1P3LB

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
79
structure length
79
Chain Sequence
b'DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 28
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3lB00
4UUZB 3REHD 2CV5C 4KUDB 4YM6A 1F66B 3UTAC 3UTBA 1M1AC 3W99B 4LD9C 3B0CW 4JJND 1P3MA 5B32G 3WTPE 1P3FB 3AZED 3AZHC 1H3OA 3LZ0B 5F99C 5GT0D 3MNNC 3W96C 3MGPD 1EQZA 5FUGA 5B33C 3AZMC 5B2IA 2FJ7C 4YS3D 1ZLAD 2IO5B 3KWQD 4WU8B 3AN2B 3A6ND 5B31B 5C3IB 4J8UD 3AYWC 2L5AA 1U35C 2NZDD 1KX5A 5CP6D 3WA9D 2CV5B 5B24D 3UTAB 4KUDA 5AV5A 1F66A 1A7WA 1M1AB 4LD9B 4M6BA 3W99A 5GXQD 3UT9B 2PYOD 1M18C 3AZGD 3AZEB 1AOIC 3LZ0A 3MNNB 2RVQC 3W96B 1TZYD 2F8NH 5B33B 3AZMB 3MVDC 2FJ7B 1S32B 4J8VD 1P3PC 5DNNC 1BH8B 4YS3B 4H9SC 1P3BD 3VH5T 1P3KD 3B6FB 3NQUB 4WU8A 3AN2A 5B31A 1U35B 3A6NB 4J8UB 3X1UD 2YFVB 3B6GD 4Z66C 3AZID 5AY8D 3WTPD 3AZKC 4H9RB 3WKJD 5AV6D 3UT9A 3AZND 5B1MC 3LZ1D 1M18B 4WV4B 5AVBD 4G91C 2AROD 4NE6A 3AZEA 3RELD 1AOIB 3V9RB 3AZGB 2F8NB 5B33A 5AV9D 3MGPA 3AZMA 1P3PB 1S32A 1P3OC 4YS3A 4XUJC 3LJAD 1P3MD 2BYMB 4DRBA 5DNMC 4X23C 4E44A 4XZQD 3NQUA 3B6FA 1P3KB 3KWQA 1U35A 4H9OB 1BH9B 3A6NA 4J8UA 2YFVA 5GSUD 5CP6A 3WA9A 1EQZD 3LELC 1P3IC 5B2ID 1Q9CA 4H9RA 5B1MB 1M18A 1P3GB 4G91B 2PYOA 5AVBB 3AFAC 1KX4C 3V9RA 3AZGA 5B2JC 5BNVB 1TZYA 3KUYC 1KX3C 3W99D 5AV9B 3X1SC 1M19C 2NQBD 1P3PA 1P3OB 4EO5B 3AZLD 3X1VD 1BFMA 4J8VA 3W97D 4WU9D 5DNMB 2BYMA 1P3FD 1HQ3C 3KXBC 1P3KA 4H9OA 1BH9A 4H9QB 5B1LD 3X1UA 3REID 3B6GA 5GSUB 5KDMB 4KGCC 5AY8A 3WTPA 5GT3D 3AN2D 4WU8D 1P3GA 3AFAB 5AVBA 5B40C 2AROA 4CSRB 2CV5D 3UTAD 4J8WC 3KUYB 1M1AD 1KX3B 1R4VA 1M19B 4LD9D 5AV9A 3TU4C 5CPIC 3UT9D 1P3OA 2NQBB 3AZLB 3X1VB 3W97B 4WU9B 3LJAA 2HIOB 5DNMA 3AZFC 1HQ3B 4R8PC 3KXBB 4QLCC 4XZQA 5G49B 5F99D 3MNND 5B1LB 3W96D 5GSUA 5KDMA 3REIB 5B33D 5BT1D 3AZMD 1JFIA 2FJ7D 1S32D 5CPJC 3WAAB 5GT3B 1P3AC 3O62C 3B6FD 3MGQC 3AYWD 3AFAA 1TAFB 1U35D 5B40B 3VH6A 4CSRA 4ZUXC 1HTAA 4J8WB 4UUZA 3KUYA 1M19A 3MGRC 5CPIB 2NQBA 4ZBJC 3AZLA 3B0BA 3X1VA 3W97A 3AZFB 4WU9A 1M18D 4R8PB 2HIOA 3KXBA 3REJC 5GT0C 3AV1C 3AZHB 1P3FA 1AOID 5B0ZC 2RVQD 5B1LA 5BS7C 5F99B 3C1CC 2F8ND 3REIA 5CPJB 1P3PD 5DNND 1P3LC 3WAAA 5GT3A 3AV2C 3REKC 3MGQB 1N1JB 2LY8A 3AZJC 1TAFA 4NFTA 3AYWB 4Z66D 1B67A 3C1BC 2CV5A 4HGAC 3UTAA 3AZKD 3MGRB 3X1TC 1M1AA 4LD9A 4G92C 5JA4B 5B1MD 3AZFA 3MGSC 4R8PA 3REJB 1P34C 4Z5TC 1P3GD 3AZHA 5B0ZB 3VH5W 5CHLB 3C1CB 4H9NB 5F99A 3MNNA 2BYKB 3W96A 5B0YC 3MVDB 5CPJA 1P3LB 1P3OD 5B31G 4Z2MG 2FJ7A 5CPKC 5DNNB 3REKB 1BH8A 5DNMD 4X23D 5AVCC 3AZJB 5B32C 1WWSA 3AYWA 5AV8C 4HGAB 4Z66B 3LELD 3WKJC 1P3ID 3AZNC 3MGRA 3AZKB 5JA4A 3MGSB 3AFAD 3REJA 1KX4D 4YM6C 3UTBC 1AOIA 3C1CA 4H9NA 5B0YB 2BYKA 2F8NA 3KUYD 1KX3D 1M19D 3X1SD 1P3MC 3MVDA 5CPKB 5DNNA 4H9SA 4XUJB 3REKA 4J8XC 5AVCB 2HIOD 5BNXB 1HQ3D 5B32B 4X23B 3KXBD 3AZJA 3VH5A 5AV8B 2HUEC 5B2IC 4Z66A 4KGCD 3LELB 1P3IB 1F1EA 3AZKA 3WAAD 1KX5C 3MGSA 5B1MA 4YM6B 5B40D 3UTBB 4KUDC 1KX4B 5AV5C 1F66C 5B2JB 4J8WD 5JRGC 5BNVA 4H9PB 3TU4D 3X1SB 5CPID 5CPKA 1ID3C 4J8XB 4XUJA 3AZFD 3R45B 5AVCA 4R8PD 5BNXA 3LZ0C 5B32A 4X23A 3AZHD 5E5AC 4H9QA 5AV8A 3NQJB 3LELA 1P3IA 4KGCB 5CPJD 4WU8C 3W98C 4Z2MH 5B31C 1P3AD 3O62D 1KX5B 3MGQD 3REHC 5AV5B 1KX4A 4ZUXD 2JSSA 4DRAA 5B2JA 5JRGB 3UT9C 4H9PA 4JJNC 3MGRD 1KX3A 3TU4B 3X1SA 1ID3B 3AZEC 4J8XA 3R45A 3REJD 3AV1D 1HQ3A 4QLCB 5B0ZD 5E5AB 5BT1C 3MGPC 5G49A 3C1CD 4NE3A 1S32C 3NQJA 1B6WA 4YS3C 1ZLAC 3MVDD 4KGCA 1WWIA 1P3LD 3W98B 3B6FC 3KWQC 3AV2D 3REKD 3A6NC 4J8UC 1P3AB 3O62B 2NZDC 5CP6C 3AZJD 3WA9C 3REHB 5B24C 1ULYA 5B40A 3C1BD 4ZUXB 5JRGA 5GXQC 4J8WA 2CWEA 4JJNB 4AWLC 3X1TD 4KHAB 3TU4A 1ID3A 2PYOC 5CPIA 4ZBJB 3MGSD 3AZGC 1P34D 4Z5TD 3AV1B 5GT0B 4QLCA 4NE5A 1TZYC 5E5AA 4WZSB 5BO0B 3MGPB 5B0YD 4WNNB 4J8VC 1ZLAB 1P3BC 3W98A 5CPKD 3KWQB 1P3KC 4XUJD 2NZDB 3AV2B 1P3AA 5AVCD 3O62A 5CP6B 3X1UC 5B32D 3B6GC 3WA9B 3MGQA 3REHA 1N1JA 5B24B 2F8NK 5AV8D 3AZIC 5AY8C 3WTPC 4ZUXA 3C1BB 5GXQB 2YFWB 4AWLB 5AV6C 4JJNA 3X1TB 4KHAA 1P3GC 2PYOB 3LZ1C 5AVBC 4G92B 2AROC 3RELC 1P34B 4Z5TB 4YM6D 3AV1A 1TZYB 5GT0A 3UTBD 4E45A 5BO0A 5B0ZA 5B2JD 5AV9C 5BS7A 4J8VB 4EO5C 4WNNA 1ZLAA 1P3BB 3LJAC 1P3LA 4XZQC 4J8XD 2NZDA 3AV2A 3X1UB 3B6GB 5GSUC 5B24A 1EQZC 3AZIB 5AY8B 3WTPB 3C1BA 5GXQA 3WKJB 5AV6B 2YFWA 3AZNB 3B0DC 3VH6T 3LZ1B 3X1TA 4CAYB 1KX5D 2AROB 3RELB 1P34A 4Z5TA 4KUDD 2F8NG 5AV5D 1F66D 5JRGD 3W99C 2NQBC 3KSYA 5B0YA 3X1VC 3AZLC 3LJAB 1P3BA 4WU9C 1P3MB 3W97C 2HIOC 1ID3D 4XZQB 1P3FC 3LZ0D 1H3OB 3VH6W 5B1LC 4QLCD 3REIC 1JFIB 5E5AD 1EQZB 3B0CT 5FUGB 3AZIA 2HUEB 5B2IB 3WAAC 3WKJA 5GT3C 5AV6A 2IO5C 3B0DB 3AZNA 1KU5A 3W98D 5B31D 3LZ1A 4CAYA 3AN2C 5C3IC 3RELA
chains in the Genus database with same CATH superfamily
4UUZB 3REHD 2CV5C 2JE5A 4KUDB 4YM6A 1F66B 3UTAC 3UTBA 1M1AC 3W99B 4LD9C 3B0CW 4JJND 1P3MA 5B32G 3WTPE 1P3FB 3AZED 3AZHC 1H3OA 3LZ0B 5F99C 5GT0D 3MNNC 2Y2GA 3W96C 3MGPD 1EQZA 5FUGA 5B33C 3AZMC 5B2IA 2FJ7C 4YS3D 1ZLAD 2IO5B 3KWQD 4WU8B 3AN2B 2Y2NA 3A6ND 5B31B 5C3IB 4J8UD 3AYWC 2L5AA 1U35C 2NZDD 1PZRA 1KX5A 5CP6D 3WA9D 2CV5B 5B24D 4WJ3C 3UTAB 4KUDA 5AV5A 1F66A 1A7WA 1M1AB 4LD9B 4M6BA 3W99A 5GXQD 3UT9B 2UWXA 2PYOD 1M18C 3AZGD 3AZEB 1AOIC 3LZ0A 3MNNB 2RVQC 3W96B 1TZYD 2F8NH 5B33B 3AZMB 3P5JB 3MVDC 2FJ7B 1S32B 4J8VD 1P3PC 5DNNC 1BH8B 3EPJA 4H9SC 4YS3B 1P3BD 3VH5T 1P3KD 3B6FB 1T3UA 3NQUB 4WU8A 3AN2A 5B31A 1U35B 3A6NB 4J8UB 3X1UD 2YFVB 3B6GD 4Z66C 3AZID 5AY8D 3WTPD 3AZKC 4H9RB 3WKJD 5AV6D 3UT9A 3AZND 3H0RC 5B1MC 3LZ1D 1M18B 4WV4B 2ZY4A 5AVBD 4G91C 2AROD 4NE6A 3AZEA 3RELD 1AOIB 3V9RB 3AZGB 2F8NB 5B33A 5AV9D 3MGPA 3AZMA 1P3PB 1S32A 4DQYB 1P3OC 4YS3A 4XUJC 3LJAD 1P3MD 2BYMB 4DRBA 5DNMC 4X23C 4E44A 4XZQD 3NQUA 3B6FA 1P3KB 3KWQA 1U35A 4H9OB 2FFFB 1BH9B 3A6NA 4J8UA 2YFVA 5GSUD 5CP6A 3WA9A 1EQZD 3LELC 1P3IC 5B2ID 1Q9CA 4H9RA 5B1MB 1M18A 1P3GB 4G91B 2PYOA 5AVBB 3AFAC 1KX4C 3V9RA 3AZGA 5B2JC 5BNVB 1TZYA 2DF4C 3KUYC 1KX3C 3W99D 5AV9B 3X1SC 1M19C 2NQBD 1P3PA 1P3OB 4EO5B 3AZLD 3X1VD 1BFMA 4J8VA 3W97D 4WU9D 5DNMB 2BYMA 1P3FD 1HQ3C 3KXBC 1P3KA 4H9OA 1BH9A 4H9QB 5B1LD 3X1UA 3REID 3B6GA 5GSUB 5KDMB 4KGCC 5AY8A 3WTPA 5GT3D 3KFUG 3EPHA 3AN2D 4WU8D 1P3GA 3AFAB 5AVBA 5B40C 2AROA 4CSRB 2CV5D 3UTAD 4J8WC 3KUYB 1M1AD 1KX3B 1R4VA 1M19B 4LD9D 5AV9A 3TU4C 5CPIC 3UT9D 3EPLA 1P3OA 3AL0C 2NQBB 3AZLB 3X1VB 3W97B 4WU9B 3LJAA 2HIOB 5DNMA 3AZFC 1HQ3B 4R8PC 3KXBB 4QLCC 4XZQA 5G49B 5F99D 3MNND 5B1LB 3W96D 5GSUA 5KDMA 3REIB 5B33D 5BT1D 3AZMD 1JFIA 2FJ7D 1S32D 5CPJC 3WAAB 5GT3B 1P3AC 3O62C 3B6FD 3MGQC 3AYWD 3AFAA 1TAFB 1U35D 5B40B 2ZY2A 3VH6A 4CSRA 4ZUXC 1HTAA 4J8WB 4UUZA 2Y2IA 3KUYA 1M19A 3MGRC 5CPIB 2NQBA 4ZBJC 3AZLA 3B0BA 3X1VA 3W97A 3AZFB 4WU9A 1M18D 4R8PB 2HIOA 2Y2LA 3KXBA 3REJC 5GT0C 3AV1C 3AZHB 1P3FA 1AOID 5B0ZC 2RVQD 2ZY3A 5B1LA 5BS7C 5F99B 3C1CC 2F8ND 3REIA 5CPJB 1P3PD 5DNND 1P3LC 3WAAA 5GT3A 3AV2C 3REKC 3MGQB 1N1JB 2LY8A 3EG5B 1Z2CB 2ZY5A 1TAFA 3H0LC 4NFTA 3AZJC 3AYWB 4Z66D 1B67A 3C1BC 2CV5A 4HGAC 3UTAA 3AZKD 3MGRB 3X1TC 1M1AA 4LD9A 4G92C 5JA4B 5B1MD 3AZFA 3MGSC 4R8PA 3REJB 1P34C 2XD1A 4Z5TC 1P3GD 3AZHA 5B0ZB 3VH5W 5CHLB 3C1CB 4H9NB 5F99A 3MNNA 2BYKB 3W96A 5B0YC 3MVDB 5CPJA 1P3LB 1P3OD 5B31G 4Z2MG 2FJ7A 5CPKC 5DNNB 2ZM5A 3REKB 1BH8A 5DNMD 4X23D 5AVCC 3AZJB 5B32C 1WWSA 3AYWA 5AV8C 4HGAB 4Z66B 3LELD 3WKJC 1P3ID 3AZNC 3MGRA 3AZKB 5JA4A 3MGSB 2J8PA 2G5HC 3AFAD 3REJA 1KX4D 4YM6C 3UTBC 1AOIA 3C1CA 4H9NA 5B0YB 2BYKA 2F8NA 3KUYD 1KX3D 1M19D 2W8SA 3X1SD 3MVDA 1P3MC 5CPKB 5DNNA 4H9SA 4XUJB 3REKA 4J8XC 5AVCB 2HIOD 5BNXB 1HQ3D 5B32B 4X23B 3KXBD 3AZJA 3VH5A 5AV8B 2HUEC 5B2IC 4Z66A 4KGCD 3LELB 1P3IB 1F1EA 2VQRA 3AZKA 3WAAD 1KX5C 3MGSA 5B1MA 4YM6B 5B40D 3UTBB 4KUDC 1KX4B 5AV5C 1F66C 5B2JB 4J8WD 5JRGC 5BNVA 4H9PB 3TU4D 3X1SB 5CPID 5CPKA 1ID3C 4J8XB 2Y2OA 4XUJA 3AZFD 3R45B 5AVCA 4R8PD 5BNXA 3LZ0C 5B32A 4X23A 3AZHD 2Y2PA 5E5AC 4H9QA 5AV8A 3EPKA 3NQJB 1W2EA 3LELA 1P3IA 4KGCB 5CPJD 4WU8C 3W98C 4Z2MH 5B31C 1P3AD 3O62D 1KX5B 3MGQD 2JCHA 3REHC 5AV5B 1KX4A 4ZUXD 2JSSA 4DRAA 5B2JA 5JRGB 3UT9C 4H9PA 4JJNC 3MGRD 1KX3A 3TU4B 3X1SA 1ID3B 3AZEC 4J8XA 3R45A 2DQNC 3REJD 3AV1D 4UPKA 1HQ3A 4QLCB 3IP4C 5B0ZD 5E5AB 5BT1C 3MGPC 5G49A 2F2AC 3C1CD 4NE3A 1S32C 2Y2QA 3NQJA 1B6WA 4YS3C 1ZLAC 3MVDD 4KGCA 2BG1A 1WWIA 1P3LD 3W98B 3B6FC 3KWQC 3AV2D 3REKD 3A6NC 4J8UC 1P3AB 3O62B 2NZDC 5CP6C 3AZJD 3WA9C 3REHB 5B24C 1ULYA 5B40A 3C1BD 4ZUXB 5JRGA 5GXQC 4J8WA 2CWEA 4JJNB 4AWLC 3X1TD 4KHAB 3TU4A 1ID3A 2PYOC 5CPIA 4ZBJB 3MGSD 3AZGC 1P34D 4Z5TD 3AV1B 5GT0B 4QLCA 4NE5A 1TZYC 5E5AA 4WZSB 5BO0B 3MGPB 5B0YD 4WNNB 4J8VC 1ZLAB 1P3BC 3W98A 5CPKD 3KWQB 1P3KC 4XUJD 2NZDB 3AV2B 1P3AA 5AVCD 3O62A 5CP6B 3X1UC 5B32D 3B6GC 3WA9B 3MGQA 3REHA 1N1JA 5B24B 2F8NK 5AV8D 3AZIC 5AY8C 3WTPC 4ZUXA 3C1BB 5GXQB 2YFWB 4AWLB 5AV6C 4JJNA 3X1TB 4KHAA 1P3GC 2PYOB 3LZ1C 5AVBC 4G92B 2AROC 3RELC 1P34B 2Y2KA 4Z5TB 4YM6D 3AV1A 1TZYB 5GT0A 3UTBD 4E45A 5BO0A 5B0ZA 5B2JD 5AV9C 5BS7A 4J8VB 4EO5C 4WNNA 3FDDA 1ZLAA 3H0MC 1P3BB 3LJAC 3A1IA 1P3LA 4XZQC 4J8XD 2NZDA 3AV2A 3X1UB 3B6GB 5GSUC 5B24A 1EQZC 3AZIB 5AY8B 2Y2MA 3WTPB 3C1BA 5GXQA 3WKJB 5AV6B 2YFWA 2XD5A 3AZNB 3B0DC 3VH6T 3LZ1B 3X1TA 4CAYB 1KX5D 2AROB 3RELB 1P34A 4Z5TA 4KUDD 2F8NG 5AV5D 1F66D 5JRGD 3W99C 2NQBC 2Y2JA 3KSYA 5B0YA 3X1VC 3AZLC 3LJAB 1P3BA 4WU9C 2RIQA 1P3MB 3W97C 2HIOC 1ID3D 4XZQB 3F6TA 1P3FC 3LZ0D 1H3OB 3VH6W 5B1LC 4QLCD 3REIC 1JFIB 5E5AD 1EQZB 3A1KA 3B0CT 5FUGB 3AZIA 2HUEB 5B2IB 3WAAC 3WKJA 5GT3C 2Y2HA 5AV6A 2IO5C 3B0DB 3AZNA 1KU5A 3W98D 2G5IC 5B31D 3LZ1A 4CAYA 3AN2C 5C3IC 3RELA
chains in the Genus database with same CATH topology
4UUZB 3REHD 2CV5C 2JE5A 4KUDB 4YM6A 1F66B 3UTAC 3UTBA 1M1AC 3W99B 4LD9C 3B0CW 4JJND 1P3MA 5B32G 3WTPE 1P3FB 3AZED 3AZHC 1H3OA 3LZ0B 5F99C 5GT0D 3MNNC 2Y2GA 3W96C 3MGPD 1EQZA 5FUGA 5B33C 3AZMC 5B2IA 2FJ7C 4YS3D 1ZLAD 2IO5B 3KWQD 4WU8B 3AN2B 2Y2NA 3A6ND 5B31B 5C3IB 4J8UD 3AYWC 2L5AA 1U35C 2NZDD 1PZRA 1KX5A 5CP6D 3WA9D 2CV5B 5B24D 4WJ3C 3UTAB 4KUDA 5AV5A 1F66A 1A7WA 1M1AB 4LD9B 4M6BA 3W99A 5GXQD 3UT9B 2UWXA 2PYOD 1M18C 3AZGD 3AZEB 1AOIC 3LZ0A 3MNNB 2RVQC 3W96B 1TZYD 2F8NH 5B33B 3AZMB 3P5JB 3MVDC 2FJ7B 1S32B 4J8VD 1P3PC 5DNNC 1BH8B 3EPJA 4H9SC 4YS3B 1P3BD 3VH5T 1P3KD 3B6FB 1T3UA 3NQUB 4WU8A 3AN2A 5B31A 1U35B 3A6NB 4J8UB 3X1UD 2YFVB 3B6GD 4Z66C 3AZID 5AY8D 3WTPD 3AZKC 4H9RB 3WKJD 5AV6D 3UT9A 3AZND 3H0RC 5B1MC 3LZ1D 1M18B 4WV4B 2ZY4A 5AVBD 4G91C 2AROD 4NE6A 3AZEA 3RELD 1AOIB 3V9RB 3AZGB 2F8NB 5B33A 5AV9D 3MGPA 3AZMA 1P3PB 1S32A 4DQYB 1P3OC 4YS3A 4XUJC 3LJAD 1P3MD 2BYMB 4DRBA 5DNMC 4X23C 4E44A 4XZQD 3NQUA 3B6FA 1P3KB 3KWQA 1U35A 4H9OB 2FFFB 1BH9B 3A6NA 4J8UA 2YFVA 5GSUD 5CP6A 3WA9A 1EQZD 3LELC 1P3IC 5B2ID 1Q9CA 4H9RA 5B1MB 1M18A 1P3GB 4G91B 2PYOA 5AVBB 3AFAC 1KX4C 3V9RA 3AZGA 5B2JC 5BNVB 1TZYA 2DF4C 3KUYC 1KX3C 3W99D 5AV9B 3X1SC 1M19C 2NQBD 1P3PA 1P3OB 4EO5B 3AZLD 3X1VD 1BFMA 4J8VA 3W97D 4WU9D 5DNMB 2BYMA 1P3FD 1HQ3C 3KXBC 1P3KA 4H9OA 1BH9A 4H9QB 5B1LD 3X1UA 3REID 3B6GA 5GSUB 5KDMB 4KGCC 5AY8A 3WTPA 5GT3D 3KFUG 3EPHA 3AN2D 4WU8D 1P3GA 3AFAB 5AVBA 5B40C 2AROA 4CSRB 2CV5D 3UTAD 4J8WC 3KUYB 1M1AD 1KX3B 1R4VA 1M19B 4LD9D 5AV9A 3TU4C 5CPIC 3UT9D 3EPLA 1P3OA 3AL0C 2NQBB 3AZLB 3X1VB 3W97B 4WU9B 3LJAA 2HIOB 5DNMA 3AZFC 1HQ3B 4R8PC 3KXBB 4QLCC 4XZQA 5G49B 5F99D 3MNND 5B1LB 3W96D 5GSUA 5KDMA 3REIB 5B33D 5BT1D 3AZMD 1JFIA 2FJ7D 1S32D 5CPJC 3WAAB 5GT3B 1P3AC 3O62C 3B6FD 3MGQC 3AYWD 3AFAA 1TAFB 1U35D 5B40B 2ZY2A 3VH6A 4CSRA 4ZUXC 1HTAA 4J8WB 4UUZA 2Y2IA 3KUYA 1M19A 3MGRC 5CPIB 2NQBA 4ZBJC 3AZLA 3B0BA 3X1VA 3W97A 3AZFB 4WU9A 1M18D 4R8PB 2HIOA 2Y2LA 3KXBA 3REJC 5GT0C 3AV1C 3AZHB 1P3FA 1AOID 5B0ZC 2RVQD 2ZY3A 5B1LA 5BS7C 5F99B 3C1CC 2F8ND 3REIA 5CPJB 1P3PD 5DNND 1P3LC 3WAAA 5GT3A 3AV2C 3REKC 3MGQB 1N1JB 2LY8A 3EG5B 1Z2CB 2ZY5A 1TAFA 3H0LC 4NFTA 3AZJC 3AYWB 4Z66D 1B67A 3C1BC 2CV5A 4HGAC 3UTAA 3AZKD 3MGRB 3X1TC 1M1AA 4LD9A 4G92C 5JA4B 5B1MD 3AZFA 3MGSC 4R8PA 3REJB 1P34C 2XD1A 4Z5TC 1P3GD 3AZHA 5B0ZB 3VH5W 5CHLB 3C1CB 4H9NB 5F99A 3MNNA 2BYKB 3W96A 5B0YC 3MVDB 5CPJA 1P3LB 1P3OD 5B31G 4Z2MG 2FJ7A 5CPKC 5DNNB 2ZM5A 3REKB 1BH8A 5DNMD 4X23D 5AVCC 3AZJB 5B32C 1WWSA 3AYWA 5AV8C 4HGAB 4Z66B 3LELD 3WKJC 1P3ID 3AZNC 3MGRA 3AZKB 5JA4A 3MGSB 2J8PA 2G5HC 3AFAD 3REJA 1KX4D 4YM6C 3UTBC 1AOIA 3C1CA 4H9NA 5B0YB 2BYKA 2F8NA 3KUYD 1KX3D 1M19D 2W8SA 3X1SD 3MVDA 1P3MC 5CPKB 5DNNA 4H9SA 4XUJB 3REKA 4J8XC 5AVCB 2HIOD 5BNXB 1HQ3D 5B32B 4X23B 3KXBD 3AZJA 3VH5A 5AV8B 2HUEC 5B2IC 4Z66A 4KGCD 3LELB 1P3IB 1F1EA 2VQRA 3AZKA 3WAAD 1KX5C 3MGSA 5B1MA 4YM6B 5B40D 3UTBB 4KUDC 1KX4B 5AV5C 1F66C 5B2JB 4J8WD 5JRGC 5BNVA 4H9PB 3TU4D 3X1SB 5CPID 5CPKA 1ID3C 4J8XB 2Y2OA 4XUJA 3AZFD 3R45B 5AVCA 4R8PD 5BNXA 3LZ0C 5B32A 4X23A 3AZHD 2Y2PA 5E5AC 4H9QA 5AV8A 3EPKA 3NQJB 1W2EA 3LELA 1P3IA 4KGCB 5CPJD 4WU8C 3W98C 4Z2MH 5B31C 1P3AD 3O62D 1KX5B 3MGQD 2JCHA 3REHC 5AV5B 1KX4A 4ZUXD 2JSSA 4DRAA 5B2JA 5JRGB 3UT9C 4H9PA 4JJNC 3MGRD 1KX3A 3TU4B 3X1SA 1ID3B 3AZEC 4J8XA 3R45A 2DQNC 3REJD 3AV1D 4UPKA 1HQ3A 4QLCB 3IP4C 5B0ZD 5E5AB 5BT1C 3MGPC 5G49A 2F2AC 3C1CD 4NE3A 1S32C 2Y2QA 3NQJA 1B6WA 4YS3C 1ZLAC 3MVDD 4KGCA 2BG1A 1WWIA 1P3LD 3W98B 3B6FC 3KWQC 3AV2D 3REKD 3A6NC 4J8UC 1P3AB 3O62B 2NZDC 5CP6C 3AZJD 3WA9C 3REHB 5B24C 1ULYA 5B40A 3C1BD 4ZUXB 5JRGA 5GXQC 4J8WA 2CWEA 4JJNB 4AWLC 3X1TD 4KHAB 3TU4A 1ID3A 2PYOC 5CPIA 4ZBJB 3MGSD 3AZGC 1P34D 4Z5TD 3AV1B 5GT0B 4QLCA 4NE5A 1TZYC 5E5AA 4WZSB 5BO0B 3MGPB 5B0YD 4WNNB 4J8VC 1ZLAB 1P3BC 3W98A 5CPKD 3KWQB 1P3KC 4XUJD 2NZDB 3AV2B 1P3AA 5AVCD 3O62A 5CP6B 3X1UC 5B32D 3B6GC 3WA9B 3MGQA 3REHA 1N1JA 5B24B 2F8NK 5AV8D 3AZIC 5AY8C 3WTPC 4ZUXA 3C1BB 5GXQB 2YFWB 4AWLB 5AV6C 4JJNA 3X1TB 4KHAA 1P3GC 2PYOB 3LZ1C 5AVBC 4G92B 2AROC 3RELC 1P34B 2Y2KA 4Z5TB 4YM6D 3AV1A 1TZYB 5GT0A 3UTBD 4E45A 5BO0A 5B0ZA 5B2JD 5AV9C 5BS7A 4J8VB 4EO5C 4WNNA 3FDDA 1ZLAA 3H0MC 1P3BB 3LJAC 3A1IA 1P3LA 4XZQC 4J8XD 2NZDA 3AV2A 3X1UB 3B6GB 5GSUC 5B24A 1EQZC 3AZIB 5AY8B 2Y2MA 3WTPB 3C1BA 5GXQA 3WKJB 5AV6B 2YFWA 2XD5A 3AZNB 3B0DC 3VH6T 3LZ1B 3X1TA 4CAYB 1KX5D 2AROB 3RELB 1P34A 4Z5TA 4KUDD 2F8NG 5AV5D 1F66D 5JRGD 3W99C 2NQBC 2Y2JA 3KSYA 5B0YA 3X1VC 3AZLC 3LJAB 1P3BA 4WU9C 2RIQA 1P3MB 3W97C 2HIOC 1ID3D 4XZQB 3F6TA 1P3FC 3LZ0D 1H3OB 3VH6W 5B1LC 4QLCD 3REIC 1JFIB 5E5AD 1EQZB 3A1KA 3B0CT 5FUGB 3AZIA 2HUEB 5B2IB 3WAAC 3WKJA 5GT3C 2Y2HA 5AV6A 2IO5C 3B0DB 3AZNA 1KU5A 3W98D 2G5IC 5B31D 3LZ1A 4CAYA 3AN2C 5C3IC 3RELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UUZ B;  3REH D;  2CV5 C;  4KUD B;  4YM6 A;  1F66 B;  3UTA C;  3UTB A;  1M1A C;  3W99 B;  4LD9 C;  3B0C W;  4JJN D;  1P3M A;  5B32 G;  3WTP E;  1P3F B;  3AZE D;  3AZH C;  1H3O A;  3LZ0 B;  5F99 C;  5GT0 D;  3MNN C;  3W96 C;  3MGP D;  1EQZ A;  5FUG A;  5B33 C;  3AZM C;  5B2I A;  2FJ7 C;  4YS3 D;  1ZLA D;  2IO5 B;  3KWQ D;  4WU8 B;  3AN2 B;  3A6N D;  5B31 B;  5C3I B;  4J8U D;  3AYW C;  2L5A A;  1U35 C;  2NZD D;  1KX5 A;  5CP6 D;  3WA9 D;  2CV5 B;  5B24 D;  3UTA B;  4KUD A;  5AV5 A;  1F66 A;  1A7W A;  1M1A B;  4LD9 B;  4M6B A;  3W99 A;  5GXQ D;  3UT9 B;  2PYO D;  1M18 C;  3AZG D;  3AZE B;  1AOI C;  3LZ0 A;  3MNN B;  2RVQ C;  3W96 B;  1TZY D;  2F8N H;  5B33 B;  3AZM B;  3MVD C;  2FJ7 B;  1S32 B;  4J8V D;  1P3P C;  5DNN C;  1BH8 B;  4YS3 B;  4H9S C;  1P3B D;  3VH5 T;  1P3K D;  3B6F B;  3NQU B;  4WU8 A;  3AN2 A;  5B31 A;  1U35 B;  3A6N B;  4J8U B;  3X1U D;  2YFV B;  3B6G D;  4Z66 C;  3AZI D;  5AY8 D;  3WTP D;  3AZK C;  4H9R B;  3WKJ D;  5AV6 D;  3UT9 A;  3AZN D;  5B1M C;  3LZ1 D;  1M18 B;  4WV4 B;  5AVB D;  4G91 C;  2ARO D;  4NE6 A;  3AZE A;  3REL D;  1AOI B;  3V9R B;  3AZG B;  2F8N B;  5B33 A;  5AV9 D;  3MGP A;  3AZM A;  1P3P B;  1S32 A;  1P3O C;  4YS3 A;  4XUJ C;  3LJA D;  1P3M D;  2BYM B;  4DRB A;  5DNM C;  4X23 C;  4E44 A;  4XZQ D;  3NQU A;  3B6F A;  1P3K B;  3KWQ A;  1U35 A;  4H9O B;  1BH9 B;  3A6N A;  4J8U A;  2YFV A;  5GSU D;  5CP6 A;  3WA9 A;  1EQZ D;  3LEL C;  1P3I C;  5B2I D;  1Q9C A;  4H9R A;  5B1M B;  1M18 A;  1P3G B;  4G91 B;  2PYO A;  5AVB B;  3AFA C;  1KX4 C;  3V9R A;  3AZG A;  5B2J C;  5BNV B;  1TZY A;  3KUY C;  1KX3 C;  3W99 D;  5AV9 B;  3X1S C;  1M19 C;  2NQB D;  1P3P A;  1P3O B;  4EO5 B;  3AZL D;  3X1V D;  1BFM A;  4J8V A;  3W97 D;  4WU9 D;  5DNM B;  2BYM A;  1P3F D;  1HQ3 C;  3KXB C;  1P3K A;  4H9O A;  1BH9 A;  4H9Q B;  5B1L D;  3X1U A;  3REI D;  3B6G A;  5GSU B;  5KDM B;  4KGC C;  5AY8 A;  3WTP A;  5GT3 D;  3AN2 D;  4WU8 D;  1P3G A;  3AFA B;  5AVB A;  5B40 C;  2ARO A;  4CSR B;  2CV5 D;  3UTA D;  4J8W C;  3KUY B;  1M1A D;  1KX3 B;  1R4V A;  1M19 B;  4LD9 D;  5AV9 A;  3TU4 C;  5CPI C;  3UT9 D;  1P3O A;  2NQB B;  3AZL B;  3X1V B;  3W97 B;  4WU9 B;  3LJA A;  2HIO B;  5DNM A;  3AZF C;  1HQ3 B;  4R8P C;  3KXB B;  4QLC C;  4XZQ A;  5G49 B;  5F99 D;  3MNN D;  5B1L B;  3W96 D;  5GSU A;  5KDM A;  3REI B;  5B33 D;  5BT1 D;  3AZM D;  1JFI A;  2FJ7 D;  1S32 D;  5CPJ C;  3WAA B;  5GT3 B;  1P3A C;  3O62 C;  3B6F D;  3MGQ C;  3AYW D;  3AFA A;  1TAF B;  1U35 D;  5B40 B;  3VH6 A;  4CSR A;  4ZUX C;  1HTA A;  4J8W B;  4UUZ A;  3KUY A;  1M19 A;  3MGR C;  5CPI B;  2NQB A;  4ZBJ C;  3AZL A;  3B0B A;  3X1V A;  3W97 A;  3AZF B;  4WU9 A;  1M18 D;  4R8P B;  2HIO A;  3KXB A;  3REJ C;  5GT0 C;  3AV1 C;  3AZH B;  1P3F A;  1AOI D;  5B0Z C;  2RVQ D;  5B1L A;  5BS7 C;  5F99 B;  3C1C C;  2F8N D;  3REI A;  5CPJ B;  1P3P D;  5DNN D;  1P3L C;  3WAA A;  5GT3 A;  3AV2 C;  3REK C;  3MGQ B;  1N1J B;  2LY8 A;  3AZJ C;  1TAF A;  4NFT A;  3AYW B;  4Z66 D;  1B67 A;  3C1B C;  2CV5 A;  4HGA C;  3UTA A;  3AZK D;  3MGR B;  3X1T C;  1M1A A;  4LD9 A;  4G92 C;  5JA4 B;  5B1M D;  3AZF A;  3MGS C;  4R8P A;  3REJ B;  1P34 C;  4Z5T C;  1P3G D;  3AZH A;  5B0Z B;  3VH5 W;  5CHL B;  3C1C B;  4H9N B;  5F99 A;  3MNN A;  2BYK B;  3W96 A;  5B0Y C;  3MVD B;  5CPJ A;  1P3L B;  1P3O D;  5B31 G;  4Z2M G;  2FJ7 A;  5CPK C;  5DNN B;  3REK B;  1BH8 A;  5DNM D;  4X23 D;  5AVC C;  3AZJ B;  5B32 C;  1WWS A;  3AYW A;  5AV8 C;  4HGA B;  4Z66 B;  3LEL D;  3WKJ C;  1P3I D;  3AZN C;  3MGR A;  3AZK B;  5JA4 A;  3MGS B;  3AFA D;  3REJ A;  1KX4 D;  4YM6 C;  3UTB C;  1AOI A;  3C1C A;  4H9N A;  5B0Y B;  2BYK A;  2F8N A;  3KUY D;  1KX3 D;  1M19 D;  3X1S D;  1P3M C;  3MVD A;  5CPK B;  5DNN A;  4H9S A;  4XUJ B;  3REK A;  4J8X C;  5AVC B;  2HIO D;  5BNX B;  1HQ3 D;  5B32 B;  4X23 B;  3KXB D;  3AZJ A;  3VH5 A;  5AV8 B;  2HUE C;  5B2I C;  4Z66 A;  4KGC D;  3LEL B;  1P3I B;  1F1E A;  3AZK A;  3WAA D;  1KX5 C;  3MGS A;  5B1M A;  4YM6 B;  5B40 D;  3UTB B;  4KUD C;  1KX4 B;  5AV5 C;  1F66 C;  5B2J B;  4J8W D;  5JRG C;  5BNV A;  4H9P B;  3TU4 D;  3X1S B;  5CPI D;  5CPK A;  1ID3 C;  4J8X B;  4XUJ A;  3AZF D;  3R45 B;  5AVC A;  4R8P D;  5BNX A;  3LZ0 C;  5B32 A;  4X23 A;  3AZH D;  5E5A C;  4H9Q A;  5AV8 A;  3NQJ B;  3LEL A;  1P3I A;  4KGC B;  5CPJ D;  4WU8 C;  3W98 C;  4Z2M H;  5B31 C;  1P3A D;  3O62 D;  1KX5 B;  3MGQ D;  3REH C;  5AV5 B;  1KX4 A;  4ZUX D;  2JSS A;  4DRA A;  5B2J A;  5JRG B;  3UT9 C;  4H9P A;  4JJN C;  3MGR D;  1KX3 A;  3TU4 B;  3X1S A;  1ID3 B;  3AZE C;  4J8X A;  3R45 A;  3REJ D;  3AV1 D;  1HQ3 A;  4QLC B;  5B0Z D;  5E5A B;  5BT1 C;  3MGP C;  5G49 A;  3C1C D;  4NE3 A;  1S32 C;  3NQJ A;  1B6W A;  4YS3 C;  1ZLA C;  3MVD D;  4KGC A;  1WWI A;  1P3L D;  3W98 B;  3B6F C;  3KWQ C;  3AV2 D;  3REK D;  3A6N C;  4J8U C;  1P3A B;  3O62 B;  2NZD C;  5CP6 C;  3AZJ D;  3WA9 C;  3REH B;  5B24 C;  1ULY A;  5B40 A;  3C1B D;  4ZUX B;  5JRG A;  5GXQ C;  4J8W A;  2CWE A;  4JJN B;  4AWL C;  3X1T D;  4KHA B;  3TU4 A;  1ID3 A;  2PYO C;  5CPI A;  4ZBJ B;  3MGS D;  3AZG C;  1P34 D;  4Z5T D;  3AV1 B;  5GT0 B;  4QLC A;  4NE5 A;  1TZY C;  5E5A A;  4WZS B;  5BO0 B;  3MGP B;  5B0Y D;  4WNN B;  4J8V C;  1ZLA B;  1P3B C;  3W98 A;  5CPK D;  3KWQ B;  1P3K C;  4XUJ D;  2NZD B;  3AV2 B;  1P3A A;  5AVC D;  3O62 A;  5CP6 B;  3X1U C;  5B32 D;  3B6G C;  3WA9 B;  3MGQ A;  3REH A;  1N1J A;  5B24 B;  2F8N K;  5AV8 D;  3AZI C;  5AY8 C;  3WTP C;  4ZUX A;  3C1B B;  5GXQ B;  2YFW B;  4AWL B;  5AV6 C;  4JJN A;  3X1T B;  4KHA A;  1P3G C;  2PYO B;  3LZ1 C;  5AVB C;  4G92 B;  2ARO C;  3REL C;  1P34 B;  4Z5T B;  4YM6 D;  3AV1 A;  1TZY B;  5GT0 A;  3UTB D;  4E45 A;  5BO0 A;  5B0Z A;  5B2J D;  5AV9 C;  5BS7 A;  4J8V B;  4EO5 C;  4WNN A;  1ZLA A;  1P3B B;  3LJA C;  1P3L A;  4XZQ C;  4J8X D;  2NZD A;  3AV2 A;  3X1U B;  3B6G B;  5GSU C;  5B24 A;  1EQZ C;  3AZI B;  5AY8 B;  3WTP B;  3C1B A;  5GXQ A;  3WKJ B;  5AV6 B;  2YFW A;  3AZN B;  3B0D C;  3VH6 T;  3LZ1 B;  3X1T A;  4CAY B;  1KX5 D;  2ARO B;  3REL B;  1P34 A;  4Z5T A;  4KUD D;  2F8N G;  5AV5 D;  1F66 D;  5JRG D;  3W99 C;  2NQB C;  3KSY A;  5B0Y A;  3X1V C;  3AZL C;  3LJA B;  1P3B A;  4WU9 C;  1P3M B;  3W97 C;  2HIO C;  1ID3 D;  4XZQ B;  1P3F C;  3LZ0 D;  1H3O B;  3VH6 W;  5B1L C;  4QLC D;  3REI C;  1JFI B;  5E5A D;  1EQZ B;  3B0C T;  5FUG B;  3AZI A;  2HUE B;  5B2I B;  3WAA C;  3WKJ A;  5GT3 C;  5AV6 A;  2IO5 C;  3B0D B;  3AZN A;  1KU5 A;  3W98 D;  5B31 D;  3LZ1 A;  4CAY A;  3AN2 C;  5C3I C;  3REL A; 
#chains in the Genus database with same CATH topology
 4UUZ B;  3REH D;  2CV5 C;  2JE5 A;  4KUD B;  4YM6 A;  1F66 B;  3UTA C;  3UTB A;  1M1A C;  3W99 B;  4LD9 C;  3B0C W;  4JJN D;  1P3M A;  5B32 G;  3WTP E;  1P3F B;  3AZE D;  3AZH C;  1H3O A;  3LZ0 B;  5F99 C;  5GT0 D;  3MNN C;  2Y2G A;  3W96 C;  3MGP D;  1EQZ A;  5FUG A;  5B33 C;  3AZM C;  5B2I A;  2FJ7 C;  4YS3 D;  1ZLA D;  2IO5 B;  3KWQ D;  4WU8 B;  3AN2 B;  2Y2N A;  3A6N D;  5B31 B;  5C3I B;  4J8U D;  3AYW C;  2L5A A;  1U35 C;  2NZD D;  1PZR A;  1KX5 A;  5CP6 D;  3WA9 D;  2CV5 B;  5B24 D;  4WJ3 C;  3UTA B;  4KUD A;  5AV5 A;  1F66 A;  1A7W A;  1M1A B;  4LD9 B;  4M6B A;  3W99 A;  5GXQ D;  3UT9 B;  2UWX A;  2PYO D;  1M18 C;  3AZG D;  3AZE B;  1AOI C;  3LZ0 A;  3MNN B;  2RVQ C;  3W96 B;  1TZY D;  2F8N H;  5B33 B;  3AZM B;  3P5J B;  3MVD C;  2FJ7 B;  1S32 B;  4J8V D;  1P3P C;  5DNN C;  1BH8 B;  3EPJ A;  4H9S C;  4YS3 B;  1P3B D;  3VH5 T;  1P3K D;  3B6F B;  1T3U A;  3NQU B;  4WU8 A;  3AN2 A;  5B31 A;  1U35 B;  3A6N B;  4J8U B;  3X1U D;  2YFV B;  3B6G D;  4Z66 C;  3AZI D;  5AY8 D;  3WTP D;  3AZK C;  4H9R B;  3WKJ D;  5AV6 D;  3UT9 A;  3AZN D;  3H0R C;  5B1M C;  3LZ1 D;  1M18 B;  4WV4 B;  2ZY4 A;  5AVB D;  4G91 C;  2ARO D;  4NE6 A;  3AZE A;  3REL D;  1AOI B;  3V9R B;  3AZG B;  2F8N B;  5B33 A;  5AV9 D;  3MGP A;  3AZM A;  1P3P B;  1S32 A;  4DQY B;  1P3O C;  4YS3 A;  4XUJ C;  3LJA D;  1P3M D;  2BYM B;  4DRB A;  5DNM C;  4X23 C;  4E44 A;  4XZQ D;  3NQU A;  3B6F A;  1P3K B;  3KWQ A;  1U35 A;  4H9O B;  2FFF B;  1BH9 B;  3A6N A;  4J8U A;  2YFV A;  5GSU D;  5CP6 A;  3WA9 A;  1EQZ D;  3LEL C;  1P3I C;  5B2I D;  1Q9C A;  4H9R A;  5B1M B;  1M18 A;  1P3G B;  4G91 B;  2PYO A;  5AVB B;  3AFA C;  1KX4 C;  3V9R A;  3AZG A;  5B2J C;  5BNV B;  1TZY A;  2DF4 C;  3KUY C;  1KX3 C;  3W99 D;  5AV9 B;  3X1S C;  1M19 C;  2NQB D;  1P3P A;  1P3O B;  4EO5 B;  3AZL D;  3X1V D;  1BFM A;  4J8V A;  3W97 D;  4WU9 D;  5DNM B;  2BYM A;  1P3F D;  1HQ3 C;  3KXB C;  1P3K A;  4H9O A;  1BH9 A;  4H9Q B;  5B1L D;  3X1U A;  3REI D;  3B6G A;  5GSU B;  5KDM B;  4KGC C;  5AY8 A;  3WTP A;  5GT3 D;  3KFU G;  3EPH A;  3AN2 D;  4WU8 D;  1P3G A;  3AFA B;  5AVB A;  5B40 C;  2ARO A;  4CSR B;  2CV5 D;  3UTA D;  4J8W C;  3KUY B;  1M1A D;  1KX3 B;  1R4V A;  1M19 B;  4LD9 D;  5AV9 A;  3TU4 C;  5CPI C;  3UT9 D;  3EPL A;  1P3O A;  3AL0 C;  2NQB B;  3AZL B;  3X1V B;  3W97 B;  4WU9 B;  3LJA A;  2HIO B;  5DNM A;  3AZF C;  1HQ3 B;  4R8P C;  3KXB B;  4QLC C;  4XZQ A;  5G49 B;  5F99 D;  3MNN D;  5B1L B;  3W96 D;  5GSU A;  5KDM A;  3REI B;  5B33 D;  5BT1 D;  3AZM D;  1JFI A;  2FJ7 D;  1S32 D;  5CPJ C;  3WAA B;  5GT3 B;  1P3A C;  3O62 C;  3B6F D;  3MGQ C;  3AYW D;  3AFA A;  1TAF B;  1U35 D;  5B40 B;  2ZY2 A;  3VH6 A;  4CSR A;  4ZUX C;  1HTA A;  4J8W B;  4UUZ A;  2Y2I A;  3KUY A;  1M19 A;  3MGR C;  5CPI B;  2NQB A;  4ZBJ C;  3AZL A;  3B0B A;  3X1V A;  3W97 A;  3AZF B;  4WU9 A;  1M18 D;  4R8P B;  2HIO A;  2Y2L A;  3KXB A;  3REJ C;  5GT0 C;  3AV1 C;  3AZH B;  1P3F A;  1AOI D;  5B0Z C;  2RVQ D;  2ZY3 A;  5B1L A;  5BS7 C;  5F99 B;  3C1C C;  2F8N D;  3REI A;  5CPJ B;  1P3P D;  5DNN D;  1P3L C;  3WAA A;  5GT3 A;  3AV2 C;  3REK C;  3MGQ B;  1N1J B;  2LY8 A;  3EG5 B;  1Z2C B;  2ZY5 A;  1TAF A;  3H0L C;  4NFT A;  3AZJ C;  3AYW B;  4Z66 D;  1B67 A;  3C1B C;  2CV5 A;  4HGA C;  3UTA A;  3AZK D;  3MGR B;  3X1T C;  1M1A A;  4LD9 A;  4G92 C;  5JA4 B;  5B1M D;  3AZF A;  3MGS C;  4R8P A;  3REJ B;  1P34 C;  2XD1 A;  4Z5T C;  1P3G D;  3AZH A;  5B0Z B;  3VH5 W;  5CHL B;  3C1C B;  4H9N B;  5F99 A;  3MNN A;  2BYK B;  3W96 A;  5B0Y C;  3MVD B;  5CPJ A;  1P3L B;  1P3O D;  5B31 G;  4Z2M G;  2FJ7 A;  5CPK C;  5DNN B;  2ZM5 A;  3REK B;  1BH8 A;  5DNM D;  4X23 D;  5AVC C;  3AZJ B;  5B32 C;  1WWS A;  3AYW A;  5AV8 C;  4HGA B;  4Z66 B;  3LEL D;  3WKJ C;  1P3I D;  3AZN C;  3MGR A;  3AZK B;  5JA4 A;  3MGS B;  2J8P A;  2G5H C;  3AFA D;  3REJ A;  1KX4 D;  4YM6 C;  3UTB C;  1AOI A;  3C1C A;  4H9N A;  5B0Y B;  2BYK A;  2F8N A;  3KUY D;  1KX3 D;  1M19 D;  2W8S A;  3X1S D;  3MVD A;  1P3M C;  5CPK B;  5DNN A;  4H9S A;  4XUJ B;  3REK A;  4J8X C;  5AVC B;  2HIO D;  5BNX B;  1HQ3 D;  5B32 B;  4X23 B;  3KXB D;  3AZJ A;  3VH5 A;  5AV8 B;  2HUE C;  5B2I C;  4Z66 A;  4KGC D;  3LEL B;  1P3I B;  1F1E A;  2VQR A;  3AZK A;  3WAA D;  1KX5 C;  3MGS A;  5B1M A;  4YM6 B;  5B40 D;  3UTB B;  4KUD C;  1KX4 B;  5AV5 C;  1F66 C;  5B2J B;  4J8W D;  5JRG C;  5BNV A;  4H9P B;  3TU4 D;  3X1S B;  5CPI D;  5CPK A;  1ID3 C;  4J8X B;  2Y2O A;  4XUJ A;  3AZF D;  3R45 B;  5AVC A;  4R8P D;  5BNX A;  3LZ0 C;  5B32 A;  4X23 A;  3AZH D;  2Y2P A;  5E5A C;  4H9Q A;  5AV8 A;  3EPK A;  3NQJ B;  1W2E A;  3LEL A;  1P3I A;  4KGC B;  5CPJ D;  4WU8 C;  3W98 C;  4Z2M H;  5B31 C;  1P3A D;  3O62 D;  1KX5 B;  3MGQ D;  2JCH A;  3REH C;  5AV5 B;  1KX4 A;  4ZUX D;  2JSS A;  4DRA A;  5B2J A;  5JRG B;  3UT9 C;  4H9P A;  4JJN C;  3MGR D;  1KX3 A;  3TU4 B;  3X1S A;  1ID3 B;  3AZE C;  4J8X A;  3R45 A;  2DQN C;  3REJ D;  3AV1 D;  4UPK A;  1HQ3 A;  4QLC B;  3IP4 C;  5B0Z D;  5E5A B;  5BT1 C;  3MGP C;  5G49 A;  2F2A C;  3C1C D;  4NE3 A;  1S32 C;  2Y2Q A;  3NQJ A;  1B6W A;  4YS3 C;  1ZLA C;  3MVD D;  4KGC A;  2BG1 A;  1WWI A;  1P3L D;  3W98 B;  3B6F C;  3KWQ C;  3AV2 D;  3REK D;  3A6N C;  4J8U C;  1P3A B;  3O62 B;  2NZD C;  5CP6 C;  3AZJ D;  3WA9 C;  3REH B;  5B24 C;  1ULY A;  5B40 A;  3C1B D;  4ZUX B;  5JRG A;  5GXQ C;  4J8W A;  2CWE A;  4JJN B;  4AWL C;  3X1T D;  4KHA B;  3TU4 A;  1ID3 A;  2PYO C;  5CPI A;  4ZBJ B;  3MGS D;  3AZG C;  1P34 D;  4Z5T D;  3AV1 B;  5GT0 B;  4QLC A;  4NE5 A;  1TZY C;  5E5A A;  4WZS B;  5BO0 B;  3MGP B;  5B0Y D;  4WNN B;  4J8V C;  1ZLA B;  1P3B C;  3W98 A;  5CPK D;  3KWQ B;  1P3K C;  4XUJ D;  2NZD B;  3AV2 B;  1P3A A;  5AVC D;  3O62 A;  5CP6 B;  3X1U C;  5B32 D;  3B6G C;  3WA9 B;  3MGQ A;  3REH A;  1N1J A;  5B24 B;  2F8N K;  5AV8 D;  3AZI C;  5AY8 C;  3WTP C;  4ZUX A;  3C1B B;  5GXQ B;  2YFW B;  4AWL B;  5AV6 C;  4JJN A;  3X1T B;  4KHA A;  1P3G C;  2PYO B;  3LZ1 C;  5AVB C;  4G92 B;  2ARO C;  3REL C;  1P34 B;  2Y2K A;  4Z5T B;  4YM6 D;  3AV1 A;  1TZY B;  5GT0 A;  3UTB D;  4E45 A;  5BO0 A;  5B0Z A;  5B2J D;  5AV9 C;  5BS7 A;  4J8V B;  4EO5 C;  4WNN A;  3FDD A;  1ZLA A;  3H0M C;  1P3B B;  3LJA C;  3A1I A;  1P3L A;  4XZQ C;  4J8X D;  2NZD A;  3AV2 A;  3X1U B;  3B6G B;  5GSU C;  5B24 A;  1EQZ C;  3AZI B;  5AY8 B;  2Y2M A;  3WTP B;  3C1B A;  5GXQ A;  3WKJ B;  5AV6 B;  2YFW A;  2XD5 A;  3AZN B;  3B0D C;  3VH6 T;  3LZ1 B;  3X1T A;  4CAY B;  1KX5 D;  2ARO B;  3REL B;  1P34 A;  4Z5T A;  4KUD D;  2F8N G;  5AV5 D;  1F66 D;  5JRG D;  3W99 C;  2NQB C;  2Y2J A;  3KSY A;  5B0Y A;  3X1V C;  3AZL C;  3LJA B;  1P3B A;  4WU9 C;  2RIQ A;  1P3M B;  3W97 C;  2HIO C;  1ID3 D;  4XZQ B;  3F6T A;  1P3F C;  3LZ0 D;  1H3O B;  3VH6 W;  5B1L C;  4QLC D;  3REI C;  1JFI B;  5E5A D;  1EQZ B;  3A1K A;  3B0C T;  5FUG B;  3AZI A;  2HUE B;  5B2I B;  3WAA C;  3WKJ A;  5GT3 C;  2Y2H A;  5AV6 A;  2IO5 C;  3B0D B;  3AZN A;  1KU5 A;  3W98 D;  2G5I C;  5B31 D;  3LZ1 A;  4CAY A;  3AN2 C;  5C3I C;  3REL A; 
#chains in the Genus database with same CATH homology
 4UUZ B;  3REH D;  2CV5 C;  2JE5 A;  4KUD B;  4YM6 A;  1F66 B;  3UTA C;  3UTB A;  1M1A C;  3W99 B;  4LD9 C;  3B0C W;  4JJN D;  1P3M A;  5B32 G;  3WTP E;  1P3F B;  3AZE D;  3AZH C;  1H3O A;  3LZ0 B;  5F99 C;  5GT0 D;  3MNN C;  2Y2G A;  3W96 C;  3MGP D;  1EQZ A;  5FUG A;  5B33 C;  3AZM C;  5B2I A;  2FJ7 C;  4YS3 D;  1ZLA D;  2IO5 B;  3KWQ D;  4WU8 B;  3AN2 B;  2Y2N A;  3A6N D;  5B31 B;  5C3I B;  4J8U D;  3AYW C;  2L5A A;  1U35 C;  2NZD D;  1PZR A;  1KX5 A;  5CP6 D;  3WA9 D;  2CV5 B;  5B24 D;  4WJ3 C;  3UTA B;  4KUD A;  5AV5 A;  1F66 A;  1A7W A;  1M1A B;  4LD9 B;  4M6B A;  3W99 A;  5GXQ D;  3UT9 B;  2UWX A;  2PYO D;  1M18 C;  3AZG D;  3AZE B;  1AOI C;  3LZ0 A;  3MNN B;  2RVQ C;  3W96 B;  1TZY D;  2F8N H;  5B33 B;  3AZM B;  3P5J B;  3MVD C;  2FJ7 B;  1S32 B;  4J8V D;  1P3P C;  5DNN C;  1BH8 B;  3EPJ A;  4H9S C;  4YS3 B;  1P3B D;  3VH5 T;  1P3K D;  3B6F B;  1T3U A;  3NQU B;  4WU8 A;  3AN2 A;  5B31 A;  1U35 B;  3A6N B;  4J8U B;  3X1U D;  2YFV B;  3B6G D;  4Z66 C;  3AZI D;  5AY8 D;  3WTP D;  3AZK C;  4H9R B;  3WKJ D;  5AV6 D;  3UT9 A;  3AZN D;  3H0R C;  5B1M C;  3LZ1 D;  1M18 B;  4WV4 B;  2ZY4 A;  5AVB D;  4G91 C;  2ARO D;  4NE6 A;  3AZE A;  3REL D;  1AOI B;  3V9R B;  3AZG B;  2F8N B;  5B33 A;  5AV9 D;  3MGP A;  3AZM A;  1P3P B;  1S32 A;  4DQY B;  1P3O C;  4YS3 A;  4XUJ C;  3LJA D;  1P3M D;  2BYM B;  4DRB A;  5DNM C;  4X23 C;  4E44 A;  4XZQ D;  3NQU A;  3B6F A;  1P3K B;  3KWQ A;  1U35 A;  4H9O B;  2FFF B;  1BH9 B;  3A6N A;  4J8U A;  2YFV A;  5GSU D;  5CP6 A;  3WA9 A;  1EQZ D;  3LEL C;  1P3I C;  5B2I D;  1Q9C A;  4H9R A;  5B1M B;  1M18 A;  1P3G B;  4G91 B;  2PYO A;  5AVB B;  3AFA C;  1KX4 C;  3V9R A;  3AZG A;  5B2J C;  5BNV B;  1TZY A;  2DF4 C;  3KUY C;  1KX3 C;  3W99 D;  5AV9 B;  3X1S C;  1M19 C;  2NQB D;  1P3P A;  1P3O B;  4EO5 B;  3AZL D;  3X1V D;  1BFM A;  4J8V A;  3W97 D;  4WU9 D;  5DNM B;  2BYM A;  1P3F D;  1HQ3 C;  3KXB C;  1P3K A;  4H9O A;  1BH9 A;  4H9Q B;  5B1L D;  3X1U A;  3REI D;  3B6G A;  5GSU B;  5KDM B;  4KGC C;  5AY8 A;  3WTP A;  5GT3 D;  3KFU G;  3EPH A;  3AN2 D;  4WU8 D;  1P3G A;  3AFA B;  5AVB A;  5B40 C;  2ARO A;  4CSR B;  2CV5 D;  3UTA D;  4J8W C;  3KUY B;  1M1A D;  1KX3 B;  1R4V A;  1M19 B;  4LD9 D;  5AV9 A;  3TU4 C;  5CPI C;  3UT9 D;  3EPL A;  1P3O A;  3AL0 C;  2NQB B;  3AZL B;  3X1V B;  3W97 B;  4WU9 B;  3LJA A;  2HIO B;  5DNM A;  3AZF C;  1HQ3 B;  4R8P C;  3KXB B;  4QLC C;  4XZQ A;  5G49 B;  5F99 D;  3MNN D;  5B1L B;  3W96 D;  5GSU A;  5KDM A;  3REI B;  5B33 D;  5BT1 D;  3AZM D;  1JFI A;  2FJ7 D;  1S32 D;  5CPJ C;  3WAA B;  5GT3 B;  1P3A C;  3O62 C;  3B6F D;  3MGQ C;  3AYW D;  3AFA A;  1TAF B;  1U35 D;  5B40 B;  2ZY2 A;  3VH6 A;  4CSR A;  4ZUX C;  1HTA A;  4J8W B;  4UUZ A;  2Y2I A;  3KUY A;  1M19 A;  3MGR C;  5CPI B;  2NQB A;  4ZBJ C;  3AZL A;  3B0B A;  3X1V A;  3W97 A;  3AZF B;  4WU9 A;  1M18 D;  4R8P B;  2HIO A;  2Y2L A;  3KXB A;  3REJ C;  5GT0 C;  3AV1 C;  3AZH B;  1P3F A;  1AOI D;  5B0Z C;  2RVQ D;  2ZY3 A;  5B1L A;  5BS7 C;  5F99 B;  3C1C C;  2F8N D;  3REI A;  5CPJ B;  1P3P D;  5DNN D;  1P3L C;  3WAA A;  5GT3 A;  3AV2 C;  3REK C;  3MGQ B;  1N1J B;  2LY8 A;  3EG5 B;  1Z2C B;  2ZY5 A;  1TAF A;  3H0L C;  4NFT A;  3AZJ C;  3AYW B;  4Z66 D;  1B67 A;  3C1B C;  2CV5 A;  4HGA C;  3UTA A;  3AZK D;  3MGR B;  3X1T C;  1M1A A;  4LD9 A;  4G92 C;  5JA4 B;  5B1M D;  3AZF A;  3MGS C;  4R8P A;  3REJ B;  1P34 C;  2XD1 A;  4Z5T C;  1P3G D;  3AZH A;  5B0Z B;  3VH5 W;  5CHL B;  3C1C B;  4H9N B;  5F99 A;  3MNN A;  2BYK B;  3W96 A;  5B0Y C;  3MVD B;  5CPJ A;  1P3L B;  1P3O D;  5B31 G;  4Z2M G;  2FJ7 A;  5CPK C;  5DNN B;  2ZM5 A;  3REK B;  1BH8 A;  5DNM D;  4X23 D;  5AVC C;  3AZJ B;  5B32 C;  1WWS A;  3AYW A;  5AV8 C;  4HGA B;  4Z66 B;  3LEL D;  3WKJ C;  1P3I D;  3AZN C;  3MGR A;  3AZK B;  5JA4 A;  3MGS B;  2J8P A;  2G5H C;  3AFA D;  3REJ A;  1KX4 D;  4YM6 C;  3UTB C;  1AOI A;  3C1C A;  4H9N A;  5B0Y B;  2BYK A;  2F8N A;  3KUY D;  1KX3 D;  1M19 D;  2W8S A;  3X1S D;  3MVD A;  1P3M C;  5CPK B;  5DNN A;  4H9S A;  4XUJ B;  3REK A;  4J8X C;  5AVC B;  2HIO D;  5BNX B;  1HQ3 D;  5B32 B;  4X23 B;  3KXB D;  3AZJ A;  3VH5 A;  5AV8 B;  2HUE C;  5B2I C;  4Z66 A;  4KGC D;  3LEL B;  1P3I B;  1F1E A;  2VQR A;  3AZK A;  3WAA D;  1KX5 C;  3MGS A;  5B1M A;  4YM6 B;  5B40 D;  3UTB B;  4KUD C;  1KX4 B;  5AV5 C;  1F66 C;  5B2J B;  4J8W D;  5JRG C;  5BNV A;  4H9P B;  3TU4 D;  3X1S B;  5CPI D;  5CPK A;  1ID3 C;  4J8X B;  2Y2O A;  4XUJ A;  3AZF D;  3R45 B;  5AVC A;  4R8P D;  5BNX A;  3LZ0 C;  5B32 A;  4X23 A;  3AZH D;  2Y2P A;  5E5A C;  4H9Q A;  5AV8 A;  3EPK A;  3NQJ B;  1W2E A;  3LEL A;  1P3I A;  4KGC B;  5CPJ D;  4WU8 C;  3W98 C;  4Z2M H;  5B31 C;  1P3A D;  3O62 D;  1KX5 B;  3MGQ D;  2JCH A;  3REH C;  5AV5 B;  1KX4 A;  4ZUX D;  2JSS A;  4DRA A;  5B2J A;  5JRG B;  3UT9 C;  4H9P A;  4JJN C;  3MGR D;  1KX3 A;  3TU4 B;  3X1S A;  1ID3 B;  3AZE C;  4J8X A;  3R45 A;  2DQN C;  3REJ D;  3AV1 D;  4UPK A;  1HQ3 A;  4QLC B;  3IP4 C;  5B0Z D;  5E5A B;  5BT1 C;  3MGP C;  5G49 A;  2F2A C;  3C1C D;  4NE3 A;  1S32 C;  2Y2Q A;  3NQJ A;  1B6W A;  4YS3 C;  1ZLA C;  3MVD D;  4KGC A;  2BG1 A;  1WWI A;  1P3L D;  3W98 B;  3B6F C;  3KWQ C;  3AV2 D;  3REK D;  3A6N C;  4J8U C;  1P3A B;  3O62 B;  2NZD C;  5CP6 C;  3AZJ D;  3WA9 C;  3REH B;  5B24 C;  1ULY A;  5B40 A;  3C1B D;  4ZUX B;  5JRG A;  5GXQ C;  4J8W A;  2CWE A;  4JJN B;  4AWL C;  3X1T D;  4KHA B;  3TU4 A;  1ID3 A;  2PYO C;  5CPI A;  4ZBJ B;  3MGS D;  3AZG C;  1P34 D;  4Z5T D;  3AV1 B;  5GT0 B;  4QLC A;  4NE5 A;  1TZY C;  5E5A A;  4WZS B;  5BO0 B;  3MGP B;  5B0Y D;  4WNN B;  4J8V C;  1ZLA B;  1P3B C;  3W98 A;  5CPK D;  3KWQ B;  1P3K C;  4XUJ D;  2NZD B;  3AV2 B;  1P3A A;  5AVC D;  3O62 A;  5CP6 B;  3X1U C;  5B32 D;  3B6G C;  3WA9 B;  3MGQ A;  3REH A;  1N1J A;  5B24 B;  2F8N K;  5AV8 D;  3AZI C;  5AY8 C;  3WTP C;  4ZUX A;  3C1B B;  5GXQ B;  2YFW B;  4AWL B;  5AV6 C;  4JJN A;  3X1T B;  4KHA A;  1P3G C;  2PYO B;  3LZ1 C;  5AVB C;  4G92 B;  2ARO C;  3REL C;  1P34 B;  2Y2K A;  4Z5T B;  4YM6 D;  3AV1 A;  1TZY B;  5GT0 A;  3UTB D;  4E45 A;  5BO0 A;  5B0Z A;  5B2J D;  5AV9 C;  5BS7 A;  4J8V B;  4EO5 C;  4WNN A;  3FDD A;  1ZLA A;  3H0M C;  1P3B B;  3LJA C;  3A1I A;  1P3L A;  4XZQ C;  4J8X D;  2NZD A;  3AV2 A;  3X1U B;  3B6G B;  5GSU C;  5B24 A;  1EQZ C;  3AZI B;  5AY8 B;  2Y2M A;  3WTP B;  3C1B A;  5GXQ A;  3WKJ B;  5AV6 B;  2YFW A;  2XD5 A;  3AZN B;  3B0D C;  3VH6 T;  3LZ1 B;  3X1T A;  4CAY B;  1KX5 D;  2ARO B;  3REL B;  1P34 A;  4Z5T A;  4KUD D;  2F8N G;  5AV5 D;  1F66 D;  5JRG D;  3W99 C;  2NQB C;  2Y2J A;  3KSY A;  5B0Y A;  3X1V C;  3AZL C;  3LJA B;  1P3B A;  4WU9 C;  2RIQ A;  1P3M B;  3W97 C;  2HIO C;  1ID3 D;  4XZQ B;  3F6T A;  1P3F C;  3LZ0 D;  1H3O B;  3VH6 W;  5B1L C;  4QLC D;  3REI C;  1JFI B;  5E5A D;  1EQZ B;  3A1K A;  3B0C T;  5FUG B;  3AZI A;  2HUE B;  5B2I B;  3WAA C;  3WKJ A;  5GT3 C;  2Y2H A;  5AV6 A;  2IO5 C;  3B0D B;  3AZN A;  1KU5 A;  3W98 D;  2G5I C;  5B31 D;  3LZ1 A;  4CAY A;  3AN2 C;  5C3I C;  3REL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...