1P3PC

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3pC00
3AYWD 5G49A 3B0BA 3AZNB 2NZDA 3A6ND 4H9PB 4J8XB 1P3GA 5B40C 3AZMD 5B2IA 1KU5A 5B33C 4X23C 5BS7A 2AROB 3WKJC 4KUDD 4NE5A 2CV5A 3LJAD 1U35D 2F8NB 1TZYD 2YFWB 4XZQB 2HUEB 1KX5A 3UT9A 3MGSA 2PYOA 1BH9B 5BNXB 3MGQC 3W99D 4CSRB 5CPJB 3WKJD 4WU9C 3MNNC 5GSUA 5B1MC 3AN2C 4LD9A 4H9NB 5GXQA 3LELC 1P3MA 4WNNB 4YM6A 4Z66A 3AZEC 5B0ZC 3MGQD 1P3LB 5F99C 4YS3C 3X1VB 3KUYB 3W97B 2L5AA 1H3OB 5AV6A 3AZGA 4J8VC 3AZHB 4G91B 1P3KA 1M19B 5B1MD 3KXBB 1AOIA 3AV1C 3AZLA 4QLCC 5DNMA 2YFVA 1P3IA 1S32B 5B32A 3AZED 2NQBA 5B0ZD 3X1UB 1P3AA 1P34B 5F99D 4J8VD 2BYMA 3X1TD 1KX3C 5AV8B 5FUGB 3REHB 5AVCA 3AV1D 3B6FB 3UT9C 3AZFD 5C3IB 5E5AD 4XUJC 4QLCD 4G92C 5CHLB 5B1LA 2HIOB 1ID3C 4H9SA 5KDMB 3AYWA 5CPKB 3C1BC 3A6NA 3W96C 4KGCC 1KX3D 3AZMA 3RELB 4KUDA 3MGPC 4LD9C 3LJAA 1U35A 1P3OC 1TZYA 4XUJD 1ID3D 4XZQC 1N1JA 5GT0C 3C1BD 5B2JC 3UTBB 1A7WA 3W96D 4KGCD 5CPIB 3TU4B 5B40A 3W99A 3C1CB 1AOIC 3WKJA 3WA9C 4J8XD 1HQ3B 4ZUXB 3UTAB 3MGPD 1TAFA 4J8UC 1P3FB 2AROD 5B32C 5B0YB 4XZQD 1P3AC 5GT0D 4HGAB 5B2JD 4Z5TB 3AZIB 5BO0B 3MGQA 3X1SB 4CAYB 5AVCC 3LZ1B 3WA9D 4NE6A 4J8WC 3WTPB 4J8UD 5B1MA 5CP6B 3WAAB 3AV2C 3O62C 3V9RB 4AWLC 3AYWC 3REIC 1EQZB 4ZBJC 3LZ0B 3AZEA 5B0ZA 3AZMC 5AY8B 1P3BC 5GT3C 5F99A 4YS3A 4H9QB 4J8VA 5AV9B 3X1TA 3LJAC 4J8WD 3AZJB 1F66B 3W97D 5B31C 4JJNB 3AZHD 3AV1A 3AV2D 1M19D 3AZFA 3O62D 1B67A 4R8PC 3B0CW 2NZDB 4QLCA 3REID 1P3GB 5B2IB 3W99C 3NQJA 1P3BD 5GT3D 2CV5B 1KX3A 3X1UD 1P34D 5B32G 3B6GB 1KX5B 5B31D 2PYOB 5AV8D 4R8PD 3REHD 4XUJA 3REKC 1M18C 3B6FD 4E44A 1ID3A 3C1BA 5AV5C 3W96A 4KGCA 4E45A 3B0DB 4NFTA 3REJC 5CPIC 4J8XA 3R45A 3MGPA 1P3PC 5GXQB 1P3MB 2AROA 4Z66B 4YM6B 3REKD 3UTAC 1HQ3C 1P3OA 4WV4B 1M18D 3MVDB 2FJ7B 4XZQA 5AV6B 5GT0A 1P3KB 5AVBC 5AV5D 5B2JA 3KWQB 5B31G 5B24C 3X1TC 2BYKA 1BH9A 3REJD 4Z5TC 3AZLB 2IO5B 5CPID 5DNMB 3AZFC 3WA9A 2YFVB 1P3IB 4J8UA 5E5AC 1P3PD 4CSRA 3B0CT 3UTAD 1HQ3D 2NQBB 4H9RA 5CP6C 1P3FD 1ZLAC 2BYMB 4EO5C 5AVBD 3W98B 5B24D 5B0YD 1ULYA 1M1AC 4Z5TD 5BT1C 5BNVA 5JRGB 4J8WA 1WWSA 5B1LB 1H3OA 3X1SD 3AZHA 1M19A 3AV2A 3O62A 3WTPD 3AZKB 3A6NB 5CP6D 4JJNC 3REIA 1KX4B 4DRBA 5DNNC 1ZLAD 3AZNC 4KUDB 1P3BA 5GT3A 4WU8B 3LZ0D 1M1AD 4J8XC 5BT1D 1HTAA 1TZYB 1P34A 2AROC 3AFAB 3MGRB 5B31A 5AV9D 1N1JB 5AV8A 4R8PA 3REHA 3WTPE 2CWEA 2HUEC 4JJND 3B6FA 5DNND 5B40B 5B33B 4X23B 3WKJB 3AZND 5JA4B 5CPJC 3B6GD 2F8ND 3REKA 1M18A 4WU9B 5AV5A 4UUZB 3MNNB 5B1MB 3NQUA 1P3LC 1JFIB 4H9OA 3X1VC 3KWQC 3KUYC 3REJA 3AN2B 3W97C 5CPJD 3AZHC 1M19C 5CPIA 4G91C 3KSYA 1P3PA 3KXBC 3LELB 3UTAA 1HQ3A 5B0ZB 4YS3B 4YM6D 1S32C 4J8VB 5AVBA 3MVDD 5B24A 5B0YA 3X1UC 1P3KD 2FJ7D 1P34C 3AV1B 1P3LD 3X1VD 3KWQD 3KUYD 4KHAB 4Z5TA 2F8NG 5BO0A 4QLCB 5G49B 5AV8C 5E5AA 3REHC 3KXBD 3X1SA 3B6FC 3WTPA 3NQJB 5C3IC 1F1EA 5CP6A 1BFMA 1S32D 1ZLAA 1KX3B 2HIOC 5CPKC 3UT9B 3LZ0A 1M1AA 3W98D 4XUJB 3MGSB 4G92B 3RELC 1BH8A 2F8NH 5JRGD 3C1BB 3AFAC 3MGRC 4JJNA 3W96B 5DNNA 4WZSB 2HIOD 5GSUB 3AZKD 5CPKD 1KX4D 3AZNA 3R45B 3UTBC 3MGPB 4LD9B 4NE3A 4H9PA 3TU4C 1P3OB 3VH5T 3RELD 3C1CC 4WU8D 4ZUXC 5GT0B 3B6GA 1P3FC 2F8NA 5B2JB 3AFAD 2YFWA 3MGRD 3AZGB 2BYKB 5B0YC 1AOIB 3WA9B 4HGAC 3UTBD 5B40D 4J8UB 3AZIC 5B33D 5BNXA 4X23D 3TU4D 3C1CD 3X1SC 5CPJA 5B32B 3LZ1C 4H9RB 4ZUXD 3WTPC 1P3AB 3WAAC 3AZJA 3VH5A 4H9NA 1EQZC 5AVCB 5BNVB 3LZ0C 4WNNA 4J8WB 3AZID 3MVDA 4M6BA 2FJ7A 5AY8C 3AV2B 1P3LA 4WU9D 3X1VA 3O62B 3KWQA 3KUYA 3W97A 4DRAA 3MNND 4AWLB 5AV9C 3LZ1D 3AYWB 3REIB 4ZBJB 3AZJC 3VH6T 3AN2D 3KXBA 1F66C 3WAAD 3AZMB 1R4VA 1P3BB 5GT3B 2NZDC 3LELD 1EQZD 1S32A 1P3GC 5B2IC 3LJAB 5BS7C 4YS3D 1U35B 3X1UA 5B31B 5AY8D 2CV5C 3W98A 1WWIA 4R8PB 1Q9CA 3B6GC 1KX5C 3AZJD 5FUGA 1F66D 3MGSC 5JRGA 2PYOC 3W99B 2NZDD 1B6WA 1P3GD 3VH6A 1TAFB 2HIOA 5B2ID 3AZKA 5KDMA 5CPKA 1KX4A 2CV5D 5GSUC 2RVQC 3B0DC 3REKB 3RELA 1M18B 1KX5D 4WU8A 3UT9D 3MGSD 3MGQB 5GXQC 2PYOD 5AV5B 1P3MC 4Z66C 4YM6C 3AFAA 3MGRA 3NQUB 4H9OB 3REJB 3MVDC 2FJ7C 4Z2MG 5AV6C 3AZGC 1P3KC 3UTBA 1P3PB 5GSUD 5B33A 4X23A 3TU4A 2RVQD 3VH5W 3AZLC 3C1CA 4LD9D 2IO5C 5DNMC 3AZEB 4ZUXA 1P3OD 1P3IC 2JSSA 5JA4A 5GXQD 5F99B 5AVBB 1P3FA 4Z66D 1P3MD 2NQBC 5B24B 3X1TB 3AZGD 5AV6D 3AZFB 3W98C 3AZIA 5E5AB 4Z2MH 1AOID 4WU9A 4UUZA 3MNNA 3AZLD 4CAYA 3LZ1A 5DNMD 5JRGC 1JFIA 1P3ID 3AN2A 1ZLAB 5B1LC 4EO5B 5B32D 4H9SC 3WAAA 2LY8A 2NQBD 3V9RA 1P3AD 3AZKC 3A6NC 1KX4C 3LELA 1EQZA 1M1AB 1BH8B 5AY8A 4KUDC 5AVCD 4H9QA 4WU8C 1U35C 2F8NK 1ID3B 1TZYC 5AV9A 3VH6W 5DNNB 1F66A 4KHAA 5B1LD 4KGCB
chains in the Genus database with same CATH superfamily
3AYWD 5G49A 3B0BA 3AZNB 2NZDA 2ZY4A 3A6ND 4H9PB 4J8XB 1P3GA 5B40C 3AZMD 5B2IA 1KU5A 5B33C 4X23C 2XD1A 5BS7A 2AROB 3WKJC 4KUDD 4NE5A 2CV5A 3LJAD 1U35D 2F8NB 1TZYD 2YFWB 4XZQB 1W2EA 2HUEB 1KX5A 3UT9A 3MGSA 2PYOA 1BH9B 5BNXB 3MGQC 3W99D 4CSRB 5CPJB 3WKJD 4WU9C 3MNNC 5GSUA 5B1MC 3AN2C 4LD9A 4H9NB 4DQYB 5GXQA 3LELC 1P3MA 4WNNB 4YM6A 4Z66A 3AZEC 5B0ZC 3MGQD 1P3LB 5F99C 4YS3C 3X1VB 3KUYB 3W97B 2L5AA 1H3OB 5AV6A 3AZGA 4J8VC 3AZHB 4G91B 1P3KA 1M19B 5B1MD 3KXBB 1AOIA 3AV1C 2Y2MA 3AZLA 4QLCC 5DNMA 2YFVA 2G5IC 1P3IA 1S32B 3FDDA 5B32A 3KFUG 3AZED 2NQBA 5B0ZD 3X1UB 1P3AA 1P34B 5F99D 4J8VD 2BYMA 3X1TD 1KX3C 5AV8B 5FUGB 3REHB 5AVCA 3AV1D 3B6FB 3UT9C 3AZFD 5C3IB 5E5AD 4XUJC 4QLCD 4G92C 5CHLB 5B1LA 2HIOB 2BG1A 4H9SA 1ID3C 5KDMB 3AYWA 5CPKB 3C1BC 3A6NA 3EPHA 3W96C 4KGCC 1KX3D 3AZMA 3RELB 4KUDA 3MGPC 4LD9C 3LJAA 2Y2PA 1U35A 1P3OC 1TZYA 4XUJD 1ID3D 4XZQC 1N1JA 5GT0C 3C1BD 5B2JC 3UTBB 1A7WA 3W96D 4KGCD 5CPIB 3TU4B 5B40A 3W99A 3C1CB 1AOIC 3WKJA 2F2AC 3WA9C 4J8XD 1HQ3B 4ZUXB 3UTAB 2Y2JA 3MGPD 1TAFA 4J8UC 1P3FB 2AROD 2JCHA 5B32C 5B0YB 4XZQD 1P3AC 5GT0D 3H0RC 4HGAB 5B2JD 4Z5TB 3AZIB 5BO0B 3MGQA 3X1SB 2ZY2A 4CAYB 5AVCC 3LZ1B 2VQRA 3WA9D 4NE6A 4J8WC 3P5JB 3WTPB 4J8UD 5B1MA 5CP6B 3WAAB 3AV2C 3O62C 3V9RB 4AWLC 3AYWC 3REIC 1EQZB 4ZBJC 3LZ0B 3AZEA 5B0ZA 3AZMC 5AY8B 1P3BC 5GT3C 5F99A 4YS3A 4H9QB 4J8VA 5AV9B 3X1TA 3LJAC 4J8WD 3AZJB 1F66B 3W97D 5B31C 4JJNB 3AZHD 3AV1A 3AV2D 1M19D 3AZFA 3O62D 1B67A 4R8PC 3B0CW 2NZDB 4QLCA 3REID 2J8PA 1P3GB 5B2IB 3W99C 3NQJA 1P3BD 5GT3D 2CV5B 1KX3A 3X1UD 1P34D 5B32G 3B6GB 1KX5B 5B31D 3A1KA 2PYOB 5AV8D 4R8PD 3REHD 4XUJA 3REKC 2G5HC 1M18C 3B6FD 4E44A 1ID3A 3C1BA 5AV5C 3W96A 4KGCA 4E45A 3B0DB 4NFTA 3REJC 5CPIC 4J8XA 3R45A 3EPLA 2Y2QA 3F6TA 3MGPA 1P3PC 5GXQB 1P3MB 2AROA 4Z66B 4YM6B 3REKD 3UTAC 1HQ3C 1P3OA 4WV4B 1M18D 2Y2GA 3MVDB 2FJ7B 4XZQA 5AV6B 5GT0A 1P3KB 5AVBC 5AV5D 5B2JA 3KWQB 5B31G 5B24C 3X1TC 2BYKA 1BH9A 3REJD 4Z5TC 3AZLB 2IO5B 5CPID 5DNMB 3AZFC 3WA9A 2YFVB 1P3IB 4J8UA 5E5AC 1P3PD 4CSRA 3B0CT 3UTAD 1HQ3D 2NQBB 4H9RA 5CP6C 1P3FD 1ZLAC 2DQNC 2BYMB 4EO5C 5AVBD 3W98B 5B24D 5B0YD 2RIQA 1ULYA 1M1AC 4Z5TD 3AL0C 5BT1C 5BNVA 5JRGB 4J8WA 1WWSA 2Y2HA 5B1LB 1H3OA 3X1SD 3AZHA 1M19A 3AV2A 3O62A 3WTPD 3AZKB 3A6NB 5CP6D 4JJNC 3REIA 1KX4B 4DRBA 5DNNC 1ZLAD 3AZNC 4KUDB 1P3BA 5GT3A 2XD5A 4WU8B 3LZ0D 1M1AD 4J8XC 5BT1D 1HTAA 1TZYB 1P34A 2AROC 3AFAB 3MGRB 5B31A 5AV9D 1N1JB 2FFFB 5AV8A 4R8PA 3REHA 3WTPE 2CWEA 2HUEC 4JJND 3B6FA 5DNND 5B40B 5B33B 4X23B 3WKJB 3AZND 5JA4B 5CPJC 2ZM5A 1Z2CB 3H0LC 3B6GD 2F8ND 3REKA 1M18A 4WU9B 5AV5A 4UUZB 3MNNB 5B1MB 3NQUA 1P3LC 3IP4C 4H9OA 3X1VC 3KWQC 3KUYC 3REJA 3AN2B 1JFIB 3W97C 5CPJD 3AZHC 1M19C 5CPIA 4G91C 3KSYA 1P3PA 3KXBC 3LELB 3UTAA 1HQ3A 5B0ZB 4YS3B 2ZY3A 4YM6D 1S32C 4J8VB 5AVBA 2ZY5A 3MVDD 5B24A 5B0YA 3X1UC 1P3KD 2FJ7D 1P34C 3AV1B 1P3LD 3X1VD 3KWQD 3KUYD 4KHAB 4Z5TA 2F8NG 5BO0A 2DF4C 4QLCB 5G49B 5AV8C 5E5AA 3REHC 3KXBD 3EG5B 3X1SA 3B6FC 2Y2KA 3NQJB 5C3IC 3WTPA 1F1EA 2Y2NA 5CP6A 1BFMA 1S32D 1ZLAA 1KX3B 2HIOC 5CPKC 3UT9B 3LZ0A 1M1AA 3W98D 4XUJB 3MGSB 4G92B 3H0MC 3RELC 1BH8A 2F8NH 5JRGD 3C1BB 3AFAC 3MGRC 4JJNA 3W96B 5DNNA 4WZSB 2HIOD 4UPKA 5GSUB 3AZKD 5CPKD 1KX4D 3AZNA 3R45B 3UTBC 3MGPB 4LD9B 2Y2LA 4H9PA 4NE3A 3TU4C 1P3OB 3VH5T 3RELD 3C1CC 4WU8D 2UWXA 4ZUXC 5GT0B 3B6GA 1P3FC 2F8NA 5B2JB 3AFAD 2YFWA 3MGRD 3AZGB 2BYKB 2W8SA 5B0YC 1AOIB 3WA9B 4HGAC 3UTBD 5B40D 4J8UB 3AZIC 5B33D 5BNXA 4X23D 3TU4D 3C1CD 3X1SC 5CPJA 5B32B 3LZ1C 4H9RB 4ZUXD 3WTPC 1P3AB 3WAAC 3AZJA 3VH5A 4H9NA 1EQZC 5AVCB 5BNVB 3LZ0C 4WNNA 4J8WB 3AZID 3MVDA 4M6BA 2FJ7A 5AY8C 3AV2B 1P3LA 4WU9D 3X1VA 3O62B 3KWQA 3KUYA 3W97A 4DRAA 3MNND 4AWLB 5AV9C 3LZ1D 3AYWB 3REIB 4ZBJB 3AZJC 3VH6T 3AN2D 3KXBA 1F66C 3WAAD 3AZMB 1R4VA 1P3BB 5GT3B 2NZDC 3LELD 1EQZD 1S32A 1P3GC 5B2IC 3LJAB 3EPJA 5BS7C 4YS3D 1U35B 3X1UA 5B31B 5AY8D 2CV5C 3W98A 1WWIA 4R8PB 1Q9CA 3B6GC 1PZRA 1KX5C 3AZJD 5FUGA 1F66D 3MGSC 5JRGA 2PYOC 3W99B 2NZDD 1B6WA 1P3GD 3VH6A 1TAFB 2HIOA 5B2ID 3AZKA 5KDMA 5CPKA 1KX4A 2JE5A 2CV5D 5GSUC 2RVQC 3B0DC 3REKB 3RELA 1M18B 3A1IA 1KX5D 4WU8A 3UT9D 3MGSD 3MGQB 5GXQC 2PYOD 5AV5B 1P3MC 4Z66C 4YM6C 3AFAA 3MGRA 3NQUB 4H9OB 3REJB 3MVDC 2FJ7C 4Z2MG 5AV6C 3AZGC 1P3KC 4WJ3C 3UTBA 1P3PB 5GSUD 5B33A 4X23A 3TU4A 2RVQD 3VH5W 3AZLC 3C1CA 4LD9D 2IO5C 5DNMC 3AZEB 4ZUXA 1P3OD 1P3IC 2JSSA 5JA4A 5GXQD 5F99B 5AVBB 1P3FA 4Z66D 1P3MD 2NQBC 5B24B 3X1TB 3EPKA 3AZGD 5AV6D 2Y2IA 3AZFB 3W98C 3AZIA 5E5AB 4Z2MH 1AOID 4WU9A 4UUZA 3MNNA 3AZLD 4CAYA 3LZ1A 5DNMD 5JRGC 1JFIA 1P3ID 3AN2A 1ZLAB 5B1LC 4EO5B 5B32D 4H9SC 3WAAA 2LY8A 2NQBD 3V9RA 1P3AD 3AZKC 3A6NC 1KX4C 2Y2OA 3LELA 1EQZA 1M1AB 1BH8B 5AY8A 4KUDC 1T3UA 5AVCD 4H9QA 4WU8C 1U35C 2F8NK 1ID3B 1TZYC 5AV9A 3VH6W 5DNNB 1F66A 4KHAA 5B1LD 4KGCB
chains in the Genus database with same CATH topology
3AYWD 5G49A 3B0BA 3AZNB 2NZDA 2ZY4A 3A6ND 4H9PB 4J8XB 1P3GA 5B40C 3AZMD 5B2IA 1KU5A 5B33C 4X23C 2XD1A 5BS7A 2AROB 3WKJC 4KUDD 4NE5A 2CV5A 3LJAD 1U35D 2F8NB 1TZYD 2YFWB 4XZQB 1W2EA 2HUEB 1KX5A 3UT9A 3MGSA 2PYOA 1BH9B 5BNXB 3MGQC 3W99D 4CSRB 5CPJB 3WKJD 4WU9C 3MNNC 5GSUA 5B1MC 3AN2C 4LD9A 4H9NB 4DQYB 5GXQA 3LELC 1P3MA 4WNNB 4YM6A 4Z66A 3AZEC 5B0ZC 3MGQD 1P3LB 5F99C 4YS3C 3X1VB 3KUYB 3W97B 2L5AA 1H3OB 5AV6A 3AZGA 4J8VC 3AZHB 4G91B 1P3KA 1M19B 5B1MD 3KXBB 1AOIA 3AV1C 2Y2MA 3AZLA 4QLCC 5DNMA 2YFVA 2G5IC 1P3IA 1S32B 3FDDA 5B32A 3KFUG 3AZED 2NQBA 5B0ZD 3X1UB 1P3AA 1P34B 5F99D 4J8VD 2BYMA 3X1TD 1KX3C 5AV8B 5FUGB 3REHB 5AVCA 3AV1D 3B6FB 3UT9C 3AZFD 5C3IB 5E5AD 4XUJC 4QLCD 4G92C 5CHLB 5B1LA 2HIOB 2BG1A 4H9SA 1ID3C 5KDMB 3AYWA 5CPKB 3C1BC 3A6NA 3EPHA 3W96C 4KGCC 1KX3D 3AZMA 3RELB 4KUDA 3MGPC 4LD9C 3LJAA 2Y2PA 1U35A 1P3OC 1TZYA 4XUJD 1ID3D 4XZQC 1N1JA 5GT0C 3C1BD 5B2JC 3UTBB 1A7WA 3W96D 4KGCD 5CPIB 3TU4B 5B40A 3W99A 3C1CB 1AOIC 3WKJA 2F2AC 3WA9C 4J8XD 1HQ3B 4ZUXB 3UTAB 2Y2JA 3MGPD 1TAFA 4J8UC 1P3FB 2AROD 2JCHA 5B32C 5B0YB 4XZQD 1P3AC 5GT0D 3H0RC 4HGAB 5B2JD 4Z5TB 3AZIB 5BO0B 3MGQA 3X1SB 2ZY2A 4CAYB 5AVCC 3LZ1B 2VQRA 3WA9D 4NE6A 4J8WC 3P5JB 3WTPB 4J8UD 5B1MA 5CP6B 3WAAB 3AV2C 3O62C 3V9RB 4AWLC 3AYWC 3REIC 1EQZB 4ZBJC 3LZ0B 3AZEA 5B0ZA 3AZMC 5AY8B 1P3BC 5GT3C 5F99A 4YS3A 4H9QB 4J8VA 5AV9B 3X1TA 3LJAC 4J8WD 3AZJB 1F66B 3W97D 5B31C 4JJNB 3AZHD 3AV1A 3AV2D 1M19D 3AZFA 3O62D 1B67A 4R8PC 3B0CW 2NZDB 4QLCA 3REID 2J8PA 1P3GB 5B2IB 3W99C 3NQJA 1P3BD 5GT3D 2CV5B 1KX3A 3X1UD 1P34D 5B32G 3B6GB 1KX5B 5B31D 3A1KA 2PYOB 5AV8D 4R8PD 3REHD 4XUJA 3REKC 2G5HC 1M18C 3B6FD 4E44A 1ID3A 3C1BA 5AV5C 3W96A 4KGCA 4E45A 3B0DB 4NFTA 3REJC 5CPIC 4J8XA 3R45A 3EPLA 2Y2QA 3F6TA 3MGPA 1P3PC 5GXQB 1P3MB 2AROA 4Z66B 4YM6B 3REKD 3UTAC 1HQ3C 1P3OA 4WV4B 1M18D 2Y2GA 3MVDB 2FJ7B 4XZQA 5AV6B 5GT0A 1P3KB 5AVBC 5AV5D 5B2JA 3KWQB 5B31G 5B24C 3X1TC 2BYKA 1BH9A 3REJD 4Z5TC 3AZLB 2IO5B 5CPID 5DNMB 3AZFC 3WA9A 2YFVB 1P3IB 4J8UA 5E5AC 1P3PD 4CSRA 3B0CT 3UTAD 1HQ3D 2NQBB 4H9RA 5CP6C 1P3FD 1ZLAC 2DQNC 2BYMB 4EO5C 5AVBD 3W98B 5B24D 5B0YD 2RIQA 1ULYA 1M1AC 4Z5TD 3AL0C 5BT1C 5BNVA 5JRGB 4J8WA 1WWSA 2Y2HA 5B1LB 1H3OA 3X1SD 3AZHA 1M19A 3AV2A 3O62A 3WTPD 3AZKB 3A6NB 5CP6D 4JJNC 3REIA 1KX4B 4DRBA 5DNNC 1ZLAD 3AZNC 4KUDB 1P3BA 5GT3A 2XD5A 4WU8B 3LZ0D 1M1AD 4J8XC 5BT1D 1HTAA 1TZYB 1P34A 2AROC 3AFAB 3MGRB 5B31A 5AV9D 1N1JB 2FFFB 5AV8A 4R8PA 3REHA 3WTPE 2CWEA 2HUEC 4JJND 3B6FA 5DNND 5B40B 5B33B 4X23B 3WKJB 3AZND 5JA4B 5CPJC 2ZM5A 1Z2CB 3H0LC 3B6GD 2F8ND 3REKA 1M18A 4WU9B 5AV5A 4UUZB 3MNNB 5B1MB 3NQUA 1P3LC 3IP4C 4H9OA 3X1VC 3KWQC 3KUYC 3REJA 3AN2B 1JFIB 3W97C 5CPJD 3AZHC 1M19C 5CPIA 4G91C 3KSYA 1P3PA 3KXBC 3LELB 3UTAA 1HQ3A 5B0ZB 4YS3B 2ZY3A 4YM6D 1S32C 4J8VB 5AVBA 2ZY5A 3MVDD 5B24A 5B0YA 3X1UC 1P3KD 2FJ7D 1P34C 3AV1B 1P3LD 3X1VD 3KWQD 3KUYD 4KHAB 4Z5TA 2F8NG 5BO0A 2DF4C 4QLCB 5G49B 5AV8C 5E5AA 3REHC 3KXBD 3EG5B 3X1SA 3B6FC 2Y2KA 3NQJB 5C3IC 3WTPA 1F1EA 2Y2NA 5CP6A 1BFMA 1S32D 1ZLAA 1KX3B 2HIOC 5CPKC 3UT9B 3LZ0A 1M1AA 3W98D 4XUJB 3MGSB 4G92B 3H0MC 3RELC 1BH8A 2F8NH 5JRGD 3C1BB 3AFAC 3MGRC 4JJNA 3W96B 5DNNA 4WZSB 2HIOD 4UPKA 5GSUB 3AZKD 5CPKD 1KX4D 3AZNA 3R45B 3UTBC 3MGPB 4LD9B 2Y2LA 4H9PA 4NE3A 3TU4C 1P3OB 3VH5T 3RELD 3C1CC 4WU8D 2UWXA 4ZUXC 5GT0B 3B6GA 1P3FC 2F8NA 5B2JB 3AFAD 2YFWA 3MGRD 3AZGB 2BYKB 2W8SA 5B0YC 1AOIB 3WA9B 4HGAC 3UTBD 5B40D 4J8UB 3AZIC 5B33D 5BNXA 4X23D 3TU4D 3C1CD 3X1SC 5CPJA 5B32B 3LZ1C 4H9RB 4ZUXD 3WTPC 1P3AB 3WAAC 3AZJA 3VH5A 4H9NA 1EQZC 5AVCB 5BNVB 3LZ0C 4WNNA 4J8WB 3AZID 3MVDA 4M6BA 2FJ7A 5AY8C 3AV2B 1P3LA 4WU9D 3X1VA 3O62B 3KWQA 3KUYA 3W97A 4DRAA 3MNND 4AWLB 5AV9C 3LZ1D 3AYWB 3REIB 4ZBJB 3AZJC 3VH6T 3AN2D 3KXBA 1F66C 3WAAD 3AZMB 1R4VA 1P3BB 5GT3B 2NZDC 3LELD 1EQZD 1S32A 1P3GC 5B2IC 3LJAB 3EPJA 5BS7C 4YS3D 1U35B 3X1UA 5B31B 5AY8D 2CV5C 3W98A 1WWIA 4R8PB 1Q9CA 3B6GC 1PZRA 1KX5C 3AZJD 5FUGA 1F66D 3MGSC 5JRGA 2PYOC 3W99B 2NZDD 1B6WA 1P3GD 3VH6A 1TAFB 2HIOA 5B2ID 3AZKA 5KDMA 5CPKA 1KX4A 2JE5A 2CV5D 5GSUC 2RVQC 3B0DC 3REKB 3RELA 1M18B 3A1IA 1KX5D 4WU8A 3UT9D 3MGSD 3MGQB 5GXQC 2PYOD 5AV5B 1P3MC 4Z66C 4YM6C 3AFAA 3MGRA 3NQUB 4H9OB 3REJB 3MVDC 2FJ7C 4Z2MG 5AV6C 3AZGC 1P3KC 4WJ3C 3UTBA 1P3PB 5GSUD 5B33A 4X23A 3TU4A 2RVQD 3VH5W 3AZLC 3C1CA 4LD9D 2IO5C 5DNMC 3AZEB 4ZUXA 1P3OD 1P3IC 2JSSA 5JA4A 5GXQD 5F99B 5AVBB 1P3FA 4Z66D 1P3MD 2NQBC 5B24B 3X1TB 3EPKA 3AZGD 5AV6D 2Y2IA 3AZFB 3W98C 3AZIA 5E5AB 4Z2MH 1AOID 4WU9A 4UUZA 3MNNA 3AZLD 4CAYA 3LZ1A 5DNMD 5JRGC 1JFIA 1P3ID 3AN2A 1ZLAB 5B1LC 4EO5B 5B32D 4H9SC 3WAAA 2LY8A 2NQBD 3V9RA 1P3AD 3AZKC 3A6NC 1KX4C 2Y2OA 3LELA 1EQZA 1M1AB 1BH8B 5AY8A 4KUDC 1T3UA 5AVCD 4H9QA 4WU8C 1U35C 2F8NK 1ID3B 1TZYC 5AV9A 3VH6W 5DNNB 1F66A 4KHAA 5B1LD 4KGCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AYW D;  5G49 A;  3B0B A;  3AZN B;  2NZD A;  3A6N D;  4H9P B;  4J8X B;  1P3G A;  5B40 C;  3AZM D;  5B2I A;  1KU5 A;  5B33 C;  4X23 C;  5BS7 A;  2ARO B;  3WKJ C;  4KUD D;  4NE5 A;  2CV5 A;  3LJA D;  1U35 D;  2F8N B;  1TZY D;  2YFW B;  4XZQ B;  2HUE B;  1KX5 A;  3UT9 A;  3MGS A;  2PYO A;  1BH9 B;  5BNX B;  3MGQ C;  3W99 D;  4CSR B;  5CPJ B;  3WKJ D;  4WU9 C;  3MNN C;  5GSU A;  5B1M C;  3AN2 C;  4LD9 A;  4H9N B;  5GXQ A;  3LEL C;  1P3M A;  4WNN B;  4YM6 A;  4Z66 A;  3AZE C;  5B0Z C;  3MGQ D;  1P3L B;  5F99 C;  4YS3 C;  3X1V B;  3KUY B;  3W97 B;  2L5A A;  1H3O B;  5AV6 A;  3AZG A;  4J8V C;  3AZH B;  4G91 B;  1P3K A;  1M19 B;  5B1M D;  3KXB B;  1AOI A;  3AV1 C;  3AZL A;  4QLC C;  5DNM A;  2YFV A;  1P3I A;  1S32 B;  5B32 A;  3AZE D;  2NQB A;  5B0Z D;  3X1U B;  1P3A A;  1P34 B;  5F99 D;  4J8V D;  2BYM A;  3X1T D;  1KX3 C;  5AV8 B;  5FUG B;  3REH B;  5AVC A;  3AV1 D;  3B6F B;  3UT9 C;  3AZF D;  5C3I B;  5E5A D;  4XUJ C;  4QLC D;  4G92 C;  5CHL B;  5B1L A;  2HIO B;  1ID3 C;  4H9S A;  5KDM B;  3AYW A;  5CPK B;  3C1B C;  3A6N A;  3W96 C;  4KGC C;  1KX3 D;  3AZM A;  3REL B;  4KUD A;  3MGP C;  4LD9 C;  3LJA A;  1U35 A;  1P3O C;  1TZY A;  4XUJ D;  1ID3 D;  4XZQ C;  1N1J A;  5GT0 C;  3C1B D;  5B2J C;  3UTB B;  1A7W A;  3W96 D;  4KGC D;  5CPI B;  3TU4 B;  5B40 A;  3W99 A;  3C1C B;  1AOI C;  3WKJ A;  3WA9 C;  4J8X D;  1HQ3 B;  4ZUX B;  3UTA B;  3MGP D;  1TAF A;  4J8U C;  1P3F B;  2ARO D;  5B32 C;  5B0Y B;  4XZQ D;  1P3A C;  5GT0 D;  4HGA B;  5B2J D;  4Z5T B;  3AZI B;  5BO0 B;  3MGQ A;  3X1S B;  4CAY B;  5AVC C;  3LZ1 B;  3WA9 D;  4NE6 A;  4J8W C;  3WTP B;  4J8U D;  5B1M A;  5CP6 B;  3WAA B;  3AV2 C;  3O62 C;  3V9R B;  4AWL C;  3AYW C;  3REI C;  1EQZ B;  4ZBJ C;  3LZ0 B;  3AZE A;  5B0Z A;  3AZM C;  5AY8 B;  1P3B C;  5GT3 C;  5F99 A;  4YS3 A;  4H9Q B;  4J8V A;  5AV9 B;  3X1T A;  3LJA C;  4J8W D;  3AZJ B;  1F66 B;  3W97 D;  5B31 C;  4JJN B;  3AZH D;  3AV1 A;  3AV2 D;  1M19 D;  3AZF A;  3O62 D;  1B67 A;  4R8P C;  3B0C W;  2NZD B;  4QLC A;  3REI D;  1P3G B;  5B2I B;  3W99 C;  3NQJ A;  1P3B D;  5GT3 D;  2CV5 B;  1KX3 A;  3X1U D;  1P34 D;  5B32 G;  3B6G B;  1KX5 B;  5B31 D;  2PYO B;  5AV8 D;  4R8P D;  3REH D;  4XUJ A;  3REK C;  1M18 C;  3B6F D;  4E44 A;  1ID3 A;  3C1B A;  5AV5 C;  3W96 A;  4KGC A;  4E45 A;  3B0D B;  4NFT A;  3REJ C;  5CPI C;  4J8X A;  3R45 A;  3MGP A;  1P3P C;  5GXQ B;  1P3M B;  2ARO A;  4Z66 B;  4YM6 B;  3REK D;  3UTA C;  1HQ3 C;  1P3O A;  4WV4 B;  1M18 D;  3MVD B;  2FJ7 B;  4XZQ A;  5AV6 B;  5GT0 A;  1P3K B;  5AVB C;  5AV5 D;  5B2J A;  3KWQ B;  5B31 G;  5B24 C;  3X1T C;  2BYK A;  1BH9 A;  3REJ D;  4Z5T C;  3AZL B;  2IO5 B;  5CPI D;  5DNM B;  3AZF C;  3WA9 A;  2YFV B;  1P3I B;  4J8U A;  5E5A C;  1P3P D;  4CSR A;  3B0C T;  3UTA D;  1HQ3 D;  2NQB B;  4H9R A;  5CP6 C;  1P3F D;  1ZLA C;  2BYM B;  4EO5 C;  5AVB D;  3W98 B;  5B24 D;  5B0Y D;  1ULY A;  1M1A C;  4Z5T D;  5BT1 C;  5BNV A;  5JRG B;  4J8W A;  1WWS A;  5B1L B;  1H3O A;  3X1S D;  3AZH A;  1M19 A;  3AV2 A;  3O62 A;  3WTP D;  3AZK B;  3A6N B;  5CP6 D;  4JJN C;  3REI A;  1KX4 B;  4DRB A;  5DNN C;  1ZLA D;  3AZN C;  4KUD B;  1P3B A;  5GT3 A;  4WU8 B;  3LZ0 D;  1M1A D;  4J8X C;  5BT1 D;  1HTA A;  1TZY B;  1P34 A;  2ARO C;  3AFA B;  3MGR B;  5B31 A;  5AV9 D;  1N1J B;  5AV8 A;  4R8P A;  3REH A;  3WTP E;  2CWE A;  2HUE C;  4JJN D;  3B6F A;  5DNN D;  5B40 B;  5B33 B;  4X23 B;  3WKJ B;  3AZN D;  5JA4 B;  5CPJ C;  3B6G D;  2F8N D;  3REK A;  1M18 A;  4WU9 B;  5AV5 A;  4UUZ B;  3MNN B;  5B1M B;  3NQU A;  1P3L C;  1JFI B;  4H9O A;  3X1V C;  3KWQ C;  3KUY C;  3REJ A;  3AN2 B;  3W97 C;  5CPJ D;  3AZH C;  1M19 C;  5CPI A;  4G91 C;  3KSY A;  1P3P A;  3KXB C;  3LEL B;  3UTA A;  1HQ3 A;  5B0Z B;  4YS3 B;  4YM6 D;  1S32 C;  4J8V B;  5AVB A;  3MVD D;  5B24 A;  5B0Y A;  3X1U C;  1P3K D;  2FJ7 D;  1P34 C;  3AV1 B;  1P3L D;  3X1V D;  3KWQ D;  3KUY D;  4KHA B;  4Z5T A;  2F8N G;  5BO0 A;  4QLC B;  5G49 B;  5AV8 C;  5E5A A;  3REH C;  3KXB D;  3X1S A;  3B6F C;  3WTP A;  3NQJ B;  5C3I C;  1F1E A;  5CP6 A;  1BFM A;  1S32 D;  1ZLA A;  1KX3 B;  2HIO C;  5CPK C;  3UT9 B;  3LZ0 A;  1M1A A;  3W98 D;  4XUJ B;  3MGS B;  4G92 B;  3REL C;  1BH8 A;  2F8N H;  5JRG D;  3C1B B;  3AFA C;  3MGR C;  4JJN A;  3W96 B;  5DNN A;  4WZS B;  2HIO D;  5GSU B;  3AZK D;  5CPK D;  1KX4 D;  3AZN A;  3R45 B;  3UTB C;  3MGP B;  4LD9 B;  4NE3 A;  4H9P A;  3TU4 C;  1P3O B;  3VH5 T;  3REL D;  3C1C C;  4WU8 D;  4ZUX C;  5GT0 B;  3B6G A;  1P3F C;  2F8N A;  5B2J B;  3AFA D;  2YFW A;  3MGR D;  3AZG B;  2BYK B;  5B0Y C;  1AOI B;  3WA9 B;  4HGA C;  3UTB D;  5B40 D;  4J8U B;  3AZI C;  5B33 D;  5BNX A;  4X23 D;  3TU4 D;  3C1C D;  3X1S C;  5CPJ A;  5B32 B;  3LZ1 C;  4H9R B;  4ZUX D;  3WTP C;  1P3A B;  3WAA C;  3AZJ A;  3VH5 A;  4H9N A;  1EQZ C;  5AVC B;  5BNV B;  3LZ0 C;  4WNN A;  4J8W B;  3AZI D;  3MVD A;  4M6B A;  2FJ7 A;  5AY8 C;  3AV2 B;  1P3L A;  4WU9 D;  3X1V A;  3O62 B;  3KWQ A;  3KUY A;  3W97 A;  4DRA A;  3MNN D;  4AWL B;  5AV9 C;  3LZ1 D;  3AYW B;  3REI B;  4ZBJ B;  3AZJ C;  3VH6 T;  3AN2 D;  3KXB A;  1F66 C;  3WAA D;  3AZM B;  1R4V A;  1P3B B;  5GT3 B;  2NZD C;  3LEL D;  1EQZ D;  1S32 A;  1P3G C;  5B2I C;  3LJA B;  5BS7 C;  4YS3 D;  1U35 B;  3X1U A;  5B31 B;  5AY8 D;  2CV5 C;  3W98 A;  1WWI A;  4R8P B;  1Q9C A;  3B6G C;  1KX5 C;  3AZJ D;  5FUG A;  1F66 D;  3MGS C;  5JRG A;  2PYO C;  3W99 B;  2NZD D;  1B6W A;  1P3G D;  3VH6 A;  1TAF B;  2HIO A;  5B2I D;  3AZK A;  5KDM A;  5CPK A;  1KX4 A;  2CV5 D;  5GSU C;  2RVQ C;  3B0D C;  3REK B;  3REL A;  1M18 B;  1KX5 D;  4WU8 A;  3UT9 D;  3MGS D;  3MGQ B;  5GXQ C;  2PYO D;  5AV5 B;  1P3M C;  4Z66 C;  4YM6 C;  3AFA A;  3MGR A;  3NQU B;  4H9O B;  3REJ B;  3MVD C;  2FJ7 C;  4Z2M G;  5AV6 C;  3AZG C;  1P3K C;  3UTB A;  1P3P B;  5GSU D;  5B33 A;  4X23 A;  3TU4 A;  2RVQ D;  3VH5 W;  3AZL C;  3C1C A;  4LD9 D;  2IO5 C;  5DNM C;  3AZE B;  4ZUX A;  1P3O D;  1P3I C;  2JSS A;  5JA4 A;  5GXQ D;  5F99 B;  5AVB B;  1P3F A;  4Z66 D;  1P3M D;  2NQB C;  5B24 B;  3X1T B;  3AZG D;  5AV6 D;  3AZF B;  3W98 C;  3AZI A;  5E5A B;  4Z2M H;  1AOI D;  4WU9 A;  4UUZ A;  3MNN A;  3AZL D;  4CAY A;  3LZ1 A;  5DNM D;  5JRG C;  1JFI A;  1P3I D;  3AN2 A;  1ZLA B;  5B1L C;  4EO5 B;  5B32 D;  4H9S C;  3WAA A;  2LY8 A;  2NQB D;  3V9R A;  1P3A D;  3AZK C;  3A6N C;  1KX4 C;  3LEL A;  1EQZ A;  1M1A B;  1BH8 B;  5AY8 A;  4KUD C;  5AVC D;  4H9Q A;  4WU8 C;  1U35 C;  2F8N K;  1ID3 B;  1TZY C;  5AV9 A;  3VH6 W;  5DNN B;  1F66 A;  4KHA A;  5B1L D;  4KGC B; 
#chains in the Genus database with same CATH topology
 3AYW D;  5G49 A;  3B0B A;  3AZN B;  2NZD A;  2ZY4 A;  3A6N D;  4H9P B;  4J8X B;  1P3G A;  5B40 C;  3AZM D;  5B2I A;  1KU5 A;  5B33 C;  4X23 C;  2XD1 A;  5BS7 A;  2ARO B;  3WKJ C;  4KUD D;  4NE5 A;  2CV5 A;  3LJA D;  1U35 D;  2F8N B;  1TZY D;  2YFW B;  4XZQ B;  1W2E A;  2HUE B;  1KX5 A;  3UT9 A;  3MGS A;  2PYO A;  1BH9 B;  5BNX B;  3MGQ C;  3W99 D;  4CSR B;  5CPJ B;  3WKJ D;  4WU9 C;  3MNN C;  5GSU A;  5B1M C;  3AN2 C;  4LD9 A;  4H9N B;  4DQY B;  5GXQ A;  3LEL C;  1P3M A;  4WNN B;  4YM6 A;  4Z66 A;  3AZE C;  5B0Z C;  3MGQ D;  1P3L B;  5F99 C;  4YS3 C;  3X1V B;  3KUY B;  3W97 B;  2L5A A;  1H3O B;  5AV6 A;  3AZG A;  4J8V C;  3AZH B;  4G91 B;  1P3K A;  1M19 B;  5B1M D;  3KXB B;  1AOI A;  3AV1 C;  2Y2M A;  3AZL A;  4QLC C;  5DNM A;  2YFV A;  2G5I C;  1P3I A;  1S32 B;  3FDD A;  5B32 A;  3KFU G;  3AZE D;  2NQB A;  5B0Z D;  3X1U B;  1P3A A;  1P34 B;  5F99 D;  4J8V D;  2BYM A;  3X1T D;  1KX3 C;  5AV8 B;  5FUG B;  3REH B;  5AVC A;  3AV1 D;  3B6F B;  3UT9 C;  3AZF D;  5C3I B;  5E5A D;  4XUJ C;  4QLC D;  4G92 C;  5CHL B;  5B1L A;  2HIO B;  2BG1 A;  4H9S A;  1ID3 C;  5KDM B;  3AYW A;  5CPK B;  3C1B C;  3A6N A;  3EPH A;  3W96 C;  4KGC C;  1KX3 D;  3AZM A;  3REL B;  4KUD A;  3MGP C;  4LD9 C;  3LJA A;  2Y2P A;  1U35 A;  1P3O C;  1TZY A;  4XUJ D;  1ID3 D;  4XZQ C;  1N1J A;  5GT0 C;  3C1B D;  5B2J C;  3UTB B;  1A7W A;  3W96 D;  4KGC D;  5CPI B;  3TU4 B;  5B40 A;  3W99 A;  3C1C B;  1AOI C;  3WKJ A;  2F2A C;  3WA9 C;  4J8X D;  1HQ3 B;  4ZUX B;  3UTA B;  2Y2J A;  3MGP D;  1TAF A;  4J8U C;  1P3F B;  2ARO D;  2JCH A;  5B32 C;  5B0Y B;  4XZQ D;  1P3A C;  5GT0 D;  3H0R C;  4HGA B;  5B2J D;  4Z5T B;  3AZI B;  5BO0 B;  3MGQ A;  3X1S B;  2ZY2 A;  4CAY B;  5AVC C;  3LZ1 B;  2VQR A;  3WA9 D;  4NE6 A;  4J8W C;  3P5J B;  3WTP B;  4J8U D;  5B1M A;  5CP6 B;  3WAA B;  3AV2 C;  3O62 C;  3V9R B;  4AWL C;  3AYW C;  3REI C;  1EQZ B;  4ZBJ C;  3LZ0 B;  3AZE A;  5B0Z A;  3AZM C;  5AY8 B;  1P3B C;  5GT3 C;  5F99 A;  4YS3 A;  4H9Q B;  4J8V A;  5AV9 B;  3X1T A;  3LJA C;  4J8W D;  3AZJ B;  1F66 B;  3W97 D;  5B31 C;  4JJN B;  3AZH D;  3AV1 A;  3AV2 D;  1M19 D;  3AZF A;  3O62 D;  1B67 A;  4R8P C;  3B0C W;  2NZD B;  4QLC A;  3REI D;  2J8P A;  1P3G B;  5B2I B;  3W99 C;  3NQJ A;  1P3B D;  5GT3 D;  2CV5 B;  1KX3 A;  3X1U D;  1P34 D;  5B32 G;  3B6G B;  1KX5 B;  5B31 D;  3A1K A;  2PYO B;  5AV8 D;  4R8P D;  3REH D;  4XUJ A;  3REK C;  2G5H C;  1M18 C;  3B6F D;  4E44 A;  1ID3 A;  3C1B A;  5AV5 C;  3W96 A;  4KGC A;  4E45 A;  3B0D B;  4NFT A;  3REJ C;  5CPI C;  4J8X A;  3R45 A;  3EPL A;  2Y2Q A;  3F6T A;  3MGP A;  1P3P C;  5GXQ B;  1P3M B;  2ARO A;  4Z66 B;  4YM6 B;  3REK D;  3UTA C;  1HQ3 C;  1P3O A;  4WV4 B;  1M18 D;  2Y2G A;  3MVD B;  2FJ7 B;  4XZQ A;  5AV6 B;  5GT0 A;  1P3K B;  5AVB C;  5AV5 D;  5B2J A;  3KWQ B;  5B31 G;  5B24 C;  3X1T C;  2BYK A;  1BH9 A;  3REJ D;  4Z5T C;  3AZL B;  2IO5 B;  5CPI D;  5DNM B;  3AZF C;  3WA9 A;  2YFV B;  1P3I B;  4J8U A;  5E5A C;  1P3P D;  4CSR A;  3B0C T;  3UTA D;  1HQ3 D;  2NQB B;  4H9R A;  5CP6 C;  1P3F D;  1ZLA C;  2DQN C;  2BYM B;  4EO5 C;  5AVB D;  3W98 B;  5B24 D;  5B0Y D;  2RIQ A;  1ULY A;  1M1A C;  4Z5T D;  3AL0 C;  5BT1 C;  5BNV A;  5JRG B;  4J8W A;  1WWS A;  2Y2H A;  5B1L B;  1H3O A;  3X1S D;  3AZH A;  1M19 A;  3AV2 A;  3O62 A;  3WTP D;  3AZK B;  3A6N B;  5CP6 D;  4JJN C;  3REI A;  1KX4 B;  4DRB A;  5DNN C;  1ZLA D;  3AZN C;  4KUD B;  1P3B A;  5GT3 A;  2XD5 A;  4WU8 B;  3LZ0 D;  1M1A D;  4J8X C;  5BT1 D;  1HTA A;  1TZY B;  1P34 A;  2ARO C;  3AFA B;  3MGR B;  5B31 A;  5AV9 D;  1N1J B;  2FFF B;  5AV8 A;  4R8P A;  3REH A;  3WTP E;  2CWE A;  2HUE C;  4JJN D;  3B6F A;  5DNN D;  5B40 B;  5B33 B;  4X23 B;  3WKJ B;  3AZN D;  5JA4 B;  5CPJ C;  2ZM5 A;  1Z2C B;  3H0L C;  3B6G D;  2F8N D;  3REK A;  1M18 A;  4WU9 B;  5AV5 A;  4UUZ B;  3MNN B;  5B1M B;  3NQU A;  1P3L C;  3IP4 C;  4H9O A;  3X1V C;  3KWQ C;  3KUY C;  3REJ A;  3AN2 B;  1JFI B;  3W97 C;  5CPJ D;  3AZH C;  1M19 C;  5CPI A;  4G91 C;  3KSY A;  1P3P A;  3KXB C;  3LEL B;  3UTA A;  1HQ3 A;  5B0Z B;  4YS3 B;  2ZY3 A;  4YM6 D;  1S32 C;  4J8V B;  5AVB A;  2ZY5 A;  3MVD D;  5B24 A;  5B0Y A;  3X1U C;  1P3K D;  2FJ7 D;  1P34 C;  3AV1 B;  1P3L D;  3X1V D;  3KWQ D;  3KUY D;  4KHA B;  4Z5T A;  2F8N G;  5BO0 A;  2DF4 C;  4QLC B;  5G49 B;  5AV8 C;  5E5A A;  3REH C;  3KXB D;  3EG5 B;  3X1S A;  3B6F C;  2Y2K A;  3NQJ B;  5C3I C;  3WTP A;  1F1E A;  2Y2N A;  5CP6 A;  1BFM A;  1S32 D;  1ZLA A;  1KX3 B;  2HIO C;  5CPK C;  3UT9 B;  3LZ0 A;  1M1A A;  3W98 D;  4XUJ B;  3MGS B;  4G92 B;  3H0M C;  3REL C;  1BH8 A;  2F8N H;  5JRG D;  3C1B B;  3AFA C;  3MGR C;  4JJN A;  3W96 B;  5DNN A;  4WZS B;  2HIO D;  4UPK A;  5GSU B;  3AZK D;  5CPK D;  1KX4 D;  3AZN A;  3R45 B;  3UTB C;  3MGP B;  4LD9 B;  2Y2L A;  4H9P A;  4NE3 A;  3TU4 C;  1P3O B;  3VH5 T;  3REL D;  3C1C C;  4WU8 D;  2UWX A;  4ZUX C;  5GT0 B;  3B6G A;  1P3F C;  2F8N A;  5B2J B;  3AFA D;  2YFW A;  3MGR D;  3AZG B;  2BYK B;  2W8S A;  5B0Y C;  1AOI B;  3WA9 B;  4HGA C;  3UTB D;  5B40 D;  4J8U B;  3AZI C;  5B33 D;  5BNX A;  4X23 D;  3TU4 D;  3C1C D;  3X1S C;  5CPJ A;  5B32 B;  3LZ1 C;  4H9R B;  4ZUX D;  3WTP C;  1P3A B;  3WAA C;  3AZJ A;  3VH5 A;  4H9N A;  1EQZ C;  5AVC B;  5BNV B;  3LZ0 C;  4WNN A;  4J8W B;  3AZI D;  3MVD A;  4M6B A;  2FJ7 A;  5AY8 C;  3AV2 B;  1P3L A;  4WU9 D;  3X1V A;  3O62 B;  3KWQ A;  3KUY A;  3W97 A;  4DRA A;  3MNN D;  4AWL B;  5AV9 C;  3LZ1 D;  3AYW B;  3REI B;  4ZBJ B;  3AZJ C;  3VH6 T;  3AN2 D;  3KXB A;  1F66 C;  3WAA D;  3AZM B;  1R4V A;  1P3B B;  5GT3 B;  2NZD C;  3LEL D;  1EQZ D;  1S32 A;  1P3G C;  5B2I C;  3LJA B;  3EPJ A;  5BS7 C;  4YS3 D;  1U35 B;  3X1U A;  5B31 B;  5AY8 D;  2CV5 C;  3W98 A;  1WWI A;  4R8P B;  1Q9C A;  3B6G C;  1PZR A;  1KX5 C;  3AZJ D;  5FUG A;  1F66 D;  3MGS C;  5JRG A;  2PYO C;  3W99 B;  2NZD D;  1B6W A;  1P3G D;  3VH6 A;  1TAF B;  2HIO A;  5B2I D;  3AZK A;  5KDM A;  5CPK A;  1KX4 A;  2JE5 A;  2CV5 D;  5GSU C;  2RVQ C;  3B0D C;  3REK B;  3REL A;  1M18 B;  3A1I A;  1KX5 D;  4WU8 A;  3UT9 D;  3MGS D;  3MGQ B;  5GXQ C;  2PYO D;  5AV5 B;  1P3M C;  4Z66 C;  4YM6 C;  3AFA A;  3MGR A;  3NQU B;  4H9O B;  3REJ B;  3MVD C;  2FJ7 C;  4Z2M G;  5AV6 C;  3AZG C;  1P3K C;  4WJ3 C;  3UTB A;  1P3P B;  5GSU D;  5B33 A;  4X23 A;  3TU4 A;  2RVQ D;  3VH5 W;  3AZL C;  3C1C A;  4LD9 D;  2IO5 C;  5DNM C;  3AZE B;  4ZUX A;  1P3O D;  1P3I C;  2JSS A;  5JA4 A;  5GXQ D;  5F99 B;  5AVB B;  1P3F A;  4Z66 D;  1P3M D;  2NQB C;  5B24 B;  3X1T B;  3EPK A;  3AZG D;  5AV6 D;  2Y2I A;  3AZF B;  3W98 C;  3AZI A;  5E5A B;  4Z2M H;  1AOI D;  4WU9 A;  4UUZ A;  3MNN A;  3AZL D;  4CAY A;  3LZ1 A;  5DNM D;  5JRG C;  1JFI A;  1P3I D;  3AN2 A;  1ZLA B;  5B1L C;  4EO5 B;  5B32 D;  4H9S C;  3WAA A;  2LY8 A;  2NQB D;  3V9R A;  1P3A D;  3AZK C;  3A6N C;  1KX4 C;  2Y2O A;  3LEL A;  1EQZ A;  1M1A B;  1BH8 B;  5AY8 A;  4KUD C;  1T3U A;  5AVC D;  4H9Q A;  4WU8 C;  1U35 C;  2F8N K;  1ID3 B;  1TZY C;  5AV9 A;  3VH6 W;  5DNN B;  1F66 A;  4KHA A;  5B1L D;  4KGC B; 
#chains in the Genus database with same CATH homology
 3AYW D;  5G49 A;  3B0B A;  3AZN B;  2NZD A;  2ZY4 A;  3A6N D;  4H9P B;  4J8X B;  1P3G A;  5B40 C;  3AZM D;  5B2I A;  1KU5 A;  5B33 C;  4X23 C;  2XD1 A;  5BS7 A;  2ARO B;  3WKJ C;  4KUD D;  4NE5 A;  2CV5 A;  3LJA D;  1U35 D;  2F8N B;  1TZY D;  2YFW B;  4XZQ B;  1W2E A;  2HUE B;  1KX5 A;  3UT9 A;  3MGS A;  2PYO A;  1BH9 B;  5BNX B;  3MGQ C;  3W99 D;  4CSR B;  5CPJ B;  3WKJ D;  4WU9 C;  3MNN C;  5GSU A;  5B1M C;  3AN2 C;  4LD9 A;  4H9N B;  4DQY B;  5GXQ A;  3LEL C;  1P3M A;  4WNN B;  4YM6 A;  4Z66 A;  3AZE C;  5B0Z C;  3MGQ D;  1P3L B;  5F99 C;  4YS3 C;  3X1V B;  3KUY B;  3W97 B;  2L5A A;  1H3O B;  5AV6 A;  3AZG A;  4J8V C;  3AZH B;  4G91 B;  1P3K A;  1M19 B;  5B1M D;  3KXB B;  1AOI A;  3AV1 C;  2Y2M A;  3AZL A;  4QLC C;  5DNM A;  2YFV A;  2G5I C;  1P3I A;  1S32 B;  3FDD A;  5B32 A;  3KFU G;  3AZE D;  2NQB A;  5B0Z D;  3X1U B;  1P3A A;  1P34 B;  5F99 D;  4J8V D;  2BYM A;  3X1T D;  1KX3 C;  5AV8 B;  5FUG B;  3REH B;  5AVC A;  3AV1 D;  3B6F B;  3UT9 C;  3AZF D;  5C3I B;  5E5A D;  4XUJ C;  4QLC D;  4G92 C;  5CHL B;  5B1L A;  2HIO B;  2BG1 A;  4H9S A;  1ID3 C;  5KDM B;  3AYW A;  5CPK B;  3C1B C;  3A6N A;  3EPH A;  3W96 C;  4KGC C;  1KX3 D;  3AZM A;  3REL B;  4KUD A;  3MGP C;  4LD9 C;  3LJA A;  2Y2P A;  1U35 A;  1P3O C;  1TZY A;  4XUJ D;  1ID3 D;  4XZQ C;  1N1J A;  5GT0 C;  3C1B D;  5B2J C;  3UTB B;  1A7W A;  3W96 D;  4KGC D;  5CPI B;  3TU4 B;  5B40 A;  3W99 A;  3C1C B;  1AOI C;  3WKJ A;  2F2A C;  3WA9 C;  4J8X D;  1HQ3 B;  4ZUX B;  3UTA B;  2Y2J A;  3MGP D;  1TAF A;  4J8U C;  1P3F B;  2ARO D;  2JCH A;  5B32 C;  5B0Y B;  4XZQ D;  1P3A C;  5GT0 D;  3H0R C;  4HGA B;  5B2J D;  4Z5T B;  3AZI B;  5BO0 B;  3MGQ A;  3X1S B;  2ZY2 A;  4CAY B;  5AVC C;  3LZ1 B;  2VQR A;  3WA9 D;  4NE6 A;  4J8W C;  3P5J B;  3WTP B;  4J8U D;  5B1M A;  5CP6 B;  3WAA B;  3AV2 C;  3O62 C;  3V9R B;  4AWL C;  3AYW C;  3REI C;  1EQZ B;  4ZBJ C;  3LZ0 B;  3AZE A;  5B0Z A;  3AZM C;  5AY8 B;  1P3B C;  5GT3 C;  5F99 A;  4YS3 A;  4H9Q B;  4J8V A;  5AV9 B;  3X1T A;  3LJA C;  4J8W D;  3AZJ B;  1F66 B;  3W97 D;  5B31 C;  4JJN B;  3AZH D;  3AV1 A;  3AV2 D;  1M19 D;  3AZF A;  3O62 D;  1B67 A;  4R8P C;  3B0C W;  2NZD B;  4QLC A;  3REI D;  2J8P A;  1P3G B;  5B2I B;  3W99 C;  3NQJ A;  1P3B D;  5GT3 D;  2CV5 B;  1KX3 A;  3X1U D;  1P34 D;  5B32 G;  3B6G B;  1KX5 B;  5B31 D;  3A1K A;  2PYO B;  5AV8 D;  4R8P D;  3REH D;  4XUJ A;  3REK C;  2G5H C;  1M18 C;  3B6F D;  4E44 A;  1ID3 A;  3C1B A;  5AV5 C;  3W96 A;  4KGC A;  4E45 A;  3B0D B;  4NFT A;  3REJ C;  5CPI C;  4J8X A;  3R45 A;  3EPL A;  2Y2Q A;  3F6T A;  3MGP A;  1P3P C;  5GXQ B;  1P3M B;  2ARO A;  4Z66 B;  4YM6 B;  3REK D;  3UTA C;  1HQ3 C;  1P3O A;  4WV4 B;  1M18 D;  2Y2G A;  3MVD B;  2FJ7 B;  4XZQ A;  5AV6 B;  5GT0 A;  1P3K B;  5AVB C;  5AV5 D;  5B2J A;  3KWQ B;  5B31 G;  5B24 C;  3X1T C;  2BYK A;  1BH9 A;  3REJ D;  4Z5T C;  3AZL B;  2IO5 B;  5CPI D;  5DNM B;  3AZF C;  3WA9 A;  2YFV B;  1P3I B;  4J8U A;  5E5A C;  1P3P D;  4CSR A;  3B0C T;  3UTA D;  1HQ3 D;  2NQB B;  4H9R A;  5CP6 C;  1P3F D;  1ZLA C;  2DQN C;  2BYM B;  4EO5 C;  5AVB D;  3W98 B;  5B24 D;  5B0Y D;  2RIQ A;  1ULY A;  1M1A C;  4Z5T D;  3AL0 C;  5BT1 C;  5BNV A;  5JRG B;  4J8W A;  1WWS A;  2Y2H A;  5B1L B;  1H3O A;  3X1S D;  3AZH A;  1M19 A;  3AV2 A;  3O62 A;  3WTP D;  3AZK B;  3A6N B;  5CP6 D;  4JJN C;  3REI A;  1KX4 B;  4DRB A;  5DNN C;  1ZLA D;  3AZN C;  4KUD B;  1P3B A;  5GT3 A;  2XD5 A;  4WU8 B;  3LZ0 D;  1M1A D;  4J8X C;  5BT1 D;  1HTA A;  1TZY B;  1P34 A;  2ARO C;  3AFA B;  3MGR B;  5B31 A;  5AV9 D;  1N1J B;  2FFF B;  5AV8 A;  4R8P A;  3REH A;  3WTP E;  2CWE A;  2HUE C;  4JJN D;  3B6F A;  5DNN D;  5B40 B;  5B33 B;  4X23 B;  3WKJ B;  3AZN D;  5JA4 B;  5CPJ C;  2ZM5 A;  1Z2C B;  3H0L C;  3B6G D;  2F8N D;  3REK A;  1M18 A;  4WU9 B;  5AV5 A;  4UUZ B;  3MNN B;  5B1M B;  3NQU A;  1P3L C;  3IP4 C;  4H9O A;  3X1V C;  3KWQ C;  3KUY C;  3REJ A;  3AN2 B;  1JFI B;  3W97 C;  5CPJ D;  3AZH C;  1M19 C;  5CPI A;  4G91 C;  3KSY A;  1P3P A;  3KXB C;  3LEL B;  3UTA A;  1HQ3 A;  5B0Z B;  4YS3 B;  2ZY3 A;  4YM6 D;  1S32 C;  4J8V B;  5AVB A;  2ZY5 A;  3MVD D;  5B24 A;  5B0Y A;  3X1U C;  1P3K D;  2FJ7 D;  1P34 C;  3AV1 B;  1P3L D;  3X1V D;  3KWQ D;  3KUY D;  4KHA B;  4Z5T A;  2F8N G;  5BO0 A;  2DF4 C;  4QLC B;  5G49 B;  5AV8 C;  5E5A A;  3REH C;  3KXB D;  3EG5 B;  3X1S A;  3B6F C;  2Y2K A;  3NQJ B;  5C3I C;  3WTP A;  1F1E A;  2Y2N A;  5CP6 A;  1BFM A;  1S32 D;  1ZLA A;  1KX3 B;  2HIO C;  5CPK C;  3UT9 B;  3LZ0 A;  1M1A A;  3W98 D;  4XUJ B;  3MGS B;  4G92 B;  3H0M C;  3REL C;  1BH8 A;  2F8N H;  5JRG D;  3C1B B;  3AFA C;  3MGR C;  4JJN A;  3W96 B;  5DNN A;  4WZS B;  2HIO D;  4UPK A;  5GSU B;  3AZK D;  5CPK D;  1KX4 D;  3AZN A;  3R45 B;  3UTB C;  3MGP B;  4LD9 B;  2Y2L A;  4H9P A;  4NE3 A;  3TU4 C;  1P3O B;  3VH5 T;  3REL D;  3C1C C;  4WU8 D;  2UWX A;  4ZUX C;  5GT0 B;  3B6G A;  1P3F C;  2F8N A;  5B2J B;  3AFA D;  2YFW A;  3MGR D;  3AZG B;  2BYK B;  2W8S A;  5B0Y C;  1AOI B;  3WA9 B;  4HGA C;  3UTB D;  5B40 D;  4J8U B;  3AZI C;  5B33 D;  5BNX A;  4X23 D;  3TU4 D;  3C1C D;  3X1S C;  5CPJ A;  5B32 B;  3LZ1 C;  4H9R B;  4ZUX D;  3WTP C;  1P3A B;  3WAA C;  3AZJ A;  3VH5 A;  4H9N A;  1EQZ C;  5AVC B;  5BNV B;  3LZ0 C;  4WNN A;  4J8W B;  3AZI D;  3MVD A;  4M6B A;  2FJ7 A;  5AY8 C;  3AV2 B;  1P3L A;  4WU9 D;  3X1V A;  3O62 B;  3KWQ A;  3KUY A;  3W97 A;  4DRA A;  3MNN D;  4AWL B;  5AV9 C;  3LZ1 D;  3AYW B;  3REI B;  4ZBJ B;  3AZJ C;  3VH6 T;  3AN2 D;  3KXB A;  1F66 C;  3WAA D;  3AZM B;  1R4V A;  1P3B B;  5GT3 B;  2NZD C;  3LEL D;  1EQZ D;  1S32 A;  1P3G C;  5B2I C;  3LJA B;  3EPJ A;  5BS7 C;  4YS3 D;  1U35 B;  3X1U A;  5B31 B;  5AY8 D;  2CV5 C;  3W98 A;  1WWI A;  4R8P B;  1Q9C A;  3B6G C;  1PZR A;  1KX5 C;  3AZJ D;  5FUG A;  1F66 D;  3MGS C;  5JRG A;  2PYO C;  3W99 B;  2NZD D;  1B6W A;  1P3G D;  3VH6 A;  1TAF B;  2HIO A;  5B2I D;  3AZK A;  5KDM A;  5CPK A;  1KX4 A;  2JE5 A;  2CV5 D;  5GSU C;  2RVQ C;  3B0D C;  3REK B;  3REL A;  1M18 B;  3A1I A;  1KX5 D;  4WU8 A;  3UT9 D;  3MGS D;  3MGQ B;  5GXQ C;  2PYO D;  5AV5 B;  1P3M C;  4Z66 C;  4YM6 C;  3AFA A;  3MGR A;  3NQU B;  4H9O B;  3REJ B;  3MVD C;  2FJ7 C;  4Z2M G;  5AV6 C;  3AZG C;  1P3K C;  4WJ3 C;  3UTB A;  1P3P B;  5GSU D;  5B33 A;  4X23 A;  3TU4 A;  2RVQ D;  3VH5 W;  3AZL C;  3C1C A;  4LD9 D;  2IO5 C;  5DNM C;  3AZE B;  4ZUX A;  1P3O D;  1P3I C;  2JSS A;  5JA4 A;  5GXQ D;  5F99 B;  5AVB B;  1P3F A;  4Z66 D;  1P3M D;  2NQB C;  5B24 B;  3X1T B;  3EPK A;  3AZG D;  5AV6 D;  2Y2I A;  3AZF B;  3W98 C;  3AZI A;  5E5A B;  4Z2M H;  1AOI D;  4WU9 A;  4UUZ A;  3MNN A;  3AZL D;  4CAY A;  3LZ1 A;  5DNM D;  5JRG C;  1JFI A;  1P3I D;  3AN2 A;  1ZLA B;  5B1L C;  4EO5 B;  5B32 D;  4H9S C;  3WAA A;  2LY8 A;  2NQB D;  3V9R A;  1P3A D;  3AZK C;  3A6N C;  1KX4 C;  2Y2O A;  3LEL A;  1EQZ A;  1M1A B;  1BH8 B;  5AY8 A;  4KUD C;  1T3U A;  5AVC D;  4H9Q A;  4WU8 C;  1U35 C;  2F8N K;  1ID3 B;  1TZY C;  5AV9 A;  3VH6 W;  5DNN B;  1F66 A;  4KHA A;  5B1L D;  4KGC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...