3AZHD

Crystal structure of human nucleosome core particle containing h3k122q mutation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
95
structure length
95
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 36
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azhD00
3AZKB 4UUZB 4J8VD 4R8PC 2NQBB 5GXQD 5C3IB 3LZ0B 1P3FC 3KWQB 3AV2C 3LJAB 3KUYB 4H9OA 4ZUXA 3UTBB 5E5AD 5GT0C 4G91C 3AZMC 3W96B 5AY8C 1AOIC 1P3LA 4X23B 5B31B 3AZFA 3C1CC 4XZQA 1ZLAB 1BH8B 5E5AA 1BH9A 3X1UA 4XUJD 1N1JA 5DNMC 3MGSA 4WU9C 1KU5A 1P3MC 3O62D 1M19D 1F66D 5G49B 1P34B 3AZID 2YFVB 3R45A 5B2IB 5CPJD 4AWLB 1P3BC 1H3OB 3X1SC 1TAFA 3AFAB 1M19A 5BNXA 3MVDD 1B6WA 2LY8A 5CPKC 2AROC 3WAAA 5DNNC 5AVBD 3AZJA 3C1BA 5B0ZB 5CPJA 1EQZA 5B2JB 1M1AD 4NE6A 3MNND 3LJAC 5AVBA 3B6FC 4KGCB 5AV6B 4J8UB 1M1AA 4YM6B 4J8XC 1JFIA 5BT1D 3X1TD 1P3AC 3W98B 4H9PB 3AZGD 4X23C 5GT3A 4WU8B 5B40C 3VH5W 3MGRD 4CAYB 1P3PD 5AVCA 1HQ3A 3B6GC 4H9SA 1P3GB 4Z66A 2F8ND 3AZEC 5CPIB 5B1MB 2CV5D 4WNNA 3A6ND 3LELB 3UTAA 1P3ID 3AN2D 5B24B 3AYWA 2BYMA 1P3PA 4Z2MG 1KX5D 4KUDA 5CHLB 3WTPA 2YFWB 3REHB 4H9QB 5B0YC 1P3FD 1ID3B 4J8WB 2FJ7D 3AN2A 5B32A 5B1LB 3AZND 3KXBA 3AZHD 1KX4D 3X1VB 3RELB 1KX3D 3WA9B 4KHAB 5JA4B 3LZ1A 1M18A 4EO5C 5GSUB 1P3LC 3AZFC 2RVQC 3AZLA 4XZQC 3W99D 5BNVB 4CSRB 3B0DB 5AV5D 1HTAA 3X1UC 4H9NA 3AV2B 4LD9A 4J8UC 5CP6B 3W98C 3MGSC 5JRGA 4YS3B 3W99A 5GT0B 1TZYA 5AV5A 4DRAA 3REKA 3AZMB 1S32D 5AY8B 1AOIB 4JJNA 3C1CB 3MGPD 5B1MC 3REID 2PYOD 3W97D 3WAAC 1R4VA 2HIOD 5B33A 5AV8A 3MGQD 3AZKD 3AZJC 2BYKA 3NQUA 3C1BC 5DNMB 1P3MB 2NQBD 3REJB 1EQZC 3VH6W 3LZ0D 3UT9B 3AV1A 5BO0A 3KWQD 4J8WC 2PYOA 3KUYD 2HIOA 3MGQA 1P3BB 4H9RB 3UTBD 5F99D 3X1SB 3WA9C 2JSSA 3VH5T 5CPKB 2AROB 3W96D 5DNNB 5B31D 2NZDA 5GSUC 5GT3C 1ZLAD 5F99A 5AVCC 1HQ3C 3B0DC 4Z66C 5CP6C 4G92B 3B6FB 4J8VA 3UTAC 4YS3C 5GXQA 3AYWC 1P3OB 3V9RB 5AV9B 4J8XB 1P34D 4KUDC 1P3AB 3WTPC 4Z5TB 5B2ID 4HGAC 1U35D 3AFAD 5B40B 3B6GB 4WZSB 3KXBC 3AZEB 5B0ZD 3LZ1C 3WKJD 3REJC 5B2JD 1U35A 1M18C 3UT9C 3AZLC 4XUJA 5B0YB 4KGCD 3KSYA 3WKJA 5AV6D 3O62A 4YM6D 4LD9C 1F66A 5JRGC 4H9OB 4QLCC 3AZIA 4ZUXB 4WU8D 3TU4D 1TZYC 4EO5B 3REKC 1P3LB 1P3GD 4JJNC 3AZFB 3MVDA 5CPID 4XZQB 3LELD 4G92C 5FUGA 3TU4A 3VH6T 5B24D 1BH9B 3X1UB 5AV8C 5B33C 1P3OC 1N1JB 3MGSB 5AV9C 3MNNA 4Z5TC 3REHD 4Z2MH 1P3KD 1ID3D 3AV1C 2IO5C 5B1LD 3R45B 3X1VD 3RELD 3X1TA 1TAFB 1P3KA 1M19B 5BNXB 3AZGA 4DRBA 4NE3A 3WAAB 2NZDC 3AZJB 3C1BB 3MGRA 4R8PD 5CPJB 1EQZB 4NE5A 2F8NA 2CV5A 3A6NA 3AV2D 1ULYA 1P3IA 5AVBB 1KX5A 4R8PA 4J8VC 4ZUXC 1A7WA 5GXQC 3VH5A 1M1AB 5GT0D 1JFIB 3AZMD 1P3FA 5AY8D 1AOID 2FJ7A 1Q9CA 3C1CD 5GT3B 4ZBJB 3WTPE 3AZNA 3AZHA 1KX4A 3NQJA 1KX3A 5AVCB 1HQ3B 5E5AC 1F1EA 4Z66B 3AZMA 5DNMD 4WU9D 1P3MD 4WNNB 3UTAB 3AYWB 2BYMB 1P3PB 5BS7A 4KUDB 3WTPB 4HGAB 1P3BD 4XUJC 4WU9A 4NFTA 3X1SD 3B0BA 3O62C 1M19C 3AN2B 5B32B 1F66C 5CPKD 2AROD 3KXBB 5DNND 3AZIC 1S32A 3LZ1B 5CPJC 3B0CW 1M18B 3MGPA 5KDMA 3REIA 3W97A 3MVDC 3AZLB 3LJAD 3B6FD 5AVBC 3AZKA 4UUZA 2NQBA 4H9NB 4LD9B 4J8XD 1M1AC 1P3AD 3LZ0A 5JRGB 3MNNC 3KWQA 4QLCB 4X23D 3LJAA 3KUYA 1BFMA 3W99B 4ZBJC 5B40D 1TZYB 5AV5B 3REKB 3UTBA 3B6GD 4H9SC 4JJNB 3AZED 5BT1C 3W96A 3X1TC 4X23A 5B31A 3VH6A 3AZGC 5B33B 5AV8B 4WV4B 1ZLAA 2BYKB 3NQUB 1BH8A 3MGRC 1P3PC 1B67A 5B0YD 2CV5C 2F8NG 3AV1B 5BO0B 2IO5B 2PYOB 3A6NC 1P3IC 5G49A 2HUEC 2HIOB 4E45A 5B32C 3MGQB 3AN2C 5B32G 1P34A 1KX5C 4ZUXD 2YFVA 5B2IA 5B0YA 1H3OA 2F8NK 3AFAA 1P3LD 2NZDB 2FJ7C 3AZFD 2RVQD 3AZNC 3AZHC 4XZQD 1KX4C 5F99B 5B0ZA 1KX3C 3X1UD 5B2JA 4J8UD 3W98D 3MGSD 4J8VB 5GXQB 3W99C 5BS7C 4KGCA 5AV5C 5AV6A 4J8UA 3W98A 4YM6A 4H9PA 5B1MD 3B0CT 5E5AB 4WU8A 3WAAD 3AZJD 3C1BD 1S32C 4CAYA 2CWEA 1EQZD 1P3GA 1U35B 5CPIA 5B1MA 3MGPC 4J8WD 3REIC 2PYOC 3LELA 3W97C 5B24A 2HIOC 4XUJB 3MGQC 3AZKC 3WKJB 2YFWA 3WA9D 2NQBC 3O62B 3REHA 4H9QA 1F66B 5C3IC 1ID3A 3LZ0C 4J8WA 3KWQC 5GSUD 3AZIB 5B1LA 5GT3D 3KUYC 3X1VA 3RELA 4E44A 3WA9A 5AVCD 1HQ3D 5F99C 3UTBC 4KHAA 5JA4A 4Z66D 3MVDB 3W96C 5CP6D 5GSUA 5B31C 5B31G 5FUGB 3UTAD 4YS3D 3TU4B 3AYWD 1ZLAC 4KUDD 5BNVA 3WTPD 4CSRA 3MNNB 3AV2A 5CP6A 4YS3A 5B32D 3KXBD 5GT0A 1P34C 3X1TB 5AY8A 3LZ1D 1P3KB 1AOIA 5B2IC 3REJD 3AZGB 4AWLC 3C1CA 1M18D 1U35C 3AFAC 3UT9D 3MGRB 3AZLD 2F8NB 5DNMA 5B0ZC 2CV5B 1P3MA 3REJA 3WKJC 3A6NB 5B2JC 4LD9D 1P3IB 2HUEB 5JRGD 3UT9A 4QLCD 1KX5B 4R8PB 1P3BA 1TZYD 4H9RA 3REKD 2L5AA 1P3FB 3X1SA 4KGCC 1WWSA 5AV6C 2FJ7B 4JJND 4YM6C 3AZNB 2AROA 1WWIA 3AZHB 5CPKA 1KX4B 4QLCA 5DNNA 3NQJB 1KX3B 4WU8C 3TU4C 5B33D 4G91B 5AV8D 1P3OD 5AV9D 4Z5TD 1P3GC 5CPIC 3AV1D 3B6FA 3LELC 2F8NH 5B24C 1P3OA 3V9RA 5AV9A 4J8XA 4WU9B 1P3AA 4Z5TA 1P3KC 3REHC 1ID3C 5B40A 2NZDD 1S32B 5B1LC 3B6GA 4M6BA 3X1VC 3RELC 3AZEA 3MGPB 5KDMB 3REIB 3W97B
chains in the Genus database with same CATH superfamily
3AZKB 4UUZB 4J8VD 4R8PC 2NQBB 5GXQD 1Z2CB 5C3IB 3LZ0B 1P3FC 3KWQB 3AV2C 3LJAB 3KUYB 4H9OA 4ZUXA 3UTBB 5E5AD 2G5HC 5GT0C 4G91C 3AZMC 3W96B 3KFUG 5AY8C 1AOIC 1P3LA 4X23B 5B31B 3A1KA 3AZFA 3C1CC 4XZQA 1ZLAB 1BH8B 5E5AA 1BH9A 3X1UA 4XUJD 1N1JA 5DNMC 3MGSA 4WU9C 1KU5A 1P3MC 3O62D 1M19D 1F66D 5G49B 1P34B 3AZID 2Y2IA 2YFVB 3R45A 5B2IB 5CPJD 4AWLB 1P3BC 1H3OB 3X1SC 1TAFA 3AFAB 1M19A 5BNXA 3MVDD 1B6WA 2LY8A 5CPKC 2AROC 3WAAA 5DNNC 5AVBD 3AZJA 3C1BA 5B0ZB 5CPJA 1EQZA 5B2JB 1M1AD 4NE6A 4UPKA 3MNND 2XD5A 3LJAC 5AVBA 3B6FC 4KGCB 5AV6B 4J8UB 1M1AA 4YM6B 4J8XC 1JFIA 5BT1D 3X1TD 2ZY2A 1P3AC 3W98B 4H9PB 3AZGD 4X23C 2VQRA 5GT3A 4WU8B 5B40C 3VH5W 3MGRD 4CAYB 1P3PD 2JE5A 1HQ3A 5AVCA 3B6GC 4H9SA 1P3GB 4Z66A 2F8ND 4WJ3C 3AZEC 5CPIB 2DF4C 5B1MB 2CV5D 4WNNA 3A6ND 3LELB 2Y2PA 3UTAA 1P3ID 3AN2D 5B24B 3AYWA 2BYMA 1P3PA 4Z2MG 1KX5D 4KUDA 5CHLB 3WTPA 2YFWB 2JCHA 3REHB 4H9QB 5B0YC 1P3FD 1ID3B 4J8WB 2FJ7D 3AN2A 5B32A 5B1LB 3AZND 3KXBA 3AZHD 1KX4D 3X1VB 3RELB 1KX3D 3WA9B 4KHAB 5JA4B 3LZ1A 1M18A 4EO5C 5GSUB 1P3LC 3AZFC 2RVQC 3AZLA 2ZY5A 4XZQC 3W99D 5BNVB 4CSRB 3B0DB 5AV5D 1HTAA 3X1UC 4H9NA 3AV2B 4LD9A 4J8UC 5CP6B 3FDDA 3H0MC 3MGSC 3W98C 5JRGA 4YS3B 2ZY4A 3W99A 5GT0B 1TZYA 5AV5A 4DRAA 3REKA 3AZMB 1S32D 5AY8B 1AOIB 4JJNA 3C1CB 3MGPD 5B1MC 3REID 2PYOD 3W97D 3WAAC 1R4VA 2HIOD 5B33A 5AV8A 3MGQD 3AZKD 3AZJC 2BYKA 3NQUA 3C1BC 5DNMB 1P3MB 2NQBD 3REJB 1EQZC 3H0RC 3VH6W 3LZ0D 3UT9B 3AV1A 5BO0A 3KWQD 4J8WC 2PYOA 3KUYD 2HIOA 3MGQA 1P3BB 4H9RB 2Y2OA 3UTBD 5F99D 3X1SB 3WA9C 2JSSA 3VH5T 5CPKB 2AROB 3W96D 5DNNB 5B31D 2NZDA 5GSUC 5GT3C 1ZLAD 5F99A 3EG5B 5AVCC 1HQ3C 3B0DC 4Z66C 5CP6C 4G92B 3B6FB 4J8VA 3UTAC 4YS3C 5GXQA 3AYWC 1P3OB 3V9RB 5AV9B 4J8XB 1P34D 4KUDC 1P3AB 3WTPC 4Z5TB 5B2ID 4HGAC 3F6TA 1U35D 2Y2GA 3AFAD 5B40B 3B6GB 4WZSB 3KXBC 3AZEB 5B0ZD 3LZ1C 4DQYB 3WKJD 3REJC 5B2JD 1U35A 1M18C 3UT9C 3AZLC 4XUJA 5B0YB 4KGCD 3KSYA 3WKJA 5AV6D 3O62A 4YM6D 4LD9C 1F66A 5JRGC 4H9OB 4QLCC 3AZIA 4ZUXB 4WU8D 3TU4D 1TZYC 4EO5B 3REKC 1P3LB 1P3GD 4JJNC 3AZFB 3MVDA 5CPID 4XZQB 3LELD 4G92C 5FUGA 3TU4A 2Y2MA 3VH6T 5B24D 1BH9B 3X1UB 2BG1A 5AV8C 5B33C 1P3OC 1N1JB 3MGSB 5AV9C 3MNNA 4Z5TC 3REHD 4Z2MH 1P3KD 1ID3D 3AV1C 2FFFB 2IO5C 2Y2HA 5B1LD 3R45B 3X1VD 1T3UA 3RELD 3X1TA 1TAFB 1P3KA 1M19B 5BNXB 3AZGA 4DRBA 4NE3A 3WAAB 2NZDC 3AZJB 3C1BB 3MGRA 4R8PD 5CPJB 1EQZB 4NE5A 2Y2JA 2F8NA 2CV5A 3A6NA 3AV2D 1ULYA 1P3IA 5AVBB 1KX5A 4R8PA 4J8VC 4ZUXC 1A7WA 5GXQC 3VH5A 1M1AB 5GT0D 1JFIB 3AZMD 1P3FA 5AY8D 1AOID 2UWXA 2FJ7A 1Q9CA 3C1CD 5GT3B 4ZBJB 3WTPE 3AZNA 3AZHA 1KX4A 3NQJA 1KX3A 5AVCB 1HQ3B 5E5AC 1F1EA 4Z66B 3AZMA 5DNMD 4WU9D 1P3MD 4WNNB 3UTAB 3AYWB 2BYMB 1P3PB 5BS7A 4KUDB 3WTPB 4HGAB 1P3BD 4XUJC 4WU9A 4NFTA 3X1SD 3B0BA 3O62C 1M19C 3AN2B 5B32B 1F66C 5CPKD 2AROD 3KXBB 5DNND 3AZIC 1S32A 3LZ1B 5CPJC 3B0CW 1M18B 3MGPA 5KDMA 3REIA 3W97A 3MVDC 3AZLB 2G5IC 3LJAD 3B6FD 5AVBC 3AZKA 4UUZA 2NQBA 4H9NB 4LD9B 4J8XD 1M1AC 1P3AD 3LZ0A 5JRGB 3MNNC 1PZRA 3KWQA 4QLCB 4X23D 3LJAA 3KUYA 1BFMA 2F2AC 3W99B 4ZBJC 5B40D 1TZYB 5AV5B 3REKB 3UTBA 3B6GD 4H9SC 4JJNB 3AZED 5BT1C 3W96A 3X1TC 4X23A 5B31A 3VH6A 3AZGC 3H0LC 5B33B 5AV8B 4WV4B 1ZLAA 2BYKB 3NQUB 1BH8A 3MGRC 1P3PC 1B67A 5B0YD 2CV5C 2F8NG 3AV1B 5BO0B 2IO5B 2PYOB 3A6NC 1P3IC 5G49A 2Y2NA 5B32C 2HUEC 2HIOB 4E45A 3MGQB 5B32G 3AN2C 2DQNC 1P34A 1KX5C 2Y2QA 4ZUXD 2YFVA 5B2IA 2W8SA 5B0YA 1H3OA 2F8NK 3AFAA 1P3LD 2NZDB 2FJ7C 3AZFD 2RVQD 3AZNC 3AZHC 4XZQD 1KX4C 5F99B 5B0ZA 1KX3C 3X1UD 5B2JA 4J8UD 3W98D 3MGSD 4J8VB 5GXQB 3W99C 5BS7C 4KGCA 5AV5C 5AV6A 4J8UA 3W98A 4YM6A 4H9PA 5B1MD 3B0CT 5E5AB 4WU8A 3WAAD 3AZJD 3C1BD 1S32C 4CAYA 2CWEA 2RIQA 1EQZD 1P3GA 1U35B 5CPIA 5B1MA 3MGPC 2ZM5A 4J8WD 3REIC 3LELA 2PYOC 3AL0C 3W97C 5B24A 2HIOC 4XUJB 3MGQC 3AZKC 3WKJB 2YFWA 3WA9D 2NQBC 3O62B 3REHA 3IP4C 4H9QA 1F66B 5C3IC 1ID3A 3LZ0C 4J8WA 3KWQC 5GSUD 3AZIB 5B1LA 5GT3D 3KUYC 3X1VA 3RELA 4E44A 3WA9A 5AVCD 1HQ3D 5F99C 3UTBC 4KHAA 5JA4A 4Z66D 3MVDB 3W96C 5CP6D 5GSUA 5B31C 3EPHA 5B31G 5FUGB 3UTAD 4YS3D 3TU4B 3AYWD 1ZLAC 4KUDD 5BNVA 3WTPD 4CSRA 3MNNB 2Y2KA 3AV2A 5CP6A 2XD1A 3EPJA 3P5JB 4YS3A 5B32D 3KXBD 5GT0A 1P34C 3EPLA 3X1TB 5AY8A 3LZ1D 1P3KB 1AOIA 5B2IC 3REJD 3AZGB 4AWLC 3C1CA 1M18D 1U35C 2ZY3A 3AFAC 3UT9D 3MGRB 3A1IA 3AZLD 3EPKA 2F8NB 5DNMA 5B0ZC 2CV5B 1P3MA 3REJA 3WKJC 3A6NB 5B2JC 4LD9D 1P3IB 2HUEB 5JRGD 3UT9A 4QLCD 1KX5B 4R8PB 1P3BA 1TZYD 4H9RA 3REKD 2L5AA 1P3FB 3X1SA 4KGCC 1WWSA 5AV6C 2FJ7B 4JJND 4YM6C 1W2EA 2AROA 1WWIA 3AZHB 3AZNB 5CPKA 4QLCA 5DNNA 1KX4B 3NQJB 1KX3B 4WU8C 3TU4C 5B33D 5AV8D 4G91B 1P3OD 2Y2LA 5AV9D 4Z5TD 1P3GC 5CPIC 2J8PA 3AV1D 3B6FA 3LELC 2F8NH 5B24C 1P3OA 3V9RA 5AV9A 4J8XA 4WU9B 1P3AA 4Z5TA 1P3KC 3REHC 1ID3C 5B40A 2NZDD 1S32B 5B1LC 3B6GA 4M6BA 3X1VC 3RELC 3AZEA 3MGPB 5KDMB 3REIB 3W97B
chains in the Genus database with same CATH topology
3AZKB 4UUZB 4J8VD 4R8PC 2NQBB 5GXQD 1Z2CB 5C3IB 3LZ0B 1P3FC 3KWQB 3AV2C 3LJAB 3KUYB 4H9OA 4ZUXA 3UTBB 5E5AD 2G5HC 5GT0C 4G91C 3AZMC 3W96B 3KFUG 5AY8C 1AOIC 1P3LA 4X23B 5B31B 3A1KA 3AZFA 3C1CC 4XZQA 1ZLAB 1BH8B 5E5AA 1BH9A 3X1UA 4XUJD 1N1JA 5DNMC 3MGSA 4WU9C 1KU5A 1P3MC 3O62D 1M19D 1F66D 5G49B 1P34B 3AZID 2Y2IA 2YFVB 3R45A 5B2IB 5CPJD 4AWLB 1P3BC 1H3OB 3X1SC 1TAFA 3AFAB 1M19A 5BNXA 3MVDD 1B6WA 2LY8A 5CPKC 2AROC 3WAAA 5DNNC 5AVBD 3AZJA 3C1BA 5B0ZB 5CPJA 1EQZA 5B2JB 1M1AD 4NE6A 4UPKA 3MNND 2XD5A 3LJAC 5AVBA 3B6FC 4KGCB 5AV6B 4J8UB 1M1AA 4YM6B 4J8XC 1JFIA 5BT1D 3X1TD 2ZY2A 1P3AC 3W98B 4H9PB 3AZGD 4X23C 2VQRA 5GT3A 4WU8B 5B40C 3VH5W 3MGRD 4CAYB 1P3PD 2JE5A 1HQ3A 5AVCA 3B6GC 4H9SA 1P3GB 4Z66A 2F8ND 4WJ3C 3AZEC 5CPIB 2DF4C 5B1MB 2CV5D 4WNNA 3A6ND 3LELB 2Y2PA 3UTAA 1P3ID 3AN2D 5B24B 3AYWA 2BYMA 1P3PA 4Z2MG 1KX5D 4KUDA 5CHLB 3WTPA 2YFWB 2JCHA 3REHB 4H9QB 5B0YC 1P3FD 1ID3B 4J8WB 2FJ7D 3AN2A 5B32A 5B1LB 3AZND 3KXBA 3AZHD 1KX4D 3X1VB 3RELB 1KX3D 3WA9B 4KHAB 5JA4B 3LZ1A 1M18A 4EO5C 5GSUB 1P3LC 3AZFC 2RVQC 3AZLA 2ZY5A 4XZQC 3W99D 5BNVB 4CSRB 3B0DB 5AV5D 1HTAA 3X1UC 4H9NA 3AV2B 4LD9A 4J8UC 5CP6B 3FDDA 3H0MC 3MGSC 3W98C 5JRGA 4YS3B 2ZY4A 3W99A 5GT0B 1TZYA 5AV5A 4DRAA 3REKA 3AZMB 1S32D 5AY8B 1AOIB 4JJNA 3C1CB 3MGPD 5B1MC 3REID 2PYOD 3W97D 3WAAC 1R4VA 2HIOD 5B33A 5AV8A 3MGQD 3AZKD 3AZJC 2BYKA 3NQUA 3C1BC 5DNMB 1P3MB 2NQBD 3REJB 1EQZC 3H0RC 3VH6W 3LZ0D 3UT9B 3AV1A 5BO0A 3KWQD 4J8WC 2PYOA 3KUYD 2HIOA 3MGQA 1P3BB 4H9RB 2Y2OA 3UTBD 5F99D 3X1SB 3WA9C 2JSSA 3VH5T 5CPKB 2AROB 3W96D 5DNNB 5B31D 2NZDA 5GSUC 5GT3C 1ZLAD 5F99A 3EG5B 5AVCC 1HQ3C 3B0DC 4Z66C 5CP6C 4G92B 3B6FB 4J8VA 3UTAC 4YS3C 5GXQA 3AYWC 1P3OB 3V9RB 5AV9B 4J8XB 1P34D 4KUDC 1P3AB 3WTPC 4Z5TB 5B2ID 4HGAC 3F6TA 1U35D 2Y2GA 3AFAD 5B40B 3B6GB 4WZSB 3KXBC 3AZEB 5B0ZD 3LZ1C 4DQYB 3WKJD 3REJC 5B2JD 1U35A 1M18C 3UT9C 3AZLC 4XUJA 5B0YB 4KGCD 3KSYA 3WKJA 5AV6D 3O62A 4YM6D 4LD9C 1F66A 5JRGC 4H9OB 4QLCC 3AZIA 4ZUXB 4WU8D 3TU4D 1TZYC 4EO5B 3REKC 1P3LB 1P3GD 4JJNC 3AZFB 3MVDA 5CPID 4XZQB 3LELD 4G92C 5FUGA 3TU4A 2Y2MA 3VH6T 5B24D 1BH9B 3X1UB 2BG1A 5AV8C 5B33C 1P3OC 1N1JB 3MGSB 5AV9C 3MNNA 4Z5TC 3REHD 4Z2MH 1P3KD 1ID3D 3AV1C 2FFFB 2IO5C 2Y2HA 5B1LD 3R45B 3X1VD 1T3UA 3RELD 3X1TA 1TAFB 1P3KA 1M19B 5BNXB 3AZGA 4DRBA 4NE3A 3WAAB 2NZDC 3AZJB 3C1BB 3MGRA 4R8PD 5CPJB 1EQZB 4NE5A 2Y2JA 2F8NA 2CV5A 3A6NA 3AV2D 1ULYA 1P3IA 5AVBB 1KX5A 4R8PA 4J8VC 4ZUXC 1A7WA 5GXQC 3VH5A 1M1AB 5GT0D 1JFIB 3AZMD 1P3FA 5AY8D 1AOID 2UWXA 2FJ7A 1Q9CA 3C1CD 5GT3B 4ZBJB 3WTPE 3AZNA 3AZHA 1KX4A 3NQJA 1KX3A 5AVCB 1HQ3B 5E5AC 1F1EA 4Z66B 3AZMA 5DNMD 4WU9D 1P3MD 4WNNB 3UTAB 3AYWB 2BYMB 1P3PB 5BS7A 4KUDB 3WTPB 4HGAB 1P3BD 4XUJC 4WU9A 4NFTA 3X1SD 3B0BA 3O62C 1M19C 3AN2B 5B32B 1F66C 5CPKD 2AROD 3KXBB 5DNND 3AZIC 1S32A 3LZ1B 5CPJC 3B0CW 1M18B 3MGPA 5KDMA 3REIA 3W97A 3MVDC 3AZLB 2G5IC 3LJAD 3B6FD 5AVBC 3AZKA 4UUZA 2NQBA 4H9NB 4LD9B 4J8XD 1M1AC 1P3AD 3LZ0A 5JRGB 3MNNC 1PZRA 3KWQA 4QLCB 4X23D 3LJAA 3KUYA 1BFMA 2F2AC 3W99B 4ZBJC 5B40D 1TZYB 5AV5B 3REKB 3UTBA 3B6GD 4H9SC 4JJNB 3AZED 5BT1C 3W96A 3X1TC 4X23A 5B31A 3VH6A 3AZGC 3H0LC 5B33B 5AV8B 4WV4B 1ZLAA 2BYKB 3NQUB 1BH8A 3MGRC 1P3PC 1B67A 5B0YD 2CV5C 2F8NG 3AV1B 5BO0B 2IO5B 2PYOB 3A6NC 1P3IC 5G49A 2Y2NA 5B32C 2HUEC 2HIOB 4E45A 3MGQB 5B32G 3AN2C 2DQNC 1P34A 1KX5C 2Y2QA 4ZUXD 2YFVA 5B2IA 2W8SA 5B0YA 1H3OA 2F8NK 3AFAA 1P3LD 2NZDB 2FJ7C 3AZFD 2RVQD 3AZNC 3AZHC 4XZQD 1KX4C 5F99B 5B0ZA 1KX3C 3X1UD 5B2JA 4J8UD 3W98D 3MGSD 4J8VB 5GXQB 3W99C 5BS7C 4KGCA 5AV5C 5AV6A 4J8UA 3W98A 4YM6A 4H9PA 5B1MD 3B0CT 5E5AB 4WU8A 3WAAD 3AZJD 3C1BD 1S32C 4CAYA 2CWEA 2RIQA 1EQZD 1P3GA 1U35B 5CPIA 5B1MA 3MGPC 2ZM5A 4J8WD 3REIC 3LELA 2PYOC 3AL0C 3W97C 5B24A 2HIOC 4XUJB 3MGQC 3AZKC 3WKJB 2YFWA 3WA9D 2NQBC 3O62B 3REHA 3IP4C 4H9QA 1F66B 5C3IC 1ID3A 3LZ0C 4J8WA 3KWQC 5GSUD 3AZIB 5B1LA 5GT3D 3KUYC 3X1VA 3RELA 4E44A 3WA9A 5AVCD 1HQ3D 5F99C 3UTBC 4KHAA 5JA4A 4Z66D 3MVDB 3W96C 5CP6D 5GSUA 5B31C 3EPHA 5B31G 5FUGB 3UTAD 4YS3D 3TU4B 3AYWD 1ZLAC 4KUDD 5BNVA 3WTPD 4CSRA 3MNNB 2Y2KA 3AV2A 5CP6A 2XD1A 3EPJA 3P5JB 4YS3A 5B32D 3KXBD 5GT0A 1P34C 3EPLA 3X1TB 5AY8A 3LZ1D 1P3KB 1AOIA 5B2IC 3REJD 3AZGB 4AWLC 3C1CA 1M18D 1U35C 2ZY3A 3AFAC 3UT9D 3MGRB 3A1IA 3AZLD 3EPKA 2F8NB 5DNMA 5B0ZC 2CV5B 1P3MA 3REJA 3WKJC 3A6NB 5B2JC 4LD9D 1P3IB 2HUEB 5JRGD 3UT9A 4QLCD 1KX5B 4R8PB 1P3BA 1TZYD 4H9RA 3REKD 2L5AA 1P3FB 3X1SA 4KGCC 1WWSA 5AV6C 2FJ7B 4JJND 4YM6C 1W2EA 2AROA 1WWIA 3AZHB 3AZNB 5CPKA 4QLCA 5DNNA 1KX4B 3NQJB 1KX3B 4WU8C 3TU4C 5B33D 5AV8D 4G91B 1P3OD 2Y2LA 5AV9D 4Z5TD 1P3GC 5CPIC 2J8PA 3AV1D 3B6FA 3LELC 2F8NH 5B24C 1P3OA 3V9RA 5AV9A 4J8XA 4WU9B 1P3AA 4Z5TA 1P3KC 3REHC 1ID3C 5B40A 2NZDD 1S32B 5B1LC 3B6GA 4M6BA 3X1VC 3RELC 3AZEA 3MGPB 5KDMB 3REIB 3W97B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZK B;  4UUZ B;  4J8V D;  4R8P C;  2NQB B;  5GXQ D;  5C3I B;  3LZ0 B;  1P3F C;  3KWQ B;  3AV2 C;  3LJA B;  3KUY B;  4H9O A;  4ZUX A;  3UTB B;  5E5A D;  5GT0 C;  4G91 C;  3AZM C;  3W96 B;  5AY8 C;  1AOI C;  1P3L A;  4X23 B;  5B31 B;  3AZF A;  3C1C C;  4XZQ A;  1ZLA B;  1BH8 B;  5E5A A;  1BH9 A;  3X1U A;  4XUJ D;  1N1J A;  5DNM C;  3MGS A;  4WU9 C;  1KU5 A;  1P3M C;  3O62 D;  1M19 D;  1F66 D;  5G49 B;  1P34 B;  3AZI D;  2YFV B;  3R45 A;  5B2I B;  5CPJ D;  4AWL B;  1P3B C;  1H3O B;  3X1S C;  1TAF A;  3AFA B;  1M19 A;  5BNX A;  3MVD D;  1B6W A;  2LY8 A;  5CPK C;  2ARO C;  3WAA A;  5DNN C;  5AVB D;  3AZJ A;  3C1B A;  5B0Z B;  5CPJ A;  1EQZ A;  5B2J B;  1M1A D;  4NE6 A;  3MNN D;  3LJA C;  5AVB A;  3B6F C;  4KGC B;  5AV6 B;  4J8U B;  1M1A A;  4YM6 B;  4J8X C;  1JFI A;  5BT1 D;  3X1T D;  1P3A C;  3W98 B;  4H9P B;  3AZG D;  4X23 C;  5GT3 A;  4WU8 B;  5B40 C;  3VH5 W;  3MGR D;  4CAY B;  1P3P D;  5AVC A;  1HQ3 A;  3B6G C;  4H9S A;  1P3G B;  4Z66 A;  2F8N D;  3AZE C;  5CPI B;  5B1M B;  2CV5 D;  4WNN A;  3A6N D;  3LEL B;  3UTA A;  1P3I D;  3AN2 D;  5B24 B;  3AYW A;  2BYM A;  1P3P A;  4Z2M G;  1KX5 D;  4KUD A;  5CHL B;  3WTP A;  2YFW B;  3REH B;  4H9Q B;  5B0Y C;  1P3F D;  1ID3 B;  4J8W B;  2FJ7 D;  3AN2 A;  5B32 A;  5B1L B;  3AZN D;  3KXB A;  3AZH D;  1KX4 D;  3X1V B;  3REL B;  1KX3 D;  3WA9 B;  4KHA B;  5JA4 B;  3LZ1 A;  1M18 A;  4EO5 C;  5GSU B;  1P3L C;  3AZF C;  2RVQ C;  3AZL A;  4XZQ C;  3W99 D;  5BNV B;  4CSR B;  3B0D B;  5AV5 D;  1HTA A;  3X1U C;  4H9N A;  3AV2 B;  4LD9 A;  4J8U C;  5CP6 B;  3W98 C;  3MGS C;  5JRG A;  4YS3 B;  3W99 A;  5GT0 B;  1TZY A;  5AV5 A;  4DRA A;  3REK A;  3AZM B;  1S32 D;  5AY8 B;  1AOI B;  4JJN A;  3C1C B;  3MGP D;  5B1M C;  3REI D;  2PYO D;  3W97 D;  3WAA C;  1R4V A;  2HIO D;  5B33 A;  5AV8 A;  3MGQ D;  3AZK D;  3AZJ C;  2BYK A;  3NQU A;  3C1B C;  5DNM B;  1P3M B;  2NQB D;  3REJ B;  1EQZ C;  3VH6 W;  3LZ0 D;  3UT9 B;  3AV1 A;  5BO0 A;  3KWQ D;  4J8W C;  2PYO A;  3KUY D;  2HIO A;  3MGQ A;  1P3B B;  4H9R B;  3UTB D;  5F99 D;  3X1S B;  3WA9 C;  2JSS A;  3VH5 T;  5CPK B;  2ARO B;  3W96 D;  5DNN B;  5B31 D;  2NZD A;  5GSU C;  5GT3 C;  1ZLA D;  5F99 A;  5AVC C;  1HQ3 C;  3B0D C;  4Z66 C;  5CP6 C;  4G92 B;  3B6F B;  4J8V A;  3UTA C;  4YS3 C;  5GXQ A;  3AYW C;  1P3O B;  3V9R B;  5AV9 B;  4J8X B;  1P34 D;  4KUD C;  1P3A B;  3WTP C;  4Z5T B;  5B2I D;  4HGA C;  1U35 D;  3AFA D;  5B40 B;  3B6G B;  4WZS B;  3KXB C;  3AZE B;  5B0Z D;  3LZ1 C;  3WKJ D;  3REJ C;  5B2J D;  1U35 A;  1M18 C;  3UT9 C;  3AZL C;  4XUJ A;  5B0Y B;  4KGC D;  3KSY A;  3WKJ A;  5AV6 D;  3O62 A;  4YM6 D;  4LD9 C;  1F66 A;  5JRG C;  4H9O B;  4QLC C;  3AZI A;  4ZUX B;  4WU8 D;  3TU4 D;  1TZY C;  4EO5 B;  3REK C;  1P3L B;  1P3G D;  4JJN C;  3AZF B;  3MVD A;  5CPI D;  4XZQ B;  3LEL D;  4G92 C;  5FUG A;  3TU4 A;  3VH6 T;  5B24 D;  1BH9 B;  3X1U B;  5AV8 C;  5B33 C;  1P3O C;  1N1J B;  3MGS B;  5AV9 C;  3MNN A;  4Z5T C;  3REH D;  4Z2M H;  1P3K D;  1ID3 D;  3AV1 C;  2IO5 C;  5B1L D;  3R45 B;  3X1V D;  3REL D;  3X1T A;  1TAF B;  1P3K A;  1M19 B;  5BNX B;  3AZG A;  4DRB A;  4NE3 A;  3WAA B;  2NZD C;  3AZJ B;  3C1B B;  3MGR A;  4R8P D;  5CPJ B;  1EQZ B;  4NE5 A;  2F8N A;  2CV5 A;  3A6N A;  3AV2 D;  1ULY A;  1P3I A;  5AVB B;  1KX5 A;  4R8P A;  4J8V C;  4ZUX C;  1A7W A;  5GXQ C;  3VH5 A;  1M1A B;  5GT0 D;  1JFI B;  3AZM D;  1P3F A;  5AY8 D;  1AOI D;  2FJ7 A;  1Q9C A;  3C1C D;  5GT3 B;  4ZBJ B;  3WTP E;  3AZN A;  3AZH A;  1KX4 A;  3NQJ A;  1KX3 A;  5AVC B;  1HQ3 B;  5E5A C;  1F1E A;  4Z66 B;  3AZM A;  5DNM D;  4WU9 D;  1P3M D;  4WNN B;  3UTA B;  3AYW B;  2BYM B;  1P3P B;  5BS7 A;  4KUD B;  3WTP B;  4HGA B;  1P3B D;  4XUJ C;  4WU9 A;  4NFT A;  3X1S D;  3B0B A;  3O62 C;  1M19 C;  3AN2 B;  5B32 B;  1F66 C;  5CPK D;  2ARO D;  3KXB B;  5DNN D;  3AZI C;  1S32 A;  3LZ1 B;  5CPJ C;  3B0C W;  1M18 B;  3MGP A;  5KDM A;  3REI A;  3W97 A;  3MVD C;  3AZL B;  3LJA D;  3B6F D;  5AVB C;  3AZK A;  4UUZ A;  2NQB A;  4H9N B;  4LD9 B;  4J8X D;  1M1A C;  1P3A D;  3LZ0 A;  5JRG B;  3MNN C;  3KWQ A;  4QLC B;  4X23 D;  3LJA A;  3KUY A;  1BFM A;  3W99 B;  4ZBJ C;  5B40 D;  1TZY B;  5AV5 B;  3REK B;  3UTB A;  3B6G D;  4H9S C;  4JJN B;  3AZE D;  5BT1 C;  3W96 A;  3X1T C;  4X23 A;  5B31 A;  3VH6 A;  3AZG C;  5B33 B;  5AV8 B;  4WV4 B;  1ZLA A;  2BYK B;  3NQU B;  1BH8 A;  3MGR C;  1P3P C;  1B67 A;  5B0Y D;  2CV5 C;  2F8N G;  3AV1 B;  5BO0 B;  2IO5 B;  2PYO B;  3A6N C;  1P3I C;  5G49 A;  2HUE C;  2HIO B;  4E45 A;  5B32 C;  3MGQ B;  3AN2 C;  5B32 G;  1P34 A;  1KX5 C;  4ZUX D;  2YFV A;  5B2I A;  5B0Y A;  1H3O A;  2F8N K;  3AFA A;  1P3L D;  2NZD B;  2FJ7 C;  3AZF D;  2RVQ D;  3AZN C;  3AZH C;  4XZQ D;  1KX4 C;  5F99 B;  5B0Z A;  1KX3 C;  3X1U D;  5B2J A;  4J8U D;  3W98 D;  3MGS D;  4J8V B;  5GXQ B;  3W99 C;  5BS7 C;  4KGC A;  5AV5 C;  5AV6 A;  4J8U A;  3W98 A;  4YM6 A;  4H9P A;  5B1M D;  3B0C T;  5E5A B;  4WU8 A;  3WAA D;  3AZJ D;  3C1B D;  1S32 C;  4CAY A;  2CWE A;  1EQZ D;  1P3G A;  1U35 B;  5CPI A;  5B1M A;  3MGP C;  4J8W D;  3REI C;  2PYO C;  3LEL A;  3W97 C;  5B24 A;  2HIO C;  4XUJ B;  3MGQ C;  3AZK C;  3WKJ B;  2YFW A;  3WA9 D;  2NQB C;  3O62 B;  3REH A;  4H9Q A;  1F66 B;  5C3I C;  1ID3 A;  3LZ0 C;  4J8W A;  3KWQ C;  5GSU D;  3AZI B;  5B1L A;  5GT3 D;  3KUY C;  3X1V A;  3REL A;  4E44 A;  3WA9 A;  5AVC D;  1HQ3 D;  5F99 C;  3UTB C;  4KHA A;  5JA4 A;  4Z66 D;  3MVD B;  3W96 C;  5CP6 D;  5GSU A;  5B31 C;  5B31 G;  5FUG B;  3UTA D;  4YS3 D;  3TU4 B;  3AYW D;  1ZLA C;  4KUD D;  5BNV A;  3WTP D;  4CSR A;  3MNN B;  3AV2 A;  5CP6 A;  4YS3 A;  5B32 D;  3KXB D;  5GT0 A;  1P34 C;  3X1T B;  5AY8 A;  3LZ1 D;  1P3K B;  1AOI A;  5B2I C;  3REJ D;  3AZG B;  4AWL C;  3C1C A;  1M18 D;  1U35 C;  3AFA C;  3UT9 D;  3MGR B;  3AZL D;  2F8N B;  5DNM A;  5B0Z C;  2CV5 B;  1P3M A;  3REJ A;  3WKJ C;  3A6N B;  5B2J C;  4LD9 D;  1P3I B;  2HUE B;  5JRG D;  3UT9 A;  4QLC D;  1KX5 B;  4R8P B;  1P3B A;  1TZY D;  4H9R A;  3REK D;  2L5A A;  1P3F B;  3X1S A;  4KGC C;  1WWS A;  5AV6 C;  2FJ7 B;  4JJN D;  4YM6 C;  3AZN B;  2ARO A;  1WWI A;  3AZH B;  5CPK A;  1KX4 B;  4QLC A;  5DNN A;  3NQJ B;  1KX3 B;  4WU8 C;  3TU4 C;  5B33 D;  4G91 B;  5AV8 D;  1P3O D;  5AV9 D;  4Z5T D;  1P3G C;  5CPI C;  3AV1 D;  3B6F A;  3LEL C;  2F8N H;  5B24 C;  1P3O A;  3V9R A;  5AV9 A;  4J8X A;  4WU9 B;  1P3A A;  4Z5T A;  1P3K C;  3REH C;  1ID3 C;  5B40 A;  2NZD D;  1S32 B;  5B1L C;  3B6G A;  4M6B A;  3X1V C;  3REL C;  3AZE A;  3MGP B;  5KDM B;  3REI B;  3W97 B; 
#chains in the Genus database with same CATH topology
 3AZK B;  4UUZ B;  4J8V D;  4R8P C;  2NQB B;  5GXQ D;  1Z2C B;  5C3I B;  3LZ0 B;  1P3F C;  3KWQ B;  3AV2 C;  3LJA B;  3KUY B;  4H9O A;  4ZUX A;  3UTB B;  5E5A D;  2G5H C;  5GT0 C;  4G91 C;  3AZM C;  3W96 B;  3KFU G;  5AY8 C;  1AOI C;  1P3L A;  4X23 B;  5B31 B;  3A1K A;  3AZF A;  3C1C C;  4XZQ A;  1ZLA B;  1BH8 B;  5E5A A;  1BH9 A;  3X1U A;  4XUJ D;  1N1J A;  5DNM C;  3MGS A;  4WU9 C;  1KU5 A;  1P3M C;  3O62 D;  1M19 D;  1F66 D;  5G49 B;  1P34 B;  3AZI D;  2Y2I A;  2YFV B;  3R45 A;  5B2I B;  5CPJ D;  4AWL B;  1P3B C;  1H3O B;  3X1S C;  1TAF A;  3AFA B;  1M19 A;  5BNX A;  3MVD D;  1B6W A;  2LY8 A;  5CPK C;  2ARO C;  3WAA A;  5DNN C;  5AVB D;  3AZJ A;  3C1B A;  5B0Z B;  5CPJ A;  1EQZ A;  5B2J B;  1M1A D;  4NE6 A;  4UPK A;  3MNN D;  2XD5 A;  3LJA C;  5AVB A;  3B6F C;  4KGC B;  5AV6 B;  4J8U B;  1M1A A;  4YM6 B;  4J8X C;  1JFI A;  5BT1 D;  3X1T D;  2ZY2 A;  1P3A C;  3W98 B;  4H9P B;  3AZG D;  4X23 C;  2VQR A;  5GT3 A;  4WU8 B;  5B40 C;  3VH5 W;  3MGR D;  4CAY B;  1P3P D;  2JE5 A;  1HQ3 A;  5AVC A;  3B6G C;  4H9S A;  1P3G B;  4Z66 A;  2F8N D;  4WJ3 C;  3AZE C;  5CPI B;  2DF4 C;  5B1M B;  2CV5 D;  4WNN A;  3A6N D;  3LEL B;  2Y2P A;  3UTA A;  1P3I D;  3AN2 D;  5B24 B;  3AYW A;  2BYM A;  1P3P A;  4Z2M G;  1KX5 D;  4KUD A;  5CHL B;  3WTP A;  2YFW B;  2JCH A;  3REH B;  4H9Q B;  5B0Y C;  1P3F D;  1ID3 B;  4J8W B;  2FJ7 D;  3AN2 A;  5B32 A;  5B1L B;  3AZN D;  3KXB A;  3AZH D;  1KX4 D;  3X1V B;  3REL B;  1KX3 D;  3WA9 B;  4KHA B;  5JA4 B;  3LZ1 A;  1M18 A;  4EO5 C;  5GSU B;  1P3L C;  3AZF C;  2RVQ C;  3AZL A;  2ZY5 A;  4XZQ C;  3W99 D;  5BNV B;  4CSR B;  3B0D B;  5AV5 D;  1HTA A;  3X1U C;  4H9N A;  3AV2 B;  4LD9 A;  4J8U C;  5CP6 B;  3FDD A;  3H0M C;  3MGS C;  3W98 C;  5JRG A;  4YS3 B;  2ZY4 A;  3W99 A;  5GT0 B;  1TZY A;  5AV5 A;  4DRA A;  3REK A;  3AZM B;  1S32 D;  5AY8 B;  1AOI B;  4JJN A;  3C1C B;  3MGP D;  5B1M C;  3REI D;  2PYO D;  3W97 D;  3WAA C;  1R4V A;  2HIO D;  5B33 A;  5AV8 A;  3MGQ D;  3AZK D;  3AZJ C;  2BYK A;  3NQU A;  3C1B C;  5DNM B;  1P3M B;  2NQB D;  3REJ B;  1EQZ C;  3H0R C;  3VH6 W;  3LZ0 D;  3UT9 B;  3AV1 A;  5BO0 A;  3KWQ D;  4J8W C;  2PYO A;  3KUY D;  2HIO A;  3MGQ A;  1P3B B;  4H9R B;  2Y2O A;  3UTB D;  5F99 D;  3X1S B;  3WA9 C;  2JSS A;  3VH5 T;  5CPK B;  2ARO B;  3W96 D;  5DNN B;  5B31 D;  2NZD A;  5GSU C;  5GT3 C;  1ZLA D;  5F99 A;  3EG5 B;  5AVC C;  1HQ3 C;  3B0D C;  4Z66 C;  5CP6 C;  4G92 B;  3B6F B;  4J8V A;  3UTA C;  4YS3 C;  5GXQ A;  3AYW C;  1P3O B;  3V9R B;  5AV9 B;  4J8X B;  1P34 D;  4KUD C;  1P3A B;  3WTP C;  4Z5T B;  5B2I D;  4HGA C;  3F6T A;  1U35 D;  2Y2G A;  3AFA D;  5B40 B;  3B6G B;  4WZS B;  3KXB C;  3AZE B;  5B0Z D;  3LZ1 C;  4DQY B;  3WKJ D;  3REJ C;  5B2J D;  1U35 A;  1M18 C;  3UT9 C;  3AZL C;  4XUJ A;  5B0Y B;  4KGC D;  3KSY A;  3WKJ A;  5AV6 D;  3O62 A;  4YM6 D;  4LD9 C;  1F66 A;  5JRG C;  4H9O B;  4QLC C;  3AZI A;  4ZUX B;  4WU8 D;  3TU4 D;  1TZY C;  4EO5 B;  3REK C;  1P3L B;  1P3G D;  4JJN C;  3AZF B;  3MVD A;  5CPI D;  4XZQ B;  3LEL D;  4G92 C;  5FUG A;  3TU4 A;  2Y2M A;  3VH6 T;  5B24 D;  1BH9 B;  3X1U B;  2BG1 A;  5AV8 C;  5B33 C;  1P3O C;  1N1J B;  3MGS B;  5AV9 C;  3MNN A;  4Z5T C;  3REH D;  4Z2M H;  1P3K D;  1ID3 D;  3AV1 C;  2FFF B;  2IO5 C;  2Y2H A;  5B1L D;  3R45 B;  3X1V D;  1T3U A;  3REL D;  3X1T A;  1TAF B;  1P3K A;  1M19 B;  5BNX B;  3AZG A;  4DRB A;  4NE3 A;  3WAA B;  2NZD C;  3AZJ B;  3C1B B;  3MGR A;  4R8P D;  5CPJ B;  1EQZ B;  4NE5 A;  2Y2J A;  2F8N A;  2CV5 A;  3A6N A;  3AV2 D;  1ULY A;  1P3I A;  5AVB B;  1KX5 A;  4R8P A;  4J8V C;  4ZUX C;  1A7W A;  5GXQ C;  3VH5 A;  1M1A B;  5GT0 D;  1JFI B;  3AZM D;  1P3F A;  5AY8 D;  1AOI D;  2UWX A;  2FJ7 A;  1Q9C A;  3C1C D;  5GT3 B;  4ZBJ B;  3WTP E;  3AZN A;  3AZH A;  1KX4 A;  3NQJ A;  1KX3 A;  5AVC B;  1HQ3 B;  5E5A C;  1F1E A;  4Z66 B;  3AZM A;  5DNM D;  4WU9 D;  1P3M D;  4WNN B;  3UTA B;  3AYW B;  2BYM B;  1P3P B;  5BS7 A;  4KUD B;  3WTP B;  4HGA B;  1P3B D;  4XUJ C;  4WU9 A;  4NFT A;  3X1S D;  3B0B A;  3O62 C;  1M19 C;  3AN2 B;  5B32 B;  1F66 C;  5CPK D;  2ARO D;  3KXB B;  5DNN D;  3AZI C;  1S32 A;  3LZ1 B;  5CPJ C;  3B0C W;  1M18 B;  3MGP A;  5KDM A;  3REI A;  3W97 A;  3MVD C;  3AZL B;  2G5I C;  3LJA D;  3B6F D;  5AVB C;  3AZK A;  4UUZ A;  2NQB A;  4H9N B;  4LD9 B;  4J8X D;  1M1A C;  1P3A D;  3LZ0 A;  5JRG B;  3MNN C;  1PZR A;  3KWQ A;  4QLC B;  4X23 D;  3LJA A;  3KUY A;  1BFM A;  2F2A C;  3W99 B;  4ZBJ C;  5B40 D;  1TZY B;  5AV5 B;  3REK B;  3UTB A;  3B6G D;  4H9S C;  4JJN B;  3AZE D;  5BT1 C;  3W96 A;  3X1T C;  4X23 A;  5B31 A;  3VH6 A;  3AZG C;  3H0L C;  5B33 B;  5AV8 B;  4WV4 B;  1ZLA A;  2BYK B;  3NQU B;  1BH8 A;  3MGR C;  1P3P C;  1B67 A;  5B0Y D;  2CV5 C;  2F8N G;  3AV1 B;  5BO0 B;  2IO5 B;  2PYO B;  3A6N C;  1P3I C;  5G49 A;  2Y2N A;  5B32 C;  2HUE C;  2HIO B;  4E45 A;  3MGQ B;  5B32 G;  3AN2 C;  2DQN C;  1P34 A;  1KX5 C;  2Y2Q A;  4ZUX D;  2YFV A;  5B2I A;  2W8S A;  5B0Y A;  1H3O A;  2F8N K;  3AFA A;  1P3L D;  2NZD B;  2FJ7 C;  3AZF D;  2RVQ D;  3AZN C;  3AZH C;  4XZQ D;  1KX4 C;  5F99 B;  5B0Z A;  1KX3 C;  3X1U D;  5B2J A;  4J8U D;  3W98 D;  3MGS D;  4J8V B;  5GXQ B;  3W99 C;  5BS7 C;  4KGC A;  5AV5 C;  5AV6 A;  4J8U A;  3W98 A;  4YM6 A;  4H9P A;  5B1M D;  3B0C T;  5E5A B;  4WU8 A;  3WAA D;  3AZJ D;  3C1B D;  1S32 C;  4CAY A;  2CWE A;  2RIQ A;  1EQZ D;  1P3G A;  1U35 B;  5CPI A;  5B1M A;  3MGP C;  2ZM5 A;  4J8W D;  3REI C;  3LEL A;  2PYO C;  3AL0 C;  3W97 C;  5B24 A;  2HIO C;  4XUJ B;  3MGQ C;  3AZK C;  3WKJ B;  2YFW A;  3WA9 D;  2NQB C;  3O62 B;  3REH A;  3IP4 C;  4H9Q A;  1F66 B;  5C3I C;  1ID3 A;  3LZ0 C;  4J8W A;  3KWQ C;  5GSU D;  3AZI B;  5B1L A;  5GT3 D;  3KUY C;  3X1V A;  3REL A;  4E44 A;  3WA9 A;  5AVC D;  1HQ3 D;  5F99 C;  3UTB C;  4KHA A;  5JA4 A;  4Z66 D;  3MVD B;  3W96 C;  5CP6 D;  5GSU A;  5B31 C;  3EPH A;  5B31 G;  5FUG B;  3UTA D;  4YS3 D;  3TU4 B;  3AYW D;  1ZLA C;  4KUD D;  5BNV A;  3WTP D;  4CSR A;  3MNN B;  2Y2K A;  3AV2 A;  5CP6 A;  2XD1 A;  3EPJ A;  3P5J B;  4YS3 A;  5B32 D;  3KXB D;  5GT0 A;  1P34 C;  3EPL A;  3X1T B;  5AY8 A;  3LZ1 D;  1P3K B;  1AOI A;  5B2I C;  3REJ D;  3AZG B;  4AWL C;  3C1C A;  1M18 D;  1U35 C;  2ZY3 A;  3AFA C;  3UT9 D;  3MGR B;  3A1I A;  3AZL D;  3EPK A;  2F8N B;  5DNM A;  5B0Z C;  2CV5 B;  1P3M A;  3REJ A;  3WKJ C;  3A6N B;  5B2J C;  4LD9 D;  1P3I B;  2HUE B;  5JRG D;  3UT9 A;  4QLC D;  1KX5 B;  4R8P B;  1P3B A;  1TZY D;  4H9R A;  3REK D;  2L5A A;  1P3F B;  3X1S A;  4KGC C;  1WWS A;  5AV6 C;  2FJ7 B;  4JJN D;  4YM6 C;  1W2E A;  2ARO A;  1WWI A;  3AZH B;  3AZN B;  5CPK A;  4QLC A;  5DNN A;  1KX4 B;  3NQJ B;  1KX3 B;  4WU8 C;  3TU4 C;  5B33 D;  5AV8 D;  4G91 B;  1P3O D;  2Y2L A;  5AV9 D;  4Z5T D;  1P3G C;  5CPI C;  2J8P A;  3AV1 D;  3B6F A;  3LEL C;  2F8N H;  5B24 C;  1P3O A;  3V9R A;  5AV9 A;  4J8X A;  4WU9 B;  1P3A A;  4Z5T A;  1P3K C;  3REH C;  1ID3 C;  5B40 A;  2NZD D;  1S32 B;  5B1L C;  3B6G A;  4M6B A;  3X1V C;  3REL C;  3AZE A;  3MGP B;  5KDM B;  3REI B;  3W97 B; 
#chains in the Genus database with same CATH homology
 3AZK B;  4UUZ B;  4J8V D;  4R8P C;  2NQB B;  5GXQ D;  1Z2C B;  5C3I B;  3LZ0 B;  1P3F C;  3KWQ B;  3AV2 C;  3LJA B;  3KUY B;  4H9O A;  4ZUX A;  3UTB B;  5E5A D;  2G5H C;  5GT0 C;  4G91 C;  3AZM C;  3W96 B;  3KFU G;  5AY8 C;  1AOI C;  1P3L A;  4X23 B;  5B31 B;  3A1K A;  3AZF A;  3C1C C;  4XZQ A;  1ZLA B;  1BH8 B;  5E5A A;  1BH9 A;  3X1U A;  4XUJ D;  1N1J A;  5DNM C;  3MGS A;  4WU9 C;  1KU5 A;  1P3M C;  3O62 D;  1M19 D;  1F66 D;  5G49 B;  1P34 B;  3AZI D;  2Y2I A;  2YFV B;  3R45 A;  5B2I B;  5CPJ D;  4AWL B;  1P3B C;  1H3O B;  3X1S C;  1TAF A;  3AFA B;  1M19 A;  5BNX A;  3MVD D;  1B6W A;  2LY8 A;  5CPK C;  2ARO C;  3WAA A;  5DNN C;  5AVB D;  3AZJ A;  3C1B A;  5B0Z B;  5CPJ A;  1EQZ A;  5B2J B;  1M1A D;  4NE6 A;  4UPK A;  3MNN D;  2XD5 A;  3LJA C;  5AVB A;  3B6F C;  4KGC B;  5AV6 B;  4J8U B;  1M1A A;  4YM6 B;  4J8X C;  1JFI A;  5BT1 D;  3X1T D;  2ZY2 A;  1P3A C;  3W98 B;  4H9P B;  3AZG D;  4X23 C;  2VQR A;  5GT3 A;  4WU8 B;  5B40 C;  3VH5 W;  3MGR D;  4CAY B;  1P3P D;  2JE5 A;  1HQ3 A;  5AVC A;  3B6G C;  4H9S A;  1P3G B;  4Z66 A;  2F8N D;  4WJ3 C;  3AZE C;  5CPI B;  2DF4 C;  5B1M B;  2CV5 D;  4WNN A;  3A6N D;  3LEL B;  2Y2P A;  3UTA A;  1P3I D;  3AN2 D;  5B24 B;  3AYW A;  2BYM A;  1P3P A;  4Z2M G;  1KX5 D;  4KUD A;  5CHL B;  3WTP A;  2YFW B;  2JCH A;  3REH B;  4H9Q B;  5B0Y C;  1P3F D;  1ID3 B;  4J8W B;  2FJ7 D;  3AN2 A;  5B32 A;  5B1L B;  3AZN D;  3KXB A;  3AZH D;  1KX4 D;  3X1V B;  3REL B;  1KX3 D;  3WA9 B;  4KHA B;  5JA4 B;  3LZ1 A;  1M18 A;  4EO5 C;  5GSU B;  1P3L C;  3AZF C;  2RVQ C;  3AZL A;  2ZY5 A;  4XZQ C;  3W99 D;  5BNV B;  4CSR B;  3B0D B;  5AV5 D;  1HTA A;  3X1U C;  4H9N A;  3AV2 B;  4LD9 A;  4J8U C;  5CP6 B;  3FDD A;  3H0M C;  3MGS C;  3W98 C;  5JRG A;  4YS3 B;  2ZY4 A;  3W99 A;  5GT0 B;  1TZY A;  5AV5 A;  4DRA A;  3REK A;  3AZM B;  1S32 D;  5AY8 B;  1AOI B;  4JJN A;  3C1C B;  3MGP D;  5B1M C;  3REI D;  2PYO D;  3W97 D;  3WAA C;  1R4V A;  2HIO D;  5B33 A;  5AV8 A;  3MGQ D;  3AZK D;  3AZJ C;  2BYK A;  3NQU A;  3C1B C;  5DNM B;  1P3M B;  2NQB D;  3REJ B;  1EQZ C;  3H0R C;  3VH6 W;  3LZ0 D;  3UT9 B;  3AV1 A;  5BO0 A;  3KWQ D;  4J8W C;  2PYO A;  3KUY D;  2HIO A;  3MGQ A;  1P3B B;  4H9R B;  2Y2O A;  3UTB D;  5F99 D;  3X1S B;  3WA9 C;  2JSS A;  3VH5 T;  5CPK B;  2ARO B;  3W96 D;  5DNN B;  5B31 D;  2NZD A;  5GSU C;  5GT3 C;  1ZLA D;  5F99 A;  3EG5 B;  5AVC C;  1HQ3 C;  3B0D C;  4Z66 C;  5CP6 C;  4G92 B;  3B6F B;  4J8V A;  3UTA C;  4YS3 C;  5GXQ A;  3AYW C;  1P3O B;  3V9R B;  5AV9 B;  4J8X B;  1P34 D;  4KUD C;  1P3A B;  3WTP C;  4Z5T B;  5B2I D;  4HGA C;  3F6T A;  1U35 D;  2Y2G A;  3AFA D;  5B40 B;  3B6G B;  4WZS B;  3KXB C;  3AZE B;  5B0Z D;  3LZ1 C;  4DQY B;  3WKJ D;  3REJ C;  5B2J D;  1U35 A;  1M18 C;  3UT9 C;  3AZL C;  4XUJ A;  5B0Y B;  4KGC D;  3KSY A;  3WKJ A;  5AV6 D;  3O62 A;  4YM6 D;  4LD9 C;  1F66 A;  5JRG C;  4H9O B;  4QLC C;  3AZI A;  4ZUX B;  4WU8 D;  3TU4 D;  1TZY C;  4EO5 B;  3REK C;  1P3L B;  1P3G D;  4JJN C;  3AZF B;  3MVD A;  5CPI D;  4XZQ B;  3LEL D;  4G92 C;  5FUG A;  3TU4 A;  2Y2M A;  3VH6 T;  5B24 D;  1BH9 B;  3X1U B;  2BG1 A;  5AV8 C;  5B33 C;  1P3O C;  1N1J B;  3MGS B;  5AV9 C;  3MNN A;  4Z5T C;  3REH D;  4Z2M H;  1P3K D;  1ID3 D;  3AV1 C;  2FFF B;  2IO5 C;  2Y2H A;  5B1L D;  3R45 B;  3X1V D;  1T3U A;  3REL D;  3X1T A;  1TAF B;  1P3K A;  1M19 B;  5BNX B;  3AZG A;  4DRB A;  4NE3 A;  3WAA B;  2NZD C;  3AZJ B;  3C1B B;  3MGR A;  4R8P D;  5CPJ B;  1EQZ B;  4NE5 A;  2Y2J A;  2F8N A;  2CV5 A;  3A6N A;  3AV2 D;  1ULY A;  1P3I A;  5AVB B;  1KX5 A;  4R8P A;  4J8V C;  4ZUX C;  1A7W A;  5GXQ C;  3VH5 A;  1M1A B;  5GT0 D;  1JFI B;  3AZM D;  1P3F A;  5AY8 D;  1AOI D;  2UWX A;  2FJ7 A;  1Q9C A;  3C1C D;  5GT3 B;  4ZBJ B;  3WTP E;  3AZN A;  3AZH A;  1KX4 A;  3NQJ A;  1KX3 A;  5AVC B;  1HQ3 B;  5E5A C;  1F1E A;  4Z66 B;  3AZM A;  5DNM D;  4WU9 D;  1P3M D;  4WNN B;  3UTA B;  3AYW B;  2BYM B;  1P3P B;  5BS7 A;  4KUD B;  3WTP B;  4HGA B;  1P3B D;  4XUJ C;  4WU9 A;  4NFT A;  3X1S D;  3B0B A;  3O62 C;  1M19 C;  3AN2 B;  5B32 B;  1F66 C;  5CPK D;  2ARO D;  3KXB B;  5DNN D;  3AZI C;  1S32 A;  3LZ1 B;  5CPJ C;  3B0C W;  1M18 B;  3MGP A;  5KDM A;  3REI A;  3W97 A;  3MVD C;  3AZL B;  2G5I C;  3LJA D;  3B6F D;  5AVB C;  3AZK A;  4UUZ A;  2NQB A;  4H9N B;  4LD9 B;  4J8X D;  1M1A C;  1P3A D;  3LZ0 A;  5JRG B;  3MNN C;  1PZR A;  3KWQ A;  4QLC B;  4X23 D;  3LJA A;  3KUY A;  1BFM A;  2F2A C;  3W99 B;  4ZBJ C;  5B40 D;  1TZY B;  5AV5 B;  3REK B;  3UTB A;  3B6G D;  4H9S C;  4JJN B;  3AZE D;  5BT1 C;  3W96 A;  3X1T C;  4X23 A;  5B31 A;  3VH6 A;  3AZG C;  3H0L C;  5B33 B;  5AV8 B;  4WV4 B;  1ZLA A;  2BYK B;  3NQU B;  1BH8 A;  3MGR C;  1P3P C;  1B67 A;  5B0Y D;  2CV5 C;  2F8N G;  3AV1 B;  5BO0 B;  2IO5 B;  2PYO B;  3A6N C;  1P3I C;  5G49 A;  2Y2N A;  5B32 C;  2HUE C;  2HIO B;  4E45 A;  3MGQ B;  5B32 G;  3AN2 C;  2DQN C;  1P34 A;  1KX5 C;  2Y2Q A;  4ZUX D;  2YFV A;  5B2I A;  2W8S A;  5B0Y A;  1H3O A;  2F8N K;  3AFA A;  1P3L D;  2NZD B;  2FJ7 C;  3AZF D;  2RVQ D;  3AZN C;  3AZH C;  4XZQ D;  1KX4 C;  5F99 B;  5B0Z A;  1KX3 C;  3X1U D;  5B2J A;  4J8U D;  3W98 D;  3MGS D;  4J8V B;  5GXQ B;  3W99 C;  5BS7 C;  4KGC A;  5AV5 C;  5AV6 A;  4J8U A;  3W98 A;  4YM6 A;  4H9P A;  5B1M D;  3B0C T;  5E5A B;  4WU8 A;  3WAA D;  3AZJ D;  3C1B D;  1S32 C;  4CAY A;  2CWE A;  2RIQ A;  1EQZ D;  1P3G A;  1U35 B;  5CPI A;  5B1M A;  3MGP C;  2ZM5 A;  4J8W D;  3REI C;  3LEL A;  2PYO C;  3AL0 C;  3W97 C;  5B24 A;  2HIO C;  4XUJ B;  3MGQ C;  3AZK C;  3WKJ B;  2YFW A;  3WA9 D;  2NQB C;  3O62 B;  3REH A;  3IP4 C;  4H9Q A;  1F66 B;  5C3I C;  1ID3 A;  3LZ0 C;  4J8W A;  3KWQ C;  5GSU D;  3AZI B;  5B1L A;  5GT3 D;  3KUY C;  3X1V A;  3REL A;  4E44 A;  3WA9 A;  5AVC D;  1HQ3 D;  5F99 C;  3UTB C;  4KHA A;  5JA4 A;  4Z66 D;  3MVD B;  3W96 C;  5CP6 D;  5GSU A;  5B31 C;  3EPH A;  5B31 G;  5FUG B;  3UTA D;  4YS3 D;  3TU4 B;  3AYW D;  1ZLA C;  4KUD D;  5BNV A;  3WTP D;  4CSR A;  3MNN B;  2Y2K A;  3AV2 A;  5CP6 A;  2XD1 A;  3EPJ A;  3P5J B;  4YS3 A;  5B32 D;  3KXB D;  5GT0 A;  1P34 C;  3EPL A;  3X1T B;  5AY8 A;  3LZ1 D;  1P3K B;  1AOI A;  5B2I C;  3REJ D;  3AZG B;  4AWL C;  3C1C A;  1M18 D;  1U35 C;  2ZY3 A;  3AFA C;  3UT9 D;  3MGR B;  3A1I A;  3AZL D;  3EPK A;  2F8N B;  5DNM A;  5B0Z C;  2CV5 B;  1P3M A;  3REJ A;  3WKJ C;  3A6N B;  5B2J C;  4LD9 D;  1P3I B;  2HUE B;  5JRG D;  3UT9 A;  4QLC D;  1KX5 B;  4R8P B;  1P3B A;  1TZY D;  4H9R A;  3REK D;  2L5A A;  1P3F B;  3X1S A;  4KGC C;  1WWS A;  5AV6 C;  2FJ7 B;  4JJN D;  4YM6 C;  1W2E A;  2ARO A;  1WWI A;  3AZH B;  3AZN B;  5CPK A;  4QLC A;  5DNN A;  1KX4 B;  3NQJ B;  1KX3 B;  4WU8 C;  3TU4 C;  5B33 D;  5AV8 D;  4G91 B;  1P3O D;  2Y2L A;  5AV9 D;  4Z5T D;  1P3G C;  5CPI C;  2J8P A;  3AV1 D;  3B6F A;  3LEL C;  2F8N H;  5B24 C;  1P3O A;  3V9R A;  5AV9 A;  4J8X A;  4WU9 B;  1P3A A;  4Z5T A;  1P3K C;  3REH C;  1ID3 C;  5B40 A;  2NZD D;  1S32 B;  5B1L C;  3B6G A;  4M6B A;  3X1V C;  3REL C;  3AZE A;  3MGP B;  5KDM B;  3REI B;  3W97 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...