1P3LB

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
79
structure length
79
Chain Sequence
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 28
structure length 79
sequence length 79
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3lB00
1P3PB 4CAYB 3MNND 4XUJA 1P3BA 5GSUB 3REKA 5DNNA 1P3PA 4CAYA 4E44A 5B0YD 1ID3D 5GSUA 3MGSD 1F1EA 1P3AD 2AROD 5E5AC 5B1LD 2FJ7C 3W99B 1KX4B 4WV4B 1M1AC 1BFMA 4UUZB 1KX5B 4NE6A 5AVBB 1P3OC 5CPKD 3MGPB 4QLCC 3W99A 2PYOB 1P3BC 1KX4A 5AV5D 4UUZA 1KX5A 5DNNC 4AWLB 5AVBA 3AZGC 5B31G 5B2IC 5B32B 4LD9B 3MGPA 3LZ0D 2PYOA 3O62D 4J8XB 3C1CB 4HGAB 3LZ1C 1AOIB 2BYMB 5B32A 4LD9A 1B67A 5AY8B 4J8XA 3MGQC 4XZQD 3C1CA 3B6GD 1ZLAB 1AOIA 5CP6B 2BYMA 1KX4C 5AY8A 3NQJB 3X1TB 1KX5C 5GT3D 1U35D 1ZLAA 3LELD 5CP6A 3TU4C 5AV8B 3MGPC 5B40B 3AZIB 1KX3D 5AV9A 4H9SA 1P3FC 3AZEB 3LJAB 3W97D 3NQJA 5B0ZC 3X1TA 4KGCC 4Z66B 4ZUXA 1TAFB 4JJND 4Z5TC 5AV8A 5B40A 4R8PB 3AZIA 3AZND 3REHB 1P3GD 4G91C 3AZEA 3LJAA 4H9NB 3VH6A 5BNXB 4HGAC 4Z66A 3AZHD 3AZKD 4X23C 1TAFA 4WU8C 1P3LC 2NQBC 4G92C 4J8VC 4R8PA 3REHA 4NFTA 3KXBB 3REID 3AZFB 4H9NA 5BNXA 3AFAC 5AV6B 1ZLAC 3B6FD 5CP6C 3A6NB 3AZJB 5DNMB 5AV9C 3VH5A 3X1SD 5JRGC 5AVCC 3KXBA 5B24B 3C1BB 1EQZB 3AZFA 3X1TC 5AV6A 3WA9B 4XUJD 2HUEB 4ZUXC 3A6NA 2BYKB 5AV8C 3REKD 5B40C 5DNMA 3AZJA 3AV1B 3B0CT 5B2JB 1M19C 3AZEC 3KWQD 1P3PD 5B24A 3C1BA 1EQZA 3VH6T 4Z66C 3WA9A 3WKJB 1S32B 5FUGB 1F66B 2BYKA 5GSUD 4R8PC 3AV1A 3REHC 5B2JA 2AROC 1P3AC 5B1LC 4DRBA 4EO5C 3WKJA 1S32A 5FUGA 1F66A 3AZMB 5BNVB 3AV2D 4ZBJC 1M18C 3VH5T 5E5AB 4WU9D 3AZFC 2FJ7B 5GT0C 3UT9D 5AV5C 5F99B 3A6NC 3AZMA 5BNVA 2CV5B 5AVBD 5CPJD 1WWIA 1P3OB 5B24C 5E5AA 2FJ7A 1BH8B 3WA9C 4QLCB 2PYOD 1HQ3D 1KU5A 5F99A 4YS3D 3AV1C 2CV5A 5B2JC 5B33D 1P3OA 3AZGB 4J8UB 5GXQD 5B2IB 5B32D 4LD9D 1BH8A 1P3KC 5BO0B 4QLCA 3WKJC 1S32C 4J8XD 3X1UB 1F66C 3B0CW 2F8NB 3C1CD 2RVQD 3LZ1B 1AOID 3AZGA 4J8UA 3VH6W 5B2IA 5BO0A 1P34D 1P3IB 5AY8D 5C3IB 3X1UA 3MGQB 3AZMC 3W96C 2F8NA 1P3MC 3LELC 3LZ1A 2JSSA 1N1JB 3WTPA 1P3IA 5F99C 3MGQA 2CV5C 3VH5W 3B0DB 3W98B 3TU4B 4JJNC 3AZID 1N1JA 5G49B 5B1MD 1P3FB 3LJAD 1BH9B 5B0ZB 4KGCB 3W98A 4J8UC 4KUDD 5B31B 3TU4A 1HTAA 2HIOB 4Z5TB 2F8NK 5G49A 2NZDB 4G91B 3X1UC 1P3FA 1BH9A 5B0ZA 4KGCA 4WU8B 5B31A 4YM6D 4X23B 3KUYC 3AZLA 4G92B 1P3LB 2HIOA 4Z5TA 4J8VB 3X1SC 2NQBB 3WTPC 1P3IC 2NZDA 5C3IC 4J8WC 3AFAB 1TZYD 5AV6D 3RELD 3MVDC 4WU8A 4X23A 1P3LA 3AZJD 3REJC 2NQBA 5AV9B 4J8VA 2IO5C 5AVCB 5JRGB 3KWQC 3AN2C 1EQZD 5B32G 3MNNB 3B0DC 3AFAA 3W98C 5BT1C 4ZUXB 3X1VC 3UTBC 3MGRD 1M19B 3AYWC 5CPIA 2L5AA 5AVCA 5JRGA 3MNNA 4H9RB 5B31C 5B0YB 3AZLC 2HIOC 3MGSB 3AV2C 1M19A 1P3AB 2AROB 3WAAD 2NZDC 5B1LB 4EO5B 4H9OB 4H9RA 5B0YA 3MGSA 4ZBJB 1P3AA 2AROA 5CPJC 1M18B 5E5AD 5B1LA 5GT0B 4H9OA 5AV5B 3UTAC 1M1AD 4YS3C 5CPIC 5B33C 1P3OD 3R45B 1M18A 3MNNC 5GT0A 4QLCD 1P3BD 5BS7C 5AV5A 5DNND 5JA4B 3R45A 3AZGD 1A7WA 1P3KB 1P34C 5B0YC 1ID3C 4E45A 4XZQB 3MGSC 2F8ND 3B6GB 2YFWB 5JA4A 1P3KA 2CWEA 4XZQA 3W96B 1P3MB 5GT3B 3B6GA 2YFWA 3LELB 5CPKC 3W99D 4Z2MH 1KX4D 5B1MC 3W96A 1KX5D 1P3MA 5GT3A 3LELA 4JJNB 3MGPD 1P3GB 3AZNB 3LZ0C 4WNNB 3O62C 1R4VA 1WWSA 4KGCD 4WZSB 3KSYA 3AZKB 4YM6C 4Z5TD 4JJNA 1P3GA 3AZNA 4WNNA 3REIB 4XZQC 4H9QB 1TZYC 3B6GC 4WU8D 4X23D 3AZKA 3KUYB 1P3LD 2NQBD 4J8VD 3X1SB 3WTPB 3REIA 1ULYA 4H9QA 4J8WB 3AFAD 5GT3C 1U35C 1ZLAD 5CP6D 3MVDB 3MGRC 3KUYA 3REJB 5AV9D 1KX3C 2IO5B 3X1SA 5JRGD 5AVCD 3KWQB 3AN2B 3W97C 4J8WA 3X1TD 4ZUXD 3X1VB 3UTBB 3MVDA 5AV8D 1P3GC 5B40D 3REJA 3AZNC 1M19D 2F8NG 3AYWB 3WAAC 3AZED 3KWQA 3AN2A 4Z66D 3AZHC 4CSRB 3AZKC 3X1VA 3NQUB 4M6BA 3UTBA 3AZLB 3AV2B 4R8PD 3REHD 3AYWA 3REIC 4WU9B 1JFIB 4NE3A 3B6FC 4CSRA 3UT9B 3NQUA 3AV2A 5CPJB 3KXBD 1M18D 1Q9CA 3AZFD 4WU9A 1JFIA 5GT0D 4XUJC 3UT9A 1HQ3B 3A6ND 3UTAB 3REKC 5DNMD 4YS3B 5CPIB 5B33B 5CPJA 5B24D 3C1BD 1P3PC 5GXQB 3WA9D 5KDMB 1HQ3A 3UTAA 5GSUC 4YS3A 3AV1D 5B2JD 2F8NH 5B33A 5GXQA 1P3KD 1P34B 5CHLB 1S32D 5KDMA 3WKJD 5BS7A 1ID3B 1F66D 4WU9C 3W99C 3UT9C 1P34A 4H9PB 1ID3A 2YFVB 3AZMD 3W96D 1P3MD 5AVBC 4NE5A 5CPKB 2FJ7D 4Z2MG 2PYOC 1HQ3C 5B1MB 4H9PA 5F99D 4DRAA 2YFVA 2CV5D 4AWLC 4KUDB 5CPKA 5GXQC 5B32C 4LD9C 3LZ0B 3O62B 5B1MA 4J8XC 3C1CC 2RVQC 1AOIC 4J8UD 4KUDA 4YM6B 5B2ID 3WTPE 3LZ0A 5AY8C 3X1UD 3O62A 1B6WA 1TZYB 3LZ1D 3RELB 4YM6A 3KUYD 3V9RB 3WTPD 1P3ID 4H9SC 3MGQD 4J8WD 1TZYA 1U35B 3RELA 3MVDD 3MGRB 3AZIC 3REJD 1KX3B 3V9RA 3LJAC 3AN2D 3W97B 3W98D 1U35A 5BT1D 4KUDC 3X1VD 1H3OB 3UTBD 3TU4D 3MGRA 1KX3A 3AYWD 3WAAB 1P3FD 3W97A 5B0ZD 3AZHB 5B31D 1H3OA 3AZLD 2HIOD 2NZDD 3WAAA 3KXBC 4KHAB 2LY8A 5AV6C 3B6FB 3AZHA 3RELC 1M1AB 3AZJC 5DNMC 3C1BC 1EQZC 4KHAA 4XUJB 2HUEC 3B0BA 1P3BB 3UTAD 3B6FA 1M1AA 3REKB 5CPID 5DNNB
chains in the Genus database with same CATH superfamily
1P3PB 4CAYB 3MNND 4XUJA 1P3BA 2Y2JA 5GSUB 3REKA 5DNNA 1P3PA 4CAYA 4E44A 5B0YD 1ID3D 4WJ3C 5GSUA 3MGSD 1F1EA 1P3AD 2AROD 1T3UA 5E5AC 5B1LD 2FJ7C 3W99B 1KX4B 4WV4B 1M1AC 1BFMA 4UUZB 1KX5B 4NE6A 5AVBB 1P3OC 5CPKD 3MGPB 4QLCC 3W99A 2PYOB 1P3BC 1KX4A 5AV5D 4UUZA 1KX5A 5DNNC 4AWLB 5AVBA 3A1IA 3AZGC 5B31G 5B2IC 5B32B 4LD9B 3MGPA 3LZ0D 2PYOA 3O62D 4J8XB 3C1CB 4HGAB 3LZ1C 1AOIB 3H0RC 2BYMB 5B32A 4LD9A 1B67A 5AY8B 4J8XA 3MGQC 3F6TA 4XZQD 3C1CA 3B6GD 1ZLAB 1AOIA 5CP6B 2Y2LA 1PZRA 2BYMA 1KX4C 5AY8A 3EPJA 3NQJB 3FDDA 3X1TB 1KX5C 5GT3D 1U35D 1ZLAA 3LELD 5CP6A 3TU4C 5AV8B 3MGPC 5B40B 3AZIB 1KX3D 5AV9A 4DQYB 4H9SA 1P3FC 3AZEB 3LJAB 3W97D 3NQJA 5B0ZC 3X1TA 4KGCC 4Z66B 4ZUXA 1TAFB 4JJND 4Z5TC 5AV8A 5B40A 4R8PB 3AZIA 3AZND 3REHB 1P3GD 4G91C 3AZEA 3LJAA 4H9NB 3VH6A 5BNXB 4HGAC 4Z66A 3AZHD 3AZKD 4X23C 1TAFA 4WU8C 1P3LC 2NQBC 4G92C 4J8VC 4R8PA 3REHA 4NFTA 3KXBB 3REID 2F2AC 3AZFB 4H9NA 5BNXA 3AFAC 5AV6B 1ZLAC 3B6FD 1W2EA 5CP6C 3A6NB 3AZJB 5DNMB 5AV9C 3VH5A 3X1SD 5JRGC 5AVCC 3KXBA 5B24B 3C1BB 1EQZB 3AZFA 3X1TC 5AV6A 3WA9B 4XUJD 2HUEB 4ZUXC 3A6NA 2BYKB 5AV8C 3REKD 5B40C 5DNMA 3AZJA 3AV1B 3B0CT 5B2JB 1M19C 3AZEC 3KWQD 1P3PD 5B24A 3C1BA 1EQZA 3IP4C 2Y2OA 3VH6T 4Z66C 3WA9A 3WKJB 1S32B 5FUGB 1F66B 5GSUD 2BYKA 4R8PC 3AV1A 3REHC 5B2JA 2AROC 1P3AC 3AL0C 5B1LC 4DRBA 4EO5C 3WKJA 1S32A 5FUGA 1F66A 3AZMB 5BNVB 3AV2D 4ZBJC 1M18C 3VH5T 5E5AB 4WU9D 3AZFC 2FJ7B 5GT0C 3UT9D 5AV5C 5F99B 3A6NC 3AZMA 5BNVA 2CV5B 5AVBD 5CPJD 1WWIA 1P3OB 5B24C 5E5AA 2FJ7A 1BH8B 3WA9C 4QLCB 2PYOD 1HQ3D 1KU5A 5F99A 4YS3D 3AV1C 2CV5A 5B2JC 3EPHA 5B33D 1P3OA 3AZGB 4J8UB 5GXQD 5B2IB 5B32D 4LD9D 1BH8A 1P3KC 5BO0B 4QLCA 3WKJC 1S32C 4J8XD 3X1UB 1F66C 3B0CW 2FFFB 2G5HC 3C1CD 2F8NB 2RVQD 3LZ1B 1AOID 3AZGA 4J8UA 3VH6W 5B2IA 5BO0A 1P34D 1P3IB 5AY8D 5C3IB 3X1UA 3MGQB 3AZMC 3W96C 2F8NA 1P3MC 3LELC 3LZ1A 2JSSA 1N1JB 2DQNC 3WTPA 1P3IA 5F99C 3MGQA 2CV5C 3VH5W 3B0DB 3W98B 3TU4B 4JJNC 3AZID 1N1JA 5G49B 5B1MD 1P3FB 3LJAD 1BH9B 2Y2NA 5B0ZB 1P3LB 4KGCB 3W98A 4J8UC 4KUDD 5B31B 3TU4A 1HTAA 2HIOB 4Z5TB 2F8NK 5G49A 2NZDB 4G91B 3X1UC 2UWXA 1P3FA 1BH9A 5B0ZA 4KGCA 4WU8B 5B31A 4YM6D 4X23B 3KUYC 3AZLA 4G92B 1Z2CB 2HIOA 4Z5TA 4J8VB 3X1SC 2NQBB 3WTPC 1P3IC 2NZDA 5C3IC 4J8WC 2J8PA 3AFAB 1TZYD 2G5IC 5AV6D 3RELD 3MVDC 4WU8A 4X23A 1P3LA 3AZJD 3REJC 2NQBA 5AV9B 4J8VA 2IO5C 5AVCB 5JRGB 3KWQC 3AN2C 1EQZD 5B32G 3MNNB 3B0DC 3AFAA 3W98C 5BT1C 4ZUXB 3X1VC 3UTBC 3MGRD 1M19B 3AYWC 5CPIA 2L5AA 5AVCA 5JRGA 3MNNA 4H9RB 5B31C 5B0YB 3AZLC 2HIOC 2DF4C 3MGSB 3AV2C 1M19A 1P3AB 2AROB 3WAAD 2NZDC 5B1LB 4EO5B 4H9RA 4H9OB 5B0YA 3MGSA 4ZBJB 1P3AA 2AROA 5CPJC 1M18B 2ZY3A 5E5AD 5B1LA 5GT0B 4H9OA 5AV5B 3UTAC 1M1AD 2ZY5A 4YS3C 5CPIC 5B33C 1P3OD 3R45B 1M18A 3MNNC 5GT0A 4QLCD 2XD1A 1P3BD 5BS7C 5AV5A 5DNND 5JA4B 3R45A 3AZGD 3EG5B 1A7WA 1P3KB 1P34C 5B0YC 1ID3C 4E45A 4XZQB 3MGSC 2F8ND 3B6GB 2YFWB 5JA4A 1P3KA 2CWEA 4XZQA 3KFUG 3W96B 2Y2QA 1P3MB 5GT3B 3B6GA 2YFWA 3LELB 5CPKC 3W99D 4Z2MH 1KX4D 5B1MC 2W8SA 3W96A 1KX5D 1P3MA 5GT3A 3LELA 4JJNB 3MGPD 1P3GB 3AZNB 3LZ0C 4WNNB 3O62C 1R4VA 1WWSA 4KGCD 2ZY2A 4WZSB 3KSYA 3AZKB 4YM6C 4Z5TD 4JJNA 1P3GA 3AZNA 4WNNA 3REIB 4XZQC 4H9QB 2XD5A 1TZYC 3B6GC 4WU8D 4X23D 3AZKA 3KUYB 1P3LD 2NQBD 4J8VD 3X1SB 3WTPB 3REIA 1ULYA 4H9QA 4J8WB 3AFAD 5GT3C 1U35C 1ZLAD 5CP6D 3MVDB 3MGRC 3KUYA 3REJB 5AV9D 1KX3C 2IO5B 3X1SA 5JRGD 5AVCD 3KWQB 3AN2B 3W97C 4J8WA 3X1TD 4ZUXD 3X1VB 3UTBB 3MVDA 2Y2MA 5AV8D 1P3GC 5B40D 3REJA 3AZNC 1M19D 2F8NG 3H0LC 3AYWB 2JE5A 3WAAC 2VQRA 3AZED 3KWQA 3AN2A 4Z66D 3AZHC 4CSRB 3AZKC 3X1VA 3NQUB 4M6BA 3UTBA 3AZLB 3AV2B 4R8PD 3REHD 2Y2HA 3AYWA 3REIC 4WU9B 2BG1A 1JFIB 4NE3A 3B6FC 4CSRA 3UT9B 3NQUA 3AV2A 5CPJB 3KXBD 1M18D 1Q9CA 3AZFD 4WU9A 1JFIA 5GT0D 4XUJC 3UT9A 1HQ3B 3A6ND 3UTAB 3REKC 5DNMD 4YS3B 5CPIB 5B33B 5CPJA 2JCHA 5B24D 3C1BD 1P3PC 5GXQB 2RIQA 3WA9D 5KDMB 1HQ3A 3UTAA 5GSUC 4YS3A 3AV1D 5B2JD 2F8NH 3A1KA 5B33A 5GXQA 1P3KD 1P34B 5CHLB 1S32D 5KDMA 3WKJD 5BS7A 1ID3B 1F66D 4WU9C 3W99C 3UT9C 1P34A 4H9PB 1ID3A 2YFVB 3AZMD 3W96D 3EPLA 1P3MD 5AVBC 4NE5A 5CPKB 2FJ7D 3EPKA 4Z2MG 2PYOC 1HQ3C 4UPKA 4H9PA 5B1MB 5F99D 4DRAA 2YFVA 2CV5D 4AWLC 4KUDB 5CPKA 5GXQC 5B32C 4LD9C 3LZ0B 3O62B 5B1MA 4J8XC 3C1CC 2RVQC 1AOIC 4J8UD 4KUDA 4YM6B 5B2ID 3WTPE 3LZ0A 2Y2PA 5AY8C 3X1UD 3O62A 2ZM5A 1B6WA 2ZY4A 1TZYB 3LZ1D 3RELB 4YM6A 3KUYD 3V9RB 3WTPD 1P3ID 4H9SC 3MGQD 4J8WD 1TZYA 1U35B 2Y2IA 3RELA 3MVDD 3MGRB 3AZIC 3REJD 1KX3B 3V9RA 3LJAC 3AN2D 3W97B 3H0MC 3W98D 1U35A 5BT1D 4KUDC 3X1VD 1H3OB 3UTBD 3TU4D 2Y2KA 3MGRA 1KX3A 3AYWD 2Y2GA 3WAAB 1P3FD 3W97A 5B0ZD 3AZHB 5B31D 1H3OA 3AZLD 2HIOD 2NZDD 3WAAA 3KXBC 4KHAB 2LY8A 5AV6C 3B6FB 3AZHA 3RELC 1M1AB 3AZJC 5DNMC 3C1BC 1EQZC 4KHAA 4XUJB 2HUEC 3B0BA 1P3BB 3UTAD 3B6FA 3P5JB 1M1AA 3REKB 5CPID 5DNNB
chains in the Genus database with same CATH topology
1P3PB 4CAYB 3MNND 4XUJA 1P3BA 2Y2JA 5GSUB 3REKA 5DNNA 1P3PA 4CAYA 4E44A 5B0YD 1ID3D 4WJ3C 5GSUA 3MGSD 1F1EA 1P3AD 2AROD 1T3UA 5E5AC 5B1LD 2FJ7C 3W99B 1KX4B 4WV4B 1M1AC 1BFMA 4UUZB 1KX5B 4NE6A 5AVBB 1P3OC 5CPKD 3MGPB 4QLCC 3W99A 2PYOB 1P3BC 1KX4A 5AV5D 4UUZA 1KX5A 5DNNC 4AWLB 5AVBA 3A1IA 3AZGC 5B31G 5B2IC 5B32B 4LD9B 3MGPA 3LZ0D 2PYOA 3O62D 4J8XB 3C1CB 4HGAB 3LZ1C 1AOIB 3H0RC 2BYMB 5B32A 4LD9A 1B67A 5AY8B 4J8XA 3MGQC 3F6TA 4XZQD 3C1CA 3B6GD 1ZLAB 1AOIA 5CP6B 2Y2LA 1PZRA 2BYMA 1KX4C 5AY8A 3EPJA 3NQJB 3FDDA 3X1TB 1KX5C 5GT3D 1U35D 1ZLAA 3LELD 5CP6A 3TU4C 5AV8B 3MGPC 5B40B 3AZIB 1KX3D 5AV9A 4DQYB 4H9SA 1P3FC 3AZEB 3LJAB 3W97D 3NQJA 5B0ZC 3X1TA 4KGCC 4Z66B 4ZUXA 1TAFB 4JJND 4Z5TC 5AV8A 5B40A 4R8PB 3AZIA 3AZND 3REHB 1P3GD 4G91C 3AZEA 3LJAA 4H9NB 3VH6A 5BNXB 4HGAC 4Z66A 3AZHD 3AZKD 4X23C 1TAFA 4WU8C 1P3LC 2NQBC 4G92C 4J8VC 4R8PA 3REHA 4NFTA 3KXBB 3REID 2F2AC 3AZFB 4H9NA 5BNXA 3AFAC 5AV6B 1ZLAC 3B6FD 1W2EA 5CP6C 3A6NB 3AZJB 5DNMB 5AV9C 3VH5A 3X1SD 5JRGC 5AVCC 3KXBA 5B24B 3C1BB 1EQZB 3AZFA 3X1TC 5AV6A 3WA9B 4XUJD 2HUEB 4ZUXC 3A6NA 2BYKB 5AV8C 3REKD 5B40C 5DNMA 3AZJA 3AV1B 3B0CT 5B2JB 1M19C 3AZEC 3KWQD 1P3PD 5B24A 3C1BA 1EQZA 3IP4C 2Y2OA 3VH6T 4Z66C 3WA9A 3WKJB 1S32B 5FUGB 1F66B 5GSUD 2BYKA 4R8PC 3AV1A 3REHC 5B2JA 2AROC 1P3AC 3AL0C 5B1LC 4DRBA 4EO5C 3WKJA 1S32A 5FUGA 1F66A 3AZMB 5BNVB 3AV2D 4ZBJC 1M18C 3VH5T 5E5AB 4WU9D 3AZFC 2FJ7B 5GT0C 3UT9D 5AV5C 5F99B 3A6NC 3AZMA 5BNVA 2CV5B 5AVBD 5CPJD 1WWIA 1P3OB 5B24C 5E5AA 2FJ7A 1BH8B 3WA9C 4QLCB 2PYOD 1HQ3D 1KU5A 5F99A 4YS3D 3AV1C 2CV5A 5B2JC 3EPHA 5B33D 1P3OA 3AZGB 4J8UB 5GXQD 5B2IB 5B32D 4LD9D 1BH8A 1P3KC 5BO0B 4QLCA 3WKJC 1S32C 4J8XD 3X1UB 1F66C 3B0CW 2FFFB 2G5HC 3C1CD 2F8NB 2RVQD 3LZ1B 1AOID 3AZGA 4J8UA 3VH6W 5B2IA 5BO0A 1P34D 1P3IB 5AY8D 5C3IB 3X1UA 3MGQB 3AZMC 3W96C 2F8NA 1P3MC 3LELC 3LZ1A 2JSSA 1N1JB 2DQNC 3WTPA 1P3IA 5F99C 3MGQA 2CV5C 3VH5W 3B0DB 3W98B 3TU4B 4JJNC 3AZID 1N1JA 5G49B 5B1MD 1P3FB 3LJAD 1BH9B 2Y2NA 5B0ZB 1P3LB 4KGCB 3W98A 4J8UC 4KUDD 5B31B 3TU4A 1HTAA 2HIOB 4Z5TB 2F8NK 5G49A 2NZDB 4G91B 3X1UC 2UWXA 1P3FA 1BH9A 5B0ZA 4KGCA 4WU8B 5B31A 4YM6D 4X23B 3KUYC 3AZLA 4G92B 1Z2CB 2HIOA 4Z5TA 4J8VB 3X1SC 2NQBB 3WTPC 1P3IC 2NZDA 5C3IC 4J8WC 2J8PA 3AFAB 1TZYD 2G5IC 5AV6D 3RELD 3MVDC 4WU8A 4X23A 1P3LA 3AZJD 3REJC 2NQBA 5AV9B 4J8VA 2IO5C 5AVCB 5JRGB 3KWQC 3AN2C 1EQZD 5B32G 3MNNB 3B0DC 3AFAA 3W98C 5BT1C 4ZUXB 3X1VC 3UTBC 3MGRD 1M19B 3AYWC 5CPIA 2L5AA 5AVCA 5JRGA 3MNNA 4H9RB 5B31C 5B0YB 3AZLC 2HIOC 2DF4C 3MGSB 3AV2C 1M19A 1P3AB 2AROB 3WAAD 2NZDC 5B1LB 4EO5B 4H9RA 4H9OB 5B0YA 3MGSA 4ZBJB 1P3AA 2AROA 5CPJC 1M18B 2ZY3A 5E5AD 5B1LA 5GT0B 4H9OA 5AV5B 3UTAC 1M1AD 2ZY5A 4YS3C 5CPIC 5B33C 1P3OD 3R45B 1M18A 3MNNC 5GT0A 4QLCD 2XD1A 1P3BD 5BS7C 5AV5A 5DNND 5JA4B 3R45A 3AZGD 3EG5B 1A7WA 1P3KB 1P34C 5B0YC 1ID3C 4E45A 4XZQB 3MGSC 2F8ND 3B6GB 2YFWB 5JA4A 1P3KA 2CWEA 4XZQA 3KFUG 3W96B 2Y2QA 1P3MB 5GT3B 3B6GA 2YFWA 3LELB 5CPKC 3W99D 4Z2MH 1KX4D 5B1MC 2W8SA 3W96A 1KX5D 1P3MA 5GT3A 3LELA 4JJNB 3MGPD 1P3GB 3AZNB 3LZ0C 4WNNB 3O62C 1R4VA 1WWSA 4KGCD 2ZY2A 4WZSB 3KSYA 3AZKB 4YM6C 4Z5TD 4JJNA 1P3GA 3AZNA 4WNNA 3REIB 4XZQC 4H9QB 2XD5A 1TZYC 3B6GC 4WU8D 4X23D 3AZKA 3KUYB 1P3LD 2NQBD 4J8VD 3X1SB 3WTPB 3REIA 1ULYA 4H9QA 4J8WB 3AFAD 5GT3C 1U35C 1ZLAD 5CP6D 3MVDB 3MGRC 3KUYA 3REJB 5AV9D 1KX3C 2IO5B 3X1SA 5JRGD 5AVCD 3KWQB 3AN2B 3W97C 4J8WA 3X1TD 4ZUXD 3X1VB 3UTBB 3MVDA 2Y2MA 5AV8D 1P3GC 5B40D 3REJA 3AZNC 1M19D 2F8NG 3H0LC 3AYWB 2JE5A 3WAAC 2VQRA 3AZED 3KWQA 3AN2A 4Z66D 3AZHC 4CSRB 3AZKC 3X1VA 3NQUB 4M6BA 3UTBA 3AZLB 3AV2B 4R8PD 3REHD 2Y2HA 3AYWA 3REIC 4WU9B 2BG1A 1JFIB 4NE3A 3B6FC 4CSRA 3UT9B 3NQUA 3AV2A 5CPJB 3KXBD 1M18D 1Q9CA 3AZFD 4WU9A 1JFIA 5GT0D 4XUJC 3UT9A 1HQ3B 3A6ND 3UTAB 3REKC 5DNMD 4YS3B 5CPIB 5B33B 5CPJA 2JCHA 5B24D 3C1BD 1P3PC 5GXQB 2RIQA 3WA9D 5KDMB 1HQ3A 3UTAA 5GSUC 4YS3A 3AV1D 5B2JD 2F8NH 3A1KA 5B33A 5GXQA 1P3KD 1P34B 5CHLB 1S32D 5KDMA 3WKJD 5BS7A 1ID3B 1F66D 4WU9C 3W99C 3UT9C 1P34A 4H9PB 1ID3A 2YFVB 3AZMD 3W96D 3EPLA 1P3MD 5AVBC 4NE5A 5CPKB 2FJ7D 3EPKA 4Z2MG 2PYOC 1HQ3C 4UPKA 4H9PA 5B1MB 5F99D 4DRAA 2YFVA 2CV5D 4AWLC 4KUDB 5CPKA 5GXQC 5B32C 4LD9C 3LZ0B 3O62B 5B1MA 4J8XC 3C1CC 2RVQC 1AOIC 4J8UD 4KUDA 4YM6B 5B2ID 3WTPE 3LZ0A 2Y2PA 5AY8C 3X1UD 3O62A 2ZM5A 1B6WA 2ZY4A 1TZYB 3LZ1D 3RELB 4YM6A 3KUYD 3V9RB 3WTPD 1P3ID 4H9SC 3MGQD 4J8WD 1TZYA 1U35B 2Y2IA 3RELA 3MVDD 3MGRB 3AZIC 3REJD 1KX3B 3V9RA 3LJAC 3AN2D 3W97B 3H0MC 3W98D 1U35A 5BT1D 4KUDC 3X1VD 1H3OB 3UTBD 3TU4D 2Y2KA 3MGRA 1KX3A 3AYWD 2Y2GA 3WAAB 1P3FD 3W97A 5B0ZD 3AZHB 5B31D 1H3OA 3AZLD 2HIOD 2NZDD 3WAAA 3KXBC 4KHAB 2LY8A 5AV6C 3B6FB 3AZHA 3RELC 1M1AB 3AZJC 5DNMC 3C1BC 1EQZC 4KHAA 4XUJB 2HUEC 3B0BA 1P3BB 3UTAD 3B6FA 3P5JB 1M1AA 3REKB 5CPID 5DNNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3P B;  4CAY B;  3MNN D;  4XUJ A;  1P3B A;  5GSU B;  3REK A;  5DNN A;  1P3P A;  4CAY A;  4E44 A;  5B0Y D;  1ID3 D;  5GSU A;  3MGS D;  1F1E A;  1P3A D;  2ARO D;  5E5A C;  5B1L D;  2FJ7 C;  3W99 B;  1KX4 B;  4WV4 B;  1M1A C;  1BFM A;  4UUZ B;  1KX5 B;  4NE6 A;  5AVB B;  1P3O C;  5CPK D;  3MGP B;  4QLC C;  3W99 A;  2PYO B;  1P3B C;  1KX4 A;  5AV5 D;  4UUZ A;  1KX5 A;  5DNN C;  4AWL B;  5AVB A;  3AZG C;  5B31 G;  5B2I C;  5B32 B;  4LD9 B;  3MGP A;  3LZ0 D;  2PYO A;  3O62 D;  4J8X B;  3C1C B;  4HGA B;  3LZ1 C;  1AOI B;  2BYM B;  5B32 A;  4LD9 A;  1B67 A;  5AY8 B;  4J8X A;  3MGQ C;  4XZQ D;  3C1C A;  3B6G D;  1ZLA B;  1AOI A;  5CP6 B;  2BYM A;  1KX4 C;  5AY8 A;  3NQJ B;  3X1T B;  1KX5 C;  5GT3 D;  1U35 D;  1ZLA A;  3LEL D;  5CP6 A;  3TU4 C;  5AV8 B;  3MGP C;  5B40 B;  3AZI B;  1KX3 D;  5AV9 A;  4H9S A;  1P3F C;  3AZE B;  3LJA B;  3W97 D;  3NQJ A;  5B0Z C;  3X1T A;  4KGC C;  4Z66 B;  4ZUX A;  1TAF B;  4JJN D;  4Z5T C;  5AV8 A;  5B40 A;  4R8P B;  3AZI A;  3AZN D;  3REH B;  1P3G D;  4G91 C;  3AZE A;  3LJA A;  4H9N B;  3VH6 A;  5BNX B;  4HGA C;  4Z66 A;  3AZH D;  3AZK D;  4X23 C;  1TAF A;  4WU8 C;  1P3L C;  2NQB C;  4G92 C;  4J8V C;  4R8P A;  3REH A;  4NFT A;  3KXB B;  3REI D;  3AZF B;  4H9N A;  5BNX A;  3AFA C;  5AV6 B;  1ZLA C;  3B6F D;  5CP6 C;  3A6N B;  3AZJ B;  5DNM B;  5AV9 C;  3VH5 A;  3X1S D;  5JRG C;  5AVC C;  3KXB A;  5B24 B;  3C1B B;  1EQZ B;  3AZF A;  3X1T C;  5AV6 A;  3WA9 B;  4XUJ D;  2HUE B;  4ZUX C;  3A6N A;  2BYK B;  5AV8 C;  3REK D;  5B40 C;  5DNM A;  3AZJ A;  3AV1 B;  3B0C T;  5B2J B;  1M19 C;  3AZE C;  3KWQ D;  1P3P D;  5B24 A;  3C1B A;  1EQZ A;  3VH6 T;  4Z66 C;  3WA9 A;  3WKJ B;  1S32 B;  5FUG B;  1F66 B;  2BYK A;  5GSU D;  4R8P C;  3AV1 A;  3REH C;  5B2J A;  2ARO C;  1P3A C;  5B1L C;  4DRB A;  4EO5 C;  3WKJ A;  1S32 A;  5FUG A;  1F66 A;  3AZM B;  5BNV B;  3AV2 D;  4ZBJ C;  1M18 C;  3VH5 T;  5E5A B;  4WU9 D;  3AZF C;  2FJ7 B;  5GT0 C;  3UT9 D;  5AV5 C;  5F99 B;  3A6N C;  3AZM A;  5BNV A;  2CV5 B;  5AVB D;  5CPJ D;  1WWI A;  1P3O B;  5B24 C;  5E5A A;  2FJ7 A;  1BH8 B;  3WA9 C;  4QLC B;  2PYO D;  1HQ3 D;  1KU5 A;  5F99 A;  4YS3 D;  3AV1 C;  2CV5 A;  5B2J C;  5B33 D;  1P3O A;  3AZG B;  4J8U B;  5GXQ D;  5B2I B;  5B32 D;  4LD9 D;  1BH8 A;  1P3K C;  5BO0 B;  4QLC A;  3WKJ C;  1S32 C;  4J8X D;  3X1U B;  1F66 C;  3B0C W;  2F8N B;  3C1C D;  2RVQ D;  3LZ1 B;  1AOI D;  3AZG A;  4J8U A;  3VH6 W;  5B2I A;  5BO0 A;  1P34 D;  1P3I B;  5AY8 D;  5C3I B;  3X1U A;  3MGQ B;  3AZM C;  3W96 C;  2F8N A;  1P3M C;  3LEL C;  3LZ1 A;  2JSS A;  1N1J B;  3WTP A;  1P3I A;  5F99 C;  3MGQ A;  2CV5 C;  3VH5 W;  3B0D B;  3W98 B;  3TU4 B;  4JJN C;  3AZI D;  1N1J A;  5G49 B;  5B1M D;  1P3F B;  3LJA D;  1BH9 B;  5B0Z B;  4KGC B;  3W98 A;  4J8U C;  4KUD D;  5B31 B;  3TU4 A;  1HTA A;  2HIO B;  4Z5T B;  2F8N K;  5G49 A;  2NZD B;  4G91 B;  3X1U C;  1P3F A;  1BH9 A;  5B0Z A;  4KGC A;  4WU8 B;  5B31 A;  4YM6 D;  4X23 B;  3KUY C;  3AZL A;  4G92 B;  1P3L B;  2HIO A;  4Z5T A;  4J8V B;  3X1S C;  2NQB B;  3WTP C;  1P3I C;  2NZD A;  5C3I C;  4J8W C;  3AFA B;  1TZY D;  5AV6 D;  3REL D;  3MVD C;  4WU8 A;  4X23 A;  1P3L A;  3AZJ D;  3REJ C;  2NQB A;  5AV9 B;  4J8V A;  2IO5 C;  5AVC B;  5JRG B;  3KWQ C;  3AN2 C;  1EQZ D;  5B32 G;  3MNN B;  3B0D C;  3AFA A;  3W98 C;  5BT1 C;  4ZUX B;  3X1V C;  3UTB C;  3MGR D;  1M19 B;  3AYW C;  5CPI A;  2L5A A;  5AVC A;  5JRG A;  3MNN A;  4H9R B;  5B31 C;  5B0Y B;  3AZL C;  2HIO C;  3MGS B;  3AV2 C;  1M19 A;  1P3A B;  2ARO B;  3WAA D;  2NZD C;  5B1L B;  4EO5 B;  4H9O B;  4H9R A;  5B0Y A;  3MGS A;  4ZBJ B;  1P3A A;  2ARO A;  5CPJ C;  1M18 B;  5E5A D;  5B1L A;  5GT0 B;  4H9O A;  5AV5 B;  3UTA C;  1M1A D;  4YS3 C;  5CPI C;  5B33 C;  1P3O D;  3R45 B;  1M18 A;  3MNN C;  5GT0 A;  4QLC D;  1P3B D;  5BS7 C;  5AV5 A;  5DNN D;  5JA4 B;  3R45 A;  3AZG D;  1A7W A;  1P3K B;  1P34 C;  5B0Y C;  1ID3 C;  4E45 A;  4XZQ B;  3MGS C;  2F8N D;  3B6G B;  2YFW B;  5JA4 A;  1P3K A;  2CWE A;  4XZQ A;  3W96 B;  1P3M B;  5GT3 B;  3B6G A;  2YFW A;  3LEL B;  5CPK C;  3W99 D;  4Z2M H;  1KX4 D;  5B1M C;  3W96 A;  1KX5 D;  1P3M A;  5GT3 A;  3LEL A;  4JJN B;  3MGP D;  1P3G B;  3AZN B;  3LZ0 C;  4WNN B;  3O62 C;  1R4V A;  1WWS A;  4KGC D;  4WZS B;  3KSY A;  3AZK B;  4YM6 C;  4Z5T D;  4JJN A;  1P3G A;  3AZN A;  4WNN A;  3REI B;  4XZQ C;  4H9Q B;  1TZY C;  3B6G C;  4WU8 D;  4X23 D;  3AZK A;  3KUY B;  1P3L D;  2NQB D;  4J8V D;  3X1S B;  3WTP B;  3REI A;  1ULY A;  4H9Q A;  4J8W B;  3AFA D;  5GT3 C;  1U35 C;  1ZLA D;  5CP6 D;  3MVD B;  3MGR C;  3KUY A;  3REJ B;  5AV9 D;  1KX3 C;  2IO5 B;  3X1S A;  5JRG D;  5AVC D;  3KWQ B;  3AN2 B;  3W97 C;  4J8W A;  3X1T D;  4ZUX D;  3X1V B;  3UTB B;  3MVD A;  5AV8 D;  1P3G C;  5B40 D;  3REJ A;  3AZN C;  1M19 D;  2F8N G;  3AYW B;  3WAA C;  3AZE D;  3KWQ A;  3AN2 A;  4Z66 D;  3AZH C;  4CSR B;  3AZK C;  3X1V A;  3NQU B;  4M6B A;  3UTB A;  3AZL B;  3AV2 B;  4R8P D;  3REH D;  3AYW A;  3REI C;  4WU9 B;  1JFI B;  4NE3 A;  3B6F C;  4CSR A;  3UT9 B;  3NQU A;  3AV2 A;  5CPJ B;  3KXB D;  1M18 D;  1Q9C A;  3AZF D;  4WU9 A;  1JFI A;  5GT0 D;  4XUJ C;  3UT9 A;  1HQ3 B;  3A6N D;  3UTA B;  3REK C;  5DNM D;  4YS3 B;  5CPI B;  5B33 B;  5CPJ A;  5B24 D;  3C1B D;  1P3P C;  5GXQ B;  3WA9 D;  5KDM B;  1HQ3 A;  3UTA A;  5GSU C;  4YS3 A;  3AV1 D;  5B2J D;  2F8N H;  5B33 A;  5GXQ A;  1P3K D;  1P34 B;  5CHL B;  1S32 D;  5KDM A;  3WKJ D;  5BS7 A;  1ID3 B;  1F66 D;  4WU9 C;  3W99 C;  3UT9 C;  1P34 A;  4H9P B;  1ID3 A;  2YFV B;  3AZM D;  3W96 D;  1P3M D;  5AVB C;  4NE5 A;  5CPK B;  2FJ7 D;  4Z2M G;  2PYO C;  1HQ3 C;  5B1M B;  4H9P A;  5F99 D;  4DRA A;  2YFV A;  2CV5 D;  4AWL C;  4KUD B;  5CPK A;  5GXQ C;  5B32 C;  4LD9 C;  3LZ0 B;  3O62 B;  5B1M A;  4J8X C;  3C1C C;  2RVQ C;  1AOI C;  4J8U D;  4KUD A;  4YM6 B;  5B2I D;  3WTP E;  3LZ0 A;  5AY8 C;  3X1U D;  3O62 A;  1B6W A;  1TZY B;  3LZ1 D;  3REL B;  4YM6 A;  3KUY D;  3V9R B;  3WTP D;  1P3I D;  4H9S C;  3MGQ D;  4J8W D;  1TZY A;  1U35 B;  3REL A;  3MVD D;  3MGR B;  3AZI C;  3REJ D;  1KX3 B;  3V9R A;  3LJA C;  3AN2 D;  3W97 B;  3W98 D;  1U35 A;  5BT1 D;  4KUD C;  3X1V D;  1H3O B;  3UTB D;  3TU4 D;  3MGR A;  1KX3 A;  3AYW D;  3WAA B;  1P3F D;  3W97 A;  5B0Z D;  3AZH B;  5B31 D;  1H3O A;  3AZL D;  2HIO D;  2NZD D;  3WAA A;  3KXB C;  4KHA B;  2LY8 A;  5AV6 C;  3B6F B;  3AZH A;  3REL C;  1M1A B;  3AZJ C;  5DNM C;  3C1B C;  1EQZ C;  4KHA A;  4XUJ B;  2HUE C;  3B0B A;  1P3B B;  3UTA D;  3B6F A;  1M1A A;  3REK B;  5CPI D;  5DNN B; 
#chains in the Genus database with same CATH topology
 1P3P B;  4CAY B;  3MNN D;  4XUJ A;  1P3B A;  2Y2J A;  5GSU B;  3REK A;  5DNN A;  1P3P A;  4CAY A;  4E44 A;  5B0Y D;  1ID3 D;  4WJ3 C;  5GSU A;  3MGS D;  1F1E A;  1P3A D;  2ARO D;  1T3U A;  5E5A C;  5B1L D;  2FJ7 C;  3W99 B;  1KX4 B;  4WV4 B;  1M1A C;  1BFM A;  4UUZ B;  1KX5 B;  4NE6 A;  5AVB B;  1P3O C;  5CPK D;  3MGP B;  4QLC C;  3W99 A;  2PYO B;  1P3B C;  1KX4 A;  5AV5 D;  4UUZ A;  1KX5 A;  5DNN C;  4AWL B;  5AVB A;  3A1I A;  3AZG C;  5B31 G;  5B2I C;  5B32 B;  4LD9 B;  3MGP A;  3LZ0 D;  2PYO A;  3O62 D;  4J8X B;  3C1C B;  4HGA B;  3LZ1 C;  1AOI B;  3H0R C;  2BYM B;  5B32 A;  4LD9 A;  1B67 A;  5AY8 B;  4J8X A;  3MGQ C;  3F6T A;  4XZQ D;  3C1C A;  3B6G D;  1ZLA B;  1AOI A;  5CP6 B;  2Y2L A;  1PZR A;  2BYM A;  1KX4 C;  5AY8 A;  3EPJ A;  3NQJ B;  3FDD A;  3X1T B;  1KX5 C;  5GT3 D;  1U35 D;  1ZLA A;  3LEL D;  5CP6 A;  3TU4 C;  5AV8 B;  3MGP C;  5B40 B;  3AZI B;  1KX3 D;  5AV9 A;  4DQY B;  4H9S A;  1P3F C;  3AZE B;  3LJA B;  3W97 D;  3NQJ A;  5B0Z C;  3X1T A;  4KGC C;  4Z66 B;  4ZUX A;  1TAF B;  4JJN D;  4Z5T C;  5AV8 A;  5B40 A;  4R8P B;  3AZI A;  3AZN D;  3REH B;  1P3G D;  4G91 C;  3AZE A;  3LJA A;  4H9N B;  3VH6 A;  5BNX B;  4HGA C;  4Z66 A;  3AZH D;  3AZK D;  4X23 C;  1TAF A;  4WU8 C;  1P3L C;  2NQB C;  4G92 C;  4J8V C;  4R8P A;  3REH A;  4NFT A;  3KXB B;  3REI D;  2F2A C;  3AZF B;  4H9N A;  5BNX A;  3AFA C;  5AV6 B;  1ZLA C;  3B6F D;  1W2E A;  5CP6 C;  3A6N B;  3AZJ B;  5DNM B;  5AV9 C;  3VH5 A;  3X1S D;  5JRG C;  5AVC C;  3KXB A;  5B24 B;  3C1B B;  1EQZ B;  3AZF A;  3X1T C;  5AV6 A;  3WA9 B;  4XUJ D;  2HUE B;  4ZUX C;  3A6N A;  2BYK B;  5AV8 C;  3REK D;  5B40 C;  5DNM A;  3AZJ A;  3AV1 B;  3B0C T;  5B2J B;  1M19 C;  3AZE C;  3KWQ D;  1P3P D;  5B24 A;  3C1B A;  1EQZ A;  3IP4 C;  2Y2O A;  3VH6 T;  4Z66 C;  3WA9 A;  3WKJ B;  1S32 B;  5FUG B;  1F66 B;  5GSU D;  2BYK A;  4R8P C;  3AV1 A;  3REH C;  5B2J A;  2ARO C;  1P3A C;  3AL0 C;  5B1L C;  4DRB A;  4EO5 C;  3WKJ A;  1S32 A;  5FUG A;  1F66 A;  3AZM B;  5BNV B;  3AV2 D;  4ZBJ C;  1M18 C;  3VH5 T;  5E5A B;  4WU9 D;  3AZF C;  2FJ7 B;  5GT0 C;  3UT9 D;  5AV5 C;  5F99 B;  3A6N C;  3AZM A;  5BNV A;  2CV5 B;  5AVB D;  5CPJ D;  1WWI A;  1P3O B;  5B24 C;  5E5A A;  2FJ7 A;  1BH8 B;  3WA9 C;  4QLC B;  2PYO D;  1HQ3 D;  1KU5 A;  5F99 A;  4YS3 D;  3AV1 C;  2CV5 A;  5B2J C;  3EPH A;  5B33 D;  1P3O A;  3AZG B;  4J8U B;  5GXQ D;  5B2I B;  5B32 D;  4LD9 D;  1BH8 A;  1P3K C;  5BO0 B;  4QLC A;  3WKJ C;  1S32 C;  4J8X D;  3X1U B;  1F66 C;  3B0C W;  2FFF B;  2G5H C;  3C1C D;  2F8N B;  2RVQ D;  3LZ1 B;  1AOI D;  3AZG A;  4J8U A;  3VH6 W;  5B2I A;  5BO0 A;  1P34 D;  1P3I B;  5AY8 D;  5C3I B;  3X1U A;  3MGQ B;  3AZM C;  3W96 C;  2F8N A;  1P3M C;  3LEL C;  3LZ1 A;  2JSS A;  1N1J B;  2DQN C;  3WTP A;  1P3I A;  5F99 C;  3MGQ A;  2CV5 C;  3VH5 W;  3B0D B;  3W98 B;  3TU4 B;  4JJN C;  3AZI D;  1N1J A;  5G49 B;  5B1M D;  1P3F B;  3LJA D;  1BH9 B;  2Y2N A;  5B0Z B;  1P3L B;  4KGC B;  3W98 A;  4J8U C;  4KUD D;  5B31 B;  3TU4 A;  1HTA A;  2HIO B;  4Z5T B;  2F8N K;  5G49 A;  2NZD B;  4G91 B;  3X1U C;  2UWX A;  1P3F A;  1BH9 A;  5B0Z A;  4KGC A;  4WU8 B;  5B31 A;  4YM6 D;  4X23 B;  3KUY C;  3AZL A;  4G92 B;  1Z2C B;  2HIO A;  4Z5T A;  4J8V B;  3X1S C;  2NQB B;  3WTP C;  1P3I C;  2NZD A;  5C3I C;  4J8W C;  2J8P A;  3AFA B;  1TZY D;  2G5I C;  5AV6 D;  3REL D;  3MVD C;  4WU8 A;  4X23 A;  1P3L A;  3AZJ D;  3REJ C;  2NQB A;  5AV9 B;  4J8V A;  2IO5 C;  5AVC B;  5JRG B;  3KWQ C;  3AN2 C;  1EQZ D;  5B32 G;  3MNN B;  3B0D C;  3AFA A;  3W98 C;  5BT1 C;  4ZUX B;  3X1V C;  3UTB C;  3MGR D;  1M19 B;  3AYW C;  5CPI A;  2L5A A;  5AVC A;  5JRG A;  3MNN A;  4H9R B;  5B31 C;  5B0Y B;  3AZL C;  2HIO C;  2DF4 C;  3MGS B;  3AV2 C;  1M19 A;  1P3A B;  2ARO B;  3WAA D;  2NZD C;  5B1L B;  4EO5 B;  4H9R A;  4H9O B;  5B0Y A;  3MGS A;  4ZBJ B;  1P3A A;  2ARO A;  5CPJ C;  1M18 B;  2ZY3 A;  5E5A D;  5B1L A;  5GT0 B;  4H9O A;  5AV5 B;  3UTA C;  1M1A D;  2ZY5 A;  4YS3 C;  5CPI C;  5B33 C;  1P3O D;  3R45 B;  1M18 A;  3MNN C;  5GT0 A;  4QLC D;  2XD1 A;  1P3B D;  5BS7 C;  5AV5 A;  5DNN D;  5JA4 B;  3R45 A;  3AZG D;  3EG5 B;  1A7W A;  1P3K B;  1P34 C;  5B0Y C;  1ID3 C;  4E45 A;  4XZQ B;  3MGS C;  2F8N D;  3B6G B;  2YFW B;  5JA4 A;  1P3K A;  2CWE A;  4XZQ A;  3KFU G;  3W96 B;  2Y2Q A;  1P3M B;  5GT3 B;  3B6G A;  2YFW A;  3LEL B;  5CPK C;  3W99 D;  4Z2M H;  1KX4 D;  5B1M C;  2W8S A;  3W96 A;  1KX5 D;  1P3M A;  5GT3 A;  3LEL A;  4JJN B;  3MGP D;  1P3G B;  3AZN B;  3LZ0 C;  4WNN B;  3O62 C;  1R4V A;  1WWS A;  4KGC D;  2ZY2 A;  4WZS B;  3KSY A;  3AZK B;  4YM6 C;  4Z5T D;  4JJN A;  1P3G A;  3AZN A;  4WNN A;  3REI B;  4XZQ C;  4H9Q B;  2XD5 A;  1TZY C;  3B6G C;  4WU8 D;  4X23 D;  3AZK A;  3KUY B;  1P3L D;  2NQB D;  4J8V D;  3X1S B;  3WTP B;  3REI A;  1ULY A;  4H9Q A;  4J8W B;  3AFA D;  5GT3 C;  1U35 C;  1ZLA D;  5CP6 D;  3MVD B;  3MGR C;  3KUY A;  3REJ B;  5AV9 D;  1KX3 C;  2IO5 B;  3X1S A;  5JRG D;  5AVC D;  3KWQ B;  3AN2 B;  3W97 C;  4J8W A;  3X1T D;  4ZUX D;  3X1V B;  3UTB B;  3MVD A;  2Y2M A;  5AV8 D;  1P3G C;  5B40 D;  3REJ A;  3AZN C;  1M19 D;  2F8N G;  3H0L C;  3AYW B;  2JE5 A;  3WAA C;  2VQR A;  3AZE D;  3KWQ A;  3AN2 A;  4Z66 D;  3AZH C;  4CSR B;  3AZK C;  3X1V A;  3NQU B;  4M6B A;  3UTB A;  3AZL B;  3AV2 B;  4R8P D;  3REH D;  2Y2H A;  3AYW A;  3REI C;  4WU9 B;  2BG1 A;  1JFI B;  4NE3 A;  3B6F C;  4CSR A;  3UT9 B;  3NQU A;  3AV2 A;  5CPJ B;  3KXB D;  1M18 D;  1Q9C A;  3AZF D;  4WU9 A;  1JFI A;  5GT0 D;  4XUJ C;  3UT9 A;  1HQ3 B;  3A6N D;  3UTA B;  3REK C;  5DNM D;  4YS3 B;  5CPI B;  5B33 B;  5CPJ A;  2JCH A;  5B24 D;  3C1B D;  1P3P C;  5GXQ B;  2RIQ A;  3WA9 D;  5KDM B;  1HQ3 A;  3UTA A;  5GSU C;  4YS3 A;  3AV1 D;  5B2J D;  2F8N H;  3A1K A;  5B33 A;  5GXQ A;  1P3K D;  1P34 B;  5CHL B;  1S32 D;  5KDM A;  3WKJ D;  5BS7 A;  1ID3 B;  1F66 D;  4WU9 C;  3W99 C;  3UT9 C;  1P34 A;  4H9P B;  1ID3 A;  2YFV B;  3AZM D;  3W96 D;  3EPL A;  1P3M D;  5AVB C;  4NE5 A;  5CPK B;  2FJ7 D;  3EPK A;  4Z2M G;  2PYO C;  1HQ3 C;  4UPK A;  4H9P A;  5B1M B;  5F99 D;  4DRA A;  2YFV A;  2CV5 D;  4AWL C;  4KUD B;  5CPK A;  5GXQ C;  5B32 C;  4LD9 C;  3LZ0 B;  3O62 B;  5B1M A;  4J8X C;  3C1C C;  2RVQ C;  1AOI C;  4J8U D;  4KUD A;  4YM6 B;  5B2I D;  3WTP E;  3LZ0 A;  2Y2P A;  5AY8 C;  3X1U D;  3O62 A;  2ZM5 A;  1B6W A;  2ZY4 A;  1TZY B;  3LZ1 D;  3REL B;  4YM6 A;  3KUY D;  3V9R B;  3WTP D;  1P3I D;  4H9S C;  3MGQ D;  4J8W D;  1TZY A;  1U35 B;  2Y2I A;  3REL A;  3MVD D;  3MGR B;  3AZI C;  3REJ D;  1KX3 B;  3V9R A;  3LJA C;  3AN2 D;  3W97 B;  3H0M C;  3W98 D;  1U35 A;  5BT1 D;  4KUD C;  3X1V D;  1H3O B;  3UTB D;  3TU4 D;  2Y2K A;  3MGR A;  1KX3 A;  3AYW D;  2Y2G A;  3WAA B;  1P3F D;  3W97 A;  5B0Z D;  3AZH B;  5B31 D;  1H3O A;  3AZL D;  2HIO D;  2NZD D;  3WAA A;  3KXB C;  4KHA B;  2LY8 A;  5AV6 C;  3B6F B;  3AZH A;  3REL C;  1M1A B;  3AZJ C;  5DNM C;  3C1B C;  1EQZ C;  4KHA A;  4XUJ B;  2HUE C;  3B0B A;  1P3B B;  3UTA D;  3B6F A;  3P5J B;  1M1A A;  3REK B;  5CPI D;  5DNN B; 
#chains in the Genus database with same CATH homology
 1P3P B;  4CAY B;  3MNN D;  4XUJ A;  1P3B A;  2Y2J A;  5GSU B;  3REK A;  5DNN A;  1P3P A;  4CAY A;  4E44 A;  5B0Y D;  1ID3 D;  4WJ3 C;  5GSU A;  3MGS D;  1F1E A;  1P3A D;  2ARO D;  1T3U A;  5E5A C;  5B1L D;  2FJ7 C;  3W99 B;  1KX4 B;  4WV4 B;  1M1A C;  1BFM A;  4UUZ B;  1KX5 B;  4NE6 A;  5AVB B;  1P3O C;  5CPK D;  3MGP B;  4QLC C;  3W99 A;  2PYO B;  1P3B C;  1KX4 A;  5AV5 D;  4UUZ A;  1KX5 A;  5DNN C;  4AWL B;  5AVB A;  3A1I A;  3AZG C;  5B31 G;  5B2I C;  5B32 B;  4LD9 B;  3MGP A;  3LZ0 D;  2PYO A;  3O62 D;  4J8X B;  3C1C B;  4HGA B;  3LZ1 C;  1AOI B;  3H0R C;  2BYM B;  5B32 A;  4LD9 A;  1B67 A;  5AY8 B;  4J8X A;  3MGQ C;  3F6T A;  4XZQ D;  3C1C A;  3B6G D;  1ZLA B;  1AOI A;  5CP6 B;  2Y2L A;  1PZR A;  2BYM A;  1KX4 C;  5AY8 A;  3EPJ A;  3NQJ B;  3FDD A;  3X1T B;  1KX5 C;  5GT3 D;  1U35 D;  1ZLA A;  3LEL D;  5CP6 A;  3TU4 C;  5AV8 B;  3MGP C;  5B40 B;  3AZI B;  1KX3 D;  5AV9 A;  4DQY B;  4H9S A;  1P3F C;  3AZE B;  3LJA B;  3W97 D;  3NQJ A;  5B0Z C;  3X1T A;  4KGC C;  4Z66 B;  4ZUX A;  1TAF B;  4JJN D;  4Z5T C;  5AV8 A;  5B40 A;  4R8P B;  3AZI A;  3AZN D;  3REH B;  1P3G D;  4G91 C;  3AZE A;  3LJA A;  4H9N B;  3VH6 A;  5BNX B;  4HGA C;  4Z66 A;  3AZH D;  3AZK D;  4X23 C;  1TAF A;  4WU8 C;  1P3L C;  2NQB C;  4G92 C;  4J8V C;  4R8P A;  3REH A;  4NFT A;  3KXB B;  3REI D;  2F2A C;  3AZF B;  4H9N A;  5BNX A;  3AFA C;  5AV6 B;  1ZLA C;  3B6F D;  1W2E A;  5CP6 C;  3A6N B;  3AZJ B;  5DNM B;  5AV9 C;  3VH5 A;  3X1S D;  5JRG C;  5AVC C;  3KXB A;  5B24 B;  3C1B B;  1EQZ B;  3AZF A;  3X1T C;  5AV6 A;  3WA9 B;  4XUJ D;  2HUE B;  4ZUX C;  3A6N A;  2BYK B;  5AV8 C;  3REK D;  5B40 C;  5DNM A;  3AZJ A;  3AV1 B;  3B0C T;  5B2J B;  1M19 C;  3AZE C;  3KWQ D;  1P3P D;  5B24 A;  3C1B A;  1EQZ A;  3IP4 C;  2Y2O A;  3VH6 T;  4Z66 C;  3WA9 A;  3WKJ B;  1S32 B;  5FUG B;  1F66 B;  5GSU D;  2BYK A;  4R8P C;  3AV1 A;  3REH C;  5B2J A;  2ARO C;  1P3A C;  3AL0 C;  5B1L C;  4DRB A;  4EO5 C;  3WKJ A;  1S32 A;  5FUG A;  1F66 A;  3AZM B;  5BNV B;  3AV2 D;  4ZBJ C;  1M18 C;  3VH5 T;  5E5A B;  4WU9 D;  3AZF C;  2FJ7 B;  5GT0 C;  3UT9 D;  5AV5 C;  5F99 B;  3A6N C;  3AZM A;  5BNV A;  2CV5 B;  5AVB D;  5CPJ D;  1WWI A;  1P3O B;  5B24 C;  5E5A A;  2FJ7 A;  1BH8 B;  3WA9 C;  4QLC B;  2PYO D;  1HQ3 D;  1KU5 A;  5F99 A;  4YS3 D;  3AV1 C;  2CV5 A;  5B2J C;  3EPH A;  5B33 D;  1P3O A;  3AZG B;  4J8U B;  5GXQ D;  5B2I B;  5B32 D;  4LD9 D;  1BH8 A;  1P3K C;  5BO0 B;  4QLC A;  3WKJ C;  1S32 C;  4J8X D;  3X1U B;  1F66 C;  3B0C W;  2FFF B;  2G5H C;  3C1C D;  2F8N B;  2RVQ D;  3LZ1 B;  1AOI D;  3AZG A;  4J8U A;  3VH6 W;  5B2I A;  5BO0 A;  1P34 D;  1P3I B;  5AY8 D;  5C3I B;  3X1U A;  3MGQ B;  3AZM C;  3W96 C;  2F8N A;  1P3M C;  3LEL C;  3LZ1 A;  2JSS A;  1N1J B;  2DQN C;  3WTP A;  1P3I A;  5F99 C;  3MGQ A;  2CV5 C;  3VH5 W;  3B0D B;  3W98 B;  3TU4 B;  4JJN C;  3AZI D;  1N1J A;  5G49 B;  5B1M D;  1P3F B;  3LJA D;  1BH9 B;  2Y2N A;  5B0Z B;  1P3L B;  4KGC B;  3W98 A;  4J8U C;  4KUD D;  5B31 B;  3TU4 A;  1HTA A;  2HIO B;  4Z5T B;  2F8N K;  5G49 A;  2NZD B;  4G91 B;  3X1U C;  2UWX A;  1P3F A;  1BH9 A;  5B0Z A;  4KGC A;  4WU8 B;  5B31 A;  4YM6 D;  4X23 B;  3KUY C;  3AZL A;  4G92 B;  1Z2C B;  2HIO A;  4Z5T A;  4J8V B;  3X1S C;  2NQB B;  3WTP C;  1P3I C;  2NZD A;  5C3I C;  4J8W C;  2J8P A;  3AFA B;  1TZY D;  2G5I C;  5AV6 D;  3REL D;  3MVD C;  4WU8 A;  4X23 A;  1P3L A;  3AZJ D;  3REJ C;  2NQB A;  5AV9 B;  4J8V A;  2IO5 C;  5AVC B;  5JRG B;  3KWQ C;  3AN2 C;  1EQZ D;  5B32 G;  3MNN B;  3B0D C;  3AFA A;  3W98 C;  5BT1 C;  4ZUX B;  3X1V C;  3UTB C;  3MGR D;  1M19 B;  3AYW C;  5CPI A;  2L5A A;  5AVC A;  5JRG A;  3MNN A;  4H9R B;  5B31 C;  5B0Y B;  3AZL C;  2HIO C;  2DF4 C;  3MGS B;  3AV2 C;  1M19 A;  1P3A B;  2ARO B;  3WAA D;  2NZD C;  5B1L B;  4EO5 B;  4H9R A;  4H9O B;  5B0Y A;  3MGS A;  4ZBJ B;  1P3A A;  2ARO A;  5CPJ C;  1M18 B;  2ZY3 A;  5E5A D;  5B1L A;  5GT0 B;  4H9O A;  5AV5 B;  3UTA C;  1M1A D;  2ZY5 A;  4YS3 C;  5CPI C;  5B33 C;  1P3O D;  3R45 B;  1M18 A;  3MNN C;  5GT0 A;  4QLC D;  2XD1 A;  1P3B D;  5BS7 C;  5AV5 A;  5DNN D;  5JA4 B;  3R45 A;  3AZG D;  3EG5 B;  1A7W A;  1P3K B;  1P34 C;  5B0Y C;  1ID3 C;  4E45 A;  4XZQ B;  3MGS C;  2F8N D;  3B6G B;  2YFW B;  5JA4 A;  1P3K A;  2CWE A;  4XZQ A;  3KFU G;  3W96 B;  2Y2Q A;  1P3M B;  5GT3 B;  3B6G A;  2YFW A;  3LEL B;  5CPK C;  3W99 D;  4Z2M H;  1KX4 D;  5B1M C;  2W8S A;  3W96 A;  1KX5 D;  1P3M A;  5GT3 A;  3LEL A;  4JJN B;  3MGP D;  1P3G B;  3AZN B;  3LZ0 C;  4WNN B;  3O62 C;  1R4V A;  1WWS A;  4KGC D;  2ZY2 A;  4WZS B;  3KSY A;  3AZK B;  4YM6 C;  4Z5T D;  4JJN A;  1P3G A;  3AZN A;  4WNN A;  3REI B;  4XZQ C;  4H9Q B;  2XD5 A;  1TZY C;  3B6G C;  4WU8 D;  4X23 D;  3AZK A;  3KUY B;  1P3L D;  2NQB D;  4J8V D;  3X1S B;  3WTP B;  3REI A;  1ULY A;  4H9Q A;  4J8W B;  3AFA D;  5GT3 C;  1U35 C;  1ZLA D;  5CP6 D;  3MVD B;  3MGR C;  3KUY A;  3REJ B;  5AV9 D;  1KX3 C;  2IO5 B;  3X1S A;  5JRG D;  5AVC D;  3KWQ B;  3AN2 B;  3W97 C;  4J8W A;  3X1T D;  4ZUX D;  3X1V B;  3UTB B;  3MVD A;  2Y2M A;  5AV8 D;  1P3G C;  5B40 D;  3REJ A;  3AZN C;  1M19 D;  2F8N G;  3H0L C;  3AYW B;  2JE5 A;  3WAA C;  2VQR A;  3AZE D;  3KWQ A;  3AN2 A;  4Z66 D;  3AZH C;  4CSR B;  3AZK C;  3X1V A;  3NQU B;  4M6B A;  3UTB A;  3AZL B;  3AV2 B;  4R8P D;  3REH D;  2Y2H A;  3AYW A;  3REI C;  4WU9 B;  2BG1 A;  1JFI B;  4NE3 A;  3B6F C;  4CSR A;  3UT9 B;  3NQU A;  3AV2 A;  5CPJ B;  3KXB D;  1M18 D;  1Q9C A;  3AZF D;  4WU9 A;  1JFI A;  5GT0 D;  4XUJ C;  3UT9 A;  1HQ3 B;  3A6N D;  3UTA B;  3REK C;  5DNM D;  4YS3 B;  5CPI B;  5B33 B;  5CPJ A;  2JCH A;  5B24 D;  3C1B D;  1P3P C;  5GXQ B;  2RIQ A;  3WA9 D;  5KDM B;  1HQ3 A;  3UTA A;  5GSU C;  4YS3 A;  3AV1 D;  5B2J D;  2F8N H;  3A1K A;  5B33 A;  5GXQ A;  1P3K D;  1P34 B;  5CHL B;  1S32 D;  5KDM A;  3WKJ D;  5BS7 A;  1ID3 B;  1F66 D;  4WU9 C;  3W99 C;  3UT9 C;  1P34 A;  4H9P B;  1ID3 A;  2YFV B;  3AZM D;  3W96 D;  3EPL A;  1P3M D;  5AVB C;  4NE5 A;  5CPK B;  2FJ7 D;  3EPK A;  4Z2M G;  2PYO C;  1HQ3 C;  4UPK A;  4H9P A;  5B1M B;  5F99 D;  4DRA A;  2YFV A;  2CV5 D;  4AWL C;  4KUD B;  5CPK A;  5GXQ C;  5B32 C;  4LD9 C;  3LZ0 B;  3O62 B;  5B1M A;  4J8X C;  3C1C C;  2RVQ C;  1AOI C;  4J8U D;  4KUD A;  4YM6 B;  5B2I D;  3WTP E;  3LZ0 A;  2Y2P A;  5AY8 C;  3X1U D;  3O62 A;  2ZM5 A;  1B6W A;  2ZY4 A;  1TZY B;  3LZ1 D;  3REL B;  4YM6 A;  3KUY D;  3V9R B;  3WTP D;  1P3I D;  4H9S C;  3MGQ D;  4J8W D;  1TZY A;  1U35 B;  2Y2I A;  3REL A;  3MVD D;  3MGR B;  3AZI C;  3REJ D;  1KX3 B;  3V9R A;  3LJA C;  3AN2 D;  3W97 B;  3H0M C;  3W98 D;  1U35 A;  5BT1 D;  4KUD C;  3X1V D;  1H3O B;  3UTB D;  3TU4 D;  2Y2K A;  3MGR A;  1KX3 A;  3AYW D;  2Y2G A;  3WAA B;  1P3F D;  3W97 A;  5B0Z D;  3AZH B;  5B31 D;  1H3O A;  3AZL D;  2HIO D;  2NZD D;  3WAA A;  3KXB C;  4KHA B;  2LY8 A;  5AV6 C;  3B6F B;  3AZH A;  3REL C;  1M1A B;  3AZJ C;  5DNM C;  3C1B C;  1EQZ C;  4KHA A;  4XUJ B;  2HUE C;  3B0B A;  1P3B B;  3UTA D;  3B6F A;  3P5J B;  1M1A A;  3REK B;  5CPI D;  5DNN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...