5AVBD

Human nucleosome core particle
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
97
structure length
97
Chain Sequence
RKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 97
sequence length 97
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5avbD00
5B31A 4X23D 4WU9B 3AFAA 4J8XA 5B40B 4J8WC 5KDMA 1P34C 3B6GB 3A6ND 5AV6C 4Z5TD 3REHD 5F99D 3KWQA 3KUYC 3W98A 4R8PB 5DNMA 5BNXB 5BNVB 5JRGA 3B0CT 5B0ZA 1TAFB 1P3LA 5B24C 3REJB 5AVBD 1A7WA 3W99C 2NZDB 3AYWC 1P3FD 2AROA 1HQ3A 2HIOC 4YS3C 3MGPA 4ZUXD 2FJ7D 1KX4C 1AOIC 4KGCB 4CSRA 4JJNB 5AV5B 5CP6D 4J8VB 2YFWA 5CPJD 4CAYB 4H9PB 5GXQD 1P3OA 3C1BC 4J8UA 5CPID 2CV5B 5AV9B 4AWLB 3LELA 3AV1B 4E44A 3AZFB 4KUDD 1P3MB 1EQZB 4H9RA 2NQBC 2YFVA 4H9QA 3AZEA 4H9SC 5E5AC 5B2IA 3VH5A 3UT9D 5BO0B 3X1VA 4QLCD 2F8NB 4XZQA 3AZGD 3WAAC 4WU9D 3AV2A 4Z66B 3WA9A 3X1UC 4WZSB 1U35D 1P3BA 3AZMA 3UTAD 5AV8C 4NFTA 3WTPA 5B32C 3LJAB 5GT0C 5BS7C 2RVQD 5B31C 1S32A 3AZHB 3LZ0B 4J8XC 5AVCA 3NQJB 3REJD 3X1TD 1P34A 1P3AC 4WU8B 4H9NA 3AZLD 1WWSA 1P3KC 3AN2A 4YM6B 2IO5C 4UUZB 1M18C 2BYKA 1JFIA 4X23B 5DNNA 1ZLAD 5JRGC 3TU4D 5B1MD 5B0ZC 1P3LC 5CPKC 3W97A 5BT1D 3W99A 3WKJD 5AY8D 1TZYB 4Z5TB 3REHB 5B1LA 2AROC 3AZJA 3AZFD 2F8NK 1EQZD 1AOIA 5GT3B 3MGPC 1F66A 4H9OB 4EO5C 5JA4B 1KX5D 5B0YB 1M19A 5AVBB 3R45B 2F8ND 4J8UC 1P3FB 3LZ1C 4G91C 4ZUXB 3V9RA 5B24D 5B33A 4XUJD 1HTAA 3AZEC 5B2IC 1BH8B 5CP6B 3RELD 5CPJB 3AYWD 5GXQB 5CPIB 3C1CC 3AZKA 2HIOD 4XZQC 3REIC 3VH5W 4YS3D 1KX4D 5GSUA 5B40C 4KUDB 3AV2C 1P3GA 3C1BD 3UT9B 5AV8A 4QLCB 1P3BC 4R8PC 3AZMC 5B32A 3AZGB 3NQUA 3WTPC 5GT0A 5BS7A 4LD9A 3KXBD 3MVDD 1KX3D 1N1JA 3UTBB 1S32C 3A6NA 1P3AA 2NZDC 3B0DC 5AVCC 5F99A 2BYMA 1TZYD 3REKD 1U35B 3X1SA 1P3KA 3UTAB 3MGSA 1M18A 3AN2C 1P3IA 4KGCC 1P3PD 4M6BA 5GT3D 4JJNC 5DNNC 3X1UD 4G92B 5AV5C 3MGQD 2PYOA 1M1AA 5CPKA 1BH9A 3X1TB 5B0YD 4E45A 2CV5C 3W97C 3AZLB 5G49A 2FJ7A 3AZIB 3AZND 5B1LC 3W96A 3AFAD 3AZJC 5B2JB 3MGRB 1ZLAB 1F66C 4J8XD 3O62A 3TU4B 3B6FB 5B1MB 1ID3A 1M19C 3WKJB 5AY8B 4WNNB 3KWQD 3LZ1A 3MNNA 3W98D 5DNMD 5FUGA 5JRGD 5C3IB 4J8WB 1P3LD 5B33C 1KX5B 5AV6B 2L5AA 3C1CA 4WU9A 2AROD 1HQ3D 3REIA 3KUYB 3B0CW 3AZKC 3MGPD 5B40A 3UTBD 5GSUC 4WU8C 5B24B 1P3GC 4XUJB 3B6GA 3RELB 1P3OD 3AYWB 4R8PA 2F8NG 2HIOB 5BNXA 3LELD 5BNVA 4YS3B 1WWIA 1TAFA 1KX4B 4LD9C 3REJA 3AZED 2NZDA 3A6NC 4KHAB 3C1BB 4Z5TC 3X1VD 5F99C 4XZQD 1B67A 3X1SC 3MGSC 3AZID 4KGCA 1P3IC 2NQBB 3KXBB 4DRAA 3MVDB 4JJNA 1KX3B 4NE3A 5AV5A 5B2JD 3MGRD 3WA9D 4J8VA 4CAYA 5E5AB 4H9PA 5AVBC 2CV5A 3B6FD 2PYOC 1M1AC 5AV9A 3REKB 3AV1A 3AZFA 1P3MA 1EQZA 3WAAB 2F8NH 2FJ7C 1H3OB 3VH6T 3W96C 1P3PB 1S32D 3X1UB 3MGQB 5CP6C 4J8WD 5AVCD 3O62C 4ZBJC 1P34D 2F8NA 5CPIC 2HUEC 5AV6D 1ID3C 3AN2D 2LY8A 3KUYD 4Z66A 2CWEA 3AZNB 5B31B 3MNNC 3AFAB 4J8XB 5KDMB 3W97D 3W99D 3LJAA 4WU9C 3KWQB 3AZHA 3LZ0A 3AZJD 5DNMB 3W98B 1AOID 1F66D 2JSSA 3NQJA 4WU8A 5JRGB 5B0ZB 1P3LB 3B6GC 4YM6A 3UTAC 4UUZA 1F1EA 3VH6W 4X23A 1HQ3B 2AROB 3MGPB 2NQBD 3B0BA 4Z2MG 3REJC 3X1TC 5B33D 1ULYA 4CSRB 5E5AD 4EO5B 5CHLB 1TZYA 2YFWB 4Z5TA 3REHA 1P3OB 4J8UB 4DRBA 3AZKD 3WAAD 5GT3A 3LELB 4H9OA 1ZLAC 4G91B 5GSUD 4H9RB 5JA4A 2YFVB 5B0YA 1P3GD 4H9QB 5AVBA 4J8VC 3R45A 3AZEB 5B2IB 3WKJC 1P3FA 3X1VB 5AV9C 4AWLC 5AV8D 4XZQB 5B32D 3REIB 3AV1C 4ZUXA 3AZFC 1P3MC 5GT0D 1EQZC 5B31D 4LD9D 4NE6A 5C3IC 3AV2B 3WA9B 4HGAB 1BH8A 4Z2MH 5CP6A 5CPJA 1KX5C 5GXQA 1P3AD 5CPIA 1P3KD 3X1SD 3AZMB 1P3BB 3MGSD 3WTPB 1M18D 4KUDA 1P3ID 4Z66C 4XUJC 1S32B 1Q9CA 5B0ZD 3UT9A 3RELC 1M1AD 2PYOD 3B0DB 5AVCB 5CPKD 4QLCA 1P34B 3AZGA 4H9NB 3LJAC 3AN2B 3UTBA 3W96D 2BYKB 3AZHC 3LZ0C 1JFIB 5DNNB 3KSYA 3O62D 3VH6A 1U35A 3UTAA 1ID3D 3W97B 3W99B 4YM6C 4J8UD 4X23C 5B1LB 3MNND 3KXBC 3LZ1D 3MVDC 1KX3C 3AZJB 1AOIB 1F66B 3X1TA 3AZLA 5B2ID 1TZYC 3REKC 1M19B 3AZIA 3C1CD 3REHC 3REID 1P3PC 5B2JA 3MGRA 5GT3C 1ZLAA 5B40D 3MGQC 3TU4A 3B6FA 5B1MA 3AV2D 3V9RB 3B6GD 5B33B 5B0YC 3WKJA 5AY8A 4WNNA 1P3FC 1P3BD 4R8PD 3AZMD 3AZNC 3AZKB 3WTPD 3AFAC 4ZUXC 4J8WA 5GSUB 1KX5A 1P3GB 5AV6A 2NZDD 5BO0A 5CPJC 5GXQC 1R4VA 3KUYA 3KWQC 5AV8B 3W98C 5DNMC 5B32B 3NQUB 4KGCD 4KUDC 5GT0B 1B6WA 3VH5T 5B24A 4LD9B 4XUJA 4JJND 5DNND 1N1JB 5AV5D 4J8VD 3RELA 3A6NB 1KU5A 3AYWA 3UT9C 2CV5D 1P3AB 4QLCC 5AV9D 2HIOA 5F99B 3AZGC 1HQ3C 2BYMB 3AV1D 4YS3A 1P3KB 3X1SB 2IO5B 3MGSB 1P3MD 5B32G 1KX4A 1M18B 5B1LD 1P3IB 3UTBC 5B31G 4NE5A 4KHAA 3C1BA 2PYOB 1M1AB 4WV4B 1P3OC 5CPKB 1BH9B 1U35C 1M19D 3LELC 2NQBA 3KXBA 5G49B 3MVDA 1KX3A 4Z66D 2RVQC 2FJ7B 4G92C 3W96B 4H9SA 5E5AA 3O62B 4ZBJB 3X1VC 3REKA 3WTPE 2HUEB 3AZLC 3WAAA 1ID3B 3LJAD 3AZIC 1H3OA 1P3PA 3LZ1B 3MNNB 3X1UA 3LZ0D 5B2JC 3MGRC 5FUGB 4HGAC 3MGQA 3AZHD 3WA9C 1BFMA 3TU4C 4WU8D 3B6FC 5B1MC 5BT1C 5AY8C 4YM6D 3C1CB 3AZNA
chains in the Genus database with same CATH superfamily
5B31A 4X23D 4WU9B 3AFAA 2DF4C 4J8XA 5B40B 4J8WC 2F2AC 5KDMA 1P34C 3B6GB 3A6ND 5AV6C 3A1IA 4Z5TD 3REHD 5F99D 3KWQA 3KUYC 3W98A 4R8PB 5DNMA 5BNXB 5BNVB 5JRGA 3B0CT 5B0ZA 1TAFB 1P3LA 5B24C 3REJB 5AVBD 1A7WA 3W99C 2NZDB 2Y2OA 3F6TA 3AYWC 1P3FD 2AROA 1HQ3A 2HIOC 2Y2JA 4YS3C 3MGPA 4ZUXD 2FJ7D 1KX4C 1AOIC 4KGCB 4CSRA 4JJNB 5AV5B 5CP6D 4J8VB 2YFWA 5CPJD 4CAYB 4H9PB 5GXQD 1P3OA 3C1BC 4J8UA 5CPID 2CV5B 2XD5A 2Y2NA 5AV9B 4AWLB 3LELA 3AV1B 4E44A 3AZFB 4KUDD 1P3MB 1EQZB 4H9RA 2NQBC 2YFVA 4H9QA 3AZEA 4H9SC 5E5AC 5B2IA 3VH5A 3UT9D 5BO0B 3X1VA 4QLCD 2F8NB 4XZQA 3AZGD 3WAAC 4WU9D 3AV2A 4Z66B 3WA9A 3X1UC 4WZSB 3KFUG 1U35D 2Y2QA 1P3BA 3AZMA 3UTAD 5AV8C 4NFTA 3WTPA 2JCHA 5B32C 3LJAB 5GT0C 5BS7C 2RVQD 5B31C 1S32A 3AZHB 3LZ0B 4J8XC 5AVCA 3NQJB 3REJD 3X1TD 1P34A 1P3AC 4WU8B 4H9NA 3AZLD 1WWSA 1P3KC 3AN2A 4YM6B 2IO5C 4UUZB 1M18C 2BYKA 1JFIA 4X23B 5DNNA 1W2EA 1ZLAD 5JRGC 3TU4D 5B1MD 5B0ZC 1P3LC 5CPKC 3W97A 5BT1D 3W99A 3WKJD 5AY8D 1TZYB 4Z5TB 3REHB 5B1LA 2AROC 3AZJA 3AZFD 2F8NK 3AL0C 1EQZD 1AOIA 5GT3B 3MGPC 1F66A 4H9OB 4EO5C 5JA4B 1KX5D 5B0YB 1M19A 5AVBB 3R45B 2F8ND 4J8UC 1P3FB 3LZ1C 4G91C 4ZUXB 3V9RA 3H0MC 5B33A 4XUJD 5B24D 1HTAA 3AZEC 5B2IC 1BH8B 5CP6B 3RELD 5CPJB 3AYWD 5GXQB 2G5IC 5CPIB 3C1CC 3AZKA 2HIOD 4XZQC 3REIC 3VH5W 4YS3D 3FDDA 2Y2KA 1KX4D 5GSUA 5B40C 4KUDB 3AV2C 1P3GA 3C1BD 3UT9B 5AV8A 4QLCB 1P3BC 4R8PC 2Y2MA 5B32A 3AZMC 3AZGB 3NQUA 3WTPC 5GT0A 5BS7A 2Y2GA 4LD9A 3KXBD 3MVDD 1KX3D 1N1JA 3UTBB 1S32C 3A6NA 1P3AA 2NZDC 3B0DC 5AVCC 5F99A 2BYMA 1TZYD 2ZY3A 3REKD 3X1SA 1U35B 3UTAB 1P3KA 3MGSA 1M18A 3AN2C 1P3IA 4KGCC 1P3PD 4M6BA 5GT3D 4JJNC 5DNNC 3X1UD 4G92B 5AV5C 3MGQD 2PYOA 1M1AA 5CPKA 1BH9A 3X1TB 5B0YD 4E45A 2CV5C 3W97C 2JE5A 3AZLB 5G49A 2FJ7A 3AZIB 3AZND 5B1LC 3W96A 3AFAD 3AZJC 5B2JB 3MGRB 1ZLAB 1F66C 4J8XD 3O62A 3TU4B 3B6FB 5B1MB 1ID3A 1M19C 3WKJB 5AY8B 4WNNB 3KWQD 3LZ1A 3MNNA 3W98D 5DNMD 5FUGA 5JRGD 5C3IB 4J8WB 1P3LD 5B33C 1KX5B 5AV6B 2L5AA 3C1CA 4WU9A 2AROD 1HQ3D 3REIA 3KUYB 3B0CW 3AZKC 3MGPD 5B40A 3UTBD 5GSUC 4WU8C 5B24B 1P3GC 4XUJB 3B6GA 3H0RC 3RELB 1P3OD 3AYWB 4R8PA 2F8NG 2HIOB 5BNXA 3LELD 5BNVA 4YS3B 1WWIA 1TAFA 2BG1A 1KX4B 4LD9C 3REJA 3AZED 2NZDA 3A6NC 4KHAB 3C1BB 4Z5TC 3X1VD 5F99C 4XZQD 1B67A 3X1SC 3MGSC 3AZID 4KGCA 1P3IC 2NQBB 3KXBB 4DRAA 3MVDB 3H0LC 4JJNA 4NE3A 5AV5A 5B2JD 3MGRD 1KX3B 3WA9D 2ZM5A 4J8VA 4CAYA 5E5AB 4H9PA 5AVBC 2CV5A 3B6FD 2PYOC 1M1AC 5AV9A 3REKB 3AV1A 3AZFA 1P3MA 1EQZA 3WAAB 2F8NH 2FJ7C 1H3OB 3VH6T 3W96C 1P3PB 1S32D 3X1UB 3MGQB 5CP6C 4J8WD 5AVCD 3O62C 4ZBJC 4WJ3C 1P34D 2F8NA 5CPIC 2HUEC 5AV6D 1ID3C 3AN2D 2LY8A 3KUYD 4Z66A 2Y2HA 2CWEA 3AZNB 5B31B 3MNNC 3AFAB 3P5JB 4J8XB 5KDMB 3W97D 3W99D 3LJAA 4WU9C 3KWQB 3AZHA 3LZ0A 3AZJD 5DNMB 3W98B 1AOID 2FFFB 1F66D 2JSSA 3NQJA 3EPHA 4WU8A 5JRGB 5B0ZB 1P3LB 3B6GC 4YM6A 3UTAC 4UUZA 2Y2PA 1F1EA 3VH6W 1T3UA 4X23A 1HQ3B 2AROB 2ZY5A 3MGPB 2NQBD 3B0BA 4Z2MG 3A1KA 3REJC 3X1TC 5B33D 1ULYA 4CSRB 5E5AD 4EO5B 5CHLB 1TZYA 2YFWB 4Z5TA 3REHA 1P3OB 4J8UB 4DRBA 3AZKD 3WAAD 5GT3A 3LELB 4H9OA 1ZLAC 4G91B 5GSUD 4H9RB 2G5HC 5JA4A 2YFVB 5B0YA 1P3GD 4H9QB 5AVBA 4J8VC 3R45A 3AZEB 5B2IB 3WKJC 1P3FA 3X1VB 5AV9C 4AWLC 5AV8D 4XZQB 5B32D 3REIB 3AV1C 4ZUXA 3AZFC 1P3MC 5GT0D 1EQZC 5B31D 4LD9D 4NE6A 5C3IC 3AV2B 3WA9B 4HGAB 1BH8A 4Z2MH 5CP6A 5CPJA 1KX5C 5GXQA 1P3AD 5CPIA 1P3KD 3X1SD 3AZMB 1P3BB 3MGSD 2UWXA 3WTPB 1M18D 4KUDA 1P3ID 4Z66C 2W8SA 4XUJC 3EG5B 1S32B 1Q9CA 2XD1A 5B0ZD 3UT9A 3RELC 1M1AD 2PYOD 3B0DB 5AVCB 5CPKD 4QLCA 1P34B 3AZGA 4H9NB 3LJAC 3AN2B 3UTBA 3W96D 2BYKB 3AZHC 3LZ0C 1JFIB 5DNNB 3KSYA 3O62D 3VH6A 1U35A 3UTAA 1ID3D 3W97B 3W99B 4YM6C 4J8UD 4X23C 5B1LB 3MNND 3KXBC 3LZ1D 3MVDC 3EPJA 1KX3C 3AZJB 1AOIB 3EPLA 1F66B 3X1TA 3AZLA 5B2ID 1TZYC 3REKC 1M19B 3AZIA 3C1CD 3REHC 4UPKA 3REID 2VQRA 1P3PC 5B2JA 3MGRA 5GT3C 1ZLAA 5B40D 3MGQC 3TU4A 3B6FA 5B1MA 3AV2D 3V9RB 3B6GD 5B33B 5B0YC 3WKJA 5AY8A 4WNNA 1P3FC 1P3BD 4R8PD 3AZMD 3AZNC 3AZKB 3WTPD 2RIQA 3AFAC 4ZUXC 4J8WA 5GSUB 1KX5A 2ZY4A 2DQNC 1P3GB 2Y2LA 3EPKA 5AV6A 2NZDD 5BO0A 4DQYB 5CPJC 5GXQC 1R4VA 3KUYA 3KWQC 5AV8B 3W98C 5DNMC 5B32B 3NQUB 4KGCD 4KUDC 5GT0B 1B6WA 3VH5T 5B24A 4LD9B 4XUJA 4JJND 5DNND 1N1JB 5AV5D 4J8VD 3RELA 3IP4C 3A6NB 1KU5A 3AYWA 3UT9C 2CV5D 1P3AB 4QLCC 5AV9D 2HIOA 5F99B 3AZGC 1HQ3C 2BYMB 3AV1D 1Z2CB 4YS3A 3X1SB 1P3KB 2IO5B 3MGSB 1P3MD 5B32G 1KX4A 1M18B 5B1LD 1P3IB 3UTBC 5B31G 1PZRA 4NE5A 4KHAA 3C1BA 2PYOB 1M1AB 4WV4B 1P3OC 5CPKB 1BH9B 1U35C 1M19D 3LELC 2NQBA 3KXBA 5G49B 3MVDA 1KX3A 4Z66D 2RVQC 2FJ7B 4G92C 3W96B 4H9SA 5E5AA 3O62B 4ZBJB 3X1VC 3REKA 3WTPE 2HUEB 3AZLC 3WAAA 1ID3B 3LJAD 3AZIC 1H3OA 1P3PA 2Y2IA 3MNNB 3LZ1B 3X1UA 3LZ0D 5B2JC 3MGRC 5FUGB 4HGAC 3MGQA 3AZHD 3WA9C 1BFMA 3TU4C 4WU8D 3B6FC 5B1MC 2J8PA 2ZY2A 5BT1C 5AY8C 4YM6D 3C1CB 3AZNA
chains in the Genus database with same CATH topology
5B31A 4X23D 4WU9B 3AFAA 2DF4C 4J8XA 5B40B 4J8WC 2F2AC 5KDMA 1P34C 3B6GB 3A6ND 5AV6C 3A1IA 4Z5TD 3REHD 5F99D 3KWQA 3KUYC 3W98A 4R8PB 5DNMA 5BNXB 5BNVB 5JRGA 3B0CT 5B0ZA 1TAFB 1P3LA 5B24C 3REJB 5AVBD 1A7WA 3W99C 2NZDB 2Y2OA 3F6TA 3AYWC 1P3FD 2AROA 1HQ3A 2HIOC 2Y2JA 4YS3C 3MGPA 4ZUXD 2FJ7D 1KX4C 1AOIC 4KGCB 4CSRA 4JJNB 5AV5B 5CP6D 4J8VB 2YFWA 5CPJD 4CAYB 4H9PB 5GXQD 1P3OA 3C1BC 4J8UA 5CPID 2CV5B 2XD5A 2Y2NA 5AV9B 4AWLB 3LELA 3AV1B 4E44A 3AZFB 4KUDD 1P3MB 1EQZB 4H9RA 2NQBC 2YFVA 4H9QA 3AZEA 4H9SC 5E5AC 5B2IA 3VH5A 3UT9D 5BO0B 3X1VA 4QLCD 2F8NB 4XZQA 3AZGD 3WAAC 4WU9D 3AV2A 4Z66B 3WA9A 3X1UC 4WZSB 3KFUG 1U35D 2Y2QA 1P3BA 3AZMA 3UTAD 5AV8C 4NFTA 3WTPA 2JCHA 5B32C 3LJAB 5GT0C 5BS7C 2RVQD 5B31C 1S32A 3AZHB 3LZ0B 4J8XC 5AVCA 3NQJB 3REJD 3X1TD 1P34A 1P3AC 4WU8B 4H9NA 3AZLD 1WWSA 1P3KC 3AN2A 4YM6B 2IO5C 4UUZB 1M18C 2BYKA 1JFIA 4X23B 5DNNA 1W2EA 1ZLAD 5JRGC 3TU4D 5B1MD 5B0ZC 1P3LC 5CPKC 3W97A 5BT1D 3W99A 3WKJD 5AY8D 1TZYB 4Z5TB 3REHB 5B1LA 2AROC 3AZJA 3AZFD 2F8NK 3AL0C 1EQZD 1AOIA 5GT3B 3MGPC 1F66A 4H9OB 4EO5C 5JA4B 1KX5D 5B0YB 1M19A 5AVBB 3R45B 2F8ND 4J8UC 1P3FB 3LZ1C 4G91C 4ZUXB 3V9RA 3H0MC 5B33A 4XUJD 5B24D 1HTAA 3AZEC 5B2IC 1BH8B 5CP6B 3RELD 5CPJB 3AYWD 5GXQB 2G5IC 5CPIB 3C1CC 3AZKA 2HIOD 4XZQC 3REIC 3VH5W 4YS3D 3FDDA 2Y2KA 1KX4D 5GSUA 5B40C 4KUDB 3AV2C 1P3GA 3C1BD 3UT9B 5AV8A 4QLCB 1P3BC 4R8PC 2Y2MA 5B32A 3AZMC 3AZGB 3NQUA 3WTPC 5GT0A 5BS7A 2Y2GA 4LD9A 3KXBD 3MVDD 1KX3D 1N1JA 3UTBB 1S32C 3A6NA 1P3AA 2NZDC 3B0DC 5AVCC 5F99A 2BYMA 1TZYD 2ZY3A 3REKD 3X1SA 1U35B 3UTAB 1P3KA 3MGSA 1M18A 3AN2C 1P3IA 4KGCC 1P3PD 4M6BA 5GT3D 4JJNC 5DNNC 3X1UD 4G92B 5AV5C 3MGQD 2PYOA 1M1AA 5CPKA 1BH9A 3X1TB 5B0YD 4E45A 2CV5C 3W97C 2JE5A 3AZLB 5G49A 2FJ7A 3AZIB 3AZND 5B1LC 3W96A 3AFAD 3AZJC 5B2JB 3MGRB 1ZLAB 1F66C 4J8XD 3O62A 3TU4B 3B6FB 5B1MB 1ID3A 1M19C 3WKJB 5AY8B 4WNNB 3KWQD 3LZ1A 3MNNA 3W98D 5DNMD 5FUGA 5JRGD 5C3IB 4J8WB 1P3LD 5B33C 1KX5B 5AV6B 2L5AA 3C1CA 4WU9A 2AROD 1HQ3D 3REIA 3KUYB 3B0CW 3AZKC 3MGPD 5B40A 3UTBD 5GSUC 4WU8C 5B24B 1P3GC 4XUJB 3B6GA 3H0RC 3RELB 1P3OD 3AYWB 4R8PA 2F8NG 2HIOB 5BNXA 3LELD 5BNVA 4YS3B 1WWIA 1TAFA 2BG1A 1KX4B 4LD9C 3REJA 3AZED 2NZDA 3A6NC 4KHAB 3C1BB 4Z5TC 3X1VD 5F99C 4XZQD 1B67A 3X1SC 3MGSC 3AZID 4KGCA 1P3IC 2NQBB 3KXBB 4DRAA 3MVDB 3H0LC 4JJNA 4NE3A 5AV5A 5B2JD 3MGRD 1KX3B 3WA9D 2ZM5A 4J8VA 4CAYA 5E5AB 4H9PA 5AVBC 2CV5A 3B6FD 2PYOC 1M1AC 5AV9A 3REKB 3AV1A 3AZFA 1P3MA 1EQZA 3WAAB 2F8NH 2FJ7C 1H3OB 3VH6T 3W96C 1P3PB 1S32D 3X1UB 3MGQB 5CP6C 4J8WD 5AVCD 3O62C 4ZBJC 4WJ3C 1P34D 2F8NA 5CPIC 2HUEC 5AV6D 1ID3C 3AN2D 2LY8A 3KUYD 4Z66A 2Y2HA 2CWEA 3AZNB 5B31B 3MNNC 3AFAB 3P5JB 4J8XB 5KDMB 3W97D 3W99D 3LJAA 4WU9C 3KWQB 3AZHA 3LZ0A 3AZJD 5DNMB 3W98B 1AOID 2FFFB 1F66D 2JSSA 3NQJA 3EPHA 4WU8A 5JRGB 5B0ZB 1P3LB 3B6GC 4YM6A 3UTAC 4UUZA 2Y2PA 1F1EA 3VH6W 1T3UA 4X23A 1HQ3B 2AROB 2ZY5A 3MGPB 2NQBD 3B0BA 4Z2MG 3A1KA 3REJC 3X1TC 5B33D 1ULYA 4CSRB 5E5AD 4EO5B 5CHLB 1TZYA 2YFWB 4Z5TA 3REHA 1P3OB 4J8UB 4DRBA 3AZKD 3WAAD 5GT3A 3LELB 4H9OA 1ZLAC 4G91B 5GSUD 4H9RB 2G5HC 5JA4A 2YFVB 5B0YA 1P3GD 4H9QB 5AVBA 4J8VC 3R45A 3AZEB 5B2IB 3WKJC 1P3FA 3X1VB 5AV9C 4AWLC 5AV8D 4XZQB 5B32D 3REIB 3AV1C 4ZUXA 3AZFC 1P3MC 5GT0D 1EQZC 5B31D 4LD9D 4NE6A 5C3IC 3AV2B 3WA9B 4HGAB 1BH8A 4Z2MH 5CP6A 5CPJA 1KX5C 5GXQA 1P3AD 5CPIA 1P3KD 3X1SD 3AZMB 1P3BB 3MGSD 2UWXA 3WTPB 1M18D 4KUDA 1P3ID 4Z66C 2W8SA 4XUJC 3EG5B 1S32B 1Q9CA 2XD1A 5B0ZD 3UT9A 3RELC 1M1AD 2PYOD 3B0DB 5AVCB 5CPKD 4QLCA 1P34B 3AZGA 4H9NB 3LJAC 3AN2B 3UTBA 3W96D 2BYKB 3AZHC 3LZ0C 1JFIB 5DNNB 3KSYA 3O62D 3VH6A 1U35A 3UTAA 1ID3D 3W97B 3W99B 4YM6C 4J8UD 4X23C 5B1LB 3MNND 3KXBC 3LZ1D 3MVDC 3EPJA 1KX3C 3AZJB 1AOIB 3EPLA 1F66B 3X1TA 3AZLA 5B2ID 1TZYC 3REKC 1M19B 3AZIA 3C1CD 3REHC 4UPKA 3REID 2VQRA 1P3PC 5B2JA 3MGRA 5GT3C 1ZLAA 5B40D 3MGQC 3TU4A 3B6FA 5B1MA 3AV2D 3V9RB 3B6GD 5B33B 5B0YC 3WKJA 5AY8A 4WNNA 1P3FC 1P3BD 4R8PD 3AZMD 3AZNC 3AZKB 3WTPD 2RIQA 3AFAC 4ZUXC 4J8WA 5GSUB 1KX5A 2ZY4A 2DQNC 1P3GB 2Y2LA 3EPKA 5AV6A 2NZDD 5BO0A 4DQYB 5CPJC 5GXQC 1R4VA 3KUYA 3KWQC 5AV8B 3W98C 5DNMC 5B32B 3NQUB 4KGCD 4KUDC 5GT0B 1B6WA 3VH5T 5B24A 4LD9B 4XUJA 4JJND 5DNND 1N1JB 5AV5D 4J8VD 3RELA 3IP4C 3A6NB 1KU5A 3AYWA 3UT9C 2CV5D 1P3AB 4QLCC 5AV9D 2HIOA 5F99B 3AZGC 1HQ3C 2BYMB 3AV1D 1Z2CB 4YS3A 3X1SB 1P3KB 2IO5B 3MGSB 1P3MD 5B32G 1KX4A 1M18B 5B1LD 1P3IB 3UTBC 5B31G 1PZRA 4NE5A 4KHAA 3C1BA 2PYOB 1M1AB 4WV4B 1P3OC 5CPKB 1BH9B 1U35C 1M19D 3LELC 2NQBA 3KXBA 5G49B 3MVDA 1KX3A 4Z66D 2RVQC 2FJ7B 4G92C 3W96B 4H9SA 5E5AA 3O62B 4ZBJB 3X1VC 3REKA 3WTPE 2HUEB 3AZLC 3WAAA 1ID3B 3LJAD 3AZIC 1H3OA 1P3PA 2Y2IA 3MNNB 3LZ1B 3X1UA 3LZ0D 5B2JC 3MGRC 5FUGB 4HGAC 3MGQA 3AZHD 3WA9C 1BFMA 3TU4C 4WU8D 3B6FC 5B1MC 2J8PA 2ZY2A 5BT1C 5AY8C 4YM6D 3C1CB 3AZNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B31 A;  4X23 D;  4WU9 B;  3AFA A;  4J8X A;  5B40 B;  4J8W C;  5KDM A;  1P34 C;  3B6G B;  3A6N D;  5AV6 C;  4Z5T D;  3REH D;  5F99 D;  3KWQ A;  3KUY C;  3W98 A;  4R8P B;  5DNM A;  5BNX B;  5BNV B;  5JRG A;  3B0C T;  5B0Z A;  1TAF B;  1P3L A;  5B24 C;  3REJ B;  5AVB D;  1A7W A;  3W99 C;  2NZD B;  3AYW C;  1P3F D;  2ARO A;  1HQ3 A;  2HIO C;  4YS3 C;  3MGP A;  4ZUX D;  2FJ7 D;  1KX4 C;  1AOI C;  4KGC B;  4CSR A;  4JJN B;  5AV5 B;  5CP6 D;  4J8V B;  2YFW A;  5CPJ D;  4CAY B;  4H9P B;  5GXQ D;  1P3O A;  3C1B C;  4J8U A;  5CPI D;  2CV5 B;  5AV9 B;  4AWL B;  3LEL A;  3AV1 B;  4E44 A;  3AZF B;  4KUD D;  1P3M B;  1EQZ B;  4H9R A;  2NQB C;  2YFV A;  4H9Q A;  3AZE A;  4H9S C;  5E5A C;  5B2I A;  3VH5 A;  3UT9 D;  5BO0 B;  3X1V A;  4QLC D;  2F8N B;  4XZQ A;  3AZG D;  3WAA C;  4WU9 D;  3AV2 A;  4Z66 B;  3WA9 A;  3X1U C;  4WZS B;  1U35 D;  1P3B A;  3AZM A;  3UTA D;  5AV8 C;  4NFT A;  3WTP A;  5B32 C;  3LJA B;  5GT0 C;  5BS7 C;  2RVQ D;  5B31 C;  1S32 A;  3AZH B;  3LZ0 B;  4J8X C;  5AVC A;  3NQJ B;  3REJ D;  3X1T D;  1P34 A;  1P3A C;  4WU8 B;  4H9N A;  3AZL D;  1WWS A;  1P3K C;  3AN2 A;  4YM6 B;  2IO5 C;  4UUZ B;  1M18 C;  2BYK A;  1JFI A;  4X23 B;  5DNN A;  1ZLA D;  5JRG C;  3TU4 D;  5B1M D;  5B0Z C;  1P3L C;  5CPK C;  3W97 A;  5BT1 D;  3W99 A;  3WKJ D;  5AY8 D;  1TZY B;  4Z5T B;  3REH B;  5B1L A;  2ARO C;  3AZJ A;  3AZF D;  2F8N K;  1EQZ D;  1AOI A;  5GT3 B;  3MGP C;  1F66 A;  4H9O B;  4EO5 C;  5JA4 B;  1KX5 D;  5B0Y B;  1M19 A;  5AVB B;  3R45 B;  2F8N D;  4J8U C;  1P3F B;  3LZ1 C;  4G91 C;  4ZUX B;  3V9R A;  5B24 D;  5B33 A;  4XUJ D;  1HTA A;  3AZE C;  5B2I C;  1BH8 B;  5CP6 B;  3REL D;  5CPJ B;  3AYW D;  5GXQ B;  5CPI B;  3C1C C;  3AZK A;  2HIO D;  4XZQ C;  3REI C;  3VH5 W;  4YS3 D;  1KX4 D;  5GSU A;  5B40 C;  4KUD B;  3AV2 C;  1P3G A;  3C1B D;  3UT9 B;  5AV8 A;  4QLC B;  1P3B C;  4R8P C;  3AZM C;  5B32 A;  3AZG B;  3NQU A;  3WTP C;  5GT0 A;  5BS7 A;  4LD9 A;  3KXB D;  3MVD D;  1KX3 D;  1N1J A;  3UTB B;  1S32 C;  3A6N A;  1P3A A;  2NZD C;  3B0D C;  5AVC C;  5F99 A;  2BYM A;  1TZY D;  3REK D;  1U35 B;  3X1S A;  1P3K A;  3UTA B;  3MGS A;  1M18 A;  3AN2 C;  1P3I A;  4KGC C;  1P3P D;  4M6B A;  5GT3 D;  4JJN C;  5DNN C;  3X1U D;  4G92 B;  5AV5 C;  3MGQ D;  2PYO A;  1M1A A;  5CPK A;  1BH9 A;  3X1T B;  5B0Y D;  4E45 A;  2CV5 C;  3W97 C;  3AZL B;  5G49 A;  2FJ7 A;  3AZI B;  3AZN D;  5B1L C;  3W96 A;  3AFA D;  3AZJ C;  5B2J B;  3MGR B;  1ZLA B;  1F66 C;  4J8X D;  3O62 A;  3TU4 B;  3B6F B;  5B1M B;  1ID3 A;  1M19 C;  3WKJ B;  5AY8 B;  4WNN B;  3KWQ D;  3LZ1 A;  3MNN A;  3W98 D;  5DNM D;  5FUG A;  5JRG D;  5C3I B;  4J8W B;  1P3L D;  5B33 C;  1KX5 B;  5AV6 B;  2L5A A;  3C1C A;  4WU9 A;  2ARO D;  1HQ3 D;  3REI A;  3KUY B;  3B0C W;  3AZK C;  3MGP D;  5B40 A;  3UTB D;  5GSU C;  4WU8 C;  5B24 B;  1P3G C;  4XUJ B;  3B6G A;  3REL B;  1P3O D;  3AYW B;  4R8P A;  2F8N G;  2HIO B;  5BNX A;  3LEL D;  5BNV A;  4YS3 B;  1WWI A;  1TAF A;  1KX4 B;  4LD9 C;  3REJ A;  3AZE D;  2NZD A;  3A6N C;  4KHA B;  3C1B B;  4Z5T C;  3X1V D;  5F99 C;  4XZQ D;  1B67 A;  3X1S C;  3MGS C;  3AZI D;  4KGC A;  1P3I C;  2NQB B;  3KXB B;  4DRA A;  3MVD B;  4JJN A;  1KX3 B;  4NE3 A;  5AV5 A;  5B2J D;  3MGR D;  3WA9 D;  4J8V A;  4CAY A;  5E5A B;  4H9P A;  5AVB C;  2CV5 A;  3B6F D;  2PYO C;  1M1A C;  5AV9 A;  3REK B;  3AV1 A;  3AZF A;  1P3M A;  1EQZ A;  3WAA B;  2F8N H;  2FJ7 C;  1H3O B;  3VH6 T;  3W96 C;  1P3P B;  1S32 D;  3X1U B;  3MGQ B;  5CP6 C;  4J8W D;  5AVC D;  3O62 C;  4ZBJ C;  1P34 D;  2F8N A;  5CPI C;  2HUE C;  5AV6 D;  1ID3 C;  3AN2 D;  2LY8 A;  3KUY D;  4Z66 A;  2CWE A;  3AZN B;  5B31 B;  3MNN C;  3AFA B;  4J8X B;  5KDM B;  3W97 D;  3W99 D;  3LJA A;  4WU9 C;  3KWQ B;  3AZH A;  3LZ0 A;  3AZJ D;  5DNM B;  3W98 B;  1AOI D;  1F66 D;  2JSS A;  3NQJ A;  4WU8 A;  5JRG B;  5B0Z B;  1P3L B;  3B6G C;  4YM6 A;  3UTA C;  4UUZ A;  1F1E A;  3VH6 W;  4X23 A;  1HQ3 B;  2ARO B;  3MGP B;  2NQB D;  3B0B A;  4Z2M G;  3REJ C;  3X1T C;  5B33 D;  1ULY A;  4CSR B;  5E5A D;  4EO5 B;  5CHL B;  1TZY A;  2YFW B;  4Z5T A;  3REH A;  1P3O B;  4J8U B;  4DRB A;  3AZK D;  3WAA D;  5GT3 A;  3LEL B;  4H9O A;  1ZLA C;  4G91 B;  5GSU D;  4H9R B;  5JA4 A;  2YFV B;  5B0Y A;  1P3G D;  4H9Q B;  5AVB A;  4J8V C;  3R45 A;  3AZE B;  5B2I B;  3WKJ C;  1P3F A;  3X1V B;  5AV9 C;  4AWL C;  5AV8 D;  4XZQ B;  5B32 D;  3REI B;  3AV1 C;  4ZUX A;  3AZF C;  1P3M C;  5GT0 D;  1EQZ C;  5B31 D;  4LD9 D;  4NE6 A;  5C3I C;  3AV2 B;  3WA9 B;  4HGA B;  1BH8 A;  4Z2M H;  5CP6 A;  5CPJ A;  1KX5 C;  5GXQ A;  1P3A D;  5CPI A;  1P3K D;  3X1S D;  3AZM B;  1P3B B;  3MGS D;  3WTP B;  1M18 D;  4KUD A;  1P3I D;  4Z66 C;  4XUJ C;  1S32 B;  1Q9C A;  5B0Z D;  3UT9 A;  3REL C;  1M1A D;  2PYO D;  3B0D B;  5AVC B;  5CPK D;  4QLC A;  1P34 B;  3AZG A;  4H9N B;  3LJA C;  3AN2 B;  3UTB A;  3W96 D;  2BYK B;  3AZH C;  3LZ0 C;  1JFI B;  5DNN B;  3KSY A;  3O62 D;  3VH6 A;  1U35 A;  3UTA A;  1ID3 D;  3W97 B;  3W99 B;  4YM6 C;  4J8U D;  4X23 C;  5B1L B;  3MNN D;  3KXB C;  3LZ1 D;  3MVD C;  1KX3 C;  3AZJ B;  1AOI B;  1F66 B;  3X1T A;  3AZL A;  5B2I D;  1TZY C;  3REK C;  1M19 B;  3AZI A;  3C1C D;  3REH C;  3REI D;  1P3P C;  5B2J A;  3MGR A;  5GT3 C;  1ZLA A;  5B40 D;  3MGQ C;  3TU4 A;  3B6F A;  5B1M A;  3AV2 D;  3V9R B;  3B6G D;  5B33 B;  5B0Y C;  3WKJ A;  5AY8 A;  4WNN A;  1P3F C;  1P3B D;  4R8P D;  3AZM D;  3AZN C;  3AZK B;  3WTP D;  3AFA C;  4ZUX C;  4J8W A;  5GSU B;  1KX5 A;  1P3G B;  5AV6 A;  2NZD D;  5BO0 A;  5CPJ C;  5GXQ C;  1R4V A;  3KUY A;  3KWQ C;  5AV8 B;  3W98 C;  5DNM C;  5B32 B;  3NQU B;  4KGC D;  4KUD C;  5GT0 B;  1B6W A;  3VH5 T;  5B24 A;  4LD9 B;  4XUJ A;  4JJN D;  5DNN D;  1N1J B;  5AV5 D;  4J8V D;  3REL A;  3A6N B;  1KU5 A;  3AYW A;  3UT9 C;  2CV5 D;  1P3A B;  4QLC C;  5AV9 D;  2HIO A;  5F99 B;  3AZG C;  1HQ3 C;  2BYM B;  3AV1 D;  4YS3 A;  1P3K B;  3X1S B;  2IO5 B;  3MGS B;  1P3M D;  5B32 G;  1KX4 A;  1M18 B;  5B1L D;  1P3I B;  3UTB C;  5B31 G;  4NE5 A;  4KHA A;  3C1B A;  2PYO B;  1M1A B;  4WV4 B;  1P3O C;  5CPK B;  1BH9 B;  1U35 C;  1M19 D;  3LEL C;  2NQB A;  3KXB A;  5G49 B;  3MVD A;  1KX3 A;  4Z66 D;  2RVQ C;  2FJ7 B;  4G92 C;  3W96 B;  4H9S A;  5E5A A;  3O62 B;  4ZBJ B;  3X1V C;  3REK A;  3WTP E;  2HUE B;  3AZL C;  3WAA A;  1ID3 B;  3LJA D;  3AZI C;  1H3O A;  1P3P A;  3LZ1 B;  3MNN B;  3X1U A;  3LZ0 D;  5B2J C;  3MGR C;  5FUG B;  4HGA C;  3MGQ A;  3AZH D;  3WA9 C;  1BFM A;  3TU4 C;  4WU8 D;  3B6F C;  5B1M C;  5BT1 C;  5AY8 C;  4YM6 D;  3C1C B;  3AZN A; 
#chains in the Genus database with same CATH topology
 5B31 A;  4X23 D;  4WU9 B;  3AFA A;  2DF4 C;  4J8X A;  5B40 B;  4J8W C;  2F2A C;  5KDM A;  1P34 C;  3B6G B;  3A6N D;  5AV6 C;  3A1I A;  4Z5T D;  3REH D;  5F99 D;  3KWQ A;  3KUY C;  3W98 A;  4R8P B;  5DNM A;  5BNX B;  5BNV B;  5JRG A;  3B0C T;  5B0Z A;  1TAF B;  1P3L A;  5B24 C;  3REJ B;  5AVB D;  1A7W A;  3W99 C;  2NZD B;  2Y2O A;  3F6T A;  3AYW C;  1P3F D;  2ARO A;  1HQ3 A;  2HIO C;  2Y2J A;  4YS3 C;  3MGP A;  4ZUX D;  2FJ7 D;  1KX4 C;  1AOI C;  4KGC B;  4CSR A;  4JJN B;  5AV5 B;  5CP6 D;  4J8V B;  2YFW A;  5CPJ D;  4CAY B;  4H9P B;  5GXQ D;  1P3O A;  3C1B C;  4J8U A;  5CPI D;  2CV5 B;  2XD5 A;  2Y2N A;  5AV9 B;  4AWL B;  3LEL A;  3AV1 B;  4E44 A;  3AZF B;  4KUD D;  1P3M B;  1EQZ B;  4H9R A;  2NQB C;  2YFV A;  4H9Q A;  3AZE A;  4H9S C;  5E5A C;  5B2I A;  3VH5 A;  3UT9 D;  5BO0 B;  3X1V A;  4QLC D;  2F8N B;  4XZQ A;  3AZG D;  3WAA C;  4WU9 D;  3AV2 A;  4Z66 B;  3WA9 A;  3X1U C;  4WZS B;  3KFU G;  1U35 D;  2Y2Q A;  1P3B A;  3AZM A;  3UTA D;  5AV8 C;  4NFT A;  3WTP A;  2JCH A;  5B32 C;  3LJA B;  5GT0 C;  5BS7 C;  2RVQ D;  5B31 C;  1S32 A;  3AZH B;  3LZ0 B;  4J8X C;  5AVC A;  3NQJ B;  3REJ D;  3X1T D;  1P34 A;  1P3A C;  4WU8 B;  4H9N A;  3AZL D;  1WWS A;  1P3K C;  3AN2 A;  4YM6 B;  2IO5 C;  4UUZ B;  1M18 C;  2BYK A;  1JFI A;  4X23 B;  5DNN A;  1W2E A;  1ZLA D;  5JRG C;  3TU4 D;  5B1M D;  5B0Z C;  1P3L C;  5CPK C;  3W97 A;  5BT1 D;  3W99 A;  3WKJ D;  5AY8 D;  1TZY B;  4Z5T B;  3REH B;  5B1L A;  2ARO C;  3AZJ A;  3AZF D;  2F8N K;  3AL0 C;  1EQZ D;  1AOI A;  5GT3 B;  3MGP C;  1F66 A;  4H9O B;  4EO5 C;  5JA4 B;  1KX5 D;  5B0Y B;  1M19 A;  5AVB B;  3R45 B;  2F8N D;  4J8U C;  1P3F B;  3LZ1 C;  4G91 C;  4ZUX B;  3V9R A;  3H0M C;  5B33 A;  4XUJ D;  5B24 D;  1HTA A;  3AZE C;  5B2I C;  1BH8 B;  5CP6 B;  3REL D;  5CPJ B;  3AYW D;  5GXQ B;  2G5I C;  5CPI B;  3C1C C;  3AZK A;  2HIO D;  4XZQ C;  3REI C;  3VH5 W;  4YS3 D;  3FDD A;  2Y2K A;  1KX4 D;  5GSU A;  5B40 C;  4KUD B;  3AV2 C;  1P3G A;  3C1B D;  3UT9 B;  5AV8 A;  4QLC B;  1P3B C;  4R8P C;  2Y2M A;  5B32 A;  3AZM C;  3AZG B;  3NQU A;  3WTP C;  5GT0 A;  5BS7 A;  2Y2G A;  4LD9 A;  3KXB D;  3MVD D;  1KX3 D;  1N1J A;  3UTB B;  1S32 C;  3A6N A;  1P3A A;  2NZD C;  3B0D C;  5AVC C;  5F99 A;  2BYM A;  1TZY D;  2ZY3 A;  3REK D;  3X1S A;  1U35 B;  3UTA B;  1P3K A;  3MGS A;  1M18 A;  3AN2 C;  1P3I A;  4KGC C;  1P3P D;  4M6B A;  5GT3 D;  4JJN C;  5DNN C;  3X1U D;  4G92 B;  5AV5 C;  3MGQ D;  2PYO A;  1M1A A;  5CPK A;  1BH9 A;  3X1T B;  5B0Y D;  4E45 A;  2CV5 C;  3W97 C;  2JE5 A;  3AZL B;  5G49 A;  2FJ7 A;  3AZI B;  3AZN D;  5B1L C;  3W96 A;  3AFA D;  3AZJ C;  5B2J B;  3MGR B;  1ZLA B;  1F66 C;  4J8X D;  3O62 A;  3TU4 B;  3B6F B;  5B1M B;  1ID3 A;  1M19 C;  3WKJ B;  5AY8 B;  4WNN B;  3KWQ D;  3LZ1 A;  3MNN A;  3W98 D;  5DNM D;  5FUG A;  5JRG D;  5C3I B;  4J8W B;  1P3L D;  5B33 C;  1KX5 B;  5AV6 B;  2L5A A;  3C1C A;  4WU9 A;  2ARO D;  1HQ3 D;  3REI A;  3KUY B;  3B0C W;  3AZK C;  3MGP D;  5B40 A;  3UTB D;  5GSU C;  4WU8 C;  5B24 B;  1P3G C;  4XUJ B;  3B6G A;  3H0R C;  3REL B;  1P3O D;  3AYW B;  4R8P A;  2F8N G;  2HIO B;  5BNX A;  3LEL D;  5BNV A;  4YS3 B;  1WWI A;  1TAF A;  2BG1 A;  1KX4 B;  4LD9 C;  3REJ A;  3AZE D;  2NZD A;  3A6N C;  4KHA B;  3C1B B;  4Z5T C;  3X1V D;  5F99 C;  4XZQ D;  1B67 A;  3X1S C;  3MGS C;  3AZI D;  4KGC A;  1P3I C;  2NQB B;  3KXB B;  4DRA A;  3MVD B;  3H0L C;  4JJN A;  4NE3 A;  5AV5 A;  5B2J D;  3MGR D;  1KX3 B;  3WA9 D;  2ZM5 A;  4J8V A;  4CAY A;  5E5A B;  4H9P A;  5AVB C;  2CV5 A;  3B6F D;  2PYO C;  1M1A C;  5AV9 A;  3REK B;  3AV1 A;  3AZF A;  1P3M A;  1EQZ A;  3WAA B;  2F8N H;  2FJ7 C;  1H3O B;  3VH6 T;  3W96 C;  1P3P B;  1S32 D;  3X1U B;  3MGQ B;  5CP6 C;  4J8W D;  5AVC D;  3O62 C;  4ZBJ C;  4WJ3 C;  1P34 D;  2F8N A;  5CPI C;  2HUE C;  5AV6 D;  1ID3 C;  3AN2 D;  2LY8 A;  3KUY D;  4Z66 A;  2Y2H A;  2CWE A;  3AZN B;  5B31 B;  3MNN C;  3AFA B;  3P5J B;  4J8X B;  5KDM B;  3W97 D;  3W99 D;  3LJA A;  4WU9 C;  3KWQ B;  3AZH A;  3LZ0 A;  3AZJ D;  5DNM B;  3W98 B;  1AOI D;  2FFF B;  1F66 D;  2JSS A;  3NQJ A;  3EPH A;  4WU8 A;  5JRG B;  5B0Z B;  1P3L B;  3B6G C;  4YM6 A;  3UTA C;  4UUZ A;  2Y2P A;  1F1E A;  3VH6 W;  1T3U A;  4X23 A;  1HQ3 B;  2ARO B;  2ZY5 A;  3MGP B;  2NQB D;  3B0B A;  4Z2M G;  3A1K A;  3REJ C;  3X1T C;  5B33 D;  1ULY A;  4CSR B;  5E5A D;  4EO5 B;  5CHL B;  1TZY A;  2YFW B;  4Z5T A;  3REH A;  1P3O B;  4J8U B;  4DRB A;  3AZK D;  3WAA D;  5GT3 A;  3LEL B;  4H9O A;  1ZLA C;  4G91 B;  5GSU D;  4H9R B;  2G5H C;  5JA4 A;  2YFV B;  5B0Y A;  1P3G D;  4H9Q B;  5AVB A;  4J8V C;  3R45 A;  3AZE B;  5B2I B;  3WKJ C;  1P3F A;  3X1V B;  5AV9 C;  4AWL C;  5AV8 D;  4XZQ B;  5B32 D;  3REI B;  3AV1 C;  4ZUX A;  3AZF C;  1P3M C;  5GT0 D;  1EQZ C;  5B31 D;  4LD9 D;  4NE6 A;  5C3I C;  3AV2 B;  3WA9 B;  4HGA B;  1BH8 A;  4Z2M H;  5CP6 A;  5CPJ A;  1KX5 C;  5GXQ A;  1P3A D;  5CPI A;  1P3K D;  3X1S D;  3AZM B;  1P3B B;  3MGS D;  2UWX A;  3WTP B;  1M18 D;  4KUD A;  1P3I D;  4Z66 C;  2W8S A;  4XUJ C;  3EG5 B;  1S32 B;  1Q9C A;  2XD1 A;  5B0Z D;  3UT9 A;  3REL C;  1M1A D;  2PYO D;  3B0D B;  5AVC B;  5CPK D;  4QLC A;  1P34 B;  3AZG A;  4H9N B;  3LJA C;  3AN2 B;  3UTB A;  3W96 D;  2BYK B;  3AZH C;  3LZ0 C;  1JFI B;  5DNN B;  3KSY A;  3O62 D;  3VH6 A;  1U35 A;  3UTA A;  1ID3 D;  3W97 B;  3W99 B;  4YM6 C;  4J8U D;  4X23 C;  5B1L B;  3MNN D;  3KXB C;  3LZ1 D;  3MVD C;  3EPJ A;  1KX3 C;  3AZJ B;  1AOI B;  3EPL A;  1F66 B;  3X1T A;  3AZL A;  5B2I D;  1TZY C;  3REK C;  1M19 B;  3AZI A;  3C1C D;  3REH C;  4UPK A;  3REI D;  2VQR A;  1P3P C;  5B2J A;  3MGR A;  5GT3 C;  1ZLA A;  5B40 D;  3MGQ C;  3TU4 A;  3B6F A;  5B1M A;  3AV2 D;  3V9R B;  3B6G D;  5B33 B;  5B0Y C;  3WKJ A;  5AY8 A;  4WNN A;  1P3F C;  1P3B D;  4R8P D;  3AZM D;  3AZN C;  3AZK B;  3WTP D;  2RIQ A;  3AFA C;  4ZUX C;  4J8W A;  5GSU B;  1KX5 A;  2ZY4 A;  2DQN C;  1P3G B;  2Y2L A;  3EPK A;  5AV6 A;  2NZD D;  5BO0 A;  4DQY B;  5CPJ C;  5GXQ C;  1R4V A;  3KUY A;  3KWQ C;  5AV8 B;  3W98 C;  5DNM C;  5B32 B;  3NQU B;  4KGC D;  4KUD C;  5GT0 B;  1B6W A;  3VH5 T;  5B24 A;  4LD9 B;  4XUJ A;  4JJN D;  5DNN D;  1N1J B;  5AV5 D;  4J8V D;  3REL A;  3IP4 C;  3A6N B;  1KU5 A;  3AYW A;  3UT9 C;  2CV5 D;  1P3A B;  4QLC C;  5AV9 D;  2HIO A;  5F99 B;  3AZG C;  1HQ3 C;  2BYM B;  3AV1 D;  1Z2C B;  4YS3 A;  3X1S B;  1P3K B;  2IO5 B;  3MGS B;  1P3M D;  5B32 G;  1KX4 A;  1M18 B;  5B1L D;  1P3I B;  3UTB C;  5B31 G;  1PZR A;  4NE5 A;  4KHA A;  3C1B A;  2PYO B;  1M1A B;  4WV4 B;  1P3O C;  5CPK B;  1BH9 B;  1U35 C;  1M19 D;  3LEL C;  2NQB A;  3KXB A;  5G49 B;  3MVD A;  1KX3 A;  4Z66 D;  2RVQ C;  2FJ7 B;  4G92 C;  3W96 B;  4H9S A;  5E5A A;  3O62 B;  4ZBJ B;  3X1V C;  3REK A;  3WTP E;  2HUE B;  3AZL C;  3WAA A;  1ID3 B;  3LJA D;  3AZI C;  1H3O A;  1P3P A;  2Y2I A;  3MNN B;  3LZ1 B;  3X1U A;  3LZ0 D;  5B2J C;  3MGR C;  5FUG B;  4HGA C;  3MGQ A;  3AZH D;  3WA9 C;  1BFM A;  3TU4 C;  4WU8 D;  3B6F C;  5B1M C;  2J8P A;  2ZY2 A;  5BT1 C;  5AY8 C;  4YM6 D;  3C1C B;  3AZN A; 
#chains in the Genus database with same CATH homology
 5B31 A;  4X23 D;  4WU9 B;  3AFA A;  2DF4 C;  4J8X A;  5B40 B;  4J8W C;  2F2A C;  5KDM A;  1P34 C;  3B6G B;  3A6N D;  5AV6 C;  3A1I A;  4Z5T D;  3REH D;  5F99 D;  3KWQ A;  3KUY C;  3W98 A;  4R8P B;  5DNM A;  5BNX B;  5BNV B;  5JRG A;  3B0C T;  5B0Z A;  1TAF B;  1P3L A;  5B24 C;  3REJ B;  5AVB D;  1A7W A;  3W99 C;  2NZD B;  2Y2O A;  3F6T A;  3AYW C;  1P3F D;  2ARO A;  1HQ3 A;  2HIO C;  2Y2J A;  4YS3 C;  3MGP A;  4ZUX D;  2FJ7 D;  1KX4 C;  1AOI C;  4KGC B;  4CSR A;  4JJN B;  5AV5 B;  5CP6 D;  4J8V B;  2YFW A;  5CPJ D;  4CAY B;  4H9P B;  5GXQ D;  1P3O A;  3C1B C;  4J8U A;  5CPI D;  2CV5 B;  2XD5 A;  2Y2N A;  5AV9 B;  4AWL B;  3LEL A;  3AV1 B;  4E44 A;  3AZF B;  4KUD D;  1P3M B;  1EQZ B;  4H9R A;  2NQB C;  2YFV A;  4H9Q A;  3AZE A;  4H9S C;  5E5A C;  5B2I A;  3VH5 A;  3UT9 D;  5BO0 B;  3X1V A;  4QLC D;  2F8N B;  4XZQ A;  3AZG D;  3WAA C;  4WU9 D;  3AV2 A;  4Z66 B;  3WA9 A;  3X1U C;  4WZS B;  3KFU G;  1U35 D;  2Y2Q A;  1P3B A;  3AZM A;  3UTA D;  5AV8 C;  4NFT A;  3WTP A;  2JCH A;  5B32 C;  3LJA B;  5GT0 C;  5BS7 C;  2RVQ D;  5B31 C;  1S32 A;  3AZH B;  3LZ0 B;  4J8X C;  5AVC A;  3NQJ B;  3REJ D;  3X1T D;  1P34 A;  1P3A C;  4WU8 B;  4H9N A;  3AZL D;  1WWS A;  1P3K C;  3AN2 A;  4YM6 B;  2IO5 C;  4UUZ B;  1M18 C;  2BYK A;  1JFI A;  4X23 B;  5DNN A;  1W2E A;  1ZLA D;  5JRG C;  3TU4 D;  5B1M D;  5B0Z C;  1P3L C;  5CPK C;  3W97 A;  5BT1 D;  3W99 A;  3WKJ D;  5AY8 D;  1TZY B;  4Z5T B;  3REH B;  5B1L A;  2ARO C;  3AZJ A;  3AZF D;  2F8N K;  3AL0 C;  1EQZ D;  1AOI A;  5GT3 B;  3MGP C;  1F66 A;  4H9O B;  4EO5 C;  5JA4 B;  1KX5 D;  5B0Y B;  1M19 A;  5AVB B;  3R45 B;  2F8N D;  4J8U C;  1P3F B;  3LZ1 C;  4G91 C;  4ZUX B;  3V9R A;  3H0M C;  5B33 A;  4XUJ D;  5B24 D;  1HTA A;  3AZE C;  5B2I C;  1BH8 B;  5CP6 B;  3REL D;  5CPJ B;  3AYW D;  5GXQ B;  2G5I C;  5CPI B;  3C1C C;  3AZK A;  2HIO D;  4XZQ C;  3REI C;  3VH5 W;  4YS3 D;  3FDD A;  2Y2K A;  1KX4 D;  5GSU A;  5B40 C;  4KUD B;  3AV2 C;  1P3G A;  3C1B D;  3UT9 B;  5AV8 A;  4QLC B;  1P3B C;  4R8P C;  2Y2M A;  5B32 A;  3AZM C;  3AZG B;  3NQU A;  3WTP C;  5GT0 A;  5BS7 A;  2Y2G A;  4LD9 A;  3KXB D;  3MVD D;  1KX3 D;  1N1J A;  3UTB B;  1S32 C;  3A6N A;  1P3A A;  2NZD C;  3B0D C;  5AVC C;  5F99 A;  2BYM A;  1TZY D;  2ZY3 A;  3REK D;  3X1S A;  1U35 B;  3UTA B;  1P3K A;  3MGS A;  1M18 A;  3AN2 C;  1P3I A;  4KGC C;  1P3P D;  4M6B A;  5GT3 D;  4JJN C;  5DNN C;  3X1U D;  4G92 B;  5AV5 C;  3MGQ D;  2PYO A;  1M1A A;  5CPK A;  1BH9 A;  3X1T B;  5B0Y D;  4E45 A;  2CV5 C;  3W97 C;  2JE5 A;  3AZL B;  5G49 A;  2FJ7 A;  3AZI B;  3AZN D;  5B1L C;  3W96 A;  3AFA D;  3AZJ C;  5B2J B;  3MGR B;  1ZLA B;  1F66 C;  4J8X D;  3O62 A;  3TU4 B;  3B6F B;  5B1M B;  1ID3 A;  1M19 C;  3WKJ B;  5AY8 B;  4WNN B;  3KWQ D;  3LZ1 A;  3MNN A;  3W98 D;  5DNM D;  5FUG A;  5JRG D;  5C3I B;  4J8W B;  1P3L D;  5B33 C;  1KX5 B;  5AV6 B;  2L5A A;  3C1C A;  4WU9 A;  2ARO D;  1HQ3 D;  3REI A;  3KUY B;  3B0C W;  3AZK C;  3MGP D;  5B40 A;  3UTB D;  5GSU C;  4WU8 C;  5B24 B;  1P3G C;  4XUJ B;  3B6G A;  3H0R C;  3REL B;  1P3O D;  3AYW B;  4R8P A;  2F8N G;  2HIO B;  5BNX A;  3LEL D;  5BNV A;  4YS3 B;  1WWI A;  1TAF A;  2BG1 A;  1KX4 B;  4LD9 C;  3REJ A;  3AZE D;  2NZD A;  3A6N C;  4KHA B;  3C1B B;  4Z5T C;  3X1V D;  5F99 C;  4XZQ D;  1B67 A;  3X1S C;  3MGS C;  3AZI D;  4KGC A;  1P3I C;  2NQB B;  3KXB B;  4DRA A;  3MVD B;  3H0L C;  4JJN A;  4NE3 A;  5AV5 A;  5B2J D;  3MGR D;  1KX3 B;  3WA9 D;  2ZM5 A;  4J8V A;  4CAY A;  5E5A B;  4H9P A;  5AVB C;  2CV5 A;  3B6F D;  2PYO C;  1M1A C;  5AV9 A;  3REK B;  3AV1 A;  3AZF A;  1P3M A;  1EQZ A;  3WAA B;  2F8N H;  2FJ7 C;  1H3O B;  3VH6 T;  3W96 C;  1P3P B;  1S32 D;  3X1U B;  3MGQ B;  5CP6 C;  4J8W D;  5AVC D;  3O62 C;  4ZBJ C;  4WJ3 C;  1P34 D;  2F8N A;  5CPI C;  2HUE C;  5AV6 D;  1ID3 C;  3AN2 D;  2LY8 A;  3KUY D;  4Z66 A;  2Y2H A;  2CWE A;  3AZN B;  5B31 B;  3MNN C;  3AFA B;  3P5J B;  4J8X B;  5KDM B;  3W97 D;  3W99 D;  3LJA A;  4WU9 C;  3KWQ B;  3AZH A;  3LZ0 A;  3AZJ D;  5DNM B;  3W98 B;  1AOI D;  2FFF B;  1F66 D;  2JSS A;  3NQJ A;  3EPH A;  4WU8 A;  5JRG B;  5B0Z B;  1P3L B;  3B6G C;  4YM6 A;  3UTA C;  4UUZ A;  2Y2P A;  1F1E A;  3VH6 W;  1T3U A;  4X23 A;  1HQ3 B;  2ARO B;  2ZY5 A;  3MGP B;  2NQB D;  3B0B A;  4Z2M G;  3A1K A;  3REJ C;  3X1T C;  5B33 D;  1ULY A;  4CSR B;  5E5A D;  4EO5 B;  5CHL B;  1TZY A;  2YFW B;  4Z5T A;  3REH A;  1P3O B;  4J8U B;  4DRB A;  3AZK D;  3WAA D;  5GT3 A;  3LEL B;  4H9O A;  1ZLA C;  4G91 B;  5GSU D;  4H9R B;  2G5H C;  5JA4 A;  2YFV B;  5B0Y A;  1P3G D;  4H9Q B;  5AVB A;  4J8V C;  3R45 A;  3AZE B;  5B2I B;  3WKJ C;  1P3F A;  3X1V B;  5AV9 C;  4AWL C;  5AV8 D;  4XZQ B;  5B32 D;  3REI B;  3AV1 C;  4ZUX A;  3AZF C;  1P3M C;  5GT0 D;  1EQZ C;  5B31 D;  4LD9 D;  4NE6 A;  5C3I C;  3AV2 B;  3WA9 B;  4HGA B;  1BH8 A;  4Z2M H;  5CP6 A;  5CPJ A;  1KX5 C;  5GXQ A;  1P3A D;  5CPI A;  1P3K D;  3X1S D;  3AZM B;  1P3B B;  3MGS D;  2UWX A;  3WTP B;  1M18 D;  4KUD A;  1P3I D;  4Z66 C;  2W8S A;  4XUJ C;  3EG5 B;  1S32 B;  1Q9C A;  2XD1 A;  5B0Z D;  3UT9 A;  3REL C;  1M1A D;  2PYO D;  3B0D B;  5AVC B;  5CPK D;  4QLC A;  1P34 B;  3AZG A;  4H9N B;  3LJA C;  3AN2 B;  3UTB A;  3W96 D;  2BYK B;  3AZH C;  3LZ0 C;  1JFI B;  5DNN B;  3KSY A;  3O62 D;  3VH6 A;  1U35 A;  3UTA A;  1ID3 D;  3W97 B;  3W99 B;  4YM6 C;  4J8U D;  4X23 C;  5B1L B;  3MNN D;  3KXB C;  3LZ1 D;  3MVD C;  3EPJ A;  1KX3 C;  3AZJ B;  1AOI B;  3EPL A;  1F66 B;  3X1T A;  3AZL A;  5B2I D;  1TZY C;  3REK C;  1M19 B;  3AZI A;  3C1C D;  3REH C;  4UPK A;  3REI D;  2VQR A;  1P3P C;  5B2J A;  3MGR A;  5GT3 C;  1ZLA A;  5B40 D;  3MGQ C;  3TU4 A;  3B6F A;  5B1M A;  3AV2 D;  3V9R B;  3B6G D;  5B33 B;  5B0Y C;  3WKJ A;  5AY8 A;  4WNN A;  1P3F C;  1P3B D;  4R8P D;  3AZM D;  3AZN C;  3AZK B;  3WTP D;  2RIQ A;  3AFA C;  4ZUX C;  4J8W A;  5GSU B;  1KX5 A;  2ZY4 A;  2DQN C;  1P3G B;  2Y2L A;  3EPK A;  5AV6 A;  2NZD D;  5BO0 A;  4DQY B;  5CPJ C;  5GXQ C;  1R4V A;  3KUY A;  3KWQ C;  5AV8 B;  3W98 C;  5DNM C;  5B32 B;  3NQU B;  4KGC D;  4KUD C;  5GT0 B;  1B6W A;  3VH5 T;  5B24 A;  4LD9 B;  4XUJ A;  4JJN D;  5DNN D;  1N1J B;  5AV5 D;  4J8V D;  3REL A;  3IP4 C;  3A6N B;  1KU5 A;  3AYW A;  3UT9 C;  2CV5 D;  1P3A B;  4QLC C;  5AV9 D;  2HIO A;  5F99 B;  3AZG C;  1HQ3 C;  2BYM B;  3AV1 D;  1Z2C B;  4YS3 A;  3X1S B;  1P3K B;  2IO5 B;  3MGS B;  1P3M D;  5B32 G;  1KX4 A;  1M18 B;  5B1L D;  1P3I B;  3UTB C;  5B31 G;  1PZR A;  4NE5 A;  4KHA A;  3C1B A;  2PYO B;  1M1A B;  4WV4 B;  1P3O C;  5CPK B;  1BH9 B;  1U35 C;  1M19 D;  3LEL C;  2NQB A;  3KXB A;  5G49 B;  3MVD A;  1KX3 A;  4Z66 D;  2RVQ C;  2FJ7 B;  4G92 C;  3W96 B;  4H9S A;  5E5A A;  3O62 B;  4ZBJ B;  3X1V C;  3REK A;  3WTP E;  2HUE B;  3AZL C;  3WAA A;  1ID3 B;  3LJA D;  3AZI C;  1H3O A;  1P3P A;  2Y2I A;  3MNN B;  3LZ1 B;  3X1U A;  3LZ0 D;  5B2J C;  3MGR C;  5FUG B;  4HGA C;  3MGQ A;  3AZH D;  3WA9 C;  1BFM A;  3TU4 C;  4WU8 D;  3B6F C;  5B1M C;  2J8P A;  2ZY2 A;  5BT1 C;  5AY8 C;  4YM6 D;  3C1C B;  3AZN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...