1P3PC

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
total genus 32
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3pC00
2HUEB 3W98D 3W97D 4UUZB 4E45A 5BO0A 4JJNB 3AZHD 5B32D 3X1UB 3KUYC 5B40D 1TZYD 4E44A 5JRGA 1P3PD 3AZED 1M19A 4G92C 4WU8D 4X23C 3X1UD 4J8VD 3AYWD 5B2JA 3UTAA 5GXQC 1H3OA 1S32B 5B1MB 5AY8C 3WAAC 3AV1D 5AVBC 3C1CD 5CPIB 5BNVA 4Z66A 4JJND 3REJD 3TU4B 1U35C 1P34D 1P3GC 3O62C 5B0YA 2AROB 3C1BB 3UTBC 3LZ0A 3AZNC 3AN2A 5CPID 1P3AA 4Z2MG 3LELA 3UTBA 3AZNA 1P3LC 1S32D 5B31B 5CP6D 5B31C 3MGQD 5AV9C 3AZID 4QLCB 2FJ7B 2FJ7C 3X1TD 3AZLB 5AV5D 3LZ1C 3MGRC 3UT9A 1M18C 4KGCD 1F66B 3W97A 1HQ3C 4R8PB 3REKB 1M19C 1F66C 5B40A 5JRGC 4H9OB 4KGCB 4KUDA 5AVCC 3WA9A 4WU8A 4WZSB 1ZLAA 3LELC 3AZLD 5BO0B 5BT1D 3AFAA 1P3KD 1F1EA 4J8WA 5B1MD 4WNNB 5E5AD 1P3MD 5BS7C 4KHAB 1JFIB 3AZMC 4YS3C 5JA4B 1H3OB 5B0YD 1B67A 3AN2D 2HIOC 3X1SA 2NZDC 3KWQD 1P3IC 5B24D 3W96D 5GSUD 1AOIC 4XUJB 3AZHC 2CWEA 3TU4D 3MGRB 1P34B 1P3FB 1P3IA 3MGQA 3AZEC 4UUZA 4WU9D 3LZ0B 1HTAA 3MVDA 4QLCD 5E5AB 1P3MB 5AV6D 4EO5B 5CPKA 5FUGA 5B2IC 4KGCA 3WAAD 4H9OA 3REHC 3AZFC 5F99A 4ZUXA 1P3PB 4XZQD 4YS3A 1EQZB 1KX3A 4CAYB 5AV8D 3KUYB 3AV2D 3O62D 3VH5T 4ZUXC 4YM6D 4J8WC 3MNNC 3AZLA 3MNNB 2IO5B 3AZJD 1S32C 5DNNB 5B1LA 3MVDC 5C3IB 3KXBA 3MGQC 4WU8B 1P3AB 3AZHA 3B0DB 2YFVA 3MGSB 5DNMA 3W97B 1EQZA 1N1JB 5CP6B 4WU9B 1P3BB 3AZEA 1KX5A 1TZYB 4KHAA 5GT0D 3REIB 4J8VA 1TZYA 3AZKC 5JRGD 3AZMA 1P3FD 5DNND 4WU9A 1KX4C 5GSUB 3WKJB 3WTPB 4H9NB 2HUEC 3KWQB 4Z66D 1P34A 3C1CB 2CV5B 3C1CA 1ID3C 3WAAA 1WWIA 1P3BD 4JJNA 5GXQB 5GT3D 4XZQB 2CV5D 1F66A 3LZ0D 3KSYA 3V9RA 3AFAC 3W99D 5B32B 1ZLAC 1U35B 4WU8C 5B1LC 3B6FB 3AYWC 1S32A 1KX3B 5CP6A 3AZJA 5CHLB 3TU4C 4H9PB 1P3GB 3W97C 5F99B 3O62B 3AV1C 3NQJB 3AYWA 5AV8B 5B0ZB 3KUYD 3AV2B 5B0ZC 4G91C 3X1UC 5BNXA 2BYKB 3W99B 3A6NC 2RVQD 5GT0A 1P3LA 5CPIA 1U35A 5AVBD 3C1CC 2YFWB 5CPKC 1ID3A 1P3AD 5B1MA 1N1JA 3REHA 3AZFA 4Z5TC 3UTBD 3AZND 5GXQA 3WTPD 1HQ3B 3LZ1D 2AROD 3C1BD 5CPJD 5JRGB 3LELB 5GT0B 3RELB 5B33C 4H9RB 5GT3A 4Z5TA 5AV5A 5GSUA 3RELC 4LD9D 1F66D 3UT9D 2LY8A 1BH9A 4H9SA 3REIA 3A6NA 4NFTA 4KUDD 1P3OD 2NQBD 5B2JB 3UTAB 5C3IC 4XUJC 3AZHB 3A6NB 5AVCA 3WA9C 3W99A 5FUGB 4YS3D 5B40C 1KX3D 1M1AD 5B2IA 3R45A 5E5AA 1P3MA 3X1VD 4XZQA 1P3KC 1P3BC 4WV4B 4YM6A 3MGRA 3RELA 3WAAB 1P3OB 4J8XA 3AZIB 2NQBB 3W96A 5B24A 4KUDB 5AVCB 4J8UD 3WKJA 1HQ3A 5B33B 3VH6W 3X1SB 3AZJB 3VH5A 4JJNC 4NE3A 1P3PC 3NQUA 3KWQC 3LZ1A 1P3ID 3X1SC 1ID3B 4R8PD 3REKD 5AV6A 4LD9A 1KX5D 5B0ZD 3MVDB 1EQZD 4QLCC 4DRAA 3MGPC 4ZUXD 1P3FA 1ZLAB 1P34C 1P3GD 3REID 3B6GB 1WWSA 3A6ND 3X1TC 3O62A 5DNNA 2PYOB 4AWLB 3B6GD 4LD9B 2F8NB 3AZGB 4Z66B 5BNVB 1A7WA 3LJAB 3VH5W 5CP6C 2YFWA 4EO5C 5AY8A 3AZGC 5B31D 4YM6C 4G91B 5DNMC 3WTPE 3KXBD 1KX5B 1P3BA 3X1VB 3WKJC 4ZUXB 3AZJC 3MGRD 3AZLC 4J8XC 3RELD 5BT1C 3B0CT 4NE6A 4J8UA 1HQ3D 3B6FD 3B0CW 3W98C 5B0YB 4H9QA 3AZMD 5AV9A 2BYMB 2FJ7A 3MNNA 5B32C 3LJAD 1P3IB 1TAFB 5B0YC 5AVBB 4XUJA 4J8VB 5AY8B 1BH8A 5KDMA 4CSRB 4J8VC 1P3FC 3V9RB 2F8NA 3LZ0C 1Q9CA 1P3PA 5B33A 2PYOA 5KDMB 4WU9C 1KX4A 3REJB 1B6WA 4Z66C 1KU5A 5B2JD 3UTAD 5AV6C 2CV5A 1TZYC 1BH9B 5AVBA 3REJC 3AZKA 1U35D 1ID3D 2NZDD 3WTPA 5GSUC 1AOID 5GT3C 2AROA 3C1BA 5CPJA 3REHD 3AZFD 2CV5C 5GXQD 5GT3B 5AY8D 4G92B 3W99C 4ZBJC 3MGSD 3KUYA 1ULYA 3AZEB 1R4VA 4H9PA 4R8PC 3REKC 3W98A 2L5AA 3W98B 5CPIC 5B31G 1M19B 1P3OA 2NQBA 5B32A 1M18D 4KGCC 1TAFA 3X1UA 5B1LB 1P3LD 4HGAB 1M19D 4HGAC 5AV5B 2AROC 3C1BC 3UTBB 3AZNB 5F99C 3AV1A 5AVCD 4J8UB 5G49A 5AV5C 3REJA 4H9NA 2F8ND 2IO5C 1M1AA 4CAYA 3UT9C 3X1VA 5DNNC 2PYOD 1AOIB 1KX4D 4Z5TD 3UT9B 3WTPC 3WKJD 1BH8B 1M18B 4J8XD 4WNNA 4ZBJB 5BS7A 3LZ1B 1AOIA 3AN2C 3LELD 2BYKA 4LD9C 3X1TA 5B1MC 4H9RA 3AZIA 3AZKB 3MGPA 5B0ZA 3KWQA 2JSSA 1KX4B 3X1VC 4KUDC 1P3GA 3REHB 3AZFB 2HIOD 5JA4A 3TU4A 5B24C 3W96C 5B2ID 3AZMB 4X23D 3WA9D 1M18A 4J8UC 4NE5A 3AZGA 5B2JC 3AFAD 3UTAC 4XZQC 1P3KA 1M1AC 4J8WB 4YS3B 2YFVB 1ZLAD 1M1AB 2NZDB 5B31A 2F8NH 4J8WD 3MGPB 2RVQC 5CPKB 3KXBB 3NQJA 3AYWB 4M6BA 3B0DC 3MGSC 3X1TB 3AN2B 4R8PA 3REKA 1P3AC 3B0BA 5B2IB 3R45B 4Z5TB 1P3KB 3VH6A 4H9SC 5AV8C 2BYMA 3VH6T 3X1SD 3REIC 3AV2C 5AV6B 3B6FA 4Z2MH 4DRBA 5AV9D 3AZIC 2FJ7D 3MNND 3LJAA 5CPJC 4QLCA 5DNMB 1KX5C 1EQZC 5CPKD 3MGPD 1JFIA 3MVDD 5B24B 3W96B 4J8XB 3B6GA 5G49B 5DNMD 2F8NG 4X23B 5F99D 1BFMA 5BNXB 4H9QB 2HIOA 2HIOB 3AFAB 3MGQB 3B6GC 5B33D 4X23A 3WA9B 2PYOC 5AV8A 5GT0C 3AV2A 3AZGD 3B6FC 3AZKD 2NZDA 5B40B 3KXBC 3NQUB 3LJAC 3MGSA 1KX3C 5E5AC 1P3MC 4AWLC 4CSRA 1P3OC 2NQBC 5B1LD 1P3LB 3AV1B 2F8NK 4YM6B 5B32G 4XUJD 5AV9B 5CPJB
chains in the Genus database with same CATH superfamily
2HUEB 3W98D 2XD1A 3W97D 4UUZB 4E45A 5BO0A 4JJNB 3AZHD 5B32D 3X1UB 3KUYC 5B40D 1TZYD 4E44A 5JRGA 1P3PD 3AZED 1M19A 4G92C 4WU8D 4X23C 3X1UD 4J8VD 3AYWD 5B2JA 3UTAA 5GXQC 1H3OA 1S32B 5B1MB 5AY8C 3WAAC 3AV1D 5AVBC 3C1CD 5CPIB 5BNVA 4Z66A 4JJND 3REJD 3TU4B 1U35C 1P34D 1P3GC 3O62C 5B0YA 2AROB 3C1BB 2Y2GA 3LZ0A 3UTBC 3AZNC 3AN2A 5CPID 1P3AA 1Z2CB 4Z2MG 3LELA 3UTBA 3AZNA 1P3LC 1S32D 5B31B 5CP6D 5B31C 3MGQD 5AV9C 3AZID 4QLCB 2DQNC 2FJ7B 2FJ7C 3X1TD 3AZLB 5AV5D 3LZ1C 3MGRC 2Y2IA 3UT9A 1M18C 4KGCD 1F66B 3W97A 1HQ3C 4R8PB 3REKB 1M19C 1F66C 5B40A 5JRGC 4H9OB 4KGCB 4KUDA 1PZRA 5AVCC 3WA9A 4WU8A 4WZSB 1ZLAA 3LELC 3AZLD 5BO0B 5BT1D 3AFAA 1P3KD 1F1EA 4J8WA 5B1MD 4WNNB 5E5AD 1P3MD 5BS7C 4KHAB 1JFIB 3AZMC 4YS3C 5JA4B 1H3OB 5B0YD 1B67A 3AN2D 2HIOC 1W2EA 3X1SA 2NZDC 3KWQD 1P3IC 5B24D 3W96D 5GSUD 1AOIC 4XUJB 3AZHC 2CWEA 3TU4D 3MGRB 1P34B 1P3FB 1P3IA 3MGQA 3AZEC 4UUZA 4WU9D 3LZ0B 1HTAA 2G5HC 4QLCD 3MVDA 5E5AB 1P3MB 5AV6D 4EO5B 5CPKA 5FUGA 5B2IC 3H0MC 4KGCA 3WAAD 4H9OA 3REHC 3AZFC 5F99A 2UWXA 4ZUXA 1P3PB 4XZQD 4YS3A 1EQZB 1KX3A 4CAYB 2ZM5A 5AV8D 3KUYB 3AV2D 3O62D 3VH5T 4ZUXC 4UPKA 2Y2LA 4YM6D 4J8WC 3MNNC 3AZLA 3MNNB 2IO5B 3AZJD 1S32C 5DNNB 5B1LA 3MVDC 5C3IB 3KXBA 3MGQC 4WU8B 1P3AB 3AZHA 3B0DB 2YFVA 3MGSB 2J8PA 5DNMA 1EQZA 1N1JB 3W97B 5CP6B 4WU9B 1P3BB 3AZEA 1KX5A 3AL0C 1TZYB 4KHAA 5GT0D 3REIB 4J8VA 1TZYA 3AZKC 5JRGD 3AZMA 1P3FD 5DNND 4WU9A 1KX4C 2DF4C 5GSUB 3WKJB 3WTPB 4H9NB 2HUEC 3KWQB 4Z66D 1P34A 3C1CB 2CV5B 3C1CA 1ID3C 3WAAA 1WWIA 1P3BD 4JJNA 2JCHA 5GXQB 5GT3D 4XZQB 3KFUG 2CV5D 1F66A 3LZ0D 3KSYA 3V9RA 3AFAC 3W99D 5B32B 1ZLAC 1U35B 4WU8C 5B1LC 3B6FB 3AYWC 1S32A 4DQYB 1KX3B 5CP6A 3AZJA 3A1KA 5CHLB 3TU4C 4H9PB 1P3GB 3W97C 5F99B 3EPJA 3O62B 3AV1C 3NQJB 3AYWA 5AV8B 5B0ZB 3KUYD 3AV2B 5B0ZC 3H0LC 4G91C 3X1UC 5BNXA 2BYKB 3W99B 3A6NC 2RVQD 5GT0A 1P3LA 5CPIA 1U35A 5AVBD 3C1CC 2YFWB 5CPKC 1ID3A 1P3AD 5B1MA 1N1JA 3EPHA 3REHA 3AZFA 4Z5TC 3UTBD 3AZND 5GXQA 3WTPD 1HQ3B 2XD5A 2AROD 3LZ1D 3C1BD 5CPJD 2Y2OA 5JRGB 3LELB 5GT0B 3RELB 5B33C 4H9RB 5GT3A 4Z5TA 5AV5A 3F6TA 5GSUA 3RELC 4LD9D 1F66D 3UT9D 3EG5B 2LY8A 1BH9A 4H9SA 3REIA 3A6NA 4NFTA 4KUDD 1P3OD 2NQBD 5B2JB 3UTAB 5C3IC 4XUJC 3AZHB 3A6NB 5AVCA 3WA9C 3W99A 2VQRA 5FUGB 4YS3D 5B40C 1KX3D 1M1AD 5B2IA 3R45A 5E5AA 1P3MA 3X1VD 4XZQA 1P3KC 1P3BC 4WV4B 4YM6A 3MGRA 3RELA 3WAAB 1P3OB 4J8XA 3AZIB 2NQBB 3W96A 5B24A 4KUDB 5AVCB 4J8UD 3WKJA 1HQ3A 5B33B 3VH6W 3X1SB 3AZJB 3VH5A 4JJNC 4NE3A 1P3PC 3NQUA 3KWQC 3LZ1A 1P3ID 3X1SC 1ID3B 4R8PD 3REKD 5AV6A 4LD9A 1KX5D 1T3UA 2G5IC 5B0ZD 3MVDB 2Y2NA 1EQZD 4QLCC 4DRAA 3MGPC 4ZUXD 1P3FA 1ZLAB 1P34C 1P3GD 3REID 3B6GB 1WWSA 3A6ND 3X1TC 3O62A 5DNNA 2PYOB 4AWLB 3B6GD 4LD9B 2F8NB 3AZGB 4Z66B 5BNVB 1A7WA 3LJAB 3VH5W 5CP6C 2YFWA 4EO5C 5AY8A 3AZGC 5B31D 4YM6C 4G91B 5DNMC 3WTPE 3KXBD 1KX5B 1P3BA 3X1VB 3WKJC 4ZUXB 3AZJC 3MGRD 3AZLC 4J8XC 3RELD 5BT1C 3B0CT 4NE6A 4J8UA 1HQ3D 4WJ3C 3B6FD 2Y2HA 3B0CW 3W98C 5B0YB 4H9QA 3AZMD 5AV9A 2BYMB 3H0RC 3MNNA 5B32C 3LJAD 1P3IB 2FJ7A 1TAFB 5B0YC 5AVBB 4XUJA 4J8VB 5AY8B 1BH8A 2FFFB 2ZY5A 5KDMA 4CSRB 4J8VC 1P3FC 3V9RB 2F8NA 3LZ0C 1Q9CA 2W8SA 1P3PA 3A1IA 5B33A 2PYOA 5KDMB 4WU9C 1KX4A 3REJB 1B6WA 4Z66C 1KU5A 5B2JD 3UTAD 5AV6C 2CV5A 1TZYC 1BH9B 5AVBA 3REJC 3AZKA 1U35D 1ID3D 2NZDD 3WTPA 5GSUC 1AOID 5GT3C 2AROA 3C1BA 5CPJA 3REHD 3AZFD 2CV5C 5GXQD 5GT3B 5AY8D 4G92B 3W99C 4ZBJC 3MGSD 2Y2QA 3KUYA 1ULYA 3AZEB 1R4VA 4H9PA 4R8PC 3REKC 3W98A 2L5AA 3W98B 5CPIC 5B31G 1M19B 1P3OA 2NQBA 5B32A 1M18D 4KGCC 1TAFA 3IP4C 3X1UA 5B1LB 1P3LD 4HGAB 1M19D 2ZY3A 2ZY4A 4HGAC 5AV5B 2AROC 3C1BC 3UTBB 3AZNB 5F99C 3AV1A 5AVCD 4J8UB 5G49A 5AV5C 3REJA 4H9NA 3P5JB 2F8ND 2IO5C 1M1AA 4CAYA 3FDDA 3UT9C 3X1VA 5DNNC 2PYOD 1AOIB 1KX4D 4Z5TD 3UT9B 3WTPC 3WKJD 1BH8B 1M18B 4J8XD 4WNNA 4ZBJB 5BS7A 3LZ1B 1AOIA 3AN2C 3LELD 2BYKA 4LD9C 3X1TA 5B1MC 4H9RA 3AZIA 3AZKB 3MGPA 5B0ZA 3KWQA 2JSSA 1KX4B 3X1VC 3EPLA 4KUDC 1P3GA 3REHB 3AZFB 2HIOD 5JA4A 3TU4A 5B24C 3W96C 5B2ID 3AZMB 4X23D 3WA9D 2Y2PA 1M18A 4J8UC 4NE5A 3AZGA 5B2JC 3AFAD 2F2AC 4XZQC 3UTAC 1P3KA 4J8WB 1M1AC 4YS3B 2YFVB 1ZLAD 1M1AB 2NZDB 5B31A 2F8NH 2Y2JA 4J8WD 3MGPB 2RVQC 5CPKB 2RIQA 2Y2MA 3NQJA 3KXBB 3AYWB 4M6BA 3B0DC 3MGSC 3X1TB 3AN2B 4R8PA 3REKA 1P3AC 2Y2KA 3B0BA 5B2IB 3R45B 4Z5TB 1P3KB 2JE5A 3VH6A 4H9SC 5AV8C 2BYMA 3VH6T 3X1SD 3REIC 3AV2C 5AV6B 3B6FA 4Z2MH 4DRBA 5AV9D 3AZIC 2FJ7D 3MNND 3LJAA 5CPJC 4QLCA 5DNMB 1KX5C 3EPKA 1EQZC 5CPKD 3MGPD 1JFIA 3MVDD 5B24B 3W96B 4J8XB 3B6GA 5G49B 5DNMD 2F8NG 4X23B 5F99D 1BFMA 5BNXB 4H9QB 2HIOA 2HIOB 3AFAB 3MGQB 3B6GC 2ZY2A 5B33D 4X23A 3WA9B 2PYOC 2BG1A 5AV8A 5GT0C 3AV2A 3AZGD 3B6FC 3AZKD 2NZDA 5B40B 3KXBC 3NQUB 3LJAC 3MGSA 1KX3C 5E5AC 1P3MC 4AWLC 4CSRA 1P3OC 2NQBC 5B1LD 1P3LB 3AV1B 2F8NK 4YM6B 5B32G 4XUJD 5AV9B 5CPJB
chains in the Genus database with same CATH topology
2HUEB 3W98D 2XD1A 3W97D 4UUZB 4E45A 5BO0A 4JJNB 3AZHD 5B32D 3X1UB 3KUYC 5B40D 1TZYD 4E44A 5JRGA 1P3PD 3AZED 1M19A 4G92C 4WU8D 4X23C 3X1UD 4J8VD 3AYWD 5B2JA 3UTAA 5GXQC 1H3OA 1S32B 5B1MB 5AY8C 3WAAC 3AV1D 5AVBC 3C1CD 5CPIB 5BNVA 4Z66A 4JJND 3REJD 3TU4B 1U35C 1P34D 1P3GC 3O62C 5B0YA 2AROB 3C1BB 2Y2GA 3LZ0A 3UTBC 3AZNC 3AN2A 5CPID 1P3AA 1Z2CB 4Z2MG 3LELA 3UTBA 3AZNA 1P3LC 1S32D 5B31B 5CP6D 5B31C 3MGQD 5AV9C 3AZID 4QLCB 2DQNC 2FJ7B 2FJ7C 3X1TD 3AZLB 5AV5D 3LZ1C 3MGRC 2Y2IA 3UT9A 1M18C 4KGCD 1F66B 3W97A 1HQ3C 4R8PB 3REKB 1M19C 1F66C 5B40A 5JRGC 4H9OB 4KGCB 4KUDA 1PZRA 5AVCC 3WA9A 4WU8A 4WZSB 1ZLAA 3LELC 3AZLD 5BO0B 5BT1D 3AFAA 1P3KD 1F1EA 4J8WA 5B1MD 4WNNB 5E5AD 1P3MD 5BS7C 4KHAB 1JFIB 3AZMC 4YS3C 5JA4B 1H3OB 5B0YD 1B67A 3AN2D 2HIOC 1W2EA 3X1SA 2NZDC 3KWQD 1P3IC 5B24D 3W96D 5GSUD 1AOIC 4XUJB 3AZHC 2CWEA 3TU4D 3MGRB 1P34B 1P3FB 1P3IA 3MGQA 3AZEC 4UUZA 4WU9D 3LZ0B 1HTAA 2G5HC 4QLCD 3MVDA 5E5AB 1P3MB 5AV6D 4EO5B 5CPKA 5FUGA 5B2IC 3H0MC 4KGCA 3WAAD 4H9OA 3REHC 3AZFC 5F99A 2UWXA 4ZUXA 1P3PB 4XZQD 4YS3A 1EQZB 1KX3A 4CAYB 2ZM5A 5AV8D 3KUYB 3AV2D 3O62D 3VH5T 4ZUXC 4UPKA 2Y2LA 4YM6D 4J8WC 3MNNC 3AZLA 3MNNB 2IO5B 3AZJD 1S32C 5DNNB 5B1LA 3MVDC 5C3IB 3KXBA 3MGQC 4WU8B 1P3AB 3AZHA 3B0DB 2YFVA 3MGSB 2J8PA 5DNMA 1EQZA 1N1JB 3W97B 5CP6B 4WU9B 1P3BB 3AZEA 1KX5A 3AL0C 1TZYB 4KHAA 5GT0D 3REIB 4J8VA 1TZYA 3AZKC 5JRGD 3AZMA 1P3FD 5DNND 4WU9A 1KX4C 2DF4C 5GSUB 3WKJB 3WTPB 4H9NB 2HUEC 3KWQB 4Z66D 1P34A 3C1CB 2CV5B 3C1CA 1ID3C 3WAAA 1WWIA 1P3BD 4JJNA 2JCHA 5GXQB 5GT3D 4XZQB 3KFUG 2CV5D 1F66A 3LZ0D 3KSYA 3V9RA 3AFAC 3W99D 5B32B 1ZLAC 1U35B 4WU8C 5B1LC 3B6FB 3AYWC 1S32A 4DQYB 1KX3B 5CP6A 3AZJA 3A1KA 5CHLB 3TU4C 4H9PB 1P3GB 3W97C 5F99B 3EPJA 3O62B 3AV1C 3NQJB 3AYWA 5AV8B 5B0ZB 3KUYD 3AV2B 5B0ZC 3H0LC 4G91C 3X1UC 5BNXA 2BYKB 3W99B 3A6NC 2RVQD 5GT0A 1P3LA 5CPIA 1U35A 5AVBD 3C1CC 2YFWB 5CPKC 1ID3A 1P3AD 5B1MA 1N1JA 3EPHA 3REHA 3AZFA 4Z5TC 3UTBD 3AZND 5GXQA 3WTPD 1HQ3B 2XD5A 2AROD 3LZ1D 3C1BD 5CPJD 2Y2OA 5JRGB 3LELB 5GT0B 3RELB 5B33C 4H9RB 5GT3A 4Z5TA 5AV5A 3F6TA 5GSUA 3RELC 4LD9D 1F66D 3UT9D 3EG5B 2LY8A 1BH9A 4H9SA 3REIA 3A6NA 4NFTA 4KUDD 1P3OD 2NQBD 5B2JB 3UTAB 5C3IC 4XUJC 3AZHB 3A6NB 5AVCA 3WA9C 3W99A 2VQRA 5FUGB 4YS3D 5B40C 1KX3D 1M1AD 5B2IA 3R45A 5E5AA 1P3MA 3X1VD 4XZQA 1P3KC 1P3BC 4WV4B 4YM6A 3MGRA 3RELA 3WAAB 1P3OB 4J8XA 3AZIB 2NQBB 3W96A 5B24A 4KUDB 5AVCB 4J8UD 3WKJA 1HQ3A 5B33B 3VH6W 3X1SB 3AZJB 3VH5A 4JJNC 4NE3A 1P3PC 3NQUA 3KWQC 3LZ1A 1P3ID 3X1SC 1ID3B 4R8PD 3REKD 5AV6A 4LD9A 1KX5D 1T3UA 2G5IC 5B0ZD 3MVDB 2Y2NA 1EQZD 4QLCC 4DRAA 3MGPC 4ZUXD 1P3FA 1ZLAB 1P34C 1P3GD 3REID 3B6GB 1WWSA 3A6ND 3X1TC 3O62A 5DNNA 2PYOB 4AWLB 3B6GD 4LD9B 2F8NB 3AZGB 4Z66B 5BNVB 1A7WA 3LJAB 3VH5W 5CP6C 2YFWA 4EO5C 5AY8A 3AZGC 5B31D 4YM6C 4G91B 5DNMC 3WTPE 3KXBD 1KX5B 1P3BA 3X1VB 3WKJC 4ZUXB 3AZJC 3MGRD 3AZLC 4J8XC 3RELD 5BT1C 3B0CT 4NE6A 4J8UA 1HQ3D 4WJ3C 3B6FD 2Y2HA 3B0CW 3W98C 5B0YB 4H9QA 3AZMD 5AV9A 2BYMB 3H0RC 3MNNA 5B32C 3LJAD 1P3IB 2FJ7A 1TAFB 5B0YC 5AVBB 4XUJA 4J8VB 5AY8B 1BH8A 2FFFB 2ZY5A 5KDMA 4CSRB 4J8VC 1P3FC 3V9RB 2F8NA 3LZ0C 1Q9CA 2W8SA 1P3PA 3A1IA 5B33A 2PYOA 5KDMB 4WU9C 1KX4A 3REJB 1B6WA 4Z66C 1KU5A 5B2JD 3UTAD 5AV6C 2CV5A 1TZYC 1BH9B 5AVBA 3REJC 3AZKA 1U35D 1ID3D 2NZDD 3WTPA 5GSUC 1AOID 5GT3C 2AROA 3C1BA 5CPJA 3REHD 3AZFD 2CV5C 5GXQD 5GT3B 5AY8D 4G92B 3W99C 4ZBJC 3MGSD 2Y2QA 3KUYA 1ULYA 3AZEB 1R4VA 4H9PA 4R8PC 3REKC 3W98A 2L5AA 3W98B 5CPIC 5B31G 1M19B 1P3OA 2NQBA 5B32A 1M18D 4KGCC 1TAFA 3IP4C 3X1UA 5B1LB 1P3LD 4HGAB 1M19D 2ZY3A 2ZY4A 4HGAC 5AV5B 2AROC 3C1BC 3UTBB 3AZNB 5F99C 3AV1A 5AVCD 4J8UB 5G49A 5AV5C 3REJA 4H9NA 3P5JB 2F8ND 2IO5C 1M1AA 4CAYA 3FDDA 3UT9C 3X1VA 5DNNC 2PYOD 1AOIB 1KX4D 4Z5TD 3UT9B 3WTPC 3WKJD 1BH8B 1M18B 4J8XD 4WNNA 4ZBJB 5BS7A 3LZ1B 1AOIA 3AN2C 3LELD 2BYKA 4LD9C 3X1TA 5B1MC 4H9RA 3AZIA 3AZKB 3MGPA 5B0ZA 3KWQA 2JSSA 1KX4B 3X1VC 3EPLA 4KUDC 1P3GA 3REHB 3AZFB 2HIOD 5JA4A 3TU4A 5B24C 3W96C 5B2ID 3AZMB 4X23D 3WA9D 2Y2PA 1M18A 4J8UC 4NE5A 3AZGA 5B2JC 3AFAD 2F2AC 4XZQC 3UTAC 1P3KA 4J8WB 1M1AC 4YS3B 2YFVB 1ZLAD 1M1AB 2NZDB 5B31A 2F8NH 2Y2JA 4J8WD 3MGPB 2RVQC 5CPKB 2RIQA 2Y2MA 3NQJA 3KXBB 3AYWB 4M6BA 3B0DC 3MGSC 3X1TB 3AN2B 4R8PA 3REKA 1P3AC 2Y2KA 3B0BA 5B2IB 3R45B 4Z5TB 1P3KB 2JE5A 3VH6A 4H9SC 5AV8C 2BYMA 3VH6T 3X1SD 3REIC 3AV2C 5AV6B 3B6FA 4Z2MH 4DRBA 5AV9D 3AZIC 2FJ7D 3MNND 3LJAA 5CPJC 4QLCA 5DNMB 1KX5C 3EPKA 1EQZC 5CPKD 3MGPD 1JFIA 3MVDD 5B24B 3W96B 4J8XB 3B6GA 5G49B 5DNMD 2F8NG 4X23B 5F99D 1BFMA 5BNXB 4H9QB 2HIOA 2HIOB 3AFAB 3MGQB 3B6GC 2ZY2A 5B33D 4X23A 3WA9B 2PYOC 2BG1A 5AV8A 5GT0C 3AV2A 3AZGD 3B6FC 3AZKD 2NZDA 5B40B 3KXBC 3NQUB 3LJAC 3MGSA 1KX3C 5E5AC 1P3MC 4AWLC 4CSRA 1P3OC 2NQBC 5B1LD 1P3LB 3AV1B 2F8NK 4YM6B 5B32G 4XUJD 5AV9B 5CPJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HUE B;  3W98 D;  3W97 D;  4UUZ B;  4E45 A;  5BO0 A;  4JJN B;  3AZH D;  5B32 D;  3X1U B;  3KUY C;  5B40 D;  1TZY D;  4E44 A;  5JRG A;  1P3P D;  3AZE D;  1M19 A;  4G92 C;  4WU8 D;  4X23 C;  3X1U D;  4J8V D;  3AYW D;  5B2J A;  3UTA A;  5GXQ C;  1H3O A;  1S32 B;  5B1M B;  5AY8 C;  3WAA C;  3AV1 D;  5AVB C;  3C1C D;  5CPI B;  5BNV A;  4Z66 A;  4JJN D;  3REJ D;  3TU4 B;  1U35 C;  1P34 D;  1P3G C;  3O62 C;  5B0Y A;  2ARO B;  3C1B B;  3UTB C;  3LZ0 A;  3AZN C;  3AN2 A;  5CPI D;  1P3A A;  4Z2M G;  3LEL A;  3UTB A;  3AZN A;  1P3L C;  1S32 D;  5B31 B;  5CP6 D;  5B31 C;  3MGQ D;  5AV9 C;  3AZI D;  4QLC B;  2FJ7 B;  2FJ7 C;  3X1T D;  3AZL B;  5AV5 D;  3LZ1 C;  3MGR C;  3UT9 A;  1M18 C;  4KGC D;  1F66 B;  3W97 A;  1HQ3 C;  4R8P B;  3REK B;  1M19 C;  1F66 C;  5B40 A;  5JRG C;  4H9O B;  4KGC B;  4KUD A;  5AVC C;  3WA9 A;  4WU8 A;  4WZS B;  1ZLA A;  3LEL C;  3AZL D;  5BO0 B;  5BT1 D;  3AFA A;  1P3K D;  1F1E A;  4J8W A;  5B1M D;  4WNN B;  5E5A D;  1P3M D;  5BS7 C;  4KHA B;  1JFI B;  3AZM C;  4YS3 C;  5JA4 B;  1H3O B;  5B0Y D;  1B67 A;  3AN2 D;  2HIO C;  3X1S A;  2NZD C;  3KWQ D;  1P3I C;  5B24 D;  3W96 D;  5GSU D;  1AOI C;  4XUJ B;  3AZH C;  2CWE A;  3TU4 D;  3MGR B;  1P34 B;  1P3F B;  1P3I A;  3MGQ A;  3AZE C;  4UUZ A;  4WU9 D;  3LZ0 B;  1HTA A;  3MVD A;  4QLC D;  5E5A B;  1P3M B;  5AV6 D;  4EO5 B;  5CPK A;  5FUG A;  5B2I C;  4KGC A;  3WAA D;  4H9O A;  3REH C;  3AZF C;  5F99 A;  4ZUX A;  1P3P B;  4XZQ D;  4YS3 A;  1EQZ B;  1KX3 A;  4CAY B;  5AV8 D;  3KUY B;  3AV2 D;  3O62 D;  3VH5 T;  4ZUX C;  4YM6 D;  4J8W C;  3MNN C;  3AZL A;  3MNN B;  2IO5 B;  3AZJ D;  1S32 C;  5DNN B;  5B1L A;  3MVD C;  5C3I B;  3KXB A;  3MGQ C;  4WU8 B;  1P3A B;  3AZH A;  3B0D B;  2YFV A;  3MGS B;  5DNM A;  3W97 B;  1EQZ A;  1N1J B;  5CP6 B;  4WU9 B;  1P3B B;  3AZE A;  1KX5 A;  1TZY B;  4KHA A;  5GT0 D;  3REI B;  4J8V A;  1TZY A;  3AZK C;  5JRG D;  3AZM A;  1P3F D;  5DNN D;  4WU9 A;  1KX4 C;  5GSU B;  3WKJ B;  3WTP B;  4H9N B;  2HUE C;  3KWQ B;  4Z66 D;  1P34 A;  3C1C B;  2CV5 B;  3C1C A;  1ID3 C;  3WAA A;  1WWI A;  1P3B D;  4JJN A;  5GXQ B;  5GT3 D;  4XZQ B;  2CV5 D;  1F66 A;  3LZ0 D;  3KSY A;  3V9R A;  3AFA C;  3W99 D;  5B32 B;  1ZLA C;  1U35 B;  4WU8 C;  5B1L C;  3B6F B;  3AYW C;  1S32 A;  1KX3 B;  5CP6 A;  3AZJ A;  5CHL B;  3TU4 C;  4H9P B;  1P3G B;  3W97 C;  5F99 B;  3O62 B;  3AV1 C;  3NQJ B;  3AYW A;  5AV8 B;  5B0Z B;  3KUY D;  3AV2 B;  5B0Z C;  4G91 C;  3X1U C;  5BNX A;  2BYK B;  3W99 B;  3A6N C;  2RVQ D;  5GT0 A;  1P3L A;  5CPI A;  1U35 A;  5AVB D;  3C1C C;  2YFW B;  5CPK C;  1ID3 A;  1P3A D;  5B1M A;  1N1J A;  3REH A;  3AZF A;  4Z5T C;  3UTB D;  3AZN D;  5GXQ A;  3WTP D;  1HQ3 B;  3LZ1 D;  2ARO D;  3C1B D;  5CPJ D;  5JRG B;  3LEL B;  5GT0 B;  3REL B;  5B33 C;  4H9R B;  5GT3 A;  4Z5T A;  5AV5 A;  5GSU A;  3REL C;  4LD9 D;  1F66 D;  3UT9 D;  2LY8 A;  1BH9 A;  4H9S A;  3REI A;  3A6N A;  4NFT A;  4KUD D;  1P3O D;  2NQB D;  5B2J B;  3UTA B;  5C3I C;  4XUJ C;  3AZH B;  3A6N B;  5AVC A;  3WA9 C;  3W99 A;  5FUG B;  4YS3 D;  5B40 C;  1KX3 D;  1M1A D;  5B2I A;  3R45 A;  5E5A A;  1P3M A;  3X1V D;  4XZQ A;  1P3K C;  1P3B C;  4WV4 B;  4YM6 A;  3MGR A;  3REL A;  3WAA B;  1P3O B;  4J8X A;  3AZI B;  2NQB B;  3W96 A;  5B24 A;  4KUD B;  5AVC B;  4J8U D;  3WKJ A;  1HQ3 A;  5B33 B;  3VH6 W;  3X1S B;  3AZJ B;  3VH5 A;  4JJN C;  4NE3 A;  1P3P C;  3NQU A;  3KWQ C;  3LZ1 A;  1P3I D;  3X1S C;  1ID3 B;  4R8P D;  3REK D;  5AV6 A;  4LD9 A;  1KX5 D;  5B0Z D;  3MVD B;  1EQZ D;  4QLC C;  4DRA A;  3MGP C;  4ZUX D;  1P3F A;  1ZLA B;  1P34 C;  1P3G D;  3REI D;  3B6G B;  1WWS A;  3A6N D;  3X1T C;  3O62 A;  5DNN A;  2PYO B;  4AWL B;  3B6G D;  4LD9 B;  2F8N B;  3AZG B;  4Z66 B;  5BNV B;  1A7W A;  3LJA B;  3VH5 W;  5CP6 C;  2YFW A;  4EO5 C;  5AY8 A;  3AZG C;  5B31 D;  4YM6 C;  4G91 B;  5DNM C;  3WTP E;  3KXB D;  1KX5 B;  1P3B A;  3X1V B;  3WKJ C;  4ZUX B;  3AZJ C;  3MGR D;  3AZL C;  4J8X C;  3REL D;  5BT1 C;  3B0C T;  4NE6 A;  4J8U A;  1HQ3 D;  3B6F D;  3B0C W;  3W98 C;  5B0Y B;  4H9Q A;  3AZM D;  5AV9 A;  2BYM B;  2FJ7 A;  3MNN A;  5B32 C;  3LJA D;  1P3I B;  1TAF B;  5B0Y C;  5AVB B;  4XUJ A;  4J8V B;  5AY8 B;  1BH8 A;  5KDM A;  4CSR B;  4J8V C;  1P3F C;  3V9R B;  2F8N A;  3LZ0 C;  1Q9C A;  1P3P A;  5B33 A;  2PYO A;  5KDM B;  4WU9 C;  1KX4 A;  3REJ B;  1B6W A;  4Z66 C;  1KU5 A;  5B2J D;  3UTA D;  5AV6 C;  2CV5 A;  1TZY C;  1BH9 B;  5AVB A;  3REJ C;  3AZK A;  1U35 D;  1ID3 D;  2NZD D;  3WTP A;  5GSU C;  1AOI D;  5GT3 C;  2ARO A;  3C1B A;  5CPJ A;  3REH D;  3AZF D;  2CV5 C;  5GXQ D;  5GT3 B;  5AY8 D;  4G92 B;  3W99 C;  4ZBJ C;  3MGS D;  3KUY A;  1ULY A;  3AZE B;  1R4V A;  4H9P A;  4R8P C;  3REK C;  3W98 A;  2L5A A;  3W98 B;  5CPI C;  5B31 G;  1M19 B;  1P3O A;  2NQB A;  5B32 A;  1M18 D;  4KGC C;  1TAF A;  3X1U A;  5B1L B;  1P3L D;  4HGA B;  1M19 D;  4HGA C;  5AV5 B;  2ARO C;  3C1B C;  3UTB B;  3AZN B;  5F99 C;  3AV1 A;  5AVC D;  4J8U B;  5G49 A;  5AV5 C;  3REJ A;  4H9N A;  2F8N D;  2IO5 C;  1M1A A;  4CAY A;  3UT9 C;  3X1V A;  5DNN C;  2PYO D;  1AOI B;  1KX4 D;  4Z5T D;  3UT9 B;  3WTP C;  3WKJ D;  1BH8 B;  1M18 B;  4J8X D;  4WNN A;  4ZBJ B;  5BS7 A;  3LZ1 B;  1AOI A;  3AN2 C;  3LEL D;  2BYK A;  4LD9 C;  3X1T A;  5B1M C;  4H9R A;  3AZI A;  3AZK B;  3MGP A;  5B0Z A;  3KWQ A;  2JSS A;  1KX4 B;  3X1V C;  4KUD C;  1P3G A;  3REH B;  3AZF B;  2HIO D;  5JA4 A;  3TU4 A;  5B24 C;  3W96 C;  5B2I D;  3AZM B;  4X23 D;  3WA9 D;  1M18 A;  4J8U C;  4NE5 A;  3AZG A;  5B2J C;  3AFA D;  3UTA C;  4XZQ C;  1P3K A;  1M1A C;  4J8W B;  4YS3 B;  2YFV B;  1ZLA D;  1M1A B;  2NZD B;  5B31 A;  2F8N H;  4J8W D;  3MGP B;  2RVQ C;  5CPK B;  3KXB B;  3NQJ A;  3AYW B;  4M6B A;  3B0D C;  3MGS C;  3X1T B;  3AN2 B;  4R8P A;  3REK A;  1P3A C;  3B0B A;  5B2I B;  3R45 B;  4Z5T B;  1P3K B;  3VH6 A;  4H9S C;  5AV8 C;  2BYM A;  3VH6 T;  3X1S D;  3REI C;  3AV2 C;  5AV6 B;  3B6F A;  4Z2M H;  4DRB A;  5AV9 D;  3AZI C;  2FJ7 D;  3MNN D;  3LJA A;  5CPJ C;  4QLC A;  5DNM B;  1KX5 C;  1EQZ C;  5CPK D;  3MGP D;  1JFI A;  3MVD D;  5B24 B;  3W96 B;  4J8X B;  3B6G A;  5G49 B;  5DNM D;  2F8N G;  4X23 B;  5F99 D;  1BFM A;  5BNX B;  4H9Q B;  2HIO A;  2HIO B;  3AFA B;  3MGQ B;  3B6G C;  5B33 D;  4X23 A;  3WA9 B;  2PYO C;  5AV8 A;  5GT0 C;  3AV2 A;  3AZG D;  3B6F C;  3AZK D;  2NZD A;  5B40 B;  3KXB C;  3NQU B;  3LJA C;  3MGS A;  1KX3 C;  5E5A C;  1P3M C;  4AWL C;  4CSR A;  1P3O C;  2NQB C;  5B1L D;  1P3L B;  3AV1 B;  2F8N K;  4YM6 B;  5B32 G;  4XUJ D;  5AV9 B;  5CPJ B; 
#chains in the Genus database with same CATH topology
 2HUE B;  3W98 D;  2XD1 A;  3W97 D;  4UUZ B;  4E45 A;  5BO0 A;  4JJN B;  3AZH D;  5B32 D;  3X1U B;  3KUY C;  5B40 D;  1TZY D;  4E44 A;  5JRG A;  1P3P D;  3AZE D;  1M19 A;  4G92 C;  4WU8 D;  4X23 C;  3X1U D;  4J8V D;  3AYW D;  5B2J A;  3UTA A;  5GXQ C;  1H3O A;  1S32 B;  5B1M B;  5AY8 C;  3WAA C;  3AV1 D;  5AVB C;  3C1C D;  5CPI B;  5BNV A;  4Z66 A;  4JJN D;  3REJ D;  3TU4 B;  1U35 C;  1P34 D;  1P3G C;  3O62 C;  5B0Y A;  2ARO B;  3C1B B;  2Y2G A;  3LZ0 A;  3UTB C;  3AZN C;  3AN2 A;  5CPI D;  1P3A A;  1Z2C B;  4Z2M G;  3LEL A;  3UTB A;  3AZN A;  1P3L C;  1S32 D;  5B31 B;  5CP6 D;  5B31 C;  3MGQ D;  5AV9 C;  3AZI D;  4QLC B;  2DQN C;  2FJ7 B;  2FJ7 C;  3X1T D;  3AZL B;  5AV5 D;  3LZ1 C;  3MGR C;  2Y2I A;  3UT9 A;  1M18 C;  4KGC D;  1F66 B;  3W97 A;  1HQ3 C;  4R8P B;  3REK B;  1M19 C;  1F66 C;  5B40 A;  5JRG C;  4H9O B;  4KGC B;  4KUD A;  1PZR A;  5AVC C;  3WA9 A;  4WU8 A;  4WZS B;  1ZLA A;  3LEL C;  3AZL D;  5BO0 B;  5BT1 D;  3AFA A;  1P3K D;  1F1E A;  4J8W A;  5B1M D;  4WNN B;  5E5A D;  1P3M D;  5BS7 C;  4KHA B;  1JFI B;  3AZM C;  4YS3 C;  5JA4 B;  1H3O B;  5B0Y D;  1B67 A;  3AN2 D;  2HIO C;  1W2E A;  3X1S A;  2NZD C;  3KWQ D;  1P3I C;  5B24 D;  3W96 D;  5GSU D;  1AOI C;  4XUJ B;  3AZH C;  2CWE A;  3TU4 D;  3MGR B;  1P34 B;  1P3F B;  1P3I A;  3MGQ A;  3AZE C;  4UUZ A;  4WU9 D;  3LZ0 B;  1HTA A;  2G5H C;  4QLC D;  3MVD A;  5E5A B;  1P3M B;  5AV6 D;  4EO5 B;  5CPK A;  5FUG A;  5B2I C;  3H0M C;  4KGC A;  3WAA D;  4H9O A;  3REH C;  3AZF C;  5F99 A;  2UWX A;  4ZUX A;  1P3P B;  4XZQ D;  4YS3 A;  1EQZ B;  1KX3 A;  4CAY B;  2ZM5 A;  5AV8 D;  3KUY B;  3AV2 D;  3O62 D;  3VH5 T;  4ZUX C;  4UPK A;  2Y2L A;  4YM6 D;  4J8W C;  3MNN C;  3AZL A;  3MNN B;  2IO5 B;  3AZJ D;  1S32 C;  5DNN B;  5B1L A;  3MVD C;  5C3I B;  3KXB A;  3MGQ C;  4WU8 B;  1P3A B;  3AZH A;  3B0D B;  2YFV A;  3MGS B;  2J8P A;  5DNM A;  1EQZ A;  1N1J B;  3W97 B;  5CP6 B;  4WU9 B;  1P3B B;  3AZE A;  1KX5 A;  3AL0 C;  1TZY B;  4KHA A;  5GT0 D;  3REI B;  4J8V A;  1TZY A;  3AZK C;  5JRG D;  3AZM A;  1P3F D;  5DNN D;  4WU9 A;  1KX4 C;  2DF4 C;  5GSU B;  3WKJ B;  3WTP B;  4H9N B;  2HUE C;  3KWQ B;  4Z66 D;  1P34 A;  3C1C B;  2CV5 B;  3C1C A;  1ID3 C;  3WAA A;  1WWI A;  1P3B D;  4JJN A;  2JCH A;  5GXQ B;  5GT3 D;  4XZQ B;  3KFU G;  2CV5 D;  1F66 A;  3LZ0 D;  3KSY A;  3V9R A;  3AFA C;  3W99 D;  5B32 B;  1ZLA C;  1U35 B;  4WU8 C;  5B1L C;  3B6F B;  3AYW C;  1S32 A;  4DQY B;  1KX3 B;  5CP6 A;  3AZJ A;  3A1K A;  5CHL B;  3TU4 C;  4H9P B;  1P3G B;  3W97 C;  5F99 B;  3EPJ A;  3O62 B;  3AV1 C;  3NQJ B;  3AYW A;  5AV8 B;  5B0Z B;  3KUY D;  3AV2 B;  5B0Z C;  3H0L C;  4G91 C;  3X1U C;  5BNX A;  2BYK B;  3W99 B;  3A6N C;  2RVQ D;  5GT0 A;  1P3L A;  5CPI A;  1U35 A;  5AVB D;  3C1C C;  2YFW B;  5CPK C;  1ID3 A;  1P3A D;  5B1M A;  1N1J A;  3EPH A;  3REH A;  3AZF A;  4Z5T C;  3UTB D;  3AZN D;  5GXQ A;  3WTP D;  1HQ3 B;  2XD5 A;  2ARO D;  3LZ1 D;  3C1B D;  5CPJ D;  2Y2O A;  5JRG B;  3LEL B;  5GT0 B;  3REL B;  5B33 C;  4H9R B;  5GT3 A;  4Z5T A;  5AV5 A;  3F6T A;  5GSU A;  3REL C;  4LD9 D;  1F66 D;  3UT9 D;  3EG5 B;  2LY8 A;  1BH9 A;  4H9S A;  3REI A;  3A6N A;  4NFT A;  4KUD D;  1P3O D;  2NQB D;  5B2J B;  3UTA B;  5C3I C;  4XUJ C;  3AZH B;  3A6N B;  5AVC A;  3WA9 C;  3W99 A;  2VQR A;  5FUG B;  4YS3 D;  5B40 C;  1KX3 D;  1M1A D;  5B2I A;  3R45 A;  5E5A A;  1P3M A;  3X1V D;  4XZQ A;  1P3K C;  1P3B C;  4WV4 B;  4YM6 A;  3MGR A;  3REL A;  3WAA B;  1P3O B;  4J8X A;  3AZI B;  2NQB B;  3W96 A;  5B24 A;  4KUD B;  5AVC B;  4J8U D;  3WKJ A;  1HQ3 A;  5B33 B;  3VH6 W;  3X1S B;  3AZJ B;  3VH5 A;  4JJN C;  4NE3 A;  1P3P C;  3NQU A;  3KWQ C;  3LZ1 A;  1P3I D;  3X1S C;  1ID3 B;  4R8P D;  3REK D;  5AV6 A;  4LD9 A;  1KX5 D;  1T3U A;  2G5I C;  5B0Z D;  3MVD B;  2Y2N A;  1EQZ D;  4QLC C;  4DRA A;  3MGP C;  4ZUX D;  1P3F A;  1ZLA B;  1P34 C;  1P3G D;  3REI D;  3B6G B;  1WWS A;  3A6N D;  3X1T C;  3O62 A;  5DNN A;  2PYO B;  4AWL B;  3B6G D;  4LD9 B;  2F8N B;  3AZG B;  4Z66 B;  5BNV B;  1A7W A;  3LJA B;  3VH5 W;  5CP6 C;  2YFW A;  4EO5 C;  5AY8 A;  3AZG C;  5B31 D;  4YM6 C;  4G91 B;  5DNM C;  3WTP E;  3KXB D;  1KX5 B;  1P3B A;  3X1V B;  3WKJ C;  4ZUX B;  3AZJ C;  3MGR D;  3AZL C;  4J8X C;  3REL D;  5BT1 C;  3B0C T;  4NE6 A;  4J8U A;  1HQ3 D;  4WJ3 C;  3B6F D;  2Y2H A;  3B0C W;  3W98 C;  5B0Y B;  4H9Q A;  3AZM D;  5AV9 A;  2BYM B;  3H0R C;  3MNN A;  5B32 C;  3LJA D;  1P3I B;  2FJ7 A;  1TAF B;  5B0Y C;  5AVB B;  4XUJ A;  4J8V B;  5AY8 B;  1BH8 A;  2FFF B;  2ZY5 A;  5KDM A;  4CSR B;  4J8V C;  1P3F C;  3V9R B;  2F8N A;  3LZ0 C;  1Q9C A;  2W8S A;  1P3P A;  3A1I A;  5B33 A;  2PYO A;  5KDM B;  4WU9 C;  1KX4 A;  3REJ B;  1B6W A;  4Z66 C;  1KU5 A;  5B2J D;  3UTA D;  5AV6 C;  2CV5 A;  1TZY C;  1BH9 B;  5AVB A;  3REJ C;  3AZK A;  1U35 D;  1ID3 D;  2NZD D;  3WTP A;  5GSU C;  1AOI D;  5GT3 C;  2ARO A;  3C1B A;  5CPJ A;  3REH D;  3AZF D;  2CV5 C;  5GXQ D;  5GT3 B;  5AY8 D;  4G92 B;  3W99 C;  4ZBJ C;  3MGS D;  2Y2Q A;  3KUY A;  1ULY A;  3AZE B;  1R4V A;  4H9P A;  4R8P C;  3REK C;  3W98 A;  2L5A A;  3W98 B;  5CPI C;  5B31 G;  1M19 B;  1P3O A;  2NQB A;  5B32 A;  1M18 D;  4KGC C;  1TAF A;  3IP4 C;  3X1U A;  5B1L B;  1P3L D;  4HGA B;  1M19 D;  2ZY3 A;  2ZY4 A;  4HGA C;  5AV5 B;  2ARO C;  3C1B C;  3UTB B;  3AZN B;  5F99 C;  3AV1 A;  5AVC D;  4J8U B;  5G49 A;  5AV5 C;  3REJ A;  4H9N A;  3P5J B;  2F8N D;  2IO5 C;  1M1A A;  4CAY A;  3FDD A;  3UT9 C;  3X1V A;  5DNN C;  2PYO D;  1AOI B;  1KX4 D;  4Z5T D;  3UT9 B;  3WTP C;  3WKJ D;  1BH8 B;  1M18 B;  4J8X D;  4WNN A;  4ZBJ B;  5BS7 A;  3LZ1 B;  1AOI A;  3AN2 C;  3LEL D;  2BYK A;  4LD9 C;  3X1T A;  5B1M C;  4H9R A;  3AZI A;  3AZK B;  3MGP A;  5B0Z A;  3KWQ A;  2JSS A;  1KX4 B;  3X1V C;  3EPL A;  4KUD C;  1P3G A;  3REH B;  3AZF B;  2HIO D;  5JA4 A;  3TU4 A;  5B24 C;  3W96 C;  5B2I D;  3AZM B;  4X23 D;  3WA9 D;  2Y2P A;  1M18 A;  4J8U C;  4NE5 A;  3AZG A;  5B2J C;  3AFA D;  2F2A C;  4XZQ C;  3UTA C;  1P3K A;  4J8W B;  1M1A C;  4YS3 B;  2YFV B;  1ZLA D;  1M1A B;  2NZD B;  5B31 A;  2F8N H;  2Y2J A;  4J8W D;  3MGP B;  2RVQ C;  5CPK B;  2RIQ A;  2Y2M A;  3NQJ A;  3KXB B;  3AYW B;  4M6B A;  3B0D C;  3MGS C;  3X1T B;  3AN2 B;  4R8P A;  3REK A;  1P3A C;  2Y2K A;  3B0B A;  5B2I B;  3R45 B;  4Z5T B;  1P3K B;  2JE5 A;  3VH6 A;  4H9S C;  5AV8 C;  2BYM A;  3VH6 T;  3X1S D;  3REI C;  3AV2 C;  5AV6 B;  3B6F A;  4Z2M H;  4DRB A;  5AV9 D;  3AZI C;  2FJ7 D;  3MNN D;  3LJA A;  5CPJ C;  4QLC A;  5DNM B;  1KX5 C;  3EPK A;  1EQZ C;  5CPK D;  3MGP D;  1JFI A;  3MVD D;  5B24 B;  3W96 B;  4J8X B;  3B6G A;  5G49 B;  5DNM D;  2F8N G;  4X23 B;  5F99 D;  1BFM A;  5BNX B;  4H9Q B;  2HIO A;  2HIO B;  3AFA B;  3MGQ B;  3B6G C;  2ZY2 A;  5B33 D;  4X23 A;  3WA9 B;  2PYO C;  2BG1 A;  5AV8 A;  5GT0 C;  3AV2 A;  3AZG D;  3B6F C;  3AZK D;  2NZD A;  5B40 B;  3KXB C;  3NQU B;  3LJA C;  3MGS A;  1KX3 C;  5E5A C;  1P3M C;  4AWL C;  4CSR A;  1P3O C;  2NQB C;  5B1L D;  1P3L B;  3AV1 B;  2F8N K;  4YM6 B;  5B32 G;  4XUJ D;  5AV9 B;  5CPJ B; 
#chains in the Genus database with same CATH homology
 2HUE B;  3W98 D;  2XD1 A;  3W97 D;  4UUZ B;  4E45 A;  5BO0 A;  4JJN B;  3AZH D;  5B32 D;  3X1U B;  3KUY C;  5B40 D;  1TZY D;  4E44 A;  5JRG A;  1P3P D;  3AZE D;  1M19 A;  4G92 C;  4WU8 D;  4X23 C;  3X1U D;  4J8V D;  3AYW D;  5B2J A;  3UTA A;  5GXQ C;  1H3O A;  1S32 B;  5B1M B;  5AY8 C;  3WAA C;  3AV1 D;  5AVB C;  3C1C D;  5CPI B;  5BNV A;  4Z66 A;  4JJN D;  3REJ D;  3TU4 B;  1U35 C;  1P34 D;  1P3G C;  3O62 C;  5B0Y A;  2ARO B;  3C1B B;  2Y2G A;  3LZ0 A;  3UTB C;  3AZN C;  3AN2 A;  5CPI D;  1P3A A;  1Z2C B;  4Z2M G;  3LEL A;  3UTB A;  3AZN A;  1P3L C;  1S32 D;  5B31 B;  5CP6 D;  5B31 C;  3MGQ D;  5AV9 C;  3AZI D;  4QLC B;  2DQN C;  2FJ7 B;  2FJ7 C;  3X1T D;  3AZL B;  5AV5 D;  3LZ1 C;  3MGR C;  2Y2I A;  3UT9 A;  1M18 C;  4KGC D;  1F66 B;  3W97 A;  1HQ3 C;  4R8P B;  3REK B;  1M19 C;  1F66 C;  5B40 A;  5JRG C;  4H9O B;  4KGC B;  4KUD A;  1PZR A;  5AVC C;  3WA9 A;  4WU8 A;  4WZS B;  1ZLA A;  3LEL C;  3AZL D;  5BO0 B;  5BT1 D;  3AFA A;  1P3K D;  1F1E A;  4J8W A;  5B1M D;  4WNN B;  5E5A D;  1P3M D;  5BS7 C;  4KHA B;  1JFI B;  3AZM C;  4YS3 C;  5JA4 B;  1H3O B;  5B0Y D;  1B67 A;  3AN2 D;  2HIO C;  1W2E A;  3X1S A;  2NZD C;  3KWQ D;  1P3I C;  5B24 D;  3W96 D;  5GSU D;  1AOI C;  4XUJ B;  3AZH C;  2CWE A;  3TU4 D;  3MGR B;  1P34 B;  1P3F B;  1P3I A;  3MGQ A;  3AZE C;  4UUZ A;  4WU9 D;  3LZ0 B;  1HTA A;  2G5H C;  4QLC D;  3MVD A;  5E5A B;  1P3M B;  5AV6 D;  4EO5 B;  5CPK A;  5FUG A;  5B2I C;  3H0M C;  4KGC A;  3WAA D;  4H9O A;  3REH C;  3AZF C;  5F99 A;  2UWX A;  4ZUX A;  1P3P B;  4XZQ D;  4YS3 A;  1EQZ B;  1KX3 A;  4CAY B;  2ZM5 A;  5AV8 D;  3KUY B;  3AV2 D;  3O62 D;  3VH5 T;  4ZUX C;  4UPK A;  2Y2L A;  4YM6 D;  4J8W C;  3MNN C;  3AZL A;  3MNN B;  2IO5 B;  3AZJ D;  1S32 C;  5DNN B;  5B1L A;  3MVD C;  5C3I B;  3KXB A;  3MGQ C;  4WU8 B;  1P3A B;  3AZH A;  3B0D B;  2YFV A;  3MGS B;  2J8P A;  5DNM A;  1EQZ A;  1N1J B;  3W97 B;  5CP6 B;  4WU9 B;  1P3B B;  3AZE A;  1KX5 A;  3AL0 C;  1TZY B;  4KHA A;  5GT0 D;  3REI B;  4J8V A;  1TZY A;  3AZK C;  5JRG D;  3AZM A;  1P3F D;  5DNN D;  4WU9 A;  1KX4 C;  2DF4 C;  5GSU B;  3WKJ B;  3WTP B;  4H9N B;  2HUE C;  3KWQ B;  4Z66 D;  1P34 A;  3C1C B;  2CV5 B;  3C1C A;  1ID3 C;  3WAA A;  1WWI A;  1P3B D;  4JJN A;  2JCH A;  5GXQ B;  5GT3 D;  4XZQ B;  3KFU G;  2CV5 D;  1F66 A;  3LZ0 D;  3KSY A;  3V9R A;  3AFA C;  3W99 D;  5B32 B;  1ZLA C;  1U35 B;  4WU8 C;  5B1L C;  3B6F B;  3AYW C;  1S32 A;  4DQY B;  1KX3 B;  5CP6 A;  3AZJ A;  3A1K A;  5CHL B;  3TU4 C;  4H9P B;  1P3G B;  3W97 C;  5F99 B;  3EPJ A;  3O62 B;  3AV1 C;  3NQJ B;  3AYW A;  5AV8 B;  5B0Z B;  3KUY D;  3AV2 B;  5B0Z C;  3H0L C;  4G91 C;  3X1U C;  5BNX A;  2BYK B;  3W99 B;  3A6N C;  2RVQ D;  5GT0 A;  1P3L A;  5CPI A;  1U35 A;  5AVB D;  3C1C C;  2YFW B;  5CPK C;  1ID3 A;  1P3A D;  5B1M A;  1N1J A;  3EPH A;  3REH A;  3AZF A;  4Z5T C;  3UTB D;  3AZN D;  5GXQ A;  3WTP D;  1HQ3 B;  2XD5 A;  2ARO D;  3LZ1 D;  3C1B D;  5CPJ D;  2Y2O A;  5JRG B;  3LEL B;  5GT0 B;  3REL B;  5B33 C;  4H9R B;  5GT3 A;  4Z5T A;  5AV5 A;  3F6T A;  5GSU A;  3REL C;  4LD9 D;  1F66 D;  3UT9 D;  3EG5 B;  2LY8 A;  1BH9 A;  4H9S A;  3REI A;  3A6N A;  4NFT A;  4KUD D;  1P3O D;  2NQB D;  5B2J B;  3UTA B;  5C3I C;  4XUJ C;  3AZH B;  3A6N B;  5AVC A;  3WA9 C;  3W99 A;  2VQR A;  5FUG B;  4YS3 D;  5B40 C;  1KX3 D;  1M1A D;  5B2I A;  3R45 A;  5E5A A;  1P3M A;  3X1V D;  4XZQ A;  1P3K C;  1P3B C;  4WV4 B;  4YM6 A;  3MGR A;  3REL A;  3WAA B;  1P3O B;  4J8X A;  3AZI B;  2NQB B;  3W96 A;  5B24 A;  4KUD B;  5AVC B;  4J8U D;  3WKJ A;  1HQ3 A;  5B33 B;  3VH6 W;  3X1S B;  3AZJ B;  3VH5 A;  4JJN C;  4NE3 A;  1P3P C;  3NQU A;  3KWQ C;  3LZ1 A;  1P3I D;  3X1S C;  1ID3 B;  4R8P D;  3REK D;  5AV6 A;  4LD9 A;  1KX5 D;  1T3U A;  2G5I C;  5B0Z D;  3MVD B;  2Y2N A;  1EQZ D;  4QLC C;  4DRA A;  3MGP C;  4ZUX D;  1P3F A;  1ZLA B;  1P34 C;  1P3G D;  3REI D;  3B6G B;  1WWS A;  3A6N D;  3X1T C;  3O62 A;  5DNN A;  2PYO B;  4AWL B;  3B6G D;  4LD9 B;  2F8N B;  3AZG B;  4Z66 B;  5BNV B;  1A7W A;  3LJA B;  3VH5 W;  5CP6 C;  2YFW A;  4EO5 C;  5AY8 A;  3AZG C;  5B31 D;  4YM6 C;  4G91 B;  5DNM C;  3WTP E;  3KXB D;  1KX5 B;  1P3B A;  3X1V B;  3WKJ C;  4ZUX B;  3AZJ C;  3MGR D;  3AZL C;  4J8X C;  3REL D;  5BT1 C;  3B0C T;  4NE6 A;  4J8U A;  1HQ3 D;  4WJ3 C;  3B6F D;  2Y2H A;  3B0C W;  3W98 C;  5B0Y B;  4H9Q A;  3AZM D;  5AV9 A;  2BYM B;  3H0R C;  3MNN A;  5B32 C;  3LJA D;  1P3I B;  2FJ7 A;  1TAF B;  5B0Y C;  5AVB B;  4XUJ A;  4J8V B;  5AY8 B;  1BH8 A;  2FFF B;  2ZY5 A;  5KDM A;  4CSR B;  4J8V C;  1P3F C;  3V9R B;  2F8N A;  3LZ0 C;  1Q9C A;  2W8S A;  1P3P A;  3A1I A;  5B33 A;  2PYO A;  5KDM B;  4WU9 C;  1KX4 A;  3REJ B;  1B6W A;  4Z66 C;  1KU5 A;  5B2J D;  3UTA D;  5AV6 C;  2CV5 A;  1TZY C;  1BH9 B;  5AVB A;  3REJ C;  3AZK A;  1U35 D;  1ID3 D;  2NZD D;  3WTP A;  5GSU C;  1AOI D;  5GT3 C;  2ARO A;  3C1B A;  5CPJ A;  3REH D;  3AZF D;  2CV5 C;  5GXQ D;  5GT3 B;  5AY8 D;  4G92 B;  3W99 C;  4ZBJ C;  3MGS D;  2Y2Q A;  3KUY A;  1ULY A;  3AZE B;  1R4V A;  4H9P A;  4R8P C;  3REK C;  3W98 A;  2L5A A;  3W98 B;  5CPI C;  5B31 G;  1M19 B;  1P3O A;  2NQB A;  5B32 A;  1M18 D;  4KGC C;  1TAF A;  3IP4 C;  3X1U A;  5B1L B;  1P3L D;  4HGA B;  1M19 D;  2ZY3 A;  2ZY4 A;  4HGA C;  5AV5 B;  2ARO C;  3C1B C;  3UTB B;  3AZN B;  5F99 C;  3AV1 A;  5AVC D;  4J8U B;  5G49 A;  5AV5 C;  3REJ A;  4H9N A;  3P5J B;  2F8N D;  2IO5 C;  1M1A A;  4CAY A;  3FDD A;  3UT9 C;  3X1V A;  5DNN C;  2PYO D;  1AOI B;  1KX4 D;  4Z5T D;  3UT9 B;  3WTP C;  3WKJ D;  1BH8 B;  1M18 B;  4J8X D;  4WNN A;  4ZBJ B;  5BS7 A;  3LZ1 B;  1AOI A;  3AN2 C;  3LEL D;  2BYK A;  4LD9 C;  3X1T A;  5B1M C;  4H9R A;  3AZI A;  3AZK B;  3MGP A;  5B0Z A;  3KWQ A;  2JSS A;  1KX4 B;  3X1V C;  3EPL A;  4KUD C;  1P3G A;  3REH B;  3AZF B;  2HIO D;  5JA4 A;  3TU4 A;  5B24 C;  3W96 C;  5B2I D;  3AZM B;  4X23 D;  3WA9 D;  2Y2P A;  1M18 A;  4J8U C;  4NE5 A;  3AZG A;  5B2J C;  3AFA D;  2F2A C;  4XZQ C;  3UTA C;  1P3K A;  4J8W B;  1M1A C;  4YS3 B;  2YFV B;  1ZLA D;  1M1A B;  2NZD B;  5B31 A;  2F8N H;  2Y2J A;  4J8W D;  3MGP B;  2RVQ C;  5CPK B;  2RIQ A;  2Y2M A;  3NQJ A;  3KXB B;  3AYW B;  4M6B A;  3B0D C;  3MGS C;  3X1T B;  3AN2 B;  4R8P A;  3REK A;  1P3A C;  2Y2K A;  3B0B A;  5B2I B;  3R45 B;  4Z5T B;  1P3K B;  2JE5 A;  3VH6 A;  4H9S C;  5AV8 C;  2BYM A;  3VH6 T;  3X1S D;  3REI C;  3AV2 C;  5AV6 B;  3B6F A;  4Z2M H;  4DRB A;  5AV9 D;  3AZI C;  2FJ7 D;  3MNN D;  3LJA A;  5CPJ C;  4QLC A;  5DNM B;  1KX5 C;  3EPK A;  1EQZ C;  5CPK D;  3MGP D;  1JFI A;  3MVD D;  5B24 B;  3W96 B;  4J8X B;  3B6G A;  5G49 B;  5DNM D;  2F8N G;  4X23 B;  5F99 D;  1BFM A;  5BNX B;  4H9Q B;  2HIO A;  2HIO B;  3AFA B;  3MGQ B;  3B6G C;  2ZY2 A;  5B33 D;  4X23 A;  3WA9 B;  2PYO C;  2BG1 A;  5AV8 A;  5GT0 C;  3AV2 A;  3AZG D;  3B6F C;  3AZK D;  2NZD A;  5B40 B;  3KXB C;  3NQU B;  3LJA C;  3MGS A;  1KX3 C;  5E5A C;  1P3M C;  4AWL C;  4CSR A;  1P3O C;  2NQB C;  5B1L D;  1P3L B;  3AV1 B;  2F8N K;  4YM6 B;  5B32 G;  4XUJ D;  5AV9 B;  5CPJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...