1P3PC

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
b'AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3pC00
3UTBB 4CAYB 5AY8A 3KXBA 2PYOB 3AV1C 3AZFA 3X1SD 4LD9D 5E5AB 2CV5A 3AV2A 2NZDC 5GXQC 3B6FB 5B1LB 4X23C 3AZKB 2AROC 3WKJB 4H9PA 3O62C 1P3IC 5B2JC 1TAFA 3AZNB 1M19C 4WU9D 3NQUB 3LELD 3C1BA 5CPKA 1P3BC 4KGCD 3REIB 3AZID 5B33C 3VH5T 4DRBA 5B24D 3X1SB 4LD9B 2F8NH 5BNVB 3MGSA 1A7WA 1P3MD 3VH6T 3UTAC 2NQBC 1M18B 4R8PD 3UTBA 5DNND 5CPIA 5JRGD 2PYOA 3LELB 4KGCB 3AZIB 4JJND 5DNMD 4YS3A 3AZEA 5AVBA 5AY8C 1TZYB 4UUZB 4Z2MH 5B24B 3KXBC 5AV9A 4NE5A 1BH9A 5B1LA 3AZFC 4H9OB 3LZ0D 2CV5C 3AV2C 1M1AA 2FJ7B 4M6BA 5GXQD 3AZMD 3W98C 3REKC 2AROD 1AOIA 4XUJA 4R8PB 1P3ID 5DNNB 5B2JD 4HGAB 5G49B 5JRGB 1M19D 3C1BC 5CPKC 2YFWA 5AV6B 3AZGC 1P3BD 4JJNB 5F99C 4KHAB 5DNMB 4H9QB 5B33D 5C3IC 1B6WA 1KX4A 3MGSC 5GT3A 3TU4D 2NZDB 5GXQB 4WU9A 3UTAD 4X23B 4KGCA 2AROB 3O62B 3AZIA 1P3IB 5CPIC 5B2JB 1HTAA 1M19B 4H9NA 1P3BB 5AVCC 4YS3C 3LZ1D 5B33B 3AZEC 5AVBC 4J8VD 4Z5TC 1P3MA 5AV9C 3KXBD 3AN2A 1P3LC 4R8PA 4EO5C 5DNNA 5B2ID 5JA4B 1M1AC 3AV2D 1EQZC 3REJC 5JRGA 3UTAB 3W98D 1AOIC 3REKD 4XUJC 5DNMA 4H9QA 3W99C 3C1BD 3AZGD 5F99D 3LZ0A 4QLCC 5AY8B 5BO0A 3AZMA 3KXBB 4WNNA 4G91C 1KX4C 5B2JA 3MGSD 5GT3C 3AV2B 2CV5B 3A6NA 1P34A 4WU9C 5B0YC 3W98B 3REKB 4H9PB 3AZHC 3REHA 3C1BB 4J8WC 3AZGB 5CPKB 5AVCD 5F99B 4YS3D 5JA4A 5AVBD 3TU4A 3VH5W 1P3AD 1P3MC 4Z5TD 5AV9D 3AN2C 5C3IB 1P3LD 3MGSB 5KDMA 5JRGC 1EQZD 3REJD 1AOID 4XUJD 5DNMC 3LZ1A 5CPIB 3W99D 4J8VA 5B0ZA 4J8UC 5AVCB 3LZ0C 3KWQA 4YS3B 4QLCD 5B2IA 1JFIA 3AZEB 5AVBB 3AZMC 4Z5TB 2HIOA 5GSUA 5AV9B 1BH9B 3W98A 1R4VA 3REKA 1P3LB 1KX4D 3LJAD 4EO5B 1M1AB 5GT3D 1P3KA 3A6NC 1P3PA 3REJB 4XZQA 1P34C 1EQZB 5B0YD 1AOIB 3AZGA 4E45A 4XUJB 5F99A 3WTPA 3W99B 3C1CD 3AZHD 3X1UC 2YFWB 4J8WD 3AFAA 2YFVA 4QLCB 3TU4C 4H9RA 3RELA 5BS7A 2F8ND 4G91B 2HUEB 3AN2D 1KX4B 5B1MC 3NQJA 5GT3B 5CP6D 4WU9B 5B0YB 3B0CT 5AVCA 1HQ3A 3LZ1C 5B31A 4J8VC 3AZHB 3X1VD 1BH8B 5B0ZC 1P3AA 4Z5TA 3MGQD 4J8UD 4J8WB 4H9NB 4ZUXC 3KWQC 1P3LA 5B2IC 1ULYA 1N1JA 5BT1C 5GSUC 2HIOC 3REJA 1P3MB 1EQZA 2F8NB 3AN2B 5B32A 1P3GA 3W99A 1P3KC 5CP6B 5GT0D 1P3PC 4XZQC 3A6ND 1P34D 4QLCA 3WTPC 3X1VB 3X1UD 3MNND 4J8UB 3AFAC 3LZ0B 5B40D 3LJAA 1S32D 1Q9CA 5FUGA 4G92C 5BO0B 5BS7C 3RELC 3AZMB 1F66A 1WWSA 4WNNB 5B0YA 3W96C 4YM6D 5B1MD 3C1CA 3AZHA 1BH8A 3A6NB 1KU5A 2IO5C 1P34B 3B0BA 1P3OD 4J8WA 1HQ3C 4CSRB 5B31C 3V9RA 3X1UB 1P3AC 5B0ZD 2F8NG 1B67A 3MVDC 2F8NA 4ZUXD 3KWQD 2BYKA 5CP6A 3TU4B 1ZLAC 3WTPE 5BT1D 5GSUD 2HIOD 4YM6B 5B1MB 5B32C 1P3GC 3WAAA 3X1VA 1P3KD 5KDMB 1P3PD 4XZQD 3MGQA 4J8UA 1P3OB 4ZBJC 2L5AA 4Z2MG 3WA9A 3LZ1B 3WTPD 4J8VB 5B0ZB 2HUEC 4ZUXB 3AFAD 3KWQB 3LJAC 5B2IB 1JFIB 3AYWA 1ID3C 5GT0A 3KSYA 5GSUB 2HIOB 3RELD 1F66C 5CPJD 3W96D 4CSRA 1U35A 3C1CC 1P3KB 3X1UA 1P3PB 3MNNA 4XZQB 3MGPC 1HQ3D 1S32A 5B40A 1WWIA 3WTPB 5B31D 1KX5A 3MVDD 3VH5A 3AFAB 2YFVB 4YM6A 5B1MA 4Z66A 3X1TA 2BYMA 5CP6C 4H9RB 1ZLAD 4G92B 3RELB 1P3OA 4KUDA 3VH6W 3W96B 3NQJB 5B32D 3WAAC 1P3GD 3VH6A 3X1VC 4WU8A 3MGQC 2IO5B 4AWLC 3KUYC 1H3OA 4ZUXA 1HQ3B 3WA9C 5B31B 1P3AB 3MVDB 4NFTA 3AYWC 5GT0C 1ID3D 1N1JB 3AZND 1ZLAB 1F66D 4E44A 5B32B 1P3GB 1U35C 3REID 3MNNC 5AV5C 4ZBJB 3MGPD 3MGRC 5B40C 1S32C 1KX5C 5CPJA 3W96A 3B6GA 4YM6C 3LJAB 4Z66C 1M18D 2JSSA 3X1TC 1ID3B 5FUGB 1F66B 3AZLC 1P3OC 3AZJD 4KUDC 5AV8A 5B31G 3WAAD 3C1CB 4WU8C 3R45A 3MVDA 1TZYD 3KUYD 3W97C 4WZSB 3MGPB 1P3FA 3WA9D 1KX3A 4J8XC 3UT9A 3V9RB 1ZLAA 2FJ7D 5B32G 2BYKB 3AYWD 2RVQC 4CAYA 3AZJB 5AV6D 3REHC 5BNXB 1U35D 3WAAB 5E5AA 3MGQB 2LY8A 5AV5D 3KUYB 4AWLB 3B6FA 3WA9B 3AZKA 3MGRD 3AV1D 3WKJA 1ID3A 1KX5D 3AZNA 5CPJC 3B6GC 2NZDD 4DRAA 4X23D 3NQUA 4Z66D 3AYWB 3X1TD 5GT0B 3O62D 3REIA 3AZLD 4H9SA 5CHLB 5AV8C 4KUDD 3MGPA 3X1SA 1U35B 4LD9A 4WU8D 5BNVA 3MNNB 5AV5B 2CWEA 1P3FC 3W97D 1S32B 5B40B 3MGRB 3AV1B 1M18A 1KX3C 3B0DC 3UT9C 4J8XD 1KX5B 3AZJA 2NQBD 3LELA 4Z66B 5BNXA 3X1TB 2BYMB 3UTBC 2RVQD 3AZLB 1TZYA 4UUZA 3KUYA 4KUDB 5B24A 2PYOC 3REHD 4H9OA 4WU8B 5E5AC 2FJ7A 5AY8D 3B6FC 1H3OB 5B1LC 3W97B 3AZKC 3WKJC 4J8XB 3AZFD 3AZNC 2CV5D 5G49A 3B6GD 2NQBB 5AV6A 4JJNA 3REIC 4KHAA 5AV5A 4H9SC 5AV8D 3MGRA 3AV1A 5CPKD 3X1SC 3REHB 4LD9C 2NZDA 5GXQA 1P3FD 4X23A 1M18C 1KX3D 2AROA 3AZFB 3O62A 3UT9D 1P3IA 3AZLA 3AZJC 5CPJB 3B6GB 1F1EA 1M19A 3LELC 4KGCC 1P3BA 3AZIC 3UTBD 1TAFB 5CPID 5B33A 1TZYC 5B24C 5AV8B 3W97A 2PYOD 3B0CW 4J8XA 4WV4B 3R45B 2FJ7C 5E5AD 1BFMA 3AZED 4NE6A 3B6FD 1P3FB 3UTAA 5B1LD 2NQBA 3AZKD 1KX3B 3WKJD 2F8NK 3B0DB 3UT9B 4R8PC 5DNNC 4HGAC 1M1AD 4NE3A 5AV6C 4JJNC
chains in the Genus database with same CATH superfamily
3UTBB 4CAYB 5AY8A 2XD1A 3KXBA 2PYOB 3AV1C 3AZFA 2UWXA 3X1SD 4LD9D 5E5AB 2CV5A 3AV2A 2NZDC 5GXQC 3B6FB 5B1LB 4X23C 3AZKB 2AROC 3WKJB 4H9PA 3O62C 1P3IC 5B2JC 1TAFA 3AZNB 2F2AC 1M19C 4WU9D 3NQUB 3LELD 3C1BA 5CPKA 1P3BC 4KGCD 3REIB 3AZID 5B33C 3VH5T 4DRBA 5B24D 1PZRA 3X1SB 4LD9B 2F8NH 5BNVB 3MGSA 1A7WA 1P3MD 3VH6T 3UTAC 2NQBC 1M18B 4R8PD 3UTBA 5DNND 5CPIA 5JRGD 2PYOA 3P5JB 3LELB 4KGCB 3AZIB 4JJND 5DNMD 4YS3A 3AZEA 5AVBA 5AY8C 1TZYB 4UUZB 4Z2MH 5B24B 3KXBC 5AV9A 4NE5A 1BH9A 5B1LA 3AZFC 4H9OB 3LZ0D 2CV5C 3AV2C 1M1AA 2FJ7B 4M6BA 2ZY3A 5GXQD 3AZMD 3W98C 3REKC 2AROD 1AOIA 4XUJA 4R8PB 1P3ID 5DNNB 5B2JD 4HGAB 5G49B 5JRGB 1M19D 3C1BC 5CPKC 2YFWA 5AV6B 3AZGC 1P3BD 4JJNB 5F99C 4KHAB 5DNMB 4H9QB 5B33D 5C3IC 1B6WA 1KX4A 3MGSC 5GT3A 3TU4D 2NZDB 5GXQB 4WU9A 3UTAD 4X23B 4KGCA 2AROB 3O62B 3AZIA 1P3IB 5CPIC 5B2JB 1HTAA 1M19B 4H9NA 1P3BB 5AVCC 2JE5A 4YS3C 3LZ1D 5B33B 3AZEC 5AVBC 4J8VD 4Z5TC 1P3MA 5AV9C 3KXBD 3AN2A 1P3LC 4R8PA 4EO5C 5DNNA 5B2ID 5JA4B 1M1AC 3AV2D 1EQZC 3REJC 5JRGA 3UTAB 3W98D 1AOIC 3REKD 4XUJC 5DNMA 4H9QA 3W99C 3C1BD 3AZGD 5F99D 3LZ0A 4QLCC 5AY8B 5BO0A 3AZMA 3KXBB 4WNNA 4G91C 1KX4C 5B2JA 3MGSD 5GT3C 3AV2B 2CV5B 3EPJA 3A6NA 1P34A 4WU9C 5B0YC 3W98B 3REKB 4H9PB 3AZHC 3REHA 3C1BB 4J8WC 3AZGB 5CPKB 2DF4C 5AVCD 5F99B 4YS3D 5JA4A 5AVBD 3TU4A 3VH5W 1P3AD 1P3MC 4Z5TD 5AV9D 3AN2C 5C3IB 3FDDA 1P3LD 3MGSB 5KDMA 5JRGC 1EQZD 3REJD 1AOID 4XUJD 5DNMC 3LZ1A 5CPIB 3W99D 4J8VA 3AL0C 5B0ZA 4J8UC 5AVCB 3LZ0C 3KWQA 4YS3B 4QLCD 5B2IA 1JFIA 3AZEB 5AVBB 4DQYB 3AZMC 4Z5TB 2HIOA 5GSUA 5AV9B 1BH9B 3W98A 1R4VA 3REKA 1P3LB 3IP4C 3LJAD 4EO5B 1KX4D 1M1AB 5GT3D 1P3KA 2Y2NA 3A6NC 1P3PA 3REJB 4XZQA 1P34C 1EQZB 5B0YD 1AOIB 3AZGA 4E45A 4XUJB 2Y2OA 5F99A 2Y2HA 3WTPA 3W99B 3C1CD 3AZHD 3X1UC 2YFWB 4J8WD 3AFAA 2YFVA 4QLCB 3TU4C 4H9RA 3RELA 5BS7A 2F8ND 4G91B 2HUEB 3AN2D 1KX4B 5B1MC 3H0MC 3NQJA 5GT3B 5CP6D 4WU9B 5B0YB 3B0CT 5AVCA 1HQ3A 3LZ1C 2FFFB 5B31A 4J8VC 3AZHB 3X1VD 1BH8B 5B0ZC 1P3AA 4Z5TA 3MGQD 4J8UD 4J8WB 4H9NB 4ZUXC 2JCHA 3F6TA 3KWQC 1P3LA 5B2IC 2Y2JA 1ULYA 1N1JA 5BT1C 5GSUC 2HIOC 3REJA 1P3MB 1EQZA 2F8NB 3AN2B 5B32A 1P3GA 3W99A 1P3KC 5CP6B 5GT0D 1P3PC 4XZQC 3A6ND 1P34D 3EG5B 4QLCA 3WTPC 4WJ3C 3X1VB 2Y2KA 3X1UD 3MNND 4J8UB 3AFAC 3LZ0B 5B40D 3LJAA 1S32D 1W2EA 1Q9CA 5FUGA 4G92C 5BO0B 5BS7C 3RELC 3AZMB 1F66A 1WWSA 4WNNB 5B0YA 3W96C 4YM6D 3H0RC 5B1MD 3C1CA 3AZHA 2ZY5A 1BH8A 3A6NB 1KU5A 2IO5C 1P34B 3B0BA 1P3OD 2ZM5A 4J8WA 1HQ3C 4CSRB 5B31C 3V9RA 3X1UB 1P3AC 5B0ZD 2F8NG 1B67A 3MVDC 2F8NA 4ZUXD 3KWQD 2BYKA 5CP6A 3TU4B 1ZLAC 3WTPE 5BT1D 5GSUD 2HIOD 4YM6B 5B1MB 5B32C 1P3GC 3WAAA 3X1VA 1P3KD 2G5IC 5KDMB 1P3PD 4XZQD 3MGQA 4J8UA 1P3OB 4ZBJC 2L5AA 4Z2MG 3WA9A 2G5HC 3LZ1B 3WTPD 4J8VB 5B0ZB 2HUEC 4ZUXB 3AFAD 3KWQB 3LJAC 5B2IB 1JFIB 3AYWA 1ID3C 5GT0A 3KSYA 5GSUB 2HIOB 3RELD 1F66C 2Y2QA 5CPJD 3W96D 4CSRA 1U35A 3A1IA 3C1CC 1P3KB 2VQRA 3X1UA 1P3PB 3MNNA 4XZQB 3MGPC 1HQ3D 2ZY4A 5B40A 1S32A 1WWIA 3WTPB 5B31D 1KX5A 2Y2GA 3MVDD 3KFUG 3VH5A 3AFAB 2YFVB 4YM6A 5B1MA 4Z66A 3X1TA 2BYMA 5CP6C 4H9RB 1ZLAD 4G92B 3RELB 1P3OA 4KUDA 3VH6W 3W96B 3NQJB 5B32D 3WAAC 1P3GD 3VH6A 3X1VC 4WU8A 3MGQC 2IO5B 4AWLC 3KUYC 1H3OA 4ZUXA 1HQ3B 3WA9C 5B31B 1P3AB 3MVDB 4NFTA 3EPHA 3AYWC 5GT0C 1ID3D 1N1JB 3AZND 1ZLAB 1F66D 4E44A 5B32B 1P3GB 1U35C 3REID 3MNNC 5AV5C 4ZBJB 3MGPD 3MGRC 5B40C 1S32C 1KX5C 2BG1A 5CPJA 3W96A 3B6GA 4YM6C 3LJAB 4Z66C 1M18D 2JSSA 3X1TC 1ID3B 5FUGB 1F66B 3AZLC 1P3OC 3AZJD 4KUDC 5AV8A 5B31G 3WAAD 3C1CB 1T3UA 4WU8C 3R45A 3MVDA 1TZYD 3KUYD 3W97C 4WZSB 3MGPB 1P3FA 3WA9D 1KX3A 4J8XC 3UT9A 3V9RB 1ZLAA 2FJ7D 5B32G 2BYKB 3AYWD 2RVQC 4CAYA 3AZJB 2Y2MA 5AV6D 3REHC 5BNXB 1U35D 3WAAB 5E5AA 3MGQB 2LY8A 2Y2LA 5AV5D 3KUYB 4AWLB 3B6FA 3WA9B 3AZKA 3MGRD 3AV1D 3WKJA 1ID3A 1KX5D 3AZNA 5CPJC 3B6GC 2NZDD 2ZY2A 2W8SA 4DRAA 4X23D 3NQUA 4Z66D 3AYWB 3X1TD 5GT0B 3O62D 3REIA 3AZLD 4H9SA 5CHLB 5AV8C 4KUDD 3MGPA 3X1SA 1U35B 4LD9A 4WU8D 5BNVA 3MNNB 5AV5B 2CWEA 1P3FC 3W97D 1S32B 5B40B 3MGRB 3AV1B 1M18A 1KX3C 3B0DC 3UT9C 4J8XD 1KX5B 3AZJA 2Y2IA 2NQBD 3LELA 4Z66B 5BNXA 3X1TB 2BYMB 3UTBC 2RVQD 3AZLB 1TZYA 4UUZA 3KUYA 4KUDB 5B24A 2J8PA 3A1KA 2PYOC 3REHD 4H9OA 4WU8B 5E5AC 2FJ7A 5AY8D 3B6FC 1H3OB 5B1LC 3W97B 3AZKC 3WKJC 4J8XB 3AZFD 3AZNC 3H0LC 3EPKA 2CV5D 5G49A 3B6GD 2NQBB 5AV6A 4JJNA 3REIC 4KHAA 2Y2PA 5AV5A 4H9SC 5AV8D 3MGRA 3AV1A 2DQNC 3X1SC 3REHB 5CPKD 4LD9C 2XD5A 2NZDA 1Z2CB 5GXQA 1P3FD 4X23A 1M18C 1KX3D 2AROA 3EPLA 3AZFB 3O62A 3UT9D 1P3IA 3AZLA 3AZJC 5CPJB 3B6GB 1F1EA 1M19A 3LELC 4KGCC 1P3BA 3AZIC 3UTBD 1TAFB 5CPID 5B33A 1TZYC 5B24C 5AV8B 3W97A 2PYOD 3B0CW 4J8XA 4WV4B 3R45B 2FJ7C 5E5AD 1BFMA 3AZED 4NE6A 3B6FD 1P3FB 3UTAA 5B1LD 2NQBA 3AZKD 1KX3B 4UPKA 3WKJD 2F8NK 3B0DB 3UT9B 4R8PC 5DNNC 4HGAC 1M1AD 2RIQA 4NE3A 5AV6C 4JJNC
chains in the Genus database with same CATH topology
3UTBB 4CAYB 5AY8A 2XD1A 3KXBA 2PYOB 3AV1C 3AZFA 2UWXA 3X1SD 4LD9D 5E5AB 2CV5A 3AV2A 2NZDC 5GXQC 3B6FB 5B1LB 4X23C 3AZKB 2AROC 3WKJB 4H9PA 3O62C 1P3IC 5B2JC 1TAFA 3AZNB 2F2AC 1M19C 4WU9D 3NQUB 3LELD 3C1BA 5CPKA 1P3BC 4KGCD 3REIB 3AZID 5B33C 3VH5T 4DRBA 5B24D 1PZRA 3X1SB 4LD9B 2F8NH 5BNVB 3MGSA 1A7WA 1P3MD 3VH6T 3UTAC 2NQBC 1M18B 4R8PD 3UTBA 5DNND 5CPIA 5JRGD 2PYOA 3P5JB 3LELB 4KGCB 3AZIB 4JJND 5DNMD 4YS3A 3AZEA 5AVBA 5AY8C 1TZYB 4UUZB 4Z2MH 5B24B 3KXBC 5AV9A 4NE5A 1BH9A 5B1LA 3AZFC 4H9OB 3LZ0D 2CV5C 3AV2C 1M1AA 2FJ7B 4M6BA 2ZY3A 5GXQD 3AZMD 3W98C 3REKC 2AROD 1AOIA 4XUJA 4R8PB 1P3ID 5DNNB 5B2JD 4HGAB 5G49B 5JRGB 1M19D 3C1BC 5CPKC 2YFWA 5AV6B 3AZGC 1P3BD 4JJNB 5F99C 4KHAB 5DNMB 4H9QB 5B33D 5C3IC 1B6WA 1KX4A 3MGSC 5GT3A 3TU4D 2NZDB 5GXQB 4WU9A 3UTAD 4X23B 4KGCA 2AROB 3O62B 3AZIA 1P3IB 5CPIC 5B2JB 1HTAA 1M19B 4H9NA 1P3BB 5AVCC 2JE5A 4YS3C 3LZ1D 5B33B 3AZEC 5AVBC 4J8VD 4Z5TC 1P3MA 5AV9C 3KXBD 3AN2A 1P3LC 4R8PA 4EO5C 5DNNA 5B2ID 5JA4B 1M1AC 3AV2D 1EQZC 3REJC 5JRGA 3UTAB 3W98D 1AOIC 3REKD 4XUJC 5DNMA 4H9QA 3W99C 3C1BD 3AZGD 5F99D 3LZ0A 4QLCC 5AY8B 5BO0A 3AZMA 3KXBB 4WNNA 4G91C 1KX4C 5B2JA 3MGSD 5GT3C 3AV2B 2CV5B 3EPJA 3A6NA 1P34A 4WU9C 5B0YC 3W98B 3REKB 4H9PB 3AZHC 3REHA 3C1BB 4J8WC 3AZGB 5CPKB 2DF4C 5AVCD 5F99B 4YS3D 5JA4A 5AVBD 3TU4A 3VH5W 1P3AD 1P3MC 4Z5TD 5AV9D 3AN2C 5C3IB 3FDDA 1P3LD 3MGSB 5KDMA 5JRGC 1EQZD 3REJD 1AOID 4XUJD 5DNMC 3LZ1A 5CPIB 3W99D 4J8VA 3AL0C 5B0ZA 4J8UC 5AVCB 3LZ0C 3KWQA 4YS3B 4QLCD 5B2IA 1JFIA 3AZEB 5AVBB 4DQYB 3AZMC 4Z5TB 2HIOA 5GSUA 5AV9B 1BH9B 3W98A 1R4VA 3REKA 1P3LB 3IP4C 3LJAD 4EO5B 1KX4D 1M1AB 5GT3D 1P3KA 2Y2NA 3A6NC 1P3PA 3REJB 4XZQA 1P34C 1EQZB 5B0YD 1AOIB 3AZGA 4E45A 4XUJB 2Y2OA 5F99A 2Y2HA 3WTPA 3W99B 3C1CD 3AZHD 3X1UC 2YFWB 4J8WD 3AFAA 2YFVA 4QLCB 3TU4C 4H9RA 3RELA 5BS7A 2F8ND 4G91B 2HUEB 3AN2D 1KX4B 5B1MC 3H0MC 3NQJA 5GT3B 5CP6D 4WU9B 5B0YB 3B0CT 5AVCA 1HQ3A 3LZ1C 2FFFB 5B31A 4J8VC 3AZHB 3X1VD 1BH8B 5B0ZC 1P3AA 4Z5TA 3MGQD 4J8UD 4J8WB 4H9NB 4ZUXC 2JCHA 3F6TA 3KWQC 1P3LA 5B2IC 2Y2JA 1ULYA 1N1JA 5BT1C 5GSUC 2HIOC 3REJA 1P3MB 1EQZA 2F8NB 3AN2B 5B32A 1P3GA 3W99A 1P3KC 5CP6B 5GT0D 1P3PC 4XZQC 3A6ND 1P34D 3EG5B 4QLCA 3WTPC 4WJ3C 3X1VB 2Y2KA 3X1UD 3MNND 4J8UB 3AFAC 3LZ0B 5B40D 3LJAA 1S32D 1W2EA 1Q9CA 5FUGA 4G92C 5BO0B 5BS7C 3RELC 3AZMB 1F66A 1WWSA 4WNNB 5B0YA 3W96C 4YM6D 3H0RC 5B1MD 3C1CA 3AZHA 2ZY5A 1BH8A 3A6NB 1KU5A 2IO5C 1P34B 3B0BA 1P3OD 2ZM5A 4J8WA 1HQ3C 4CSRB 5B31C 3V9RA 3X1UB 1P3AC 5B0ZD 2F8NG 1B67A 3MVDC 2F8NA 4ZUXD 3KWQD 2BYKA 5CP6A 3TU4B 1ZLAC 3WTPE 5BT1D 5GSUD 2HIOD 4YM6B 5B1MB 5B32C 1P3GC 3WAAA 3X1VA 1P3KD 2G5IC 5KDMB 1P3PD 4XZQD 3MGQA 4J8UA 1P3OB 4ZBJC 2L5AA 4Z2MG 3WA9A 2G5HC 3LZ1B 3WTPD 4J8VB 5B0ZB 2HUEC 4ZUXB 3AFAD 3KWQB 3LJAC 5B2IB 1JFIB 3AYWA 1ID3C 5GT0A 3KSYA 5GSUB 2HIOB 3RELD 1F66C 2Y2QA 5CPJD 3W96D 4CSRA 1U35A 3A1IA 3C1CC 1P3KB 2VQRA 3X1UA 1P3PB 3MNNA 4XZQB 3MGPC 1HQ3D 2ZY4A 5B40A 1S32A 1WWIA 3WTPB 5B31D 1KX5A 2Y2GA 3MVDD 3KFUG 3VH5A 3AFAB 2YFVB 4YM6A 5B1MA 4Z66A 3X1TA 2BYMA 5CP6C 4H9RB 1ZLAD 4G92B 3RELB 1P3OA 4KUDA 3VH6W 3W96B 3NQJB 5B32D 3WAAC 1P3GD 3VH6A 3X1VC 4WU8A 3MGQC 2IO5B 4AWLC 3KUYC 1H3OA 4ZUXA 1HQ3B 3WA9C 5B31B 1P3AB 3MVDB 4NFTA 3EPHA 3AYWC 5GT0C 1ID3D 1N1JB 3AZND 1ZLAB 1F66D 4E44A 5B32B 1P3GB 1U35C 3REID 3MNNC 5AV5C 4ZBJB 3MGPD 3MGRC 5B40C 1S32C 1KX5C 2BG1A 5CPJA 3W96A 3B6GA 4YM6C 3LJAB 4Z66C 1M18D 2JSSA 3X1TC 1ID3B 5FUGB 1F66B 3AZLC 1P3OC 3AZJD 4KUDC 5AV8A 5B31G 3WAAD 3C1CB 1T3UA 4WU8C 3R45A 3MVDA 1TZYD 3KUYD 3W97C 4WZSB 3MGPB 1P3FA 3WA9D 1KX3A 4J8XC 3UT9A 3V9RB 1ZLAA 2FJ7D 5B32G 2BYKB 3AYWD 2RVQC 4CAYA 3AZJB 2Y2MA 5AV6D 3REHC 5BNXB 1U35D 3WAAB 5E5AA 3MGQB 2LY8A 2Y2LA 5AV5D 3KUYB 4AWLB 3B6FA 3WA9B 3AZKA 3MGRD 3AV1D 3WKJA 1ID3A 1KX5D 3AZNA 5CPJC 3B6GC 2NZDD 2ZY2A 2W8SA 4DRAA 4X23D 3NQUA 4Z66D 3AYWB 3X1TD 5GT0B 3O62D 3REIA 3AZLD 4H9SA 5CHLB 5AV8C 4KUDD 3MGPA 3X1SA 1U35B 4LD9A 4WU8D 5BNVA 3MNNB 5AV5B 2CWEA 1P3FC 3W97D 1S32B 5B40B 3MGRB 3AV1B 1M18A 1KX3C 3B0DC 3UT9C 4J8XD 1KX5B 3AZJA 2Y2IA 2NQBD 3LELA 4Z66B 5BNXA 3X1TB 2BYMB 3UTBC 2RVQD 3AZLB 1TZYA 4UUZA 3KUYA 4KUDB 5B24A 2J8PA 3A1KA 2PYOC 3REHD 4H9OA 4WU8B 5E5AC 2FJ7A 5AY8D 3B6FC 1H3OB 5B1LC 3W97B 3AZKC 3WKJC 4J8XB 3AZFD 3AZNC 3H0LC 3EPKA 2CV5D 5G49A 3B6GD 2NQBB 5AV6A 4JJNA 3REIC 4KHAA 2Y2PA 5AV5A 4H9SC 5AV8D 3MGRA 3AV1A 2DQNC 3X1SC 3REHB 5CPKD 4LD9C 2XD5A 2NZDA 1Z2CB 5GXQA 1P3FD 4X23A 1M18C 1KX3D 2AROA 3EPLA 3AZFB 3O62A 3UT9D 1P3IA 3AZLA 3AZJC 5CPJB 3B6GB 1F1EA 1M19A 3LELC 4KGCC 1P3BA 3AZIC 3UTBD 1TAFB 5CPID 5B33A 1TZYC 5B24C 5AV8B 3W97A 2PYOD 3B0CW 4J8XA 4WV4B 3R45B 2FJ7C 5E5AD 1BFMA 3AZED 4NE6A 3B6FD 1P3FB 3UTAA 5B1LD 2NQBA 3AZKD 1KX3B 4UPKA 3WKJD 2F8NK 3B0DB 3UT9B 4R8PC 5DNNC 4HGAC 1M1AD 2RIQA 4NE3A 5AV6C 4JJNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTB B;  4CAY B;  5AY8 A;  3KXB A;  2PYO B;  3AV1 C;  3AZF A;  3X1S D;  4LD9 D;  5E5A B;  2CV5 A;  3AV2 A;  2NZD C;  5GXQ C;  3B6F B;  5B1L B;  4X23 C;  3AZK B;  2ARO C;  3WKJ B;  4H9P A;  3O62 C;  1P3I C;  5B2J C;  1TAF A;  3AZN B;  1M19 C;  4WU9 D;  3NQU B;  3LEL D;  3C1B A;  5CPK A;  1P3B C;  4KGC D;  3REI B;  3AZI D;  5B33 C;  3VH5 T;  4DRB A;  5B24 D;  3X1S B;  4LD9 B;  2F8N H;  5BNV B;  3MGS A;  1A7W A;  1P3M D;  3VH6 T;  3UTA C;  2NQB C;  1M18 B;  4R8P D;  3UTB A;  5DNN D;  5CPI A;  5JRG D;  2PYO A;  3LEL B;  4KGC B;  3AZI B;  4JJN D;  5DNM D;  4YS3 A;  3AZE A;  5AVB A;  5AY8 C;  1TZY B;  4UUZ B;  4Z2M H;  5B24 B;  3KXB C;  5AV9 A;  4NE5 A;  1BH9 A;  5B1L A;  3AZF C;  4H9O B;  3LZ0 D;  2CV5 C;  3AV2 C;  1M1A A;  2FJ7 B;  4M6B A;  5GXQ D;  3AZM D;  3W98 C;  3REK C;  2ARO D;  1AOI A;  4XUJ A;  4R8P B;  1P3I D;  5DNN B;  5B2J D;  4HGA B;  5G49 B;  5JRG B;  1M19 D;  3C1B C;  5CPK C;  2YFW A;  5AV6 B;  3AZG C;  1P3B D;  4JJN B;  5F99 C;  4KHA B;  5DNM B;  4H9Q B;  5B33 D;  5C3I C;  1B6W A;  1KX4 A;  3MGS C;  5GT3 A;  3TU4 D;  2NZD B;  5GXQ B;  4WU9 A;  3UTA D;  4X23 B;  4KGC A;  2ARO B;  3O62 B;  3AZI A;  1P3I B;  5CPI C;  5B2J B;  1HTA A;  1M19 B;  4H9N A;  1P3B B;  5AVC C;  4YS3 C;  3LZ1 D;  5B33 B;  3AZE C;  5AVB C;  4J8V D;  4Z5T C;  1P3M A;  5AV9 C;  3KXB D;  3AN2 A;  1P3L C;  4R8P A;  4EO5 C;  5DNN A;  5B2I D;  5JA4 B;  1M1A C;  3AV2 D;  1EQZ C;  3REJ C;  5JRG A;  3UTA B;  3W98 D;  1AOI C;  3REK D;  4XUJ C;  5DNM A;  4H9Q A;  3W99 C;  3C1B D;  3AZG D;  5F99 D;  3LZ0 A;  4QLC C;  5AY8 B;  5BO0 A;  3AZM A;  3KXB B;  4WNN A;  4G91 C;  1KX4 C;  5B2J A;  3MGS D;  5GT3 C;  3AV2 B;  2CV5 B;  3A6N A;  1P34 A;  4WU9 C;  5B0Y C;  3W98 B;  3REK B;  4H9P B;  3AZH C;  3REH A;  3C1B B;  4J8W C;  3AZG B;  5CPK B;  5AVC D;  5F99 B;  4YS3 D;  5JA4 A;  5AVB D;  3TU4 A;  3VH5 W;  1P3A D;  1P3M C;  4Z5T D;  5AV9 D;  3AN2 C;  5C3I B;  1P3L D;  3MGS B;  5KDM A;  5JRG C;  1EQZ D;  3REJ D;  1AOI D;  4XUJ D;  5DNM C;  3LZ1 A;  5CPI B;  3W99 D;  4J8V A;  5B0Z A;  4J8U C;  5AVC B;  3LZ0 C;  3KWQ A;  4YS3 B;  4QLC D;  5B2I A;  1JFI A;  3AZE B;  5AVB B;  3AZM C;  4Z5T B;  2HIO A;  5GSU A;  5AV9 B;  1BH9 B;  3W98 A;  1R4V A;  3REK A;  1P3L B;  1KX4 D;  3LJA D;  4EO5 B;  1M1A B;  5GT3 D;  1P3K A;  3A6N C;  1P3P A;  3REJ B;  4XZQ A;  1P34 C;  1EQZ B;  5B0Y D;  1AOI B;  3AZG A;  4E45 A;  4XUJ B;  5F99 A;  3WTP A;  3W99 B;  3C1C D;  3AZH D;  3X1U C;  2YFW B;  4J8W D;  3AFA A;  2YFV A;  4QLC B;  3TU4 C;  4H9R A;  3REL A;  5BS7 A;  2F8N D;  4G91 B;  2HUE B;  3AN2 D;  1KX4 B;  5B1M C;  3NQJ A;  5GT3 B;  5CP6 D;  4WU9 B;  5B0Y B;  3B0C T;  5AVC A;  1HQ3 A;  3LZ1 C;  5B31 A;  4J8V C;  3AZH B;  3X1V D;  1BH8 B;  5B0Z C;  1P3A A;  4Z5T A;  3MGQ D;  4J8U D;  4J8W B;  4H9N B;  4ZUX C;  3KWQ C;  1P3L A;  5B2I C;  1ULY A;  1N1J A;  5BT1 C;  5GSU C;  2HIO C;  3REJ A;  1P3M B;  1EQZ A;  2F8N B;  3AN2 B;  5B32 A;  1P3G A;  3W99 A;  1P3K C;  5CP6 B;  5GT0 D;  1P3P C;  4XZQ C;  3A6N D;  1P34 D;  4QLC A;  3WTP C;  3X1V B;  3X1U D;  3MNN D;  4J8U B;  3AFA C;  3LZ0 B;  5B40 D;  3LJA A;  1S32 D;  1Q9C A;  5FUG A;  4G92 C;  5BO0 B;  5BS7 C;  3REL C;  3AZM B;  1F66 A;  1WWS A;  4WNN B;  5B0Y A;  3W96 C;  4YM6 D;  5B1M D;  3C1C A;  3AZH A;  1BH8 A;  3A6N B;  1KU5 A;  2IO5 C;  1P34 B;  3B0B A;  1P3O D;  4J8W A;  1HQ3 C;  4CSR B;  5B31 C;  3V9R A;  3X1U B;  1P3A C;  5B0Z D;  2F8N G;  1B67 A;  3MVD C;  2F8N A;  4ZUX D;  3KWQ D;  2BYK A;  5CP6 A;  3TU4 B;  1ZLA C;  3WTP E;  5BT1 D;  5GSU D;  2HIO D;  4YM6 B;  5B1M B;  5B32 C;  1P3G C;  3WAA A;  3X1V A;  1P3K D;  5KDM B;  1P3P D;  4XZQ D;  3MGQ A;  4J8U A;  1P3O B;  4ZBJ C;  2L5A A;  4Z2M G;  3WA9 A;  3LZ1 B;  3WTP D;  4J8V B;  5B0Z B;  2HUE C;  4ZUX B;  3AFA D;  3KWQ B;  3LJA C;  5B2I B;  1JFI B;  3AYW A;  1ID3 C;  5GT0 A;  3KSY A;  5GSU B;  2HIO B;  3REL D;  1F66 C;  5CPJ D;  3W96 D;  4CSR A;  1U35 A;  3C1C C;  1P3K B;  3X1U A;  1P3P B;  3MNN A;  4XZQ B;  3MGP C;  1HQ3 D;  1S32 A;  5B40 A;  1WWI A;  3WTP B;  5B31 D;  1KX5 A;  3MVD D;  3VH5 A;  3AFA B;  2YFV B;  4YM6 A;  5B1M A;  4Z66 A;  3X1T A;  2BYM A;  5CP6 C;  4H9R B;  1ZLA D;  4G92 B;  3REL B;  1P3O A;  4KUD A;  3VH6 W;  3W96 B;  3NQJ B;  5B32 D;  3WAA C;  1P3G D;  3VH6 A;  3X1V C;  4WU8 A;  3MGQ C;  2IO5 B;  4AWL C;  3KUY C;  1H3O A;  4ZUX A;  1HQ3 B;  3WA9 C;  5B31 B;  1P3A B;  3MVD B;  4NFT A;  3AYW C;  5GT0 C;  1ID3 D;  1N1J B;  3AZN D;  1ZLA B;  1F66 D;  4E44 A;  5B32 B;  1P3G B;  1U35 C;  3REI D;  3MNN C;  5AV5 C;  4ZBJ B;  3MGP D;  3MGR C;  5B40 C;  1S32 C;  1KX5 C;  5CPJ A;  3W96 A;  3B6G A;  4YM6 C;  3LJA B;  4Z66 C;  1M18 D;  2JSS A;  3X1T C;  1ID3 B;  5FUG B;  1F66 B;  3AZL C;  1P3O C;  3AZJ D;  4KUD C;  5AV8 A;  5B31 G;  3WAA D;  3C1C B;  4WU8 C;  3R45 A;  3MVD A;  1TZY D;  3KUY D;  3W97 C;  4WZS B;  3MGP B;  1P3F A;  3WA9 D;  1KX3 A;  4J8X C;  3UT9 A;  3V9R B;  1ZLA A;  2FJ7 D;  5B32 G;  2BYK B;  3AYW D;  2RVQ C;  4CAY A;  3AZJ B;  5AV6 D;  3REH C;  5BNX B;  1U35 D;  3WAA B;  5E5A A;  3MGQ B;  2LY8 A;  5AV5 D;  3KUY B;  4AWL B;  3B6F A;  3WA9 B;  3AZK A;  3MGR D;  3AV1 D;  3WKJ A;  1ID3 A;  1KX5 D;  3AZN A;  5CPJ C;  3B6G C;  2NZD D;  4DRA A;  4X23 D;  3NQU A;  4Z66 D;  3AYW B;  3X1T D;  5GT0 B;  3O62 D;  3REI A;  3AZL D;  4H9S A;  5CHL B;  5AV8 C;  4KUD D;  3MGP A;  3X1S A;  1U35 B;  4LD9 A;  4WU8 D;  5BNV A;  3MNN B;  5AV5 B;  2CWE A;  1P3F C;  3W97 D;  1S32 B;  5B40 B;  3MGR B;  3AV1 B;  1M18 A;  1KX3 C;  3B0D C;  3UT9 C;  4J8X D;  1KX5 B;  3AZJ A;  2NQB D;  3LEL A;  4Z66 B;  5BNX A;  3X1T B;  2BYM B;  3UTB C;  2RVQ D;  3AZL B;  1TZY A;  4UUZ A;  3KUY A;  4KUD B;  5B24 A;  2PYO C;  3REH D;  4H9O A;  4WU8 B;  5E5A C;  2FJ7 A;  5AY8 D;  3B6F C;  1H3O B;  5B1L C;  3W97 B;  3AZK C;  3WKJ C;  4J8X B;  3AZF D;  3AZN C;  2CV5 D;  5G49 A;  3B6G D;  2NQB B;  5AV6 A;  4JJN A;  3REI C;  4KHA A;  5AV5 A;  4H9S C;  5AV8 D;  3MGR A;  3AV1 A;  5CPK D;  3X1S C;  3REH B;  4LD9 C;  2NZD A;  5GXQ A;  1P3F D;  4X23 A;  1M18 C;  1KX3 D;  2ARO A;  3AZF B;  3O62 A;  3UT9 D;  1P3I A;  3AZL A;  3AZJ C;  5CPJ B;  3B6G B;  1F1E A;  1M19 A;  3LEL C;  4KGC C;  1P3B A;  3AZI C;  3UTB D;  1TAF B;  5CPI D;  5B33 A;  1TZY C;  5B24 C;  5AV8 B;  3W97 A;  2PYO D;  3B0C W;  4J8X A;  4WV4 B;  3R45 B;  2FJ7 C;  5E5A D;  1BFM A;  3AZE D;  4NE6 A;  3B6F D;  1P3F B;  3UTA A;  5B1L D;  2NQB A;  3AZK D;  1KX3 B;  3WKJ D;  2F8N K;  3B0D B;  3UT9 B;  4R8P C;  5DNN C;  4HGA C;  1M1A D;  4NE3 A;  5AV6 C;  4JJN C; 
#chains in the Genus database with same CATH topology
 3UTB B;  4CAY B;  5AY8 A;  2XD1 A;  3KXB A;  2PYO B;  3AV1 C;  3AZF A;  2UWX A;  3X1S D;  4LD9 D;  5E5A B;  2CV5 A;  3AV2 A;  2NZD C;  5GXQ C;  3B6F B;  5B1L B;  4X23 C;  3AZK B;  2ARO C;  3WKJ B;  4H9P A;  3O62 C;  1P3I C;  5B2J C;  1TAF A;  3AZN B;  2F2A C;  1M19 C;  4WU9 D;  3NQU B;  3LEL D;  3C1B A;  5CPK A;  1P3B C;  4KGC D;  3REI B;  3AZI D;  5B33 C;  3VH5 T;  4DRB A;  5B24 D;  1PZR A;  3X1S B;  4LD9 B;  2F8N H;  5BNV B;  3MGS A;  1A7W A;  1P3M D;  3VH6 T;  3UTA C;  2NQB C;  1M18 B;  4R8P D;  3UTB A;  5DNN D;  5CPI A;  5JRG D;  2PYO A;  3P5J B;  3LEL B;  4KGC B;  3AZI B;  4JJN D;  5DNM D;  4YS3 A;  3AZE A;  5AVB A;  5AY8 C;  1TZY B;  4UUZ B;  4Z2M H;  5B24 B;  3KXB C;  5AV9 A;  4NE5 A;  1BH9 A;  5B1L A;  3AZF C;  4H9O B;  3LZ0 D;  2CV5 C;  3AV2 C;  1M1A A;  2FJ7 B;  4M6B A;  2ZY3 A;  5GXQ D;  3AZM D;  3W98 C;  3REK C;  2ARO D;  1AOI A;  4XUJ A;  4R8P B;  1P3I D;  5DNN B;  5B2J D;  4HGA B;  5G49 B;  5JRG B;  1M19 D;  3C1B C;  5CPK C;  2YFW A;  5AV6 B;  3AZG C;  1P3B D;  4JJN B;  5F99 C;  4KHA B;  5DNM B;  4H9Q B;  5B33 D;  5C3I C;  1B6W A;  1KX4 A;  3MGS C;  5GT3 A;  3TU4 D;  2NZD B;  5GXQ B;  4WU9 A;  3UTA D;  4X23 B;  4KGC A;  2ARO B;  3O62 B;  3AZI A;  1P3I B;  5CPI C;  5B2J B;  1HTA A;  1M19 B;  4H9N A;  1P3B B;  5AVC C;  2JE5 A;  4YS3 C;  3LZ1 D;  5B33 B;  3AZE C;  5AVB C;  4J8V D;  4Z5T C;  1P3M A;  5AV9 C;  3KXB D;  3AN2 A;  1P3L C;  4R8P A;  4EO5 C;  5DNN A;  5B2I D;  5JA4 B;  1M1A C;  3AV2 D;  1EQZ C;  3REJ C;  5JRG A;  3UTA B;  3W98 D;  1AOI C;  3REK D;  4XUJ C;  5DNM A;  4H9Q A;  3W99 C;  3C1B D;  3AZG D;  5F99 D;  3LZ0 A;  4QLC C;  5AY8 B;  5BO0 A;  3AZM A;  3KXB B;  4WNN A;  4G91 C;  1KX4 C;  5B2J A;  3MGS D;  5GT3 C;  3AV2 B;  2CV5 B;  3EPJ A;  3A6N A;  1P34 A;  4WU9 C;  5B0Y C;  3W98 B;  3REK B;  4H9P B;  3AZH C;  3REH A;  3C1B B;  4J8W C;  3AZG B;  5CPK B;  2DF4 C;  5AVC D;  5F99 B;  4YS3 D;  5JA4 A;  5AVB D;  3TU4 A;  3VH5 W;  1P3A D;  1P3M C;  4Z5T D;  5AV9 D;  3AN2 C;  5C3I B;  3FDD A;  1P3L D;  3MGS B;  5KDM A;  5JRG C;  1EQZ D;  3REJ D;  1AOI D;  4XUJ D;  5DNM C;  3LZ1 A;  5CPI B;  3W99 D;  4J8V A;  3AL0 C;  5B0Z A;  4J8U C;  5AVC B;  3LZ0 C;  3KWQ A;  4YS3 B;  4QLC D;  5B2I A;  1JFI A;  3AZE B;  5AVB B;  4DQY B;  3AZM C;  4Z5T B;  2HIO A;  5GSU A;  5AV9 B;  1BH9 B;  3W98 A;  1R4V A;  3REK A;  1P3L B;  3IP4 C;  3LJA D;  4EO5 B;  1KX4 D;  1M1A B;  5GT3 D;  1P3K A;  2Y2N A;  3A6N C;  1P3P A;  3REJ B;  4XZQ A;  1P34 C;  1EQZ B;  5B0Y D;  1AOI B;  3AZG A;  4E45 A;  4XUJ B;  2Y2O A;  5F99 A;  2Y2H A;  3WTP A;  3W99 B;  3C1C D;  3AZH D;  3X1U C;  2YFW B;  4J8W D;  3AFA A;  2YFV A;  4QLC B;  3TU4 C;  4H9R A;  3REL A;  5BS7 A;  2F8N D;  4G91 B;  2HUE B;  3AN2 D;  1KX4 B;  5B1M C;  3H0M C;  3NQJ A;  5GT3 B;  5CP6 D;  4WU9 B;  5B0Y B;  3B0C T;  5AVC A;  1HQ3 A;  3LZ1 C;  2FFF B;  5B31 A;  4J8V C;  3AZH B;  3X1V D;  1BH8 B;  5B0Z C;  1P3A A;  4Z5T A;  3MGQ D;  4J8U D;  4J8W B;  4H9N B;  4ZUX C;  2JCH A;  3F6T A;  3KWQ C;  1P3L A;  5B2I C;  2Y2J A;  1ULY A;  1N1J A;  5BT1 C;  5GSU C;  2HIO C;  3REJ A;  1P3M B;  1EQZ A;  2F8N B;  3AN2 B;  5B32 A;  1P3G A;  3W99 A;  1P3K C;  5CP6 B;  5GT0 D;  1P3P C;  4XZQ C;  3A6N D;  1P34 D;  3EG5 B;  4QLC A;  3WTP C;  4WJ3 C;  3X1V B;  2Y2K A;  3X1U D;  3MNN D;  4J8U B;  3AFA C;  3LZ0 B;  5B40 D;  3LJA A;  1S32 D;  1W2E A;  1Q9C A;  5FUG A;  4G92 C;  5BO0 B;  5BS7 C;  3REL C;  3AZM B;  1F66 A;  1WWS A;  4WNN B;  5B0Y A;  3W96 C;  4YM6 D;  3H0R C;  5B1M D;  3C1C A;  3AZH A;  2ZY5 A;  1BH8 A;  3A6N B;  1KU5 A;  2IO5 C;  1P34 B;  3B0B A;  1P3O D;  2ZM5 A;  4J8W A;  1HQ3 C;  4CSR B;  5B31 C;  3V9R A;  3X1U B;  1P3A C;  5B0Z D;  2F8N G;  1B67 A;  3MVD C;  2F8N A;  4ZUX D;  3KWQ D;  2BYK A;  5CP6 A;  3TU4 B;  1ZLA C;  3WTP E;  5BT1 D;  5GSU D;  2HIO D;  4YM6 B;  5B1M B;  5B32 C;  1P3G C;  3WAA A;  3X1V A;  1P3K D;  2G5I C;  5KDM B;  1P3P D;  4XZQ D;  3MGQ A;  4J8U A;  1P3O B;  4ZBJ C;  2L5A A;  4Z2M G;  3WA9 A;  2G5H C;  3LZ1 B;  3WTP D;  4J8V B;  5B0Z B;  2HUE C;  4ZUX B;  3AFA D;  3KWQ B;  3LJA C;  5B2I B;  1JFI B;  3AYW A;  1ID3 C;  5GT0 A;  3KSY A;  5GSU B;  2HIO B;  3REL D;  1F66 C;  2Y2Q A;  5CPJ D;  3W96 D;  4CSR A;  1U35 A;  3A1I A;  3C1C C;  1P3K B;  2VQR A;  3X1U A;  1P3P B;  3MNN A;  4XZQ B;  3MGP C;  1HQ3 D;  2ZY4 A;  5B40 A;  1S32 A;  1WWI A;  3WTP B;  5B31 D;  1KX5 A;  2Y2G A;  3MVD D;  3KFU G;  3VH5 A;  3AFA B;  2YFV B;  4YM6 A;  5B1M A;  4Z66 A;  3X1T A;  2BYM A;  5CP6 C;  4H9R B;  1ZLA D;  4G92 B;  3REL B;  1P3O A;  4KUD A;  3VH6 W;  3W96 B;  3NQJ B;  5B32 D;  3WAA C;  1P3G D;  3VH6 A;  3X1V C;  4WU8 A;  3MGQ C;  2IO5 B;  4AWL C;  3KUY C;  1H3O A;  4ZUX A;  1HQ3 B;  3WA9 C;  5B31 B;  1P3A B;  3MVD B;  4NFT A;  3EPH A;  3AYW C;  5GT0 C;  1ID3 D;  1N1J B;  3AZN D;  1ZLA B;  1F66 D;  4E44 A;  5B32 B;  1P3G B;  1U35 C;  3REI D;  3MNN C;  5AV5 C;  4ZBJ B;  3MGP D;  3MGR C;  5B40 C;  1S32 C;  1KX5 C;  2BG1 A;  5CPJ A;  3W96 A;  3B6G A;  4YM6 C;  3LJA B;  4Z66 C;  1M18 D;  2JSS A;  3X1T C;  1ID3 B;  5FUG B;  1F66 B;  3AZL C;  1P3O C;  3AZJ D;  4KUD C;  5AV8 A;  5B31 G;  3WAA D;  3C1C B;  1T3U A;  4WU8 C;  3R45 A;  3MVD A;  1TZY D;  3KUY D;  3W97 C;  4WZS B;  3MGP B;  1P3F A;  3WA9 D;  1KX3 A;  4J8X C;  3UT9 A;  3V9R B;  1ZLA A;  2FJ7 D;  5B32 G;  2BYK B;  3AYW D;  2RVQ C;  4CAY A;  3AZJ B;  2Y2M A;  5AV6 D;  3REH C;  5BNX B;  1U35 D;  3WAA B;  5E5A A;  3MGQ B;  2LY8 A;  2Y2L A;  5AV5 D;  3KUY B;  4AWL B;  3B6F A;  3WA9 B;  3AZK A;  3MGR D;  3AV1 D;  3WKJ A;  1ID3 A;  1KX5 D;  3AZN A;  5CPJ C;  3B6G C;  2NZD D;  2ZY2 A;  2W8S A;  4DRA A;  4X23 D;  3NQU A;  4Z66 D;  3AYW B;  3X1T D;  5GT0 B;  3O62 D;  3REI A;  3AZL D;  4H9S A;  5CHL B;  5AV8 C;  4KUD D;  3MGP A;  3X1S A;  1U35 B;  4LD9 A;  4WU8 D;  5BNV A;  3MNN B;  5AV5 B;  2CWE A;  1P3F C;  3W97 D;  1S32 B;  5B40 B;  3MGR B;  3AV1 B;  1M18 A;  1KX3 C;  3B0D C;  3UT9 C;  4J8X D;  1KX5 B;  3AZJ A;  2Y2I A;  2NQB D;  3LEL A;  4Z66 B;  5BNX A;  3X1T B;  2BYM B;  3UTB C;  2RVQ D;  3AZL B;  1TZY A;  4UUZ A;  3KUY A;  4KUD B;  5B24 A;  2J8P A;  3A1K A;  2PYO C;  3REH D;  4H9O A;  4WU8 B;  5E5A C;  2FJ7 A;  5AY8 D;  3B6F C;  1H3O B;  5B1L C;  3W97 B;  3AZK C;  3WKJ C;  4J8X B;  3AZF D;  3AZN C;  3H0L C;  3EPK A;  2CV5 D;  5G49 A;  3B6G D;  2NQB B;  5AV6 A;  4JJN A;  3REI C;  4KHA A;  2Y2P A;  5AV5 A;  4H9S C;  5AV8 D;  3MGR A;  3AV1 A;  2DQN C;  3X1S C;  3REH B;  5CPK D;  4LD9 C;  2XD5 A;  2NZD A;  1Z2C B;  5GXQ A;  1P3F D;  4X23 A;  1M18 C;  1KX3 D;  2ARO A;  3EPL A;  3AZF B;  3O62 A;  3UT9 D;  1P3I A;  3AZL A;  3AZJ C;  5CPJ B;  3B6G B;  1F1E A;  1M19 A;  3LEL C;  4KGC C;  1P3B A;  3AZI C;  3UTB D;  1TAF B;  5CPI D;  5B33 A;  1TZY C;  5B24 C;  5AV8 B;  3W97 A;  2PYO D;  3B0C W;  4J8X A;  4WV4 B;  3R45 B;  2FJ7 C;  5E5A D;  1BFM A;  3AZE D;  4NE6 A;  3B6F D;  1P3F B;  3UTA A;  5B1L D;  2NQB A;  3AZK D;  1KX3 B;  4UPK A;  3WKJ D;  2F8N K;  3B0D B;  3UT9 B;  4R8P C;  5DNN C;  4HGA C;  1M1A D;  2RIQ A;  4NE3 A;  5AV6 C;  4JJN C; 
#chains in the Genus database with same CATH homology
 3UTB B;  4CAY B;  5AY8 A;  2XD1 A;  3KXB A;  2PYO B;  3AV1 C;  3AZF A;  2UWX A;  3X1S D;  4LD9 D;  5E5A B;  2CV5 A;  3AV2 A;  2NZD C;  5GXQ C;  3B6F B;  5B1L B;  4X23 C;  3AZK B;  2ARO C;  3WKJ B;  4H9P A;  3O62 C;  1P3I C;  5B2J C;  1TAF A;  3AZN B;  2F2A C;  1M19 C;  4WU9 D;  3NQU B;  3LEL D;  3C1B A;  5CPK A;  1P3B C;  4KGC D;  3REI B;  3AZI D;  5B33 C;  3VH5 T;  4DRB A;  5B24 D;  1PZR A;  3X1S B;  4LD9 B;  2F8N H;  5BNV B;  3MGS A;  1A7W A;  1P3M D;  3VH6 T;  3UTA C;  2NQB C;  1M18 B;  4R8P D;  3UTB A;  5DNN D;  5CPI A;  5JRG D;  2PYO A;  3P5J B;  3LEL B;  4KGC B;  3AZI B;  4JJN D;  5DNM D;  4YS3 A;  3AZE A;  5AVB A;  5AY8 C;  1TZY B;  4UUZ B;  4Z2M H;  5B24 B;  3KXB C;  5AV9 A;  4NE5 A;  1BH9 A;  5B1L A;  3AZF C;  4H9O B;  3LZ0 D;  2CV5 C;  3AV2 C;  1M1A A;  2FJ7 B;  4M6B A;  2ZY3 A;  5GXQ D;  3AZM D;  3W98 C;  3REK C;  2ARO D;  1AOI A;  4XUJ A;  4R8P B;  1P3I D;  5DNN B;  5B2J D;  4HGA B;  5G49 B;  5JRG B;  1M19 D;  3C1B C;  5CPK C;  2YFW A;  5AV6 B;  3AZG C;  1P3B D;  4JJN B;  5F99 C;  4KHA B;  5DNM B;  4H9Q B;  5B33 D;  5C3I C;  1B6W A;  1KX4 A;  3MGS C;  5GT3 A;  3TU4 D;  2NZD B;  5GXQ B;  4WU9 A;  3UTA D;  4X23 B;  4KGC A;  2ARO B;  3O62 B;  3AZI A;  1P3I B;  5CPI C;  5B2J B;  1HTA A;  1M19 B;  4H9N A;  1P3B B;  5AVC C;  2JE5 A;  4YS3 C;  3LZ1 D;  5B33 B;  3AZE C;  5AVB C;  4J8V D;  4Z5T C;  1P3M A;  5AV9 C;  3KXB D;  3AN2 A;  1P3L C;  4R8P A;  4EO5 C;  5DNN A;  5B2I D;  5JA4 B;  1M1A C;  3AV2 D;  1EQZ C;  3REJ C;  5JRG A;  3UTA B;  3W98 D;  1AOI C;  3REK D;  4XUJ C;  5DNM A;  4H9Q A;  3W99 C;  3C1B D;  3AZG D;  5F99 D;  3LZ0 A;  4QLC C;  5AY8 B;  5BO0 A;  3AZM A;  3KXB B;  4WNN A;  4G91 C;  1KX4 C;  5B2J A;  3MGS D;  5GT3 C;  3AV2 B;  2CV5 B;  3EPJ A;  3A6N A;  1P34 A;  4WU9 C;  5B0Y C;  3W98 B;  3REK B;  4H9P B;  3AZH C;  3REH A;  3C1B B;  4J8W C;  3AZG B;  5CPK B;  2DF4 C;  5AVC D;  5F99 B;  4YS3 D;  5JA4 A;  5AVB D;  3TU4 A;  3VH5 W;  1P3A D;  1P3M C;  4Z5T D;  5AV9 D;  3AN2 C;  5C3I B;  3FDD A;  1P3L D;  3MGS B;  5KDM A;  5JRG C;  1EQZ D;  3REJ D;  1AOI D;  4XUJ D;  5DNM C;  3LZ1 A;  5CPI B;  3W99 D;  4J8V A;  3AL0 C;  5B0Z A;  4J8U C;  5AVC B;  3LZ0 C;  3KWQ A;  4YS3 B;  4QLC D;  5B2I A;  1JFI A;  3AZE B;  5AVB B;  4DQY B;  3AZM C;  4Z5T B;  2HIO A;  5GSU A;  5AV9 B;  1BH9 B;  3W98 A;  1R4V A;  3REK A;  1P3L B;  3IP4 C;  3LJA D;  4EO5 B;  1KX4 D;  1M1A B;  5GT3 D;  1P3K A;  2Y2N A;  3A6N C;  1P3P A;  3REJ B;  4XZQ A;  1P34 C;  1EQZ B;  5B0Y D;  1AOI B;  3AZG A;  4E45 A;  4XUJ B;  2Y2O A;  5F99 A;  2Y2H A;  3WTP A;  3W99 B;  3C1C D;  3AZH D;  3X1U C;  2YFW B;  4J8W D;  3AFA A;  2YFV A;  4QLC B;  3TU4 C;  4H9R A;  3REL A;  5BS7 A;  2F8N D;  4G91 B;  2HUE B;  3AN2 D;  1KX4 B;  5B1M C;  3H0M C;  3NQJ A;  5GT3 B;  5CP6 D;  4WU9 B;  5B0Y B;  3B0C T;  5AVC A;  1HQ3 A;  3LZ1 C;  2FFF B;  5B31 A;  4J8V C;  3AZH B;  3X1V D;  1BH8 B;  5B0Z C;  1P3A A;  4Z5T A;  3MGQ D;  4J8U D;  4J8W B;  4H9N B;  4ZUX C;  2JCH A;  3F6T A;  3KWQ C;  1P3L A;  5B2I C;  2Y2J A;  1ULY A;  1N1J A;  5BT1 C;  5GSU C;  2HIO C;  3REJ A;  1P3M B;  1EQZ A;  2F8N B;  3AN2 B;  5B32 A;  1P3G A;  3W99 A;  1P3K C;  5CP6 B;  5GT0 D;  1P3P C;  4XZQ C;  3A6N D;  1P34 D;  3EG5 B;  4QLC A;  3WTP C;  4WJ3 C;  3X1V B;  2Y2K A;  3X1U D;  3MNN D;  4J8U B;  3AFA C;  3LZ0 B;  5B40 D;  3LJA A;  1S32 D;  1W2E A;  1Q9C A;  5FUG A;  4G92 C;  5BO0 B;  5BS7 C;  3REL C;  3AZM B;  1F66 A;  1WWS A;  4WNN B;  5B0Y A;  3W96 C;  4YM6 D;  3H0R C;  5B1M D;  3C1C A;  3AZH A;  2ZY5 A;  1BH8 A;  3A6N B;  1KU5 A;  2IO5 C;  1P34 B;  3B0B A;  1P3O D;  2ZM5 A;  4J8W A;  1HQ3 C;  4CSR B;  5B31 C;  3V9R A;  3X1U B;  1P3A C;  5B0Z D;  2F8N G;  1B67 A;  3MVD C;  2F8N A;  4ZUX D;  3KWQ D;  2BYK A;  5CP6 A;  3TU4 B;  1ZLA C;  3WTP E;  5BT1 D;  5GSU D;  2HIO D;  4YM6 B;  5B1M B;  5B32 C;  1P3G C;  3WAA A;  3X1V A;  1P3K D;  2G5I C;  5KDM B;  1P3P D;  4XZQ D;  3MGQ A;  4J8U A;  1P3O B;  4ZBJ C;  2L5A A;  4Z2M G;  3WA9 A;  2G5H C;  3LZ1 B;  3WTP D;  4J8V B;  5B0Z B;  2HUE C;  4ZUX B;  3AFA D;  3KWQ B;  3LJA C;  5B2I B;  1JFI B;  3AYW A;  1ID3 C;  5GT0 A;  3KSY A;  5GSU B;  2HIO B;  3REL D;  1F66 C;  2Y2Q A;  5CPJ D;  3W96 D;  4CSR A;  1U35 A;  3A1I A;  3C1C C;  1P3K B;  2VQR A;  3X1U A;  1P3P B;  3MNN A;  4XZQ B;  3MGP C;  1HQ3 D;  2ZY4 A;  5B40 A;  1S32 A;  1WWI A;  3WTP B;  5B31 D;  1KX5 A;  2Y2G A;  3MVD D;  3KFU G;  3VH5 A;  3AFA B;  2YFV B;  4YM6 A;  5B1M A;  4Z66 A;  3X1T A;  2BYM A;  5CP6 C;  4H9R B;  1ZLA D;  4G92 B;  3REL B;  1P3O A;  4KUD A;  3VH6 W;  3W96 B;  3NQJ B;  5B32 D;  3WAA C;  1P3G D;  3VH6 A;  3X1V C;  4WU8 A;  3MGQ C;  2IO5 B;  4AWL C;  3KUY C;  1H3O A;  4ZUX A;  1HQ3 B;  3WA9 C;  5B31 B;  1P3A B;  3MVD B;  4NFT A;  3EPH A;  3AYW C;  5GT0 C;  1ID3 D;  1N1J B;  3AZN D;  1ZLA B;  1F66 D;  4E44 A;  5B32 B;  1P3G B;  1U35 C;  3REI D;  3MNN C;  5AV5 C;  4ZBJ B;  3MGP D;  3MGR C;  5B40 C;  1S32 C;  1KX5 C;  2BG1 A;  5CPJ A;  3W96 A;  3B6G A;  4YM6 C;  3LJA B;  4Z66 C;  1M18 D;  2JSS A;  3X1T C;  1ID3 B;  5FUG B;  1F66 B;  3AZL C;  1P3O C;  3AZJ D;  4KUD C;  5AV8 A;  5B31 G;  3WAA D;  3C1C B;  1T3U A;  4WU8 C;  3R45 A;  3MVD A;  1TZY D;  3KUY D;  3W97 C;  4WZS B;  3MGP B;  1P3F A;  3WA9 D;  1KX3 A;  4J8X C;  3UT9 A;  3V9R B;  1ZLA A;  2FJ7 D;  5B32 G;  2BYK B;  3AYW D;  2RVQ C;  4CAY A;  3AZJ B;  2Y2M A;  5AV6 D;  3REH C;  5BNX B;  1U35 D;  3WAA B;  5E5A A;  3MGQ B;  2LY8 A;  2Y2L A;  5AV5 D;  3KUY B;  4AWL B;  3B6F A;  3WA9 B;  3AZK A;  3MGR D;  3AV1 D;  3WKJ A;  1ID3 A;  1KX5 D;  3AZN A;  5CPJ C;  3B6G C;  2NZD D;  2ZY2 A;  2W8S A;  4DRA A;  4X23 D;  3NQU A;  4Z66 D;  3AYW B;  3X1T D;  5GT0 B;  3O62 D;  3REI A;  3AZL D;  4H9S A;  5CHL B;  5AV8 C;  4KUD D;  3MGP A;  3X1S A;  1U35 B;  4LD9 A;  4WU8 D;  5BNV A;  3MNN B;  5AV5 B;  2CWE A;  1P3F C;  3W97 D;  1S32 B;  5B40 B;  3MGR B;  3AV1 B;  1M18 A;  1KX3 C;  3B0D C;  3UT9 C;  4J8X D;  1KX5 B;  3AZJ A;  2Y2I A;  2NQB D;  3LEL A;  4Z66 B;  5BNX A;  3X1T B;  2BYM B;  3UTB C;  2RVQ D;  3AZL B;  1TZY A;  4UUZ A;  3KUY A;  4KUD B;  5B24 A;  2J8P A;  3A1K A;  2PYO C;  3REH D;  4H9O A;  4WU8 B;  5E5A C;  2FJ7 A;  5AY8 D;  3B6F C;  1H3O B;  5B1L C;  3W97 B;  3AZK C;  3WKJ C;  4J8X B;  3AZF D;  3AZN C;  3H0L C;  3EPK A;  2CV5 D;  5G49 A;  3B6G D;  2NQB B;  5AV6 A;  4JJN A;  3REI C;  4KHA A;  2Y2P A;  5AV5 A;  4H9S C;  5AV8 D;  3MGR A;  3AV1 A;  2DQN C;  3X1S C;  3REH B;  5CPK D;  4LD9 C;  2XD5 A;  2NZD A;  1Z2C B;  5GXQ A;  1P3F D;  4X23 A;  1M18 C;  1KX3 D;  2ARO A;  3EPL A;  3AZF B;  3O62 A;  3UT9 D;  1P3I A;  3AZL A;  3AZJ C;  5CPJ B;  3B6G B;  1F1E A;  1M19 A;  3LEL C;  4KGC C;  1P3B A;  3AZI C;  3UTB D;  1TAF B;  5CPI D;  5B33 A;  1TZY C;  5B24 C;  5AV8 B;  3W97 A;  2PYO D;  3B0C W;  4J8X A;  4WV4 B;  3R45 B;  2FJ7 C;  5E5A D;  1BFM A;  3AZE D;  4NE6 A;  3B6F D;  1P3F B;  3UTA A;  5B1L D;  2NQB A;  3AZK D;  1KX3 B;  4UPK A;  3WKJ D;  2F8N K;  3B0D B;  3UT9 B;  4R8P C;  5DNN C;  4HGA C;  1M1A D;  2RIQ A;  4NE3 A;  5AV6 C;  4JJN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...