3AZHD

Crystal structure of human nucleosome core particle containing h3k122q mutation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
95
structure length
95
Chain Sequence
b'KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
molecule tags Structural protein/dna
source organism Homo sapiens
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
total genus 36
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azhD00
5B2IB 3AZKB 4KHAA 5FUGB 5CPJB 2F8NB 1S32A 2NZDC 2FJ7C 3AZNB 3C1BB 5B33C 1U35A 5GSUB 3WAAD 3MGRA 4QLCC 5B24A 4J8UA 5F99D 3UT9C 4J8XD 5JRGD 1H3OA 1P3IC 4Z5TD 4Z66D 1P3FD 2CWEA 4KUDA 1BH8A 5G49B 5B24D 3REIA 3AV2B 4CSRA 3TU4A 1WWSA 4X23B 4XUJB 3X1VD 3W97A 3LZ1C 4QLCB 5GT0B 3AZMB 1TZYA 4YM6D 3AZJD 3REKC 3AFAA 3W98D 4H9SA 2JSSA 1P34D 4QLCD 5AV5B 4J8VA 3AZNA 5C3IB 4ZUXD 4KGCC 4YS3B 1S32D 1P34A 3O62C 3AZIC 5CHLB 5E5AB 4WU8D 1HTAA 3AZFA 3X1SC 1P3AC 1KX3A 3AV2A 3TU4B 3AYWD 3AZGC 3KWQA 3C1BD 1P3GC 1M19B 5CPKA 1P3OC 4X23C 1P3LB 2HUEB 5DNNC 1M1AA 5DNND 5GT0A 1M18D 1M18C 3WA9C 3W96C 3KWQD 4XZQC 3C1CC 4WZSB 3B6FC 1P3BC 1BH9B 1KU5A 5GXQA 3AZID 3MGQA 5B0YB 1M19C 3KUYB 2F8ND 3MGQC 3MNND 4ZUXA 3AZND 5CPID 5CPIC 5CPJD 2LY8A 5B40A 5AVCB 3B6GD 5B32C 5B2JB 3VH5T 4WU8A 1P3PB 3NQJA 2HIOD 1EQZB 5BO0A 3X1TA 3B6GA 4JJNC 5CPKC 4H9QB 3MVDA 3W99A 3AN2C 5DNMC 5AVCC 3LELD 4CAYA 3X1SA 3AZMC 2PYOC 3O62A 1P3FC 4H9OB 5B1LC 5GXQD 1ULYA 4YM6A 3MGSA 1ID3C 3WAAC 5B40B 1P3MC 4KUDD 3AZHA 1TZYC 5AVBA 1EQZA 5GSUA 1ID3D 5B1LD 1P3BD 3REKB 5BS7C 3RELB 3LZ1D 1AOIB 3V9RA 1F66C 3AZGB 1P3KA 1A7WA 3REIC 1TAFB 3W99D 1WWIA 3AV1A 3WA9A 1P3LD 4M6BA 3O62B 4XZQB 3REHD 3MGPD 3W97B 4LD9D 4QLCA 4DRBA 5GT3B 3MGRC 1F66A 1KX4D 4ZBJB 5B33D 1P3GB 5AV5C 1HQ3B 2NZDB 5FUGA 2NZDD 3UTBB 5GT3C 3MGRB 1HQ3D 4YS3C 4YS3A 1P34B 3TU4D 3RELA 3REJA 1AOIA 2BYKB 4H9SC 5B1LA 3AZJC 5GT0D 3UTBD 3REIB 2NQBB 5AV9A 3B0CW 3X1VB 4XUJA 5B0ZB 5B0ZC 5GT3A 3LZ1B 5B33B 3X1UB 1TZYB 3C1BC 3REID 1P3GD 1P3OD 1B6WA 2F8NH 4Z5TC 4Z66C 1B67A 2BYMB 1R4VA 5AV5A 3X1SD 3WAAB 3MGPB 5B40C 3LJAB 2YFWA 1U35D 2FJ7A 3MNNA 4G92B 5CPIA 5GSUC 5AV8C 4R8PB 3AZHC 3AZED 5B24B 3X1TD 3REKD 4Z5TA 4Z66A 5B1LB 1AOID 3RELD 5GXQC 5B2JA 3WKJD 3W97D 4XUJC 4ZBJC 4UUZA 3MGSC 1ID3A 5JA4A 4YM6C 3AZMD 2YFVA 4JJNB 3W99B 3UTAC 4Z2MG 3AZMA 5CPKD 4AWLC 3MGSD 3RELC 3WAAA 1KX3C 3MGPA 3MVDC 4WU9B 3WTPE 3MGQB 3NQUA 3B6GC 5CPIB 5B0YC 4H9RB 3X1TC 2PYOD 3KXBB 1KX5D 2PYOB 2FJ7D 5BNXB 5B1MA 5CP6C 5AVCA 5B32G 3R45A 4WU9D 5B2ID 3MVDD 3AZKD 3B6FB 1KX3D 3AZFB 2HIOB 1EQZD 4UUZB 5AVBB 1P3PD 5B0ZD 5AVCD 5BO0B 3LELC 3X1TB 3WTPC 3B6GB 3KWQB 1M19A 5KDMA 3V9RB 5AY8B 5BNVB 2NQBD 4JJND 2HUEC 2AROD 3LZ0D 3X1SB 5DNMB 3AZIB 1ZLAA 5AV9D 3UTAB 4H9OA 5AVBC 1EQZC 3WTPA 3W98A 4DRAA 3LELA 1P3OA 1ZLAD 3MGSB 1P3GA 3MNNC 1HQ3A 5BNXA 4ZUXB 1Q9CA 1U35C 3LJAD 1S32C 3B0CT 5B1MC 5AV5D 3B6FA 2NZDA 3A6NB 5B0YD 3UTBA 4WU8B 1P3PA 3NQJB 5KDMB 4XZQD 3REJB 3KWQC 3AZGA 3W96D 3MGPC 5E5AD 4LD9A 3AV2C 3MGRD 4X23D 4H9QA 3AZLC 3WA9B 2NQBA 3AZGD 5DNNB 1M18B 3AZIA 2AROA 3LZ0A 3UTAA 1ZLAB 1P3LC 5CP6B 3W96B 3AFAD 2RVQC 3W98B 5B32A 1AOIC 3REJC 1F66B 1F66D 4J8VC 3TU4C 4WU9C 2F8NG 4ZUXC 1JFIA 1TZYD 3AZEC 3AZHD 2F8NA 1S32B 5AV8A 3LJAA 2CV5A 4J8XB 1KX4C 3REJD 3VH6A 5AV6B 4Z5TB 4NE6A 4Z66B 5G49A 1N1JB 4H9PB 5DNMD 2CV5D 5DNNA 3AV1D 4J8WA 2AROB 3LZ0B 3AV1C 1M18A 1M1AC 4X23A 5AY8D 3B0BA 5JA4B 5B24C 5B0ZA 3AN2B 3WKJC 3AV2D 5B33A 3AYWA 5BS7A 2CV5C 1P3AA 5B32D 4NFTA 1P3IB 2HIOC 3AZJA 3AZEA 3VH5A 5GT3D 4E45A 4WU9A 4KHAB 2YFWB 3AZNC 5CPJA 2FJ7B 5B40D 3NQUB 2CV5B 5CPJC 3X1UC 1P3KD 3KXBC 5AV6D 4R8PA 4NE3A 1P3MB 3MGQD 1N1JA 4H9PA 1P3FA 1H3OB 3VH5W 5AVBD 4J8WB 4R8PD 1P3BB 2F8NK 3B6FD 3REHC 5CPKB 1ID3B 4LD9C 2YFVB 3X1VA 4HGAB 3W99C 3AN2A 3AZLD 4JJNA 3AYWB 5AY8A 5BNVA 3WKJB 4WV4B 4WNNB 4Z2MH 3UTBC 1P3IA 4WU8C 3UT9A 3AFAB 1BH9A 4E44A 1P3AD 5GXQB 3B0DC 3X1UD 5B31B 5B1MD 1P3KC 1KX4A 4YS3D 5B2IA 3AZKA 1HQ3C 4J8VB 5AV6C 3WTPB 1U35B 1KX5C 3MNNB 2PYOA 1P3MA 4KGCB 3R45B 1ZLAC 2IO5C 1P3BA 4G91C 2L5AA 3KUYC 1M1AD 1P3LA 4WNNA 1M1AB 3AN2D 5AY8C 4EO5C 3A6NC 3AZLA 4CAYB 4G91B 3X1VC 5DNMA 5E5AC 2IO5B 5B31A 3C1CB 4J8XC 1KX4B 5CP6A 3KUYD 3AZFC 1F1EA 5JRGC 4YM6B 3O62D 1P3OB 5B0YA 5AV8D 5CP6D 3KUYA 4KGCA 4H9RA 3KXBA 4H9NA 4J8VD 1JFIB 5B31G 5E5AA 5B1MB 3AZHB 4NE5A 3A6NA 3AZFD 5AV8B 1KX3B 3AFAC 1M19D 3W98C 2HIOA 4AWLB 3REKA 5JRGB 5F99B 3A6ND 5C3IC 3C1CD 4LD9B 5AV6A 3AZLB 2RVQD 3REHB 1TAFA 4HGAC 4XUJD 4EO5B 3C1CA 4XZQA 3VH6W 3WA9D 3W96A 3WTPD 5GT0C 5B31D 1BFMA 5BT1C 4J8UC 1P3AB 5B2IC 3AZKC 3LELB 4H9NB 4G92C 5GSUD 3AZJB 4KGCD 3LJAC 3KXBD 1KX5B 1P34C 4J8WD 5JRGA 5F99A 3C1BA 2BYKA 5BT1D 4J8UD 5B31C 4J8XA 5B2JD 4J8UB 3REHA 1P3FB 3MVDB 3B0DB 1P3KB 5AV9C 5AV9B 3UTAD 4KUDB 1BH8B 2AROC 3LZ0C 3AV1B 2NQBC 4CSRB 4R8PC 3KSYA 3LZ1A 3W97C 3X1UA 3AYWC 3WKJA 1P3ID 5B32B 5B2JC 2BYMA 5F99C 3UT9D 1P3PC 3UT9B 3AZEB 4J8WC 4KUDC 1P3MD 1KX5A 3VH6T
chains in the Genus database with same CATH superfamily
3F6TA 5B2IB 3AZKB 4KHAA 5FUGB 5CPJB 2F8NB 1S32A 2NZDC 2FJ7C 3AZNB 3C1BB 5B33C 1U35A 5GSUB 3WAAD 3MGRA 4QLCC 5B24A 4J8UA 2XD1A 5F99D 3UT9C 4J8XD 5JRGD 1H3OA 1P3IC 4Z5TD 4Z66D 1P3FD 2CWEA 4KUDA 1BH8A 2BG1A 5G49B 5B24D 3REIA 3AV2B 4CSRA 3TU4A 1WWSA 4X23B 4XUJB 3X1VD 3W97A 3LZ1C 4QLCB 5GT0B 3AZMB 1TZYA 4YM6D 3AZJD 3REKC 3AFAA 3W98D 4H9SA 2JSSA 1P34D 4QLCD 3EPLA 5AV5B 4J8VA 3AZNA 5C3IB 4ZUXD 4KGCC 2DF4C 4YS3B 1S32D 1P34A 3EPJA 3O62C 3AZIC 5CHLB 3KFUG 5E5AB 4WU8D 1HTAA 2Y2HA 3AZFA 3X1SC 1P3AC 1KX3A 3AV2A 3TU4B 3AYWD 3AZGC 3KWQA 3C1BD 1P3GC 1M19B 5CPKA 1P3OC 4X23C 1P3LB 2HUEB 5DNNC 1M1AA 5DNND 5GT0A 1M18D 1M18C 3WA9C 3W96C 3KWQD 4XZQC 2Y2PA 4WZSB 3C1CC 3B6FC 1P3BC 1BH9B 1KU5A 5GXQA 3AZID 3MGQA 5B0YB 1M19C 3KUYB 2F8ND 3MGQC 3MNND 4ZUXA 3AZND 5CPID 5CPIC 5CPJD 2LY8A 5B40A 5AVCB 3B6GD 5B32C 5B2JB 3VH5T 4WU8A 1P3PB 3NQJA 2HIOD 1EQZB 5BO0A 3X1TA 3B6GA 4JJNC 5CPKC 4H9QB 3MVDA 2W8SA 3AN2C 3W99A 2UWXA 3A1KA 5DNMC 5AVCC 3LELD 2JE5A 4CAYA 3X1SA 3AZMC 2PYOC 3O62A 1P3FC 4H9OB 5B1LC 5GXQD 4YM6A 1ULYA 2ZY5A 3MGSA 1ID3C 3WAAC 3EPKA 5B40B 1P3MD 1P3MC 4UPKA 4KUDD 3AZHA 1T3UA 1TZYC 5AVBA 5GSUA 1EQZA 1ID3D 2J8PA 5B1LD 1P3BD 3REKB 5BS7C 3RELB 3LZ1D 1AOIB 3V9RA 1F66C 3AZGB 1P3KA 1A7WA 3REIC 1TAFB 3W99D 1WWIA 3AV1A 3WA9A 2ZY3A 1P3LD 4M6BA 3O62B 4XZQB 3REHD 3MGPD 3W97B 4LD9D 4QLCA 4DRBA 5GT3B 3MGRC 1F66A 1KX4D 4ZBJB 5B33D 1P3GB 5AV5C 1HQ3B 2Y2GA 3H0LC 2Y2QA 2NZDB 5FUGA 2NZDD 3UTBB 5GT3C 3MGRB 1HQ3D 4YS3C 4YS3A 2G5IC 3TU4D 1P34B 3RELA 3REJA 1AOIA 2BYKB 2Y2JA 4H9SC 5B1LA 3AZJC 5GT0D 3UTBD 2G5HC 3REIB 2NQBB 5AV9A 3B0CW 3H0RC 3X1VB 4XUJA 5B0ZB 5B0ZC 5GT3A 3LZ1B 5B33B 3X1UB 1TZYB 3C1BC 3REID 1P3GD 1P3OD 1B6WA 2F8NH 4Z5TC 4Z66C 1B67A 2BYMB 1R4VA 3P5JB 5AV5A 3X1SD 3WAAB 3MGPB 5B40C 3LJAB 2YFWA 1U35D 2FJ7A 3MNNA 4G92B 5CPIA 5GSUC 5AV8C 4R8PB 3AZHC 3AZED 5B24B 3X1TD 3REKD 4Z5TA 4Z66A 5B1LB 1AOID 3RELD 5GXQC 5B2JA 2ZY2A 2Y2OA 3WKJD 3W97D 4XUJC 4ZBJC 4UUZA 3MGSC 1ID3A 5JA4A 4YM6C 3AZMD 2YFVA 4JJNB 3W99B 3UTAC 4Z2MG 3AZMA 5CPKD 4AWLC 3MGSD 3RELC 3WAAA 1KX3C 3MGPA 2Y2NA 3MVDC 4WU9B 3WTPE 3MGQB 3NQUA 3B6GC 2XD5A 5CPIB 5B0YC 4H9RB 3X1TC 2PYOD 3KXBB 1KX5D 3IP4C 3AL0C 2PYOB 2FJ7D 5BNXB 5B1MA 5CP6C 5AVCA 5B32G 3R45A 4WU9D 5B2ID 3MVDD 3AZKD 3B6FB 1KX3D 3AZFB 2HIOB 3FDDA 1EQZD 4DQYB 4UUZB 5AVBB 1P3PD 5B0ZD 5AVCD 5BO0B 3LELC 3X1TB 3WTPC 3B6GB 3KWQB 1M19A 5KDMA 3V9RB 5AY8B 5BNVB 2NQBD 4JJND 2HUEC 2AROD 3LZ0D 3X1SB 5DNMB 3AZIB 1ZLAA 5AV9D 3UTAB 4H9OA 5AVBC 1EQZC 3WTPA 3W98A 4DRAA 3LELA 2ZY4A 1P3OA 1ZLAD 3MGSB 1P3GA 3MNNC 1HQ3A 5BNXA 4ZUXB 1Q9CA 1U35C 3LJAD 1S32C 3B0CT 5B1MC 5AV5D 3B6FA 2NZDA 3A6NB 5B0YD 3UTBA 4WU8B 1P3PA 3NQJB 5KDMB 4XZQD 3REJB 3KWQC 3AZGA 3W96D 3MGPC 5E5AD 4LD9A 3AV2C 4WJ3C 3MGRD 4X23D 4H9QA 3AZLC 3WA9B 2NQBA 3AZGD 5DNNB 1M18B 3AZIA 2AROA 3LZ0A 3UTAA 1ZLAB 1P3LC 5CP6B 3W96B 3AFAD 2RVQC 3W98B 3EG5B 2JCHA 5B32A 1AOIC 3REJC 1Z2CB 1F66B 1F66D 4J8VC 3TU4C 4WU9C 2F8NG 4ZUXC 1JFIA 1TZYD 3AZEC 3AZHD 2F8NA 1S32B 2FFFB 5AV8A 3LJAA 2CV5A 4J8XB 1KX4C 3REJD 3VH6A 5AV6B 4Z5TB 4NE6A 4Z66B 5G49A 1N1JB 1PZRA 4H9PB 5DNMD 2CV5D 5DNNA 3AV1D 4J8WA 2AROB 3LZ0B 3AV1C 1M18A 1M1AC 4X23A 5AY8D 3B0BA 5JA4B 5B24C 5B0ZA 3AN2B 3WKJC 3AV2D 5B33A 3AYWA 5BS7A 2CV5C 1P3AA 5B32D 4NFTA 1P3IB 2HIOC 3AZJA 3AZEA 3VH5A 5GT3D 4E45A 4WU9A 4KHAB 2YFWB 3AZNC 5CPJA 2FJ7B 5B40D 3NQUB 2CV5B 2Y2MA 5CPJC 3X1UC 1P3KD 3KXBC 5AV6D 4R8PA 4NE3A 1P3MB 3MGQD 1N1JA 4H9PA 1P3FA 1H3OB 3VH5W 5AVBD 4J8WB 4R8PD 1P3BB 2F8NK 3B6FD 3REHC 5CPKB 1ID3B 2DQNC 4LD9C 2YFVB 3X1VA 4HGAB 3W99C 3AN2A 3AZLD 4JJNA 3AYWB 5AY8A 5BNVA 3WKJB 4WV4B 4WNNB 4Z2MH 3UTBC 1P3IA 4WU8C 3UT9A 3AFAB 1BH9A 4E44A 1P3AD 2Y2KA 5GXQB 3B0DC 3X1UD 5B31B 2VQRA 5B1MD 1P3KC 1KX4A 4YS3D 5B2IA 3AZKA 1HQ3C 4J8VB 5AV6C 3WTPB 1U35B 1KX5C 3MNNB 2PYOA 1P3MA 4KGCB 3R45B 1ZLAC 2IO5C 1P3BA 4G91C 2L5AA 3KUYC 2ZM5A 1M1AD 1P3LA 4WNNA 3H0MC 3AN2D 1W2EA 5AY8C 1M1AB 4EO5C 3A6NC 3AZLA 4CAYB 4G91B 3X1VC 5DNMA 5E5AC 2IO5B 5B31A 3C1CB 4J8XC 1KX4B 5CP6A 3KUYD 3AZFC 1F1EA 5JRGC 4YM6B 3O62D 1P3OB 5B0YA 2F2AC 5AV8D 5CP6D 3KUYA 4KGCA 4H9RA 3KXBA 4H9NA 4J8VD 1JFIB 5B31G 5E5AA 5B1MB 3AZHB 4NE5A 3A6NA 3AZFD 5AV8B 1KX3B 3AFAC 1M19D 3W98C 2HIOA 4AWLB 3REKA 5JRGB 5F99B 3A6ND 5C3IC 3C1CD 4LD9B 5AV6A 3AZLB 2RVQD 3REHB 1TAFA 4HGAC 4XUJD 4EO5B 3C1CA 4XZQA 3VH6W 3WA9D 3W96A 3WTPD 5GT0C 5B31D 1BFMA 5BT1C 4J8UC 1P3AB 5B2IC 3AZKC 3LELB 4H9NB 4G92C 5GSUD 3AZJB 4KGCD 3LJAC 3KXBD 1KX5B 2Y2IA 3A1IA 1P34C 4J8WD 5JRGA 5F99A 3C1BA 2BYKA 5BT1D 4J8UD 5B31C 4J8XA 5B2JD 4J8UB 3REHA 1P3FB 3MVDB 2Y2LA 3B0DB 1P3KB 5AV9C 5AV9B 3UTAD 4KUDB 1BH8B 2AROC 3LZ0C 3AV1B 2NQBC 4CSRB 4R8PC 3KSYA 3LZ1A 3W97C 3X1UA 3AYWC 3WKJA 3EPHA 1P3ID 5B32B 5B2JC 2BYMA 5F99C 3UT9D 1P3PC 3UT9B 3AZEB 4J8WC 4KUDC 2RIQA 1KX5A 3VH6T
chains in the Genus database with same CATH topology
3F6TA 5B2IB 3AZKB 4KHAA 5FUGB 5CPJB 2F8NB 1S32A 2NZDC 2FJ7C 3AZNB 3C1BB 5B33C 1U35A 5GSUB 3WAAD 3MGRA 4QLCC 5B24A 4J8UA 2XD1A 5F99D 3UT9C 4J8XD 5JRGD 1H3OA 1P3IC 4Z5TD 4Z66D 1P3FD 2CWEA 4KUDA 1BH8A 2BG1A 5G49B 5B24D 3REIA 3AV2B 4CSRA 3TU4A 1WWSA 4X23B 4XUJB 3X1VD 3W97A 3LZ1C 4QLCB 5GT0B 3AZMB 1TZYA 4YM6D 3AZJD 3REKC 3AFAA 3W98D 4H9SA 2JSSA 1P34D 4QLCD 3EPLA 5AV5B 4J8VA 3AZNA 5C3IB 4ZUXD 4KGCC 2DF4C 4YS3B 1S32D 1P34A 3EPJA 3O62C 3AZIC 5CHLB 3KFUG 5E5AB 4WU8D 1HTAA 2Y2HA 3AZFA 3X1SC 1P3AC 1KX3A 3AV2A 3TU4B 3AYWD 3AZGC 3KWQA 3C1BD 1P3GC 1M19B 5CPKA 1P3OC 4X23C 1P3LB 2HUEB 5DNNC 1M1AA 5DNND 5GT0A 1M18D 1M18C 3WA9C 3W96C 3KWQD 4XZQC 2Y2PA 4WZSB 3C1CC 3B6FC 1P3BC 1BH9B 1KU5A 5GXQA 3AZID 3MGQA 5B0YB 1M19C 3KUYB 2F8ND 3MGQC 3MNND 4ZUXA 3AZND 5CPID 5CPIC 5CPJD 2LY8A 5B40A 5AVCB 3B6GD 5B32C 5B2JB 3VH5T 4WU8A 1P3PB 3NQJA 2HIOD 1EQZB 5BO0A 3X1TA 3B6GA 4JJNC 5CPKC 4H9QB 3MVDA 2W8SA 3AN2C 3W99A 2UWXA 3A1KA 5DNMC 5AVCC 3LELD 2JE5A 4CAYA 3X1SA 3AZMC 2PYOC 3O62A 1P3FC 4H9OB 5B1LC 5GXQD 4YM6A 1ULYA 2ZY5A 3MGSA 1ID3C 3WAAC 3EPKA 5B40B 1P3MD 1P3MC 4UPKA 4KUDD 3AZHA 1T3UA 1TZYC 5AVBA 5GSUA 1EQZA 1ID3D 2J8PA 5B1LD 1P3BD 3REKB 5BS7C 3RELB 3LZ1D 1AOIB 3V9RA 1F66C 3AZGB 1P3KA 1A7WA 3REIC 1TAFB 3W99D 1WWIA 3AV1A 3WA9A 2ZY3A 1P3LD 4M6BA 3O62B 4XZQB 3REHD 3MGPD 3W97B 4LD9D 4QLCA 4DRBA 5GT3B 3MGRC 1F66A 1KX4D 4ZBJB 5B33D 1P3GB 5AV5C 1HQ3B 2Y2GA 3H0LC 2Y2QA 2NZDB 5FUGA 2NZDD 3UTBB 5GT3C 3MGRB 1HQ3D 4YS3C 4YS3A 2G5IC 3TU4D 1P34B 3RELA 3REJA 1AOIA 2BYKB 2Y2JA 4H9SC 5B1LA 3AZJC 5GT0D 3UTBD 2G5HC 3REIB 2NQBB 5AV9A 3B0CW 3H0RC 3X1VB 4XUJA 5B0ZB 5B0ZC 5GT3A 3LZ1B 5B33B 3X1UB 1TZYB 3C1BC 3REID 1P3GD 1P3OD 1B6WA 2F8NH 4Z5TC 4Z66C 1B67A 2BYMB 1R4VA 3P5JB 5AV5A 3X1SD 3WAAB 3MGPB 5B40C 3LJAB 2YFWA 1U35D 2FJ7A 3MNNA 4G92B 5CPIA 5GSUC 5AV8C 4R8PB 3AZHC 3AZED 5B24B 3X1TD 3REKD 4Z5TA 4Z66A 5B1LB 1AOID 3RELD 5GXQC 5B2JA 2ZY2A 2Y2OA 3WKJD 3W97D 4XUJC 4ZBJC 4UUZA 3MGSC 1ID3A 5JA4A 4YM6C 3AZMD 2YFVA 4JJNB 3W99B 3UTAC 4Z2MG 3AZMA 5CPKD 4AWLC 3MGSD 3RELC 3WAAA 1KX3C 3MGPA 2Y2NA 3MVDC 4WU9B 3WTPE 3MGQB 3NQUA 3B6GC 2XD5A 5CPIB 5B0YC 4H9RB 3X1TC 2PYOD 3KXBB 1KX5D 3IP4C 3AL0C 2PYOB 2FJ7D 5BNXB 5B1MA 5CP6C 5AVCA 5B32G 3R45A 4WU9D 5B2ID 3MVDD 3AZKD 3B6FB 1KX3D 3AZFB 2HIOB 3FDDA 1EQZD 4DQYB 4UUZB 5AVBB 1P3PD 5B0ZD 5AVCD 5BO0B 3LELC 3X1TB 3WTPC 3B6GB 3KWQB 1M19A 5KDMA 3V9RB 5AY8B 5BNVB 2NQBD 4JJND 2HUEC 2AROD 3LZ0D 3X1SB 5DNMB 3AZIB 1ZLAA 5AV9D 3UTAB 4H9OA 5AVBC 1EQZC 3WTPA 3W98A 4DRAA 3LELA 2ZY4A 1P3OA 1ZLAD 3MGSB 1P3GA 3MNNC 1HQ3A 5BNXA 4ZUXB 1Q9CA 1U35C 3LJAD 1S32C 3B0CT 5B1MC 5AV5D 3B6FA 2NZDA 3A6NB 5B0YD 3UTBA 4WU8B 1P3PA 3NQJB 5KDMB 4XZQD 3REJB 3KWQC 3AZGA 3W96D 3MGPC 5E5AD 4LD9A 3AV2C 4WJ3C 3MGRD 4X23D 4H9QA 3AZLC 3WA9B 2NQBA 3AZGD 5DNNB 1M18B 3AZIA 2AROA 3LZ0A 3UTAA 1ZLAB 1P3LC 5CP6B 3W96B 3AFAD 2RVQC 3W98B 3EG5B 2JCHA 5B32A 1AOIC 3REJC 1Z2CB 1F66B 1F66D 4J8VC 3TU4C 4WU9C 2F8NG 4ZUXC 1JFIA 1TZYD 3AZEC 3AZHD 2F8NA 1S32B 2FFFB 5AV8A 3LJAA 2CV5A 4J8XB 1KX4C 3REJD 3VH6A 5AV6B 4Z5TB 4NE6A 4Z66B 5G49A 1N1JB 1PZRA 4H9PB 5DNMD 2CV5D 5DNNA 3AV1D 4J8WA 2AROB 3LZ0B 3AV1C 1M18A 1M1AC 4X23A 5AY8D 3B0BA 5JA4B 5B24C 5B0ZA 3AN2B 3WKJC 3AV2D 5B33A 3AYWA 5BS7A 2CV5C 1P3AA 5B32D 4NFTA 1P3IB 2HIOC 3AZJA 3AZEA 3VH5A 5GT3D 4E45A 4WU9A 4KHAB 2YFWB 3AZNC 5CPJA 2FJ7B 5B40D 3NQUB 2CV5B 2Y2MA 5CPJC 3X1UC 1P3KD 3KXBC 5AV6D 4R8PA 4NE3A 1P3MB 3MGQD 1N1JA 4H9PA 1P3FA 1H3OB 3VH5W 5AVBD 4J8WB 4R8PD 1P3BB 2F8NK 3B6FD 3REHC 5CPKB 1ID3B 2DQNC 4LD9C 2YFVB 3X1VA 4HGAB 3W99C 3AN2A 3AZLD 4JJNA 3AYWB 5AY8A 5BNVA 3WKJB 4WV4B 4WNNB 4Z2MH 3UTBC 1P3IA 4WU8C 3UT9A 3AFAB 1BH9A 4E44A 1P3AD 2Y2KA 5GXQB 3B0DC 3X1UD 5B31B 2VQRA 5B1MD 1P3KC 1KX4A 4YS3D 5B2IA 3AZKA 1HQ3C 4J8VB 5AV6C 3WTPB 1U35B 1KX5C 3MNNB 2PYOA 1P3MA 4KGCB 3R45B 1ZLAC 2IO5C 1P3BA 4G91C 2L5AA 3KUYC 2ZM5A 1M1AD 1P3LA 4WNNA 3H0MC 3AN2D 1W2EA 5AY8C 1M1AB 4EO5C 3A6NC 3AZLA 4CAYB 4G91B 3X1VC 5DNMA 5E5AC 2IO5B 5B31A 3C1CB 4J8XC 1KX4B 5CP6A 3KUYD 3AZFC 1F1EA 5JRGC 4YM6B 3O62D 1P3OB 5B0YA 2F2AC 5AV8D 5CP6D 3KUYA 4KGCA 4H9RA 3KXBA 4H9NA 4J8VD 1JFIB 5B31G 5E5AA 5B1MB 3AZHB 4NE5A 3A6NA 3AZFD 5AV8B 1KX3B 3AFAC 1M19D 3W98C 2HIOA 4AWLB 3REKA 5JRGB 5F99B 3A6ND 5C3IC 3C1CD 4LD9B 5AV6A 3AZLB 2RVQD 3REHB 1TAFA 4HGAC 4XUJD 4EO5B 3C1CA 4XZQA 3VH6W 3WA9D 3W96A 3WTPD 5GT0C 5B31D 1BFMA 5BT1C 4J8UC 1P3AB 5B2IC 3AZKC 3LELB 4H9NB 4G92C 5GSUD 3AZJB 4KGCD 3LJAC 3KXBD 1KX5B 2Y2IA 3A1IA 1P34C 4J8WD 5JRGA 5F99A 3C1BA 2BYKA 5BT1D 4J8UD 5B31C 4J8XA 5B2JD 4J8UB 3REHA 1P3FB 3MVDB 2Y2LA 3B0DB 1P3KB 5AV9C 5AV9B 3UTAD 4KUDB 1BH8B 2AROC 3LZ0C 3AV1B 2NQBC 4CSRB 4R8PC 3KSYA 3LZ1A 3W97C 3X1UA 3AYWC 3WKJA 3EPHA 1P3ID 5B32B 5B2JC 2BYMA 5F99C 3UT9D 1P3PC 3UT9B 3AZEB 4J8WC 4KUDC 2RIQA 1KX5A 3VH6T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B2I B;  3AZK B;  4KHA A;  5FUG B;  5CPJ B;  2F8N B;  1S32 A;  2NZD C;  2FJ7 C;  3AZN B;  3C1B B;  5B33 C;  1U35 A;  5GSU B;  3WAA D;  3MGR A;  4QLC C;  5B24 A;  4J8U A;  5F99 D;  3UT9 C;  4J8X D;  5JRG D;  1H3O A;  1P3I C;  4Z5T D;  4Z66 D;  1P3F D;  2CWE A;  4KUD A;  1BH8 A;  5G49 B;  5B24 D;  3REI A;  3AV2 B;  4CSR A;  3TU4 A;  1WWS A;  4X23 B;  4XUJ B;  3X1V D;  3W97 A;  3LZ1 C;  4QLC B;  5GT0 B;  3AZM B;  1TZY A;  4YM6 D;  3AZJ D;  3REK C;  3AFA A;  3W98 D;  4H9S A;  2JSS A;  1P34 D;  4QLC D;  5AV5 B;  4J8V A;  3AZN A;  5C3I B;  4ZUX D;  4KGC C;  4YS3 B;  1S32 D;  1P34 A;  3O62 C;  3AZI C;  5CHL B;  5E5A B;  4WU8 D;  1HTA A;  3AZF A;  3X1S C;  1P3A C;  1KX3 A;  3AV2 A;  3TU4 B;  3AYW D;  3AZG C;  3KWQ A;  3C1B D;  1P3G C;  1M19 B;  5CPK A;  1P3O C;  4X23 C;  1P3L B;  2HUE B;  5DNN C;  1M1A A;  5DNN D;  5GT0 A;  1M18 D;  1M18 C;  3WA9 C;  3W96 C;  3KWQ D;  4XZQ C;  3C1C C;  4WZS B;  3B6F C;  1P3B C;  1BH9 B;  1KU5 A;  5GXQ A;  3AZI D;  3MGQ A;  5B0Y B;  1M19 C;  3KUY B;  2F8N D;  3MGQ C;  3MNN D;  4ZUX A;  3AZN D;  5CPI D;  5CPI C;  5CPJ D;  2LY8 A;  5B40 A;  5AVC B;  3B6G D;  5B32 C;  5B2J B;  3VH5 T;  4WU8 A;  1P3P B;  3NQJ A;  2HIO D;  1EQZ B;  5BO0 A;  3X1T A;  3B6G A;  4JJN C;  5CPK C;  4H9Q B;  3MVD A;  3W99 A;  3AN2 C;  5DNM C;  5AVC C;  3LEL D;  4CAY A;  3X1S A;  3AZM C;  2PYO C;  3O62 A;  1P3F C;  4H9O B;  5B1L C;  5GXQ D;  1ULY A;  4YM6 A;  3MGS A;  1ID3 C;  3WAA C;  5B40 B;  1P3M C;  4KUD D;  3AZH A;  1TZY C;  5AVB A;  1EQZ A;  5GSU A;  1ID3 D;  5B1L D;  1P3B D;  3REK B;  5BS7 C;  3REL B;  3LZ1 D;  1AOI B;  3V9R A;  1F66 C;  3AZG B;  1P3K A;  1A7W A;  3REI C;  1TAF B;  3W99 D;  1WWI A;  3AV1 A;  3WA9 A;  1P3L D;  4M6B A;  3O62 B;  4XZQ B;  3REH D;  3MGP D;  3W97 B;  4LD9 D;  4QLC A;  4DRB A;  5GT3 B;  3MGR C;  1F66 A;  1KX4 D;  4ZBJ B;  5B33 D;  1P3G B;  5AV5 C;  1HQ3 B;  2NZD B;  5FUG A;  2NZD D;  3UTB B;  5GT3 C;  3MGR B;  1HQ3 D;  4YS3 C;  4YS3 A;  1P34 B;  3TU4 D;  3REL A;  3REJ A;  1AOI A;  2BYK B;  4H9S C;  5B1L A;  3AZJ C;  5GT0 D;  3UTB D;  3REI B;  2NQB B;  5AV9 A;  3B0C W;  3X1V B;  4XUJ A;  5B0Z B;  5B0Z C;  5GT3 A;  3LZ1 B;  5B33 B;  3X1U B;  1TZY B;  3C1B C;  3REI D;  1P3G D;  1P3O D;  1B6W A;  2F8N H;  4Z5T C;  4Z66 C;  1B67 A;  2BYM B;  1R4V A;  5AV5 A;  3X1S D;  3WAA B;  3MGP B;  5B40 C;  3LJA B;  2YFW A;  1U35 D;  2FJ7 A;  3MNN A;  4G92 B;  5CPI A;  5GSU C;  5AV8 C;  4R8P B;  3AZH C;  3AZE D;  5B24 B;  3X1T D;  3REK D;  4Z5T A;  4Z66 A;  5B1L B;  1AOI D;  3REL D;  5GXQ C;  5B2J A;  3WKJ D;  3W97 D;  4XUJ C;  4ZBJ C;  4UUZ A;  3MGS C;  1ID3 A;  5JA4 A;  4YM6 C;  3AZM D;  2YFV A;  4JJN B;  3W99 B;  3UTA C;  4Z2M G;  3AZM A;  5CPK D;  4AWL C;  3MGS D;  3REL C;  3WAA A;  1KX3 C;  3MGP A;  3MVD C;  4WU9 B;  3WTP E;  3MGQ B;  3NQU A;  3B6G C;  5CPI B;  5B0Y C;  4H9R B;  3X1T C;  2PYO D;  3KXB B;  1KX5 D;  2PYO B;  2FJ7 D;  5BNX B;  5B1M A;  5CP6 C;  5AVC A;  5B32 G;  3R45 A;  4WU9 D;  5B2I D;  3MVD D;  3AZK D;  3B6F B;  1KX3 D;  3AZF B;  2HIO B;  1EQZ D;  4UUZ B;  5AVB B;  1P3P D;  5B0Z D;  5AVC D;  5BO0 B;  3LEL C;  3X1T B;  3WTP C;  3B6G B;  3KWQ B;  1M19 A;  5KDM A;  3V9R B;  5AY8 B;  5BNV B;  2NQB D;  4JJN D;  2HUE C;  2ARO D;  3LZ0 D;  3X1S B;  5DNM B;  3AZI B;  1ZLA A;  5AV9 D;  3UTA B;  4H9O A;  5AVB C;  1EQZ C;  3WTP A;  3W98 A;  4DRA A;  3LEL A;  1P3O A;  1ZLA D;  3MGS B;  1P3G A;  3MNN C;  1HQ3 A;  5BNX A;  4ZUX B;  1Q9C A;  1U35 C;  3LJA D;  1S32 C;  3B0C T;  5B1M C;  5AV5 D;  3B6F A;  2NZD A;  3A6N B;  5B0Y D;  3UTB A;  4WU8 B;  1P3P A;  3NQJ B;  5KDM B;  4XZQ D;  3REJ B;  3KWQ C;  3AZG A;  3W96 D;  3MGP C;  5E5A D;  4LD9 A;  3AV2 C;  3MGR D;  4X23 D;  4H9Q A;  3AZL C;  3WA9 B;  2NQB A;  3AZG D;  5DNN B;  1M18 B;  3AZI A;  2ARO A;  3LZ0 A;  3UTA A;  1ZLA B;  1P3L C;  5CP6 B;  3W96 B;  3AFA D;  2RVQ C;  3W98 B;  5B32 A;  1AOI C;  3REJ C;  1F66 B;  1F66 D;  4J8V C;  3TU4 C;  4WU9 C;  2F8N G;  4ZUX C;  1JFI A;  1TZY D;  3AZE C;  3AZH D;  2F8N A;  1S32 B;  5AV8 A;  3LJA A;  2CV5 A;  4J8X B;  1KX4 C;  3REJ D;  3VH6 A;  5AV6 B;  4Z5T B;  4NE6 A;  4Z66 B;  5G49 A;  1N1J B;  4H9P B;  5DNM D;  2CV5 D;  5DNN A;  3AV1 D;  4J8W A;  2ARO B;  3LZ0 B;  3AV1 C;  1M18 A;  1M1A C;  4X23 A;  5AY8 D;  3B0B A;  5JA4 B;  5B24 C;  5B0Z A;  3AN2 B;  3WKJ C;  3AV2 D;  5B33 A;  3AYW A;  5BS7 A;  2CV5 C;  1P3A A;  5B32 D;  4NFT A;  1P3I B;  2HIO C;  3AZJ A;  3AZE A;  3VH5 A;  5GT3 D;  4E45 A;  4WU9 A;  4KHA B;  2YFW B;  3AZN C;  5CPJ A;  2FJ7 B;  5B40 D;  3NQU B;  2CV5 B;  5CPJ C;  3X1U C;  1P3K D;  3KXB C;  5AV6 D;  4R8P A;  4NE3 A;  1P3M B;  3MGQ D;  1N1J A;  4H9P A;  1P3F A;  1H3O B;  3VH5 W;  5AVB D;  4J8W B;  4R8P D;  1P3B B;  2F8N K;  3B6F D;  3REH C;  5CPK B;  1ID3 B;  4LD9 C;  2YFV B;  3X1V A;  4HGA B;  3W99 C;  3AN2 A;  3AZL D;  4JJN A;  3AYW B;  5AY8 A;  5BNV A;  3WKJ B;  4WV4 B;  4WNN B;  4Z2M H;  3UTB C;  1P3I A;  4WU8 C;  3UT9 A;  3AFA B;  1BH9 A;  4E44 A;  1P3A D;  5GXQ B;  3B0D C;  3X1U D;  5B31 B;  5B1M D;  1P3K C;  1KX4 A;  4YS3 D;  5B2I A;  3AZK A;  1HQ3 C;  4J8V B;  5AV6 C;  3WTP B;  1U35 B;  1KX5 C;  3MNN B;  2PYO A;  1P3M A;  4KGC B;  3R45 B;  1ZLA C;  2IO5 C;  1P3B A;  4G91 C;  2L5A A;  3KUY C;  1M1A D;  1P3L A;  4WNN A;  1M1A B;  3AN2 D;  5AY8 C;  4EO5 C;  3A6N C;  3AZL A;  4CAY B;  4G91 B;  3X1V C;  5DNM A;  5E5A C;  2IO5 B;  5B31 A;  3C1C B;  4J8X C;  1KX4 B;  5CP6 A;  3KUY D;  3AZF C;  1F1E A;  5JRG C;  4YM6 B;  3O62 D;  1P3O B;  5B0Y A;  5AV8 D;  5CP6 D;  3KUY A;  4KGC A;  4H9R A;  3KXB A;  4H9N A;  4J8V D;  1JFI B;  5B31 G;  5E5A A;  5B1M B;  3AZH B;  4NE5 A;  3A6N A;  3AZF D;  5AV8 B;  1KX3 B;  3AFA C;  1M19 D;  3W98 C;  2HIO A;  4AWL B;  3REK A;  5JRG B;  5F99 B;  3A6N D;  5C3I C;  3C1C D;  4LD9 B;  5AV6 A;  3AZL B;  2RVQ D;  3REH B;  1TAF A;  4HGA C;  4XUJ D;  4EO5 B;  3C1C A;  4XZQ A;  3VH6 W;  3WA9 D;  3W96 A;  3WTP D;  5GT0 C;  5B31 D;  1BFM A;  5BT1 C;  4J8U C;  1P3A B;  5B2I C;  3AZK C;  3LEL B;  4H9N B;  4G92 C;  5GSU D;  3AZJ B;  4KGC D;  3LJA C;  3KXB D;  1KX5 B;  1P34 C;  4J8W D;  5JRG A;  5F99 A;  3C1B A;  2BYK A;  5BT1 D;  4J8U D;  5B31 C;  4J8X A;  5B2J D;  4J8U B;  3REH A;  1P3F B;  3MVD B;  3B0D B;  1P3K B;  5AV9 C;  5AV9 B;  3UTA D;  4KUD B;  1BH8 B;  2ARO C;  3LZ0 C;  3AV1 B;  2NQB C;  4CSR B;  4R8P C;  3KSY A;  3LZ1 A;  3W97 C;  3X1U A;  3AYW C;  3WKJ A;  1P3I D;  5B32 B;  5B2J C;  2BYM A;  5F99 C;  3UT9 D;  1P3P C;  3UT9 B;  3AZE B;  4J8W C;  4KUD C;  1P3M D;  1KX5 A;  3VH6 T; 
#chains in the Genus database with same CATH topology
 3F6T A;  5B2I B;  3AZK B;  4KHA A;  5FUG B;  5CPJ B;  2F8N B;  1S32 A;  2NZD C;  2FJ7 C;  3AZN B;  3C1B B;  5B33 C;  1U35 A;  5GSU B;  3WAA D;  3MGR A;  4QLC C;  5B24 A;  4J8U A;  2XD1 A;  5F99 D;  3UT9 C;  4J8X D;  5JRG D;  1H3O A;  1P3I C;  4Z5T D;  4Z66 D;  1P3F D;  2CWE A;  4KUD A;  1BH8 A;  2BG1 A;  5G49 B;  5B24 D;  3REI A;  3AV2 B;  4CSR A;  3TU4 A;  1WWS A;  4X23 B;  4XUJ B;  3X1V D;  3W97 A;  3LZ1 C;  4QLC B;  5GT0 B;  3AZM B;  1TZY A;  4YM6 D;  3AZJ D;  3REK C;  3AFA A;  3W98 D;  4H9S A;  2JSS A;  1P34 D;  4QLC D;  3EPL A;  5AV5 B;  4J8V A;  3AZN A;  5C3I B;  4ZUX D;  4KGC C;  2DF4 C;  4YS3 B;  1S32 D;  1P34 A;  3EPJ A;  3O62 C;  3AZI C;  5CHL B;  3KFU G;  5E5A B;  4WU8 D;  1HTA A;  2Y2H A;  3AZF A;  3X1S C;  1P3A C;  1KX3 A;  3AV2 A;  3TU4 B;  3AYW D;  3AZG C;  3KWQ A;  3C1B D;  1P3G C;  1M19 B;  5CPK A;  1P3O C;  4X23 C;  1P3L B;  2HUE B;  5DNN C;  1M1A A;  5DNN D;  5GT0 A;  1M18 D;  1M18 C;  3WA9 C;  3W96 C;  3KWQ D;  4XZQ C;  2Y2P A;  4WZS B;  3C1C C;  3B6F C;  1P3B C;  1BH9 B;  1KU5 A;  5GXQ A;  3AZI D;  3MGQ A;  5B0Y B;  1M19 C;  3KUY B;  2F8N D;  3MGQ C;  3MNN D;  4ZUX A;  3AZN D;  5CPI D;  5CPI C;  5CPJ D;  2LY8 A;  5B40 A;  5AVC B;  3B6G D;  5B32 C;  5B2J B;  3VH5 T;  4WU8 A;  1P3P B;  3NQJ A;  2HIO D;  1EQZ B;  5BO0 A;  3X1T A;  3B6G A;  4JJN C;  5CPK C;  4H9Q B;  3MVD A;  2W8S A;  3AN2 C;  3W99 A;  2UWX A;  3A1K A;  5DNM C;  5AVC C;  3LEL D;  2JE5 A;  4CAY A;  3X1S A;  3AZM C;  2PYO C;  3O62 A;  1P3F C;  4H9O B;  5B1L C;  5GXQ D;  4YM6 A;  1ULY A;  2ZY5 A;  3MGS A;  1ID3 C;  3WAA C;  3EPK A;  5B40 B;  1P3M D;  1P3M C;  4UPK A;  4KUD D;  3AZH A;  1T3U A;  1TZY C;  5AVB A;  5GSU A;  1EQZ A;  1ID3 D;  2J8P A;  5B1L D;  1P3B D;  3REK B;  5BS7 C;  3REL B;  3LZ1 D;  1AOI B;  3V9R A;  1F66 C;  3AZG B;  1P3K A;  1A7W A;  3REI C;  1TAF B;  3W99 D;  1WWI A;  3AV1 A;  3WA9 A;  2ZY3 A;  1P3L D;  4M6B A;  3O62 B;  4XZQ B;  3REH D;  3MGP D;  3W97 B;  4LD9 D;  4QLC A;  4DRB A;  5GT3 B;  3MGR C;  1F66 A;  1KX4 D;  4ZBJ B;  5B33 D;  1P3G B;  5AV5 C;  1HQ3 B;  2Y2G A;  3H0L C;  2Y2Q A;  2NZD B;  5FUG A;  2NZD D;  3UTB B;  5GT3 C;  3MGR B;  1HQ3 D;  4YS3 C;  4YS3 A;  2G5I C;  3TU4 D;  1P34 B;  3REL A;  3REJ A;  1AOI A;  2BYK B;  2Y2J A;  4H9S C;  5B1L A;  3AZJ C;  5GT0 D;  3UTB D;  2G5H C;  3REI B;  2NQB B;  5AV9 A;  3B0C W;  3H0R C;  3X1V B;  4XUJ A;  5B0Z B;  5B0Z C;  5GT3 A;  3LZ1 B;  5B33 B;  3X1U B;  1TZY B;  3C1B C;  3REI D;  1P3G D;  1P3O D;  1B6W A;  2F8N H;  4Z5T C;  4Z66 C;  1B67 A;  2BYM B;  1R4V A;  3P5J B;  5AV5 A;  3X1S D;  3WAA B;  3MGP B;  5B40 C;  3LJA B;  2YFW A;  1U35 D;  2FJ7 A;  3MNN A;  4G92 B;  5CPI A;  5GSU C;  5AV8 C;  4R8P B;  3AZH C;  3AZE D;  5B24 B;  3X1T D;  3REK D;  4Z5T A;  4Z66 A;  5B1L B;  1AOI D;  3REL D;  5GXQ C;  5B2J A;  2ZY2 A;  2Y2O A;  3WKJ D;  3W97 D;  4XUJ C;  4ZBJ C;  4UUZ A;  3MGS C;  1ID3 A;  5JA4 A;  4YM6 C;  3AZM D;  2YFV A;  4JJN B;  3W99 B;  3UTA C;  4Z2M G;  3AZM A;  5CPK D;  4AWL C;  3MGS D;  3REL C;  3WAA A;  1KX3 C;  3MGP A;  2Y2N A;  3MVD C;  4WU9 B;  3WTP E;  3MGQ B;  3NQU A;  3B6G C;  2XD5 A;  5CPI B;  5B0Y C;  4H9R B;  3X1T C;  2PYO D;  3KXB B;  1KX5 D;  3IP4 C;  3AL0 C;  2PYO B;  2FJ7 D;  5BNX B;  5B1M A;  5CP6 C;  5AVC A;  5B32 G;  3R45 A;  4WU9 D;  5B2I D;  3MVD D;  3AZK D;  3B6F B;  1KX3 D;  3AZF B;  2HIO B;  3FDD A;  1EQZ D;  4DQY B;  4UUZ B;  5AVB B;  1P3P D;  5B0Z D;  5AVC D;  5BO0 B;  3LEL C;  3X1T B;  3WTP C;  3B6G B;  3KWQ B;  1M19 A;  5KDM A;  3V9R B;  5AY8 B;  5BNV B;  2NQB D;  4JJN D;  2HUE C;  2ARO D;  3LZ0 D;  3X1S B;  5DNM B;  3AZI B;  1ZLA A;  5AV9 D;  3UTA B;  4H9O A;  5AVB C;  1EQZ C;  3WTP A;  3W98 A;  4DRA A;  3LEL A;  2ZY4 A;  1P3O A;  1ZLA D;  3MGS B;  1P3G A;  3MNN C;  1HQ3 A;  5BNX A;  4ZUX B;  1Q9C A;  1U35 C;  3LJA D;  1S32 C;  3B0C T;  5B1M C;  5AV5 D;  3B6F A;  2NZD A;  3A6N B;  5B0Y D;  3UTB A;  4WU8 B;  1P3P A;  3NQJ B;  5KDM B;  4XZQ D;  3REJ B;  3KWQ C;  3AZG A;  3W96 D;  3MGP C;  5E5A D;  4LD9 A;  3AV2 C;  4WJ3 C;  3MGR D;  4X23 D;  4H9Q A;  3AZL C;  3WA9 B;  2NQB A;  3AZG D;  5DNN B;  1M18 B;  3AZI A;  2ARO A;  3LZ0 A;  3UTA A;  1ZLA B;  1P3L C;  5CP6 B;  3W96 B;  3AFA D;  2RVQ C;  3W98 B;  3EG5 B;  2JCH A;  5B32 A;  1AOI C;  3REJ C;  1Z2C B;  1F66 B;  1F66 D;  4J8V C;  3TU4 C;  4WU9 C;  2F8N G;  4ZUX C;  1JFI A;  1TZY D;  3AZE C;  3AZH D;  2F8N A;  1S32 B;  2FFF B;  5AV8 A;  3LJA A;  2CV5 A;  4J8X B;  1KX4 C;  3REJ D;  3VH6 A;  5AV6 B;  4Z5T B;  4NE6 A;  4Z66 B;  5G49 A;  1N1J B;  1PZR A;  4H9P B;  5DNM D;  2CV5 D;  5DNN A;  3AV1 D;  4J8W A;  2ARO B;  3LZ0 B;  3AV1 C;  1M18 A;  1M1A C;  4X23 A;  5AY8 D;  3B0B A;  5JA4 B;  5B24 C;  5B0Z A;  3AN2 B;  3WKJ C;  3AV2 D;  5B33 A;  3AYW A;  5BS7 A;  2CV5 C;  1P3A A;  5B32 D;  4NFT A;  1P3I B;  2HIO C;  3AZJ A;  3AZE A;  3VH5 A;  5GT3 D;  4E45 A;  4WU9 A;  4KHA B;  2YFW B;  3AZN C;  5CPJ A;  2FJ7 B;  5B40 D;  3NQU B;  2CV5 B;  2Y2M A;  5CPJ C;  3X1U C;  1P3K D;  3KXB C;  5AV6 D;  4R8P A;  4NE3 A;  1P3M B;  3MGQ D;  1N1J A;  4H9P A;  1P3F A;  1H3O B;  3VH5 W;  5AVB D;  4J8W B;  4R8P D;  1P3B B;  2F8N K;  3B6F D;  3REH C;  5CPK B;  1ID3 B;  2DQN C;  4LD9 C;  2YFV B;  3X1V A;  4HGA B;  3W99 C;  3AN2 A;  3AZL D;  4JJN A;  3AYW B;  5AY8 A;  5BNV A;  3WKJ B;  4WV4 B;  4WNN B;  4Z2M H;  3UTB C;  1P3I A;  4WU8 C;  3UT9 A;  3AFA B;  1BH9 A;  4E44 A;  1P3A D;  2Y2K A;  5GXQ B;  3B0D C;  3X1U D;  5B31 B;  2VQR A;  5B1M D;  1P3K C;  1KX4 A;  4YS3 D;  5B2I A;  3AZK A;  1HQ3 C;  4J8V B;  5AV6 C;  3WTP B;  1U35 B;  1KX5 C;  3MNN B;  2PYO A;  1P3M A;  4KGC B;  3R45 B;  1ZLA C;  2IO5 C;  1P3B A;  4G91 C;  2L5A A;  3KUY C;  2ZM5 A;  1M1A D;  1P3L A;  4WNN A;  3H0M C;  3AN2 D;  1W2E A;  5AY8 C;  1M1A B;  4EO5 C;  3A6N C;  3AZL A;  4CAY B;  4G91 B;  3X1V C;  5DNM A;  5E5A C;  2IO5 B;  5B31 A;  3C1C B;  4J8X C;  1KX4 B;  5CP6 A;  3KUY D;  3AZF C;  1F1E A;  5JRG C;  4YM6 B;  3O62 D;  1P3O B;  5B0Y A;  2F2A C;  5AV8 D;  5CP6 D;  3KUY A;  4KGC A;  4H9R A;  3KXB A;  4H9N A;  4J8V D;  1JFI B;  5B31 G;  5E5A A;  5B1M B;  3AZH B;  4NE5 A;  3A6N A;  3AZF D;  5AV8 B;  1KX3 B;  3AFA C;  1M19 D;  3W98 C;  2HIO A;  4AWL B;  3REK A;  5JRG B;  5F99 B;  3A6N D;  5C3I C;  3C1C D;  4LD9 B;  5AV6 A;  3AZL B;  2RVQ D;  3REH B;  1TAF A;  4HGA C;  4XUJ D;  4EO5 B;  3C1C A;  4XZQ A;  3VH6 W;  3WA9 D;  3W96 A;  3WTP D;  5GT0 C;  5B31 D;  1BFM A;  5BT1 C;  4J8U C;  1P3A B;  5B2I C;  3AZK C;  3LEL B;  4H9N B;  4G92 C;  5GSU D;  3AZJ B;  4KGC D;  3LJA C;  3KXB D;  1KX5 B;  2Y2I A;  3A1I A;  1P34 C;  4J8W D;  5JRG A;  5F99 A;  3C1B A;  2BYK A;  5BT1 D;  4J8U D;  5B31 C;  4J8X A;  5B2J D;  4J8U B;  3REH A;  1P3F B;  3MVD B;  2Y2L A;  3B0D B;  1P3K B;  5AV9 C;  5AV9 B;  3UTA D;  4KUD B;  1BH8 B;  2ARO C;  3LZ0 C;  3AV1 B;  2NQB C;  4CSR B;  4R8P C;  3KSY A;  3LZ1 A;  3W97 C;  3X1U A;  3AYW C;  3WKJ A;  3EPH A;  1P3I D;  5B32 B;  5B2J C;  2BYM A;  5F99 C;  3UT9 D;  1P3P C;  3UT9 B;  3AZE B;  4J8W C;  4KUD C;  2RIQ A;  1KX5 A;  3VH6 T; 
#chains in the Genus database with same CATH homology
 3F6T A;  5B2I B;  3AZK B;  4KHA A;  5FUG B;  5CPJ B;  2F8N B;  1S32 A;  2NZD C;  2FJ7 C;  3AZN B;  3C1B B;  5B33 C;  1U35 A;  5GSU B;  3WAA D;  3MGR A;  4QLC C;  5B24 A;  4J8U A;  2XD1 A;  5F99 D;  3UT9 C;  4J8X D;  5JRG D;  1H3O A;  1P3I C;  4Z5T D;  4Z66 D;  1P3F D;  2CWE A;  4KUD A;  1BH8 A;  2BG1 A;  5G49 B;  5B24 D;  3REI A;  3AV2 B;  4CSR A;  3TU4 A;  1WWS A;  4X23 B;  4XUJ B;  3X1V D;  3W97 A;  3LZ1 C;  4QLC B;  5GT0 B;  3AZM B;  1TZY A;  4YM6 D;  3AZJ D;  3REK C;  3AFA A;  3W98 D;  4H9S A;  2JSS A;  1P34 D;  4QLC D;  3EPL A;  5AV5 B;  4J8V A;  3AZN A;  5C3I B;  4ZUX D;  4KGC C;  2DF4 C;  4YS3 B;  1S32 D;  1P34 A;  3EPJ A;  3O62 C;  3AZI C;  5CHL B;  3KFU G;  5E5A B;  4WU8 D;  1HTA A;  2Y2H A;  3AZF A;  3X1S C;  1P3A C;  1KX3 A;  3AV2 A;  3TU4 B;  3AYW D;  3AZG C;  3KWQ A;  3C1B D;  1P3G C;  1M19 B;  5CPK A;  1P3O C;  4X23 C;  1P3L B;  2HUE B;  5DNN C;  1M1A A;  5DNN D;  5GT0 A;  1M18 D;  1M18 C;  3WA9 C;  3W96 C;  3KWQ D;  4XZQ C;  2Y2P A;  4WZS B;  3C1C C;  3B6F C;  1P3B C;  1BH9 B;  1KU5 A;  5GXQ A;  3AZI D;  3MGQ A;  5B0Y B;  1M19 C;  3KUY B;  2F8N D;  3MGQ C;  3MNN D;  4ZUX A;  3AZN D;  5CPI D;  5CPI C;  5CPJ D;  2LY8 A;  5B40 A;  5AVC B;  3B6G D;  5B32 C;  5B2J B;  3VH5 T;  4WU8 A;  1P3P B;  3NQJ A;  2HIO D;  1EQZ B;  5BO0 A;  3X1T A;  3B6G A;  4JJN C;  5CPK C;  4H9Q B;  3MVD A;  2W8S A;  3AN2 C;  3W99 A;  2UWX A;  3A1K A;  5DNM C;  5AVC C;  3LEL D;  2JE5 A;  4CAY A;  3X1S A;  3AZM C;  2PYO C;  3O62 A;  1P3F C;  4H9O B;  5B1L C;  5GXQ D;  4YM6 A;  1ULY A;  2ZY5 A;  3MGS A;  1ID3 C;  3WAA C;  3EPK A;  5B40 B;  1P3M D;  1P3M C;  4UPK A;  4KUD D;  3AZH A;  1T3U A;  1TZY C;  5AVB A;  5GSU A;  1EQZ A;  1ID3 D;  2J8P A;  5B1L D;  1P3B D;  3REK B;  5BS7 C;  3REL B;  3LZ1 D;  1AOI B;  3V9R A;  1F66 C;  3AZG B;  1P3K A;  1A7W A;  3REI C;  1TAF B;  3W99 D;  1WWI A;  3AV1 A;  3WA9 A;  2ZY3 A;  1P3L D;  4M6B A;  3O62 B;  4XZQ B;  3REH D;  3MGP D;  3W97 B;  4LD9 D;  4QLC A;  4DRB A;  5GT3 B;  3MGR C;  1F66 A;  1KX4 D;  4ZBJ B;  5B33 D;  1P3G B;  5AV5 C;  1HQ3 B;  2Y2G A;  3H0L C;  2Y2Q A;  2NZD B;  5FUG A;  2NZD D;  3UTB B;  5GT3 C;  3MGR B;  1HQ3 D;  4YS3 C;  4YS3 A;  2G5I C;  3TU4 D;  1P34 B;  3REL A;  3REJ A;  1AOI A;  2BYK B;  2Y2J A;  4H9S C;  5B1L A;  3AZJ C;  5GT0 D;  3UTB D;  2G5H C;  3REI B;  2NQB B;  5AV9 A;  3B0C W;  3H0R C;  3X1V B;  4XUJ A;  5B0Z B;  5B0Z C;  5GT3 A;  3LZ1 B;  5B33 B;  3X1U B;  1TZY B;  3C1B C;  3REI D;  1P3G D;  1P3O D;  1B6W A;  2F8N H;  4Z5T C;  4Z66 C;  1B67 A;  2BYM B;  1R4V A;  3P5J B;  5AV5 A;  3X1S D;  3WAA B;  3MGP B;  5B40 C;  3LJA B;  2YFW A;  1U35 D;  2FJ7 A;  3MNN A;  4G92 B;  5CPI A;  5GSU C;  5AV8 C;  4R8P B;  3AZH C;  3AZE D;  5B24 B;  3X1T D;  3REK D;  4Z5T A;  4Z66 A;  5B1L B;  1AOI D;  3REL D;  5GXQ C;  5B2J A;  2ZY2 A;  2Y2O A;  3WKJ D;  3W97 D;  4XUJ C;  4ZBJ C;  4UUZ A;  3MGS C;  1ID3 A;  5JA4 A;  4YM6 C;  3AZM D;  2YFV A;  4JJN B;  3W99 B;  3UTA C;  4Z2M G;  3AZM A;  5CPK D;  4AWL C;  3MGS D;  3REL C;  3WAA A;  1KX3 C;  3MGP A;  2Y2N A;  3MVD C;  4WU9 B;  3WTP E;  3MGQ B;  3NQU A;  3B6G C;  2XD5 A;  5CPI B;  5B0Y C;  4H9R B;  3X1T C;  2PYO D;  3KXB B;  1KX5 D;  3IP4 C;  3AL0 C;  2PYO B;  2FJ7 D;  5BNX B;  5B1M A;  5CP6 C;  5AVC A;  5B32 G;  3R45 A;  4WU9 D;  5B2I D;  3MVD D;  3AZK D;  3B6F B;  1KX3 D;  3AZF B;  2HIO B;  3FDD A;  1EQZ D;  4DQY B;  4UUZ B;  5AVB B;  1P3P D;  5B0Z D;  5AVC D;  5BO0 B;  3LEL C;  3X1T B;  3WTP C;  3B6G B;  3KWQ B;  1M19 A;  5KDM A;  3V9R B;  5AY8 B;  5BNV B;  2NQB D;  4JJN D;  2HUE C;  2ARO D;  3LZ0 D;  3X1S B;  5DNM B;  3AZI B;  1ZLA A;  5AV9 D;  3UTA B;  4H9O A;  5AVB C;  1EQZ C;  3WTP A;  3W98 A;  4DRA A;  3LEL A;  2ZY4 A;  1P3O A;  1ZLA D;  3MGS B;  1P3G A;  3MNN C;  1HQ3 A;  5BNX A;  4ZUX B;  1Q9C A;  1U35 C;  3LJA D;  1S32 C;  3B0C T;  5B1M C;  5AV5 D;  3B6F A;  2NZD A;  3A6N B;  5B0Y D;  3UTB A;  4WU8 B;  1P3P A;  3NQJ B;  5KDM B;  4XZQ D;  3REJ B;  3KWQ C;  3AZG A;  3W96 D;  3MGP C;  5E5A D;  4LD9 A;  3AV2 C;  4WJ3 C;  3MGR D;  4X23 D;  4H9Q A;  3AZL C;  3WA9 B;  2NQB A;  3AZG D;  5DNN B;  1M18 B;  3AZI A;  2ARO A;  3LZ0 A;  3UTA A;  1ZLA B;  1P3L C;  5CP6 B;  3W96 B;  3AFA D;  2RVQ C;  3W98 B;  3EG5 B;  2JCH A;  5B32 A;  1AOI C;  3REJ C;  1Z2C B;  1F66 B;  1F66 D;  4J8V C;  3TU4 C;  4WU9 C;  2F8N G;  4ZUX C;  1JFI A;  1TZY D;  3AZE C;  3AZH D;  2F8N A;  1S32 B;  2FFF B;  5AV8 A;  3LJA A;  2CV5 A;  4J8X B;  1KX4 C;  3REJ D;  3VH6 A;  5AV6 B;  4Z5T B;  4NE6 A;  4Z66 B;  5G49 A;  1N1J B;  1PZR A;  4H9P B;  5DNM D;  2CV5 D;  5DNN A;  3AV1 D;  4J8W A;  2ARO B;  3LZ0 B;  3AV1 C;  1M18 A;  1M1A C;  4X23 A;  5AY8 D;  3B0B A;  5JA4 B;  5B24 C;  5B0Z A;  3AN2 B;  3WKJ C;  3AV2 D;  5B33 A;  3AYW A;  5BS7 A;  2CV5 C;  1P3A A;  5B32 D;  4NFT A;  1P3I B;  2HIO C;  3AZJ A;  3AZE A;  3VH5 A;  5GT3 D;  4E45 A;  4WU9 A;  4KHA B;  2YFW B;  3AZN C;  5CPJ A;  2FJ7 B;  5B40 D;  3NQU B;  2CV5 B;  2Y2M A;  5CPJ C;  3X1U C;  1P3K D;  3KXB C;  5AV6 D;  4R8P A;  4NE3 A;  1P3M B;  3MGQ D;  1N1J A;  4H9P A;  1P3F A;  1H3O B;  3VH5 W;  5AVB D;  4J8W B;  4R8P D;  1P3B B;  2F8N K;  3B6F D;  3REH C;  5CPK B;  1ID3 B;  2DQN C;  4LD9 C;  2YFV B;  3X1V A;  4HGA B;  3W99 C;  3AN2 A;  3AZL D;  4JJN A;  3AYW B;  5AY8 A;  5BNV A;  3WKJ B;  4WV4 B;  4WNN B;  4Z2M H;  3UTB C;  1P3I A;  4WU8 C;  3UT9 A;  3AFA B;  1BH9 A;  4E44 A;  1P3A D;  2Y2K A;  5GXQ B;  3B0D C;  3X1U D;  5B31 B;  2VQR A;  5B1M D;  1P3K C;  1KX4 A;  4YS3 D;  5B2I A;  3AZK A;  1HQ3 C;  4J8V B;  5AV6 C;  3WTP B;  1U35 B;  1KX5 C;  3MNN B;  2PYO A;  1P3M A;  4KGC B;  3R45 B;  1ZLA C;  2IO5 C;  1P3B A;  4G91 C;  2L5A A;  3KUY C;  2ZM5 A;  1M1A D;  1P3L A;  4WNN A;  3H0M C;  3AN2 D;  1W2E A;  5AY8 C;  1M1A B;  4EO5 C;  3A6N C;  3AZL A;  4CAY B;  4G91 B;  3X1V C;  5DNM A;  5E5A C;  2IO5 B;  5B31 A;  3C1C B;  4J8X C;  1KX4 B;  5CP6 A;  3KUY D;  3AZF C;  1F1E A;  5JRG C;  4YM6 B;  3O62 D;  1P3O B;  5B0Y A;  2F2A C;  5AV8 D;  5CP6 D;  3KUY A;  4KGC A;  4H9R A;  3KXB A;  4H9N A;  4J8V D;  1JFI B;  5B31 G;  5E5A A;  5B1M B;  3AZH B;  4NE5 A;  3A6N A;  3AZF D;  5AV8 B;  1KX3 B;  3AFA C;  1M19 D;  3W98 C;  2HIO A;  4AWL B;  3REK A;  5JRG B;  5F99 B;  3A6N D;  5C3I C;  3C1C D;  4LD9 B;  5AV6 A;  3AZL B;  2RVQ D;  3REH B;  1TAF A;  4HGA C;  4XUJ D;  4EO5 B;  3C1C A;  4XZQ A;  3VH6 W;  3WA9 D;  3W96 A;  3WTP D;  5GT0 C;  5B31 D;  1BFM A;  5BT1 C;  4J8U C;  1P3A B;  5B2I C;  3AZK C;  3LEL B;  4H9N B;  4G92 C;  5GSU D;  3AZJ B;  4KGC D;  3LJA C;  3KXB D;  1KX5 B;  2Y2I A;  3A1I A;  1P34 C;  4J8W D;  5JRG A;  5F99 A;  3C1B A;  2BYK A;  5BT1 D;  4J8U D;  5B31 C;  4J8X A;  5B2J D;  4J8U B;  3REH A;  1P3F B;  3MVD B;  2Y2L A;  3B0D B;  1P3K B;  5AV9 C;  5AV9 B;  3UTA D;  4KUD B;  1BH8 B;  2ARO C;  3LZ0 C;  3AV1 B;  2NQB C;  4CSR B;  4R8P C;  3KSY A;  3LZ1 A;  3W97 C;  3X1U A;  3AYW C;  3WKJ A;  3EPH A;  1P3I D;  5B32 B;  5B2J C;  2BYM A;  5F99 C;  3UT9 D;  1P3P C;  3UT9 B;  3AZE B;  4J8W C;  4KUD C;  2RIQ A;  1KX5 A;  3VH6 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...