;  1P3M D;  3AYW B;  3AZE A;  1H3O A;  1P3G A;  4Z66 C;  4KUD D;  1ID3 A;  3WKJ D;  4LD9 A;  3AV1 D;  2ZY3 A;  5E5A B;  1HQ3 A;  2HUE C;  3AZM C;  1KX5 B;  1ZLA A;  5B40 A;  4YM6 B;  1AOI C;  1BFM A;  1BH8 B;  1P3I A;  5KDM A;  4YS3 A;  3REL A;  3KXB D;  3WAA B;  5AVC A;  5B31 A;  1HTA A;  5GT0 C;  4H9N B;  3REJ C;  1M18 C;  1R4V A;  3C1B A;  3AZF C;  2JSS A;  3F6T A;  4H9S C;  5B33 B;  4WU8 A;  3B0C W;  4J8V C;  3B6G A;  5F99 C;  2HIO C;  3LZ0 C;  3KWQ A;  3MGP C;  3WKJ B;  5JA4 A;  5B32 G;  3AZK B;  2Y2M A;  4H9Q B;  3AZJ C;  1F66 C;  3AZE D;  3AZH C;  1P3G D;  5GSU A;  4R8P C;  3TU4 B;  1HQ3 D;  3WTP A;  3X1U D;  5CHL B;  1ZLA D;  5B40 D;  1WWI A;  5DNN C;  4YS3 D;  3REL D;  1P3M B;  4JJN C;  4G92 B;  5AVC D;  2YFW B;  5CPK C;  2FJ7 B;  3AFA C;  1TZY D;  1P3L D;  4KUD B;  3A6N A;  1P3P B;  3AV1 B;  3LJA C;  3W97 A;  3C1B D;  2Y2J A;  4KGC C;  5DNM C;  4WU8 D;  5CPJ D;  3KFU G;  3REH C;  3MGS C;  3KWQ D;  3KXB B;  3B0C T;  3UTA A;  3MGR B;  2ARO C;  3IP4 C;  1P3K C;  2CV5 A;  5GSU D;  1P3A A;  1TAF B;  3WTP D;  4Z66 A;  3X1U C;  5JRG C;  1N1J A;  2PYO C;  4ZUX C;  3AZE B;  3V9R A;  1H3O B;  3AZM A;  1P3G B;  3W96 C;  3B0B A;  4LD9 B;  1AOI A;  1TZY C;  1P3L C;  2Y2Q A;  3W97 D;  1HQ3 B;  3UT9 C;  1KX4 C;  3AZK A;  4H9Q A;  5GT0 A;  1ZLA B;  5B40 B;  5CPJ C;  3REJ A;  5KDM B;  4YS3 B;  3REL B;  1M18 A;  3UTA D;  3KUY D;  3AZF A;  5AVC B;  4X23 C;  5B2J C;  4J8V A;  2CV5 D;  1P3F C;  5F99 A;  4NE3 A;  2RVQ C;  2HIO A;  3LZ0 A;  3W98 C;  1P3A D;  2F2A C;  3MGP A;  3C1B B;  2VQR A;  4G91 C;  1F66 A;  3AZJ A;  4ZBJ C;  4WU8 B;  3AZH A;  3AL0 C;  3EG5 B;  1KX3 C;  3B6G B;  5BS7 C;  3B0D C;  4Z66 D;  3X1T C;  4EO5 C;  4R8P A;  3O62 C;  3KWQ B;  5JA4 B;  3P5J B;  5BO0 A;  3C1C C;  5GSU B;  5B0Z C;  1AOI D;  5AVB C;  5DNN A;  4JJN A;  3AZG D;  4WV4 B;  3WTP B;  3AFA A;  5GT0 D;  2YFV A;  3REJ D;  4CSR A;  3AZL D;  1M18 D;  4QLC D;  3EPL A;  3AZF D;  2G5I C;  4KGC A;  5DNM A;  3KUY C;  4WNN A;  4J8V D;  3REH A;  5F99 D;  2HIO D;  3A6N B;  2F8N H;  3MGS A;  2Y2N A;  1P3B C;  3MGP D;  2IO5 C;  3W97 B;  1M1A C;  2ARO A;  1F66 D;  3AZJ D;  3KSY A;  1WWS A;  1P3K A;  2Y2H A;  1M19 C;  4J8X D;  4R8P D;  5CPI D;  4XZQ C;  3UTA B;  3KUY B;  3AV2 C;  2NZD C;  2Y2O A;  2CV5 B;  1Z2C B;  2XD1 A;  2JCH A;  3H0R C;  4UPK A;  3X1U A;  5JRG A;  1P3A B;  3R45 B;  5DNN D;  2PYO A;  4ZUX A;  3MNN D;  2W8S A;  4DRB A;  4JJN D;  3REK C;  5CPK D;  3AFA D;  4Z66 B;  3AZG C;  1T3U A;  2BYK A;  3W96 A;  1TZY A;  1P3L A;  2UWX A;  3X1V C;  1N1J B;  2ZY4 A;  3MGQ C;  4AWL C;  4Z5T C;  3LJA D;  3AZL C;  3WA9 C;  5AY8 C;  3V9R B;  4QLC C;  4KGC D;  2HUE B;  5DNM D;  3UT9 A;  1Q9C A;  3AZM B;  5B31 G;  1KX4 A;  5CPJ A;  3REH D;  1AOI B;  3B6F C;  3MGS D;  4NFT A;  2ARO D;  4X23 A;  5GT0 B;  1P3K D;  5B2J A;  3REJ B;  1P3F A;  4UUZ A;  3W98 A;  3NQJ A;  1M18 B;  4J8X C;  2LY8 A;  1U35 C;  3AZF B;  5CPI C;  4XUJ C;  5AV8 C;  4J8V B;  1KX3 A;  5F99 B;  5BS7 A;  3X1T A;  2HIO B;  3LZ0 B;  5JRG D;  3O62 A;  3MGP B;  1PZR A;  2PYO D;  4ZUX D;  1F66 B;  3AZJ B;  5AV9 C;  3MNN C;  3C1C A;  3AZH B;  1EQZ C;  3VH5 A;  1B6W A;  5B0Z A;  3W96 D;  4J8U C;  4R8P B;  5BO0 B;  5AVB A;  3UT9 D;  1KX4 D;  3UTB D;  5DNN B;  1KU5 A;  3AN2 C;  4JJN B;  1JFI B;  5CPK B;  4X23 D;  3A1I A;  3KUY A;  3AFA B;  2YFV B;  5B2J D;  1P3F D;  1ULY A;  4CSR B;  4J8W C;  2RVQ D;  3W98 D;  1P3B A;  3LJA B;  5BNV A;  3VH5 W;  1M1A A;  3R45 A;  4KGC B;  5B2I C;  5DNM B;  5B24 C;  3W99 B;  1B67 A;  4WNN B;  1KX3 D;  3REH B;  1M19 A;  3X1T D;  3MGS B;  3O62 D;  4XZQ A;  5FUG B;  2ARO B;  1P3O D;  2NZD A;  4H9P A;  3C1C D;  1P3K B;  2Y2G A;  5B0Z D;  5AVB D;  4HGA C;  3REK A;  2BYM A;  3AZG A;  3MVD C;  3X1U B;  5JRG B;  5B1M C;  1BH9 A;  3MGQ A;  3X1V A;  2PYO B;  3VH6 A;  4ZUX B;  3UTB C;  4Z5T A;  1ID3 C;  3AZL A;  3WA9 A;  4QLC A;  2XD5 A;  4H9S A;  2BYK B;  4CAY A;  3LEL D;  3W96 B;  1TZY B;  1P3L B;  5GT3 C;  1P3B D;  3REI C;  1M1A D;  1P3I C;  3UT9 B;  1KX4 B;  5CPJ B;  3VH5 T;  1M19 D;  3X1S D;  5GXQ C;  4J8X A;  1U35 A;  4XZQ D;  4H9O B;  5CPI A;  3AZI C;  3AV2 D;  2NZD D;  4X23 B;  5BT1 C;  1P3O C;  5B2J B;  4XUJ A;  5AV8 A;  1P3F B;  3VH6 W;  5B32 C;  4UUZ B;  3W98 B;  3NQJ B;  3H0L C;  4DRA A;  4G91 B;  5B0Y C;  4ZBJ B;  5AV9 A;  2NQB C;  2F8N A;  3MNN A;  1EQZ A;  3REK D;  1KX3 B;  1JFI A;  3X1T B;  3B0D B;  5CPK A;  4EO5 B;  4J8U A;  3O62 B;  3MGQ D;  3X1V D;  1F1E A;  5B1L C;  4WZS B;  4Z5T D;  4DQY B;  3WA9 D;  5AY8 D;  3C1C B;  3LJA A;  1P34 C;  5B0Z B;  2ZY5 A;  3W99 C;  5AV5 C;  4E44 A;  5AV6 C;  3LZ1 C;  3LEL C;  3B6F D;  5AVB B;  3AN2 A;  5C3I C;  1S32 C;  5FUG A;  4J8W A;  3X1S C;  1U35 D;  5B2I A;  5B24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...