3AZHD

Crystal structure of human nucleosome core particle containing h3k122q mutation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
95
structure length
95
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azhD00
3B0DC 2F8NG 4YS3B 2HUEC 3REKC 3AZMA 3REIB 3B0CT 3KUYD 2AROD 3X1SD 3AZEB 3MNND 3AZGC 1S32C 1P34A 3A6ND 3W98B 5AV9D 4E45A 5AV6D 3AZLB 2BYKB 3B6GC 3VH6T 5GT3B 3AV1D 1P3KB 4R8PA 5B1LC 5GT3C 1EQZD 3AZND 1P3LC 3WKJC 4NE3A 3KUYA 2AROA 3X1SA 3C1CD 5BNXB 1P3IC 1P3FA 1KX4D 1ZLAD 4J8WD 3REHC 3AZHB 3A6NA 3W99D 3UTBD 4ZUXA 4R8PB 5AV9A 3UTAD 5B2JB 2NQBC 5AV6A 4J8UD 4J8VB 1P3FB 2PYOC 3X1SB 3WA9C 4H9OB 3AV1A 5BT1C 4ZUXB 5B2ID 4Z5TC 1KX4A 3C1CA 3MGRB 3AN2D 1ZLAA 4J8WA 5B1MB 5GSUD 4H9SA 5B24A 1H3OA 3UTBA 3UTAA 4WU9D 3AFAD 1JFIB 4J8UA 3REJB 5AV8C 5B33C 3KSYA 3VH6A 3MGPD 4JJNB 3AZIB 5AY8D 3UT9C 3AZIC 1ZLAB 4J8WB 3WAAB 1ID3C 5B31C 5B24B 1H3OB 5GT0D 3TU4A 3AV2C 4ZBJB 1TZYB 2BYMB 5B2IA 3AZFD 4J8UB 1KX5D 3LELD 5FUGB 5GSUA 3KWQC 2IO5B 5JRGD 4KUDB 1P3MB 4XZQB 5DNMC 3X1TD 4WU9A 3R45A 3AFAA 1M18B 5AV5B 3MVDD 3TU4B 5CPKB 1U35C 4H9RA 3MGPA 5CP6C 5AVBD 5B40C 3WTPD 3AZKC 1M19D 5KDMA 3MGSD 5GT0A 3X1VA 4H9QA 1P3AD 3R45B 3AZFA 1P3BC 4Z66C 1P3GD 1KX5A 3LELA 4H9RB 5AVCB 5DNNA 3X1UA 3MGQB 5JRGA 3RELC 3AZJA 4XUJB 3X1TA 3NQUA 5CPJA 5KDMB 3MVDA 4CAYA 3X1VB 4YS3D 1AOIA 5AVBA 3REID 1HQ3C 5DNNB 3AZED 3X1UB 4LD9B 5JRGB 3MGSA 5E5AC 5BS7C 3AZJB 5CPJB 3X1TB 3W98D 2NZDB 1BH9A 3MVDB 4CAYB 1P3GA 3W96B 1TAFB 4HGAC 2YFWA 5F99B 1AOIB 3AZLD 3B6GD 3LZ0C 5GT3D 4KGCC 1P3KD 4QLCC 4YS3A 4M6BA 3NQJB 3REIA 5CPIB 1P3ID 1P3OC 3AZGA 2F8NH 1S32A 4YM6C 3AZHD 3W98A 3AYWB 1HTAA 3AYWC 2HUEB 4DRBA 5B2JD 3REKB 4WU8C 5BO0B 2RVQC 3AZLA 3B6GA 4J8VD 2BYKA 4EO5C 1P3FD 5B1LA 5GT3A 3AZGB 5BT1D 2LY8A 1P3KA 1S32B 3WKJA 3C1BC 4ZUXD 5GXQC 4Z2MH 2L5AA 1P3IA 5BNXA 1BH8B 3MGRD 3B6GB 2FJ7C 5B1MD 2JSSA 5B1LB 5B0YC 3AZHA 1P3PC 1P3LB 2NQBA 2YFVB 5B2JA 3WKJB 3REJD 4J8VA 1KX3C 1P3IB 2HIOC 4JJND 3AZID 4H9OA 4UUZA 3REHB 5B31D 3WAAD 5B24D 2NQBB 1TZYD 3LZ1B 3LZ1C 3MGRA 4X23C 2PYOB 3WA9B 3B0BA 5B1MA 5BNVB 3AZMC 4CSRA 4KUDD 1P3MD 4XZQD 4UUZB 3VH5W 5JA4A 1M18D 5AV5D 5AV8A 1JFIA 3REJA 3TU4D 4Z5TB 5CPKD 1P34C 3UT9A 4JJNA 1F66B 3AZIA 4G92C 1F66C 4E44A 4J8XC 5B31A 1ID3A 3WAAA 3AV2A 4CSRB 1TZYA 2BYMA 5JA4B 5AV8B 5B33B 5AVCD 5FUGA 3UT9B 3MGQD 4KUDA 1P3MA 4XZQA 2AROC 4XUJD 1ID3B 5B31B 1M18A 3AV2B 5AV5A 3MNNC 3X1VD 5CP6A 5CPKA 3A6NC 5G49B 4NE5A 3AZKA 1WWSA 1HQ3D 3KWQB 3B6FB 5DNND 3X1UD 3B6FC 5DNMB 4LD9D 3AZJD 5CPJD 1P3BA 2NZDD 4Z66A 3AV1C 1EQZC 3AZNC 1U35B 3W96D 5B32B 5CP6B 5F99D 5B32C 5AVCA 5B40B 3RELA 3MGQA 1AOID 1B6WA 3LZ0D 3AZKB 4KGCD 4XUJA 1KX4C 1P3BB 3W99C 4Z66B 3UTBC 3UTAC 1HQ3A 5CPID 1R4VA 3RELB 5B31G 5E5AA 4YM6D 4LD9A 2NZDA 3VH5T 3AYWD 3W96A 2RVQD 1TAFA 3REKD 5F99A 3LZ0A 4KGCA 3B0CW 1HQ3B 3AZGD 3AN2C 5E5AB 1S32D 5GSUC 5GXQD 1P3OA 4HGAB 3NQJA 4WU9C 5CPIA 4YM6A 3LZ0B 4KGCB 3VH6W 3MGPC 5B1LD 5AY8C 3AYWA 1P3LD 4QLCB 3REKA 3WKJD 5BO0A 5GT0C 1KX3D 1P3OB 4AWLC 3AZFC 2CWEA 3W97C 4YM6B 1KX5C 3REHD 3LELC 1M1AC 5GXQA 5C3IC 2NQBD 3LZ1D 4WU8B 1BH8A 4EO5B 2PYOD 3WA9D 5AVBC 3O62C 1P3LA 3WTPC 1M19C 2YFVA 3C1BB 1N1JA 5GXQB 3V9RB 5B0ZC 3MGSC 1KX3A 4Z5TD 1P3AC 1F66D 3LJAC 2FJ7B 3REHA 5B0YB 1P3PB 2CV5C 4G91C 3LZ1A 1N1JB 5AV8D 4X23A 4KHAB 5B33D 3KXBC 1KX3B 2HIOB 2PYOA 4YS3C 3WA9A 3UT9D 5BNVA 3REIC 1ID3D 3AZEC 3AV2D 4Z5TA 3W98C 1F66A 4X23B 4NE6A 4J8XA 3KWQD 3AZMB 3B6FD 3AZLC 4Z2MG 5DNMD 1BFMA 1P3KC 5B33A 1U35D 1P34B 5B32D 5CP6D 4G92B 5B40D 3AZKD 4J8XB 4H9NA 3MNNA 1A7WA 3AZHC 1P3BD 4Z66D 4R8PC 1F1EA 5G49A 5B2JC 3KWQA 3B6FA 3RELD 5DNMA 2AROB 5CHLB 3KUYB 4J8VC 3KUYC 1P3FC 3X1SC 4H9NB 3MNNB 1EQZA 3AZNA 1U35A 3A6NB 5B32A 5AV9B 5B40A 4ZUXC 1WWIA 5AV9C 5AV6B 5AV6C 1ULYA 3MGRC 5E5AD 3W99A 5B1MC 3AV1B 1EQZB 3AZNB 3REJC 1KX4B 3C1CB 4JJNC 3C1CC 1ZLAC 4QLCD 4J8WC 3WAAC 3UTBB 3W99B 4H9SC 3UTAB 5B24C 4H9PA 4ZBJC 3WTPE 1TZYC 1P3OD 3W97D 3AN2A 1Q9CA 2F8ND 4J8UC 5BS7A 1M1AD 2IO5C 4KUDC 1P3MC 4XZQC 4WZSB 4WU8D 1M18C 5AV5C 3TU4C 4H9PB 5B2IB 4WNNA 5CPKC 5AY8A 5B2IC 3O62D 3AN2B 5GSUB 4QLCA 5B0ZD 3C1BD 2F8NK 5B32G 4WU9B 3AFAB 1KU5A 3LJAD 3W97A 3AFAC 2F8NA 2FJ7D 2CV5D 4WNNB 3MGPB 1M1AA 5B0YD 5AY8B 5AVCC 1P3PD 3MGQC 4XUJC 4WU8A 3KXBD 5GT0B 4NFTA 4H9QB 3X1VC 4AWLB 2HIOD 3AZFB 3O62A 3W97B 2F8NB 3WTPA 1KX5B 3LELB 1M19A 1M1AB 5B0ZA 5DNNC 3C1BA 5C3IB 3X1UC 3V9RA 4LD9C 5JRGC 3NQUB 1P3AA 3AZJC 5CPJC 3X1TC 3LJAA 2NZDC 3MVDC 4X23D 2FJ7A 3W96C 2CV5A 5AVBB 5B0YA 5F99C 3O62B 3AZMD 1P3PA 1AOIC 3WTPB 3VH5A 1M19B 3KXBA 3MGSB 5B0ZB 4KHAA 1P34D 1P3AB 1BH9B 2HIOA 3LJAB 1P3GB 2YFWB 1P3GC 4J8XD 5CPIC 1B67A 4G91B 3AZEA 2CV5B 4DRAA 4R8PD 3KXBB 3B0DB 4WV4B
chains in the Genus database with same CATH superfamily
3B0DC 2F8NG 4YS3B 2HUEC 3REKC 3AZMA 3REIB 3B0CT 3KUYD 2AROD 3X1SD 3AZEB 3MNND 3AZGC 1S32C 1P34A 3A6ND 3W98B 2Y2QA 5AV9D 4E45A 5AV6D 2F2AC 3AZLB 2BYKB 3B6GC 3VH6T 5GT3B 2Y2KA 3AV1D 1P3KB 4R8PA 5B1LC 5GT3C 1EQZD 3AZND 1P3LC 3WKJC 4NE3A 3KUYA 2AROA 3X1SA 3C1CD 5BNXB 1P3IC 1P3FA 1KX4D 1ZLAD 4J8WD 2G5HC 3REHC 3AZHB 3A6NA 1Z2CB 3W99D 3UTBD 4ZUXA 4R8PB 5AV9A 3UTAD 5B2JB 2NQBC 5AV6A 4J8UD 4J8VB 1P3FB 2PYOC 3X1SB 3WA9C 4H9OB 3AV1A 5BT1C 4ZUXB 2VQRA 5B2ID 4Z5TC 1KX4A 3C1CA 3MGRB 3AN2D 2XD5A 1ZLAA 4J8WA 5B1MB 5GSUD 4H9SA 5B24A 1H3OA 3UTBA 3UTAA 4WU9D 3AFAD 1JFIB 4J8UA 3REJB 5AV8C 5B33C 3KSYA 3VH6A 3MGPD 4JJNB 3AZIB 5AY8D 3UT9C 3AZIC 4UPKA 4J8WB 1ZLAB 3WAAB 1ID3C 5B31C 5B24B 1H3OB 5GT0D 3TU4A 3AV2C 4ZBJB 1TZYB 2BYMB 5B2IA 3AZFD 4J8UB 1KX5D 3LELD 5FUGB 2BG1A 5GSUA 3KWQC 2IO5B 5JRGD 4KUDB 1P3MB 4XZQB 3IP4C 5DNMC 3X1TD 3EG5B 4WU9A 3R45A 3AFAA 1M18B 5AV5B 3MVDD 3TU4B 5CPKB 1U35C 4H9RA 3MGPA 5CP6C 5AVBD 5B40C 3A1IA 3WTPD 3AZKC 1M19D 5KDMA 3MGSD 5GT0A 3X1VA 2JE5A 4H9QA 2G5IC 1P3AD 3R45B 3AZFA 1P3BC 4Z66C 1P3GD 1KX5A 3F6TA 3LELA 4H9RB 5AVCB 3KFUG 5DNNA 3X1UA 3MGQB 5JRGA 3RELC 4DQYB 3AZJA 4XUJB 3X1TA 3NQUA 5CPJA 5KDMB 3MVDA 4CAYA 3X1VB 2RIQA 4YS3D 1AOIA 5AVBA 3REID 1HQ3C 5DNNB 3AZED 3X1UB 4LD9B 5JRGB 3MGSA 5E5AC 5BS7C 3AZJB 5CPJB 3X1TB 3W98D 2NZDB 1BH9A 3MVDB 4CAYB 1P3GA 3W96B 1TAFB 4HGAC 2YFWA 5F99B 1AOIB 3AZLD 3B6GD 3FDDA 3LZ0C 5GT3D 4KGCC 1P3KD 4QLCC 2ZM5A 4YS3A 4M6BA 2Y2MA 3NQJB 3REIA 5CPIB 1P3ID 1P3OC 3AZGA 2F8NH 1S32A 4YM6C 3AZHD 3W98A 3H0RC 3AYWB 1HTAA 3AYWC 2HUEB 4DRBA 5B2JD 2JCHA 3REKB 4WU8C 5BO0B 2RVQC 3AZLA 3B6GA 4J8VD 2BYKA 4EO5C 1P3FD 5B1LA 5GT3A 3AZGB 5BT1D 3EPHA 2LY8A 1P3KA 1S32B 3WKJA 2Y2JA 3C1BC 4ZUXD 5GXQC 4Z2MH 2L5AA 1P3IA 5BNXA 1BH8B 3MGRD 3B6GB 2FJ7C 5B1MD 2JSSA 5B1LB 5B0YC 3AZHA 1P3PC 1P3LB 2NQBA 2YFVB 2ZY4A 5B2JA 3WKJB 3REJD 4J8VA 1KX3C 1P3IB 2HIOC 4JJND 3AZID 2XD1A 4H9OA 4UUZA 3REHB 5B31D 3WAAD 5B24D 2NQBB 1TZYD 3LZ1B 3LZ1C 3MGRA 4X23C 2PYOB 3WA9B 3B0BA 5B1MA 5BNVB 3AZMC 4CSRA 3P5JB 4KUDD 1P3MD 4XZQD 4UUZB 3VH5W 5JA4A 1M18D 5AV5D 5AV8A 1JFIA 3REJA 2W8SA 3TU4D 4Z5TB 5CPKD 1P34C 2Y2PA 3UT9A 4JJNA 1F66B 3AZIA 4G92C 1F66C 4E44A 4J8XC 5B31A 1ID3A 3WAAA 3AV2A 4CSRB 1TZYA 2BYMA 5JA4B 5AV8B 5B33B 2J8PA 5AVCD 5FUGA 3UT9B 3MGQD 4KUDA 2ZY5A 1P3MA 4XZQA 2AROC 4XUJD 1ID3B 5B31B 1M18A 3AV2B 5AV5A 3MNNC 3X1VD 5CP6A 5CPKA 3A6NC 2ZY2A 5G49B 4NE5A 3AZKA 1WWSA 1HQ3D 3KWQB 3B6FB 5DNND 3X1UD 3B6FC 5DNMB 4LD9D 3AZJD 5CPJD 1P3BA 2NZDD 4Z66A 3AV1C 1EQZC 3AZNC 1U35B 3W96D 5B32B 5CP6B 5F99D 5B32C 5AVCA 5B40B 3RELA 3MGQA 1AOID 1B6WA 3LZ0D 3AZKB 3AL0C 4KGCD 4XUJA 1KX4C 1P3BB 3W99C 4Z66B 3UTBC 3UTAC 1HQ3A 5CPID 1R4VA 3RELB 5B31G 5E5AA 4YM6D 4LD9A 2NZDA 3VH5T 3AYWD 3W96A 2RVQD 1TAFA 3REKD 5F99A 3LZ0A 4KGCA 3B0CW 1HQ3B 3AZGD 3AN2C 5E5AB 1S32D 5GSUC 5GXQD 1P3OA 4HGAB 3NQJA 4WU9C 5CPIA 4YM6A 3LZ0B 4KGCB 3VH6W 3MGPC 5B1LD 5AY8C 3AYWA 1P3LD 4QLCB 3REKA 3WKJD 5BO0A 5GT0C 1KX3D 1P3OB 4AWLC 3AZFC 2CWEA 3W97C 4YM6B 1KX5C 3REHD 3LELC 1M1AC 5GXQA 5C3IC 2NQBD 1W2EA 3LZ1D 4WU8B 1BH8A 3A1KA 4EO5B 2PYOD 3WA9D 5AVBC 3O62C 1T3UA 3WTPC 1P3LA 1M19C 2YFVA 3C1BB 3V9RB 1N1JA 2ZY3A 5GXQB 5B0ZC 3MGSC 1KX3A 4Z5TD 1P3AC 1F66D 3LJAC 2FJ7B 3REHA 3H0MC 5B0YB 1P3PB 2CV5C 4G91C 3LZ1A 1N1JB 5AV8D 4X23A 4KHAB 5B33D 3KXBC 1KX3B 2HIOB 2PYOA 4YS3C 3WA9A 3UT9D 5BNVA 3REIC 1ID3D 3AZEC 3H0LC 3AV2D 4Z5TA 3W98C 1F66A 4X23B 4NE6A 4J8XA 4WJ3C 3KWQD 3AZMB 3B6FD 3AZLC 4Z2MG 5DNMD 1BFMA 1P3KC 5B33A 1U35D 1P34B 5B32D 5CP6D 4G92B 5B40D 3AZKD 4J8XB 4H9NA 3MNNA 1A7WA 3AZHC 1P3BD 2Y2NA 4Z66D 4R8PC 1PZRA 1F1EA 5G49A 5B2JC 3KWQA 3B6FA 2UWXA 3RELD 5DNMA 2AROB 5CHLB 3KUYB 4J8VC 3KUYC 1P3FC 3X1SC 4H9NB 3MNNB 1EQZA 3AZNA 1U35A 3A6NB 2FFFB 5B32A 5AV9B 5B40A 4ZUXC 1WWIA 5AV9C 5AV6B 5AV6C 2Y2GA 1ULYA 3MGRC 5E5AD 2Y2HA 5B1MC 3AV1B 3W99A 1EQZB 3AZNB 3REJC 1KX4B 3C1CB 4JJNC 3C1CC 1ZLAC 4QLCD 4J8WC 3WAAC 3UTBB 3W99B 4H9SC 3UTAB 5B24C 4H9PA 4ZBJC 3WTPE 1TZYC 1P3OD 3W97D 3AN2A 1Q9CA 2F8ND 2DQNC 4J8UC 5BS7A 1M1AD 2Y2IA 2IO5C 4KUDC 1P3MC 4XZQC 4WZSB 4WU8D 1M18C 5AV5C 3TU4C 4H9PB 5B2IB 4WNNA 5CPKC 5AY8A 5B2IC 3O62D 3AN2B 5GSUB 3EPLA 4QLCA 5B0ZD 3C1BD 2F8NK 5B32G 2Y2OA 4WU9B 3AFAB 1KU5A 3LJAD 3W97A 3AFAC 2F8NA 2FJ7D 2CV5D 4WNNB 3MGPB 1M1AA 5B0YD 5AY8B 5AVCC 1P3PD 3MGQC 4XUJC 4WU8A 3KXBD 5GT0B 4NFTA 4H9QB 3X1VC 4AWLB 2HIOD 3AZFB 3O62A 3W97B 2F8NB 3WTPA 1KX5B 3LELB 1M19A 1M1AB 5B0ZA 5DNNC 3C1BA 5C3IB 3X1UC 3V9RA 4LD9C 5JRGC 3NQUB 1P3AA 2Y2LA 3AZJC 5CPJC 3X1TC 3LJAA 2NZDC 3MVDC 4X23D 2FJ7A 3W96C 2CV5A 5AVBB 5B0YA 5F99C 3O62B 3AZMD 1P3PA 1AOIC 3WTPB 3VH5A 3EPKA 1M19B 3KXBA 3MGSB 5B0ZB 3EPJA 4KHAA 1P34D 1P3AB 1BH9B 2HIOA 2DF4C 3LJAB 1P3GB 2YFWB 1P3GC 4J8XD 5CPIC 1B67A 4G91B 3AZEA 2CV5B 4DRAA 4R8PD 3KXBB 3B0DB 4WV4B
chains in the Genus database with same CATH topology
3B0DC 2F8NG 4YS3B 2HUEC 3REKC 3AZMA 3REIB 3B0CT 3KUYD 2AROD 3X1SD 3AZEB 3MNND 3AZGC 1S32C 1P34A 3A6ND 3W98B 2Y2QA 5AV9D 4E45A 5AV6D 2F2AC 3AZLB 2BYKB 3B6GC 3VH6T 5GT3B 2Y2KA 3AV1D 1P3KB 4R8PA 5B1LC 5GT3C 1EQZD 3AZND 1P3LC 3WKJC 4NE3A 3KUYA 2AROA 3X1SA 3C1CD 5BNXB 1P3IC 1P3FA 1KX4D 1ZLAD 4J8WD 2G5HC 3REHC 3AZHB 3A6NA 1Z2CB 3W99D 3UTBD 4ZUXA 4R8PB 5AV9A 3UTAD 5B2JB 2NQBC 5AV6A 4J8UD 4J8VB 1P3FB 2PYOC 3X1SB 3WA9C 4H9OB 3AV1A 5BT1C 4ZUXB 2VQRA 5B2ID 4Z5TC 1KX4A 3C1CA 3MGRB 3AN2D 2XD5A 1ZLAA 4J8WA 5B1MB 5GSUD 4H9SA 5B24A 1H3OA 3UTBA 3UTAA 4WU9D 3AFAD 1JFIB 4J8UA 3REJB 5AV8C 5B33C 3KSYA 3VH6A 3MGPD 4JJNB 3AZIB 5AY8D 3UT9C 3AZIC 4UPKA 4J8WB 1ZLAB 3WAAB 1ID3C 5B31C 5B24B 1H3OB 5GT0D 3TU4A 3AV2C 4ZBJB 1TZYB 2BYMB 5B2IA 3AZFD 4J8UB 1KX5D 3LELD 5FUGB 2BG1A 5GSUA 3KWQC 2IO5B 5JRGD 4KUDB 1P3MB 4XZQB 3IP4C 5DNMC 3X1TD 3EG5B 4WU9A 3R45A 3AFAA 1M18B 5AV5B 3MVDD 3TU4B 5CPKB 1U35C 4H9RA 3MGPA 5CP6C 5AVBD 5B40C 3A1IA 3WTPD 3AZKC 1M19D 5KDMA 3MGSD 5GT0A 3X1VA 2JE5A 4H9QA 2G5IC 1P3AD 3R45B 3AZFA 1P3BC 4Z66C 1P3GD 1KX5A 3F6TA 3LELA 4H9RB 5AVCB 3KFUG 5DNNA 3X1UA 3MGQB 5JRGA 3RELC 4DQYB 3AZJA 4XUJB 3X1TA 3NQUA 5CPJA 5KDMB 3MVDA 4CAYA 3X1VB 2RIQA 4YS3D 1AOIA 5AVBA 3REID 1HQ3C 5DNNB 3AZED 3X1UB 4LD9B 5JRGB 3MGSA 5E5AC 5BS7C 3AZJB 5CPJB 3X1TB 3W98D 2NZDB 1BH9A 3MVDB 4CAYB 1P3GA 3W96B 1TAFB 4HGAC 2YFWA 5F99B 1AOIB 3AZLD 3B6GD 3FDDA 3LZ0C 5GT3D 4KGCC 1P3KD 4QLCC 2ZM5A 4YS3A 4M6BA 2Y2MA 3NQJB 3REIA 5CPIB 1P3ID 1P3OC 3AZGA 2F8NH 1S32A 4YM6C 3AZHD 3W98A 3H0RC 3AYWB 1HTAA 3AYWC 2HUEB 4DRBA 5B2JD 2JCHA 3REKB 4WU8C 5BO0B 2RVQC 3AZLA 3B6GA 4J8VD 2BYKA 4EO5C 1P3FD 5B1LA 5GT3A 3AZGB 5BT1D 3EPHA 2LY8A 1P3KA 1S32B 3WKJA 2Y2JA 3C1BC 4ZUXD 5GXQC 4Z2MH 2L5AA 1P3IA 5BNXA 1BH8B 3MGRD 3B6GB 2FJ7C 5B1MD 2JSSA 5B1LB 5B0YC 3AZHA 1P3PC 1P3LB 2NQBA 2YFVB 2ZY4A 5B2JA 3WKJB 3REJD 4J8VA 1KX3C 1P3IB 2HIOC 4JJND 3AZID 2XD1A 4H9OA 4UUZA 3REHB 5B31D 3WAAD 5B24D 2NQBB 1TZYD 3LZ1B 3LZ1C 3MGRA 4X23C 2PYOB 3WA9B 3B0BA 5B1MA 5BNVB 3AZMC 4CSRA 3P5JB 4KUDD 1P3MD 4XZQD 4UUZB 3VH5W 5JA4A 1M18D 5AV5D 5AV8A 1JFIA 3REJA 2W8SA 3TU4D 4Z5TB 5CPKD 1P34C 2Y2PA 3UT9A 4JJNA 1F66B 3AZIA 4G92C 1F66C 4E44A 4J8XC 5B31A 1ID3A 3WAAA 3AV2A 4CSRB 1TZYA 2BYMA 5JA4B 5AV8B 5B33B 2J8PA 5AVCD 5FUGA 3UT9B 3MGQD 4KUDA 2ZY5A 1P3MA 4XZQA 2AROC 4XUJD 1ID3B 5B31B 1M18A 3AV2B 5AV5A 3MNNC 3X1VD 5CP6A 5CPKA 3A6NC 2ZY2A 5G49B 4NE5A 3AZKA 1WWSA 1HQ3D 3KWQB 3B6FB 5DNND 3X1UD 3B6FC 5DNMB 4LD9D 3AZJD 5CPJD 1P3BA 2NZDD 4Z66A 3AV1C 1EQZC 3AZNC 1U35B 3W96D 5B32B 5CP6B 5F99D 5B32C 5AVCA 5B40B 3RELA 3MGQA 1AOID 1B6WA 3LZ0D 3AZKB 3AL0C 4KGCD 4XUJA 1KX4C 1P3BB 3W99C 4Z66B 3UTBC 3UTAC 1HQ3A 5CPID 1R4VA 3RELB 5B31G 5E5AA 4YM6D 4LD9A 2NZDA 3VH5T 3AYWD 3W96A 2RVQD 1TAFA 3REKD 5F99A 3LZ0A 4KGCA 3B0CW 1HQ3B 3AZGD 3AN2C 5E5AB 1S32D 5GSUC 5GXQD 1P3OA 4HGAB 3NQJA 4WU9C 5CPIA 4YM6A 3LZ0B 4KGCB 3VH6W 3MGPC 5B1LD 5AY8C 3AYWA 1P3LD 4QLCB 3REKA 3WKJD 5BO0A 5GT0C 1KX3D 1P3OB 4AWLC 3AZFC 2CWEA 3W97C 4YM6B 1KX5C 3REHD 3LELC 1M1AC 5GXQA 5C3IC 2NQBD 1W2EA 3LZ1D 4WU8B 1BH8A 3A1KA 4EO5B 2PYOD 3WA9D 5AVBC 3O62C 1T3UA 3WTPC 1P3LA 1M19C 2YFVA 3C1BB 3V9RB 1N1JA 2ZY3A 5GXQB 5B0ZC 3MGSC 1KX3A 4Z5TD 1P3AC 1F66D 3LJAC 2FJ7B 3REHA 3H0MC 5B0YB 1P3PB 2CV5C 4G91C 3LZ1A 1N1JB 5AV8D 4X23A 4KHAB 5B33D 3KXBC 1KX3B 2HIOB 2PYOA 4YS3C 3WA9A 3UT9D 5BNVA 3REIC 1ID3D 3AZEC 3H0LC 3AV2D 4Z5TA 3W98C 1F66A 4X23B 4NE6A 4J8XA 4WJ3C 3KWQD 3AZMB 3B6FD 3AZLC 4Z2MG 5DNMD 1BFMA 1P3KC 5B33A 1U35D 1P34B 5B32D 5CP6D 4G92B 5B40D 3AZKD 4J8XB 4H9NA 3MNNA 1A7WA 3AZHC 1P3BD 2Y2NA 4Z66D 4R8PC 1PZRA 1F1EA 5G49A 5B2JC 3KWQA 3B6FA 2UWXA 3RELD 5DNMA 2AROB 5CHLB 3KUYB 4J8VC 3KUYC 1P3FC 3X1SC 4H9NB 3MNNB 1EQZA 3AZNA 1U35A 3A6NB 2FFFB 5B32A 5AV9B 5B40A 4ZUXC 1WWIA 5AV9C 5AV6B 5AV6C 2Y2GA 1ULYA 3MGRC 5E5AD 2Y2HA 5B1MC 3AV1B 3W99A 1EQZB 3AZNB 3REJC 1KX4B 3C1CB 4JJNC 3C1CC 1ZLAC 4QLCD 4J8WC 3WAAC 3UTBB 3W99B 4H9SC 3UTAB 5B24C 4H9PA 4ZBJC 3WTPE 1TZYC 1P3OD 3W97D 3AN2A 1Q9CA 2F8ND 2DQNC 4J8UC 5BS7A 1M1AD 2Y2IA 2IO5C 4KUDC 1P3MC 4XZQC 4WZSB 4WU8D 1M18C 5AV5C 3TU4C 4H9PB 5B2IB 4WNNA 5CPKC 5AY8A 5B2IC 3O62D 3AN2B 5GSUB 3EPLA 4QLCA 5B0ZD 3C1BD 2F8NK 5B32G 2Y2OA 4WU9B 3AFAB 1KU5A 3LJAD 3W97A 3AFAC 2F8NA 2FJ7D 2CV5D 4WNNB 3MGPB 1M1AA 5B0YD 5AY8B 5AVCC 1P3PD 3MGQC 4XUJC 4WU8A 3KXBD 5GT0B 4NFTA 4H9QB 3X1VC 4AWLB 2HIOD 3AZFB 3O62A 3W97B 2F8NB 3WTPA 1KX5B 3LELB 1M19A 1M1AB 5B0ZA 5DNNC 3C1BA 5C3IB 3X1UC 3V9RA 4LD9C 5JRGC 3NQUB 1P3AA 2Y2LA 3AZJC 5CPJC 3X1TC 3LJAA 2NZDC 3MVDC 4X23D 2FJ7A 3W96C 2CV5A 5AVBB 5B0YA 5F99C 3O62B 3AZMD 1P3PA 1AOIC 3WTPB 3VH5A 3EPKA 1M19B 3KXBA 3MGSB 5B0ZB 3EPJA 4KHAA 1P34D 1P3AB 1BH9B 2HIOA 2DF4C 3LJAB 1P3GB 2YFWB 1P3GC 4J8XD 5CPIC 1B67A 4G91B 3AZEA 2CV5B 4DRAA 4R8PD 3KXBB 3B0DB 4WV4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B0D C;  2F8N G;  4YS3 B;  2HUE C;  3REK C;  3AZM A;  3REI B;  3B0C T;  3KUY D;  2ARO D;  3X1S D;  3AZE B;  3MNN D;  3AZG C;  1S32 C;  1P34 A;  3A6N D;  3W98 B;  5AV9 D;  4E45 A;  5AV6 D;  3AZL B;  2BYK B;  3B6G C;  3VH6 T;  5GT3 B;  3AV1 D;  1P3K B;  4R8P A;  5B1L C;  5GT3 C;  1EQZ D;  3AZN D;  1P3L C;  3WKJ C;  4NE3 A;  3KUY A;  2ARO A;  3X1S A;  3C1C D;  5BNX B;  1P3I C;  1P3F A;  1KX4 D;  1ZLA D;  4J8W D;  3REH C;  3AZH B;  3A6N A;  3W99 D;  3UTB D;  4ZUX A;  4R8P B;  5AV9 A;  3UTA D;  5B2J B;  2NQB C;  5AV6 A;  4J8U D;  4J8V B;  1P3F B;  2PYO C;  3X1S B;  3WA9 C;  4H9O B;  3AV1 A;  5BT1 C;  4ZUX B;  5B2I D;  4Z5T C;  1KX4 A;  3C1C A;  3MGR B;  3AN2 D;  1ZLA A;  4J8W A;  5B1M B;  5GSU D;  4H9S A;  5B24 A;  1H3O A;  3UTB A;  3UTA A;  4WU9 D;  3AFA D;  1JFI B;  4J8U A;  3REJ B;  5AV8 C;  5B33 C;  3KSY A;  3VH6 A;  3MGP D;  4JJN B;  3AZI B;  5AY8 D;  3UT9 C;  3AZI C;  1ZLA B;  4J8W B;  3WAA B;  1ID3 C;  5B31 C;  5B24 B;  1H3O B;  5GT0 D;  3TU4 A;  3AV2 C;  4ZBJ B;  1TZY B;  2BYM B;  5B2I A;  3AZF D;  4J8U B;  1KX5 D;  3LEL D;  5FUG B;  5GSU A;  3KWQ C;  2IO5 B;  5JRG D;  4KUD B;  1P3M B;  4XZQ B;  5DNM C;  3X1T D;  4WU9 A;  3R45 A;  3AFA A;  1M18 B;  5AV5 B;  3MVD D;  3TU4 B;  5CPK B;  1U35 C;  4H9R A;  3MGP A;  5CP6 C;  5AVB D;  5B40 C;  3WTP D;  3AZK C;  1M19 D;  5KDM A;  3MGS D;  5GT0 A;  3X1V A;  4H9Q A;  1P3A D;  3R45 B;  3AZF A;  1P3B C;  4Z66 C;  1P3G D;  1KX5 A;  3LEL A;  4H9R B;  5AVC B;  5DNN A;  3X1U A;  3MGQ B;  5JRG A;  3REL C;  3AZJ A;  4XUJ B;  3X1T A;  3NQU A;  5CPJ A;  5KDM B;  3MVD A;  4CAY A;  3X1V B;  4YS3 D;  1AOI A;  5AVB A;  3REI D;  1HQ3 C;  5DNN B;  3AZE D;  3X1U B;  4LD9 B;  5JRG B;  3MGS A;  5E5A C;  5BS7 C;  3AZJ B;  5CPJ B;  3X1T B;  3W98 D;  2NZD B;  1BH9 A;  3MVD B;  4CAY B;  1P3G A;  3W96 B;  1TAF B;  4HGA C;  2YFW A;  5F99 B;  1AOI B;  3AZL D;  3B6G D;  3LZ0 C;  5GT3 D;  4KGC C;  1P3K D;  4QLC C;  4YS3 A;  4M6B A;  3NQJ B;  3REI A;  5CPI B;  1P3I D;  1P3O C;  3AZG A;  2F8N H;  1S32 A;  4YM6 C;  3AZH D;  3W98 A;  3AYW B;  1HTA A;  3AYW C;  2HUE B;  4DRB A;  5B2J D;  3REK B;  4WU8 C;  5BO0 B;  2RVQ C;  3AZL A;  3B6G A;  4J8V D;  2BYK A;  4EO5 C;  1P3F D;  5B1L A;  5GT3 A;  3AZG B;  5BT1 D;  2LY8 A;  1P3K A;  1S32 B;  3WKJ A;  3C1B C;  4ZUX D;  5GXQ C;  4Z2M H;  2L5A A;  1P3I A;  5BNX A;  1BH8 B;  3MGR D;  3B6G B;  2FJ7 C;  5B1M D;  2JSS A;  5B1L B;  5B0Y C;  3AZH A;  1P3P C;  1P3L B;  2NQB A;  2YFV B;  5B2J A;  3WKJ B;  3REJ D;  4J8V A;  1KX3 C;  1P3I B;  2HIO C;  4JJN D;  3AZI D;  4H9O A;  4UUZ A;  3REH B;  5B31 D;  3WAA D;  5B24 D;  2NQB B;  1TZY D;  3LZ1 B;  3LZ1 C;  3MGR A;  4X23 C;  2PYO B;  3WA9 B;  3B0B A;  5B1M A;  5BNV B;  3AZM C;  4CSR A;  4KUD D;  1P3M D;  4XZQ D;  4UUZ B;  3VH5 W;  5JA4 A;  1M18 D;  5AV5 D;  5AV8 A;  1JFI A;  3REJ A;  3TU4 D;  4Z5T B;  5CPK D;  1P34 C;  3UT9 A;  4JJN A;  1F66 B;  3AZI A;  4G92 C;  1F66 C;  4E44 A;  4J8X C;  5B31 A;  1ID3 A;  3WAA A;  3AV2 A;  4CSR B;  1TZY A;  2BYM A;  5JA4 B;  5AV8 B;  5B33 B;  5AVC D;  5FUG A;  3UT9 B;  3MGQ D;  4KUD A;  1P3M A;  4XZQ A;  2ARO C;  4XUJ D;  1ID3 B;  5B31 B;  1M18 A;  3AV2 B;  5AV5 A;  3MNN C;  3X1V D;  5CP6 A;  5CPK A;  3A6N C;  5G49 B;  4NE5 A;  3AZK A;  1WWS A;  1HQ3 D;  3KWQ B;  3B6F B;  5DNN D;  3X1U D;  3B6F C;  5DNM B;  4LD9 D;  3AZJ D;  5CPJ D;  1P3B A;  2NZD D;  4Z66 A;  3AV1 C;  1EQZ C;  3AZN C;  1U35 B;  3W96 D;  5B32 B;  5CP6 B;  5F99 D;  5B32 C;  5AVC A;  5B40 B;  3REL A;  3MGQ A;  1AOI D;  1B6W A;  3LZ0 D;  3AZK B;  4KGC D;  4XUJ A;  1KX4 C;  1P3B B;  3W99 C;  4Z66 B;  3UTB C;  3UTA C;  1HQ3 A;  5CPI D;  1R4V A;  3REL B;  5B31 G;  5E5A A;  4YM6 D;  4LD9 A;  2NZD A;  3VH5 T;  3AYW D;  3W96 A;  2RVQ D;  1TAF A;  3REK D;  5F99 A;  3LZ0 A;  4KGC A;  3B0C W;  1HQ3 B;  3AZG D;  3AN2 C;  5E5A B;  1S32 D;  5GSU C;  5GXQ D;  1P3O A;  4HGA B;  3NQJ A;  4WU9 C;  5CPI A;  4YM6 A;  3LZ0 B;  4KGC B;  3VH6 W;  3MGP C;  5B1L D;  5AY8 C;  3AYW A;  1P3L D;  4QLC B;  3REK A;  3WKJ D;  5BO0 A;  5GT0 C;  1KX3 D;  1P3O B;  4AWL C;  3AZF C;  2CWE A;  3W97 C;  4YM6 B;  1KX5 C;  3REH D;  3LEL C;  1M1A C;  5GXQ A;  5C3I C;  2NQB D;  3LZ1 D;  4WU8 B;  1BH8 A;  4EO5 B;  2PYO D;  3WA9 D;  5AVB C;  3O62 C;  1P3L A;  3WTP C;  1M19 C;  2YFV A;  3C1B B;  1N1J A;  5GXQ B;  3V9R B;  5B0Z C;  3MGS C;  1KX3 A;  4Z5T D;  1P3A C;  1F66 D;  3LJA C;  2FJ7 B;  3REH A;  5B0Y B;  1P3P B;  2CV5 C;  4G91 C;  3LZ1 A;  1N1J B;  5AV8 D;  4X23 A;  4KHA B;  5B33 D;  3KXB C;  1KX3 B;  2HIO B;  2PYO A;  4YS3 C;  3WA9 A;  3UT9 D;  5BNV A;  3REI C;  1ID3 D;  3AZE C;  3AV2 D;  4Z5T A;  3W98 C;  1F66 A;  4X23 B;  4NE6 A;  4J8X A;  3KWQ D;  3AZM B;  3B6F D;  3AZL C;  4Z2M G;  5DNM D;  1BFM A;  1P3K C;  5B33 A;  1U35 D;  1P34 B;  5B32 D;  5CP6 D;  4G92 B;  5B40 D;  3AZK D;  4J8X B;  4H9N A;  3MNN A;  1A7W A;  3AZH C;  1P3B D;  4Z66 D;  4R8P C;  1F1E A;  5G49 A;  5B2J C;  3KWQ A;  3B6F A;  3REL D;  5DNM A;  2ARO B;  5CHL B;  3KUY B;  4J8V C;  3KUY C;  1P3F C;  3X1S C;  4H9N B;  3MNN B;  1EQZ A;  3AZN A;  1U35 A;  3A6N B;  5B32 A;  5AV9 B;  5B40 A;  4ZUX C;  1WWI A;  5AV9 C;  5AV6 B;  5AV6 C;  1ULY A;  3MGR C;  5E5A D;  3W99 A;  5B1M C;  3AV1 B;  1EQZ B;  3AZN B;  3REJ C;  1KX4 B;  3C1C B;  4JJN C;  3C1C C;  1ZLA C;  4QLC D;  4J8W C;  3WAA C;  3UTB B;  3W99 B;  4H9S C;  3UTA B;  5B24 C;  4H9P A;  4ZBJ C;  3WTP E;  1TZY C;  1P3O D;  3W97 D;  3AN2 A;  1Q9C A;  2F8N D;  4J8U C;  5BS7 A;  1M1A D;  2IO5 C;  4KUD C;  1P3M C;  4XZQ C;  4WZS B;  4WU8 D;  1M18 C;  5AV5 C;  3TU4 C;  4H9P B;  5B2I B;  4WNN A;  5CPK C;  5AY8 A;  5B2I C;  3O62 D;  3AN2 B;  5GSU B;  4QLC A;  5B0Z D;  3C1B D;  2F8N K;  5B32 G;  4WU9 B;  3AFA B;  1KU5 A;  3LJA D;  3W97 A;  3AFA C;  2F8N A;  2FJ7 D;  2CV5 D;  4WNN B;  3MGP B;  1M1A A;  5B0Y D;  5AY8 B;  5AVC C;  1P3P D;  3MGQ C;  4XUJ C;  4WU8 A;  3KXB D;  5GT0 B;  4NFT A;  4H9Q B;  3X1V C;  4AWL B;  2HIO D;  3AZF B;  3O62 A;  3W97 B;  2F8N B;  3WTP A;  1KX5 B;  3LEL B;  1M19 A;  1M1A B;  5B0Z A;  5DNN C;  3C1B A;  5C3I B;  3X1U C;  3V9R A;  4LD9 C;  5JRG C;  3NQU B;  1P3A A;  3AZJ C;  5CPJ C;  3X1T C;  3LJA A;  2NZD C;  3MVD C;  4X23 D;  2FJ7 A;  3W96 C;  2CV5 A;  5AVB B;  5B0Y A;  5F99 C;  3O62 B;  3AZM D;  1P3P A;  1AOI C;  3WTP B;  3VH5 A;  1M19 B;  3KXB A;  3MGS B;  5B0Z B;  4KHA A;  1P34 D;  1P3A B;  1BH9 B;  2HIO A;  3LJA B;  1P3G B;  2YFW B;  1P3G C;  4J8X D;  5CPI C;  1B67 A;  4G91 B;  3AZE A;  2CV5 B;  4DRA A;  4R8P D;  3KXB B;  3B0D B;  4WV4 B; 
#chains in the Genus database with same CATH topology
 3B0D C;  2F8N G;  4YS3 B;  2HUE C;  3REK C;  3AZM A;  3REI B;  3B0C T;  3KUY D;  2ARO D;  3X1S D;  3AZE B;  3MNN D;  3AZG C;  1S32 C;  1P34 A;  3A6N D;  3W98 B;  2Y2Q A;  5AV9 D;  4E45 A;  5AV6 D;  2F2A C;  3AZL B;  2BYK B;  3B6G C;  3VH6 T;  5GT3 B;  2Y2K A;  3AV1 D;  1P3K B;  4R8P A;  5B1L C;  5GT3 C;  1EQZ D;  3AZN D;  1P3L C;  3WKJ C;  4NE3 A;  3KUY A;  2ARO A;  3X1S A;  3C1C D;  5BNX B;  1P3I C;  1P3F A;  1KX4 D;  1ZLA D;  4J8W D;  2G5H C;  3REH C;  3AZH B;  3A6N A;  1Z2C B;  3W99 D;  3UTB D;  4ZUX A;  4R8P B;  5AV9 A;  3UTA D;  5B2J B;  2NQB C;  5AV6 A;  4J8U D;  4J8V B;  1P3F B;  2PYO C;  3X1S B;  3WA9 C;  4H9O B;  3AV1 A;  5BT1 C;  4ZUX B;  2VQR A;  5B2I D;  4Z5T C;  1KX4 A;  3C1C A;  3MGR B;  3AN2 D;  2XD5 A;  1ZLA A;  4J8W A;  5B1M B;  5GSU D;  4H9S A;  5B24 A;  1H3O A;  3UTB A;  3UTA A;  4WU9 D;  3AFA D;  1JFI B;  4J8U A;  3REJ B;  5AV8 C;  5B33 C;  3KSY A;  3VH6 A;  3MGP D;  4JJN B;  3AZI B;  5AY8 D;  3UT9 C;  3AZI C;  4UPK A;  4J8W B;  1ZLA B;  3WAA B;  1ID3 C;  5B31 C;  5B24 B;  1H3O B;  5GT0 D;  3TU4 A;  3AV2 C;  4ZBJ B;  1TZY B;  2BYM B;  5B2I A;  3AZF D;  4J8U B;  1KX5 D;  3LEL D;  5FUG B;  2BG1 A;  5GSU A;  3KWQ C;  2IO5 B;  5JRG D;  4KUD B;  1P3M B;  4XZQ B;  3IP4 C;  5DNM C;  3X1T D;  3EG5 B;  4WU9 A;  3R45 A;  3AFA A;  1M18 B;  5AV5 B;  3MVD D;  3TU4 B;  5CPK B;  1U35 C;  4H9R A;  3MGP A;  5CP6 C;  5AVB D;  5B40 C;  3A1I A;  3WTP D;  3AZK C;  1M19 D;  5KDM A;  3MGS D;  5GT0 A;  3X1V A;  2JE5 A;  4H9Q A;  2G5I C;  1P3A D;  3R45 B;  3AZF A;  1P3B C;  4Z66 C;  1P3G D;  1KX5 A;  3F6T A;  3LEL A;  4H9R B;  5AVC B;  3KFU G;  5DNN A;  3X1U A;  3MGQ B;  5JRG A;  3REL C;  4DQY B;  3AZJ A;  4XUJ B;  3X1T A;  3NQU A;  5CPJ A;  5KDM B;  3MVD A;  4CAY A;  3X1V B;  2RIQ A;  4YS3 D;  1AOI A;  5AVB A;  3REI D;  1HQ3 C;  5DNN B;  3AZE D;  3X1U B;  4LD9 B;  5JRG B;  3MGS A;  5E5A C;  5BS7 C;  3AZJ B;  5CPJ B;  3X1T B;  3W98 D;  2NZD B;  1BH9 A;  3MVD B;  4CAY B;  1P3G A;  3W96 B;  1TAF B;  4HGA C;  2YFW A;  5F99 B;  1AOI B;  3AZL D;  3B6G D;  3FDD A;  3LZ0 C;  5GT3 D;  4KGC C;  1P3K D;  4QLC C;  2ZM5 A;  4YS3 A;  4M6B A;  2Y2M A;  3NQJ B;  3REI A;  5CPI B;  1P3I D;  1P3O C;  3AZG A;  2F8N H;  1S32 A;  4YM6 C;  3AZH D;  3W98 A;  3H0R C;  3AYW B;  1HTA A;  3AYW C;  2HUE B;  4DRB A;  5B2J D;  2JCH A;  3REK B;  4WU8 C;  5BO0 B;  2RVQ C;  3AZL A;  3B6G A;  4J8V D;  2BYK A;  4EO5 C;  1P3F D;  5B1L A;  5GT3 A;  3AZG B;  5BT1 D;  3EPH A;  2LY8 A;  1P3K A;  1S32 B;  3WKJ A;  2Y2J A;  3C1B C;  4ZUX D;  5GXQ C;  4Z2M H;  2L5A A;  1P3I A;  5BNX A;  1BH8 B;  3MGR D;  3B6G B;  2FJ7 C;  5B1M D;  2JSS A;  5B1L B;  5B0Y C;  3AZH A;  1P3P C;  1P3L B;  2NQB A;  2YFV B;  2ZY4 A;  5B2J A;  3WKJ B;  3REJ D;  4J8V A;  1KX3 C;  1P3I B;  2HIO C;  4JJN D;  3AZI D;  2XD1 A;  4H9O A;  4UUZ A;  3REH B;  5B31 D;  3WAA D;  5B24 D;  2NQB B;  1TZY D;  3LZ1 B;  3LZ1 C;  3MGR A;  4X23 C;  2PYO B;  3WA9 B;  3B0B A;  5B1M A;  5BNV B;  3AZM C;  4CSR A;  3P5J B;  4KUD D;  1P3M D;  4XZQ D;  4UUZ B;  3VH5 W;  5JA4 A;  1M18 D;  5AV5 D;  5AV8 A;  1JFI A;  3REJ A;  2W8S A;  3TU4 D;  4Z5T B;  5CPK D;  1P34 C;  2Y2P A;  3UT9 A;  4JJN A;  1F66 B;  3AZI A;  4G92 C;  1F66 C;  4E44 A;  4J8X C;  5B31 A;  1ID3 A;  3WAA A;  3AV2 A;  4CSR B;  1TZY A;  2BYM A;  5JA4 B;  5AV8 B;  5B33 B;  2J8P A;  5AVC D;  5FUG A;  3UT9 B;  3MGQ D;  4KUD A;  2ZY5 A;  1P3M A;  4XZQ A;  2ARO C;  4XUJ D;  1ID3 B;  5B31 B;  1M18 A;  3AV2 B;  5AV5 A;  3MNN C;  3X1V D;  5CP6 A;  5CPK A;  3A6N C;  2ZY2 A;  5G49 B;  4NE5 A;  3AZK A;  1WWS A;  1HQ3 D;  3KWQ B;  3B6F B;  5DNN D;  3X1U D;  3B6F C;  5DNM B;  4LD9 D;  3AZJ D;  5CPJ D;  1P3B A;  2NZD D;  4Z66 A;  3AV1 C;  1EQZ C;  3AZN C;  1U35 B;  3W96 D;  5B32 B;  5CP6 B;  5F99 D;  5B32 C;  5AVC A;  5B40 B;  3REL A;  3MGQ A;  1AOI D;  1B6W A;  3LZ0 D;  3AZK B;  3AL0 C;  4KGC D;  4XUJ A;  1KX4 C;  1P3B B;  3W99 C;  4Z66 B;  3UTB C;  3UTA C;  1HQ3 A;  5CPI D;  1R4V A;  3REL B;  5B31 G;  5E5A A;  4YM6 D;  4LD9 A;  2NZD A;  3VH5 T;  3AYW D;  3W96 A;  2RVQ D;  1TAF A;  3REK D;  5F99 A;  3LZ0 A;  4KGC A;  3B0C W;  1HQ3 B;  3AZG D;  3AN2 C;  5E5A B;  1S32 D;  5GSU C;  5GXQ D;  1P3O A;  4HGA B;  3NQJ A;  4WU9 C;  5CPI A;  4YM6 A;  3LZ0 B;  4KGC B;  3VH6 W;  3MGP C;  5B1L D;  5AY8 C;  3AYW A;  1P3L D;  4QLC B;  3REK A;  3WKJ D;  5BO0 A;  5GT0 C;  1KX3 D;  1P3O B;  4AWL C;  3AZF C;  2CWE A;  3W97 C;  4YM6 B;  1KX5 C;  3REH D;  3LEL C;  1M1A C;  5GXQ A;  5C3I C;  2NQB D;  1W2E A;  3LZ1 D;  4WU8 B;  1BH8 A;  3A1K A;  4EO5 B;  2PYO D;  3WA9 D;  5AVB C;  3O62 C;  1T3U A;  3WTP C;  1P3L A;  1M19 C;  2YFV A;  3C1B B;  3V9R B;  1N1J A;  2ZY3 A;  5GXQ B;  5B0Z C;  3MGS C;  1KX3 A;  4Z5T D;  1P3A C;  1F66 D;  3LJA C;  2FJ7 B;  3REH A;  3H0M C;  5B0Y B;  1P3P B;  2CV5 C;  4G91 C;  3LZ1 A;  1N1J B;  5AV8 D;  4X23 A;  4KHA B;  5B33 D;  3KXB C;  1KX3 B;  2HIO B;  2PYO A;  4YS3 C;  3WA9 A;  3UT9 D;  5BNV A;  3REI C;  1ID3 D;  3AZE C;  3H0L C;  3AV2 D;  4Z5T A;  3W98 C;  1F66 A;  4X23 B;  4NE6 A;  4J8X A;  4WJ3 C;  3KWQ D;  3AZM B;  3B6F D;  3AZL C;  4Z2M G;  5DNM D;  1BFM A;  1P3K C;  5B33 A;  1U35 D;  1P34 B;  5B32 D;  5CP6 D;  4G92 B;  5B40 D;  3AZK D;  4J8X B;  4H9N A;  3MNN A;  1A7W A;  3AZH C;  1P3B D;  2Y2N A;  4Z66 D;  4R8P C;  1PZR A;  1F1E A;  5G49 A;  5B2J C;  3KWQ A;  3B6F A;  2UWX A;  3REL D;  5DNM A;  2ARO B;  5CHL B;  3KUY B;  4J8V C;  3KUY C;  1P3F C;  3X1S C;  4H9N B;  3MNN B;  1EQZ A;  3AZN A;  1U35 A;  3A6N B;  2FFF B;  5B32 A;  5AV9 B;  5B40 A;  4ZUX C;  1WWI A;  5AV9 C;  5AV6 B;  5AV6 C;  2Y2G A;  1ULY A;  3MGR C;  5E5A D;  2Y2H A;  5B1M C;  3AV1 B;  3W99 A;  1EQZ B;  3AZN B;  3REJ C;  1KX4 B;  3C1C B;  4JJN C;  3C1C C;  1ZLA C;  4QLC D;  4J8W C;  3WAA C;  3UTB B;  3W99 B;  4H9S C;  3UTA B;  5B24 C;  4H9P A;  4ZBJ C;  3WTP E;  1TZY C;  1P3O D;  3W97 D;  3AN2 A;  1Q9C A;  2F8N D;  2DQN C;  4J8U C;  5BS7 A;  1M1A D;  2Y2I A;  2IO5 C;  4KUD C;  1P3M C;  4XZQ C;  4WZS B;  4WU8 D;  1M18 C;  5AV5 C;  3TU4 C;  4H9P B;  5B2I B;  4WNN A;  5CPK C;  5AY8 A;  5B2I C;  3O62 D;  3AN2 B;  5GSU B;  3EPL A;  4QLC A;  5B0Z D;  3C1B D;  2F8N K;  5B32 G;  2Y2O A;  4WU9 B;  3AFA B;  1KU5 A;  3LJA D;  3W97 A;  3AFA C;  2F8N A;  2FJ7 D;  2CV5 D;  4WNN B;  3MGP B;  1M1A A;  5B0Y D;  5AY8 B;  5AVC C;  1P3P D;  3MGQ C;  4XUJ C;  4WU8 A;  3KXB D;  5GT0 B;  4NFT A;  4H9Q B;  3X1V C;  4AWL B;  2HIO D;  3AZF B;  3O62 A;  3W97 B;  2F8N B;  3WTP A;  1KX5 B;  3LEL B;  1M19 A;  1M1A B;  5B0Z A;  5DNN C;  3C1B A;  5C3I B;  3X1U C;  3V9R A;  4LD9 C;  5JRG C;  3NQU B;  1P3A A;  2Y2L A;  3AZJ C;  5CPJ C;  3X1T C;  3LJA A;  2NZD C;  3MVD C;  4X23 D;  2FJ7 A;  3W96 C;  2CV5 A;  5AVB B;  5B0Y A;  5F99 C;  3O62 B;  3AZM D;  1P3P A;  1AOI C;  3WTP B;  3VH5 A;  3EPK A;  1M19 B;  3KXB A;  3MGS B;  5B0Z B;  3EPJ A;  4KHA A;  1P34 D;  1P3A B;  1BH9 B;  2HIO A;  2DF4 C;  3LJA B;  1P3G B;  2YFW B;  1P3G C;  4J8X D;  5CPI C;  1B67 A;  4G91 B;  3AZE A;  2CV5 B;  4DRA A;  4R8P D;  3KXB B;  3B0D B;  4WV4 B; 
#chains in the Genus database with same CATH homology
 3B0D C;  2F8N G;  4YS3 B;  2HUE C;  3REK C;  3AZM A;  3REI B;  3B0C T;  3KUY D;  2ARO D;  3X1S D;  3AZE B;  3MNN D;  3AZG C;  1S32 C;  1P34 A;  3A6N D;  3W98 B;  2Y2Q A;  5AV9 D;  4E45 A;  5AV6 D;  2F2A C;  3AZL B;  2BYK B;  3B6G C;  3VH6 T;  5GT3 B;  2Y2K A;  3AV1 D;  1P3K B;  4R8P A;  5B1L C;  5GT3 C;  1EQZ D;  3AZN D;  1P3L C;  3WKJ C;  4NE3 A;  3KUY A;  2ARO A;  3X1S A;  3C1C D;  5BNX B;  1P3I C;  1P3F A;  1KX4 D;  1ZLA D;  4J8W D;  2G5H C;  3REH C;  3AZH B;  3A6N A;  1Z2C B;  3W99 D;  3UTB D;  4ZUX A;  4R8P B;  5AV9 A;  3UTA D;  5B2J B;  2NQB C;  5AV6 A;  4J8U D;  4J8V B;  1P3F B;  2PYO C;  3X1S B;  3WA9 C;  4H9O B;  3AV1 A;  5BT1 C;  4ZUX B;  2VQR A;  5B2I D;  4Z5T C;  1KX4 A;  3C1C A;  3MGR B;  3AN2 D;  2XD5 A;  1ZLA A;  4J8W A;  5B1M B;  5GSU D;  4H9S A;  5B24 A;  1H3O A;  3UTB A;  3UTA A;  4WU9 D;  3AFA D;  1JFI B;  4J8U A;  3REJ B;  5AV8 C;  5B33 C;  3KSY A;  3VH6 A;  3MGP D;  4JJN B;  3AZI B;  5AY8 D;  3UT9 C;  3AZI C;  4UPK A;  4J8W B;  1ZLA B;  3WAA B;  1ID3 C;  5B31 C;  5B24 B;  1H3O B;  5GT0 D;  3TU4 A;  3AV2 C;  4ZBJ B;  1TZY B;  2BYM B;  5B2I A;  3AZF D;  4J8U B;  1KX5 D;  3LEL D;  5FUG B;  2BG1 A;  5GSU A;  3KWQ C;  2IO5 B;  5JRG D;  4KUD B;  1P3M B;  4XZQ B;  3IP4 C;  5DNM C;  3X1T D;  3EG5 B;  4WU9 A;  3R45 A;  3AFA A;  1M18 B;  5AV5 B;  3MVD D;  3TU4 B;  5CPK B;  1U35 C;  4H9R A;  3MGP A;  5CP6 C;  5AVB D;  5B40 C;  3A1I A;  3WTP D;  3AZK C;  1M19 D;  5KDM A;  3MGS D;  5GT0 A;  3X1V A;  2JE5 A;  4H9Q A;  2G5I C;  1P3A D;  3R45 B;  3AZF A;  1P3B C;  4Z66 C;  1P3G D;  1KX5 A;  3F6T A;  3LEL A;  4H9R B;  5AVC B;  3KFU G;  5DNN A;  3X1U A;  3MGQ B;  5JRG A;  3REL C;  4DQY B;  3AZJ A;  4XUJ B;  3X1T A;  3NQU A;  5CPJ A;  5KDM B;  3MVD A;  4CAY A;  3X1V B;  2RIQ A;  4YS3 D;  1AOI A;  5AVB A;  3REI D;  1HQ3 C;  5DNN B;  3AZE D;  3X1U B;  4LD9 B;  5JRG B;  3MGS A;  5E5A C;  5BS7 C;  3AZJ B;  5CPJ B;  3X1T B;  3W98 D;  2NZD B;  1BH9 A;  3MVD B;  4CAY B;  1P3G A;  3W96 B;  1TAF B;  4HGA C;  2YFW A;  5F99 B;  1AOI B;  3AZL D;  3B6G D;  3FDD A;  3LZ0 C;  5GT3 D;  4KGC C;  1P3K D;  4QLC C;  2ZM5 A;  4YS3 A;  4M6B A;  2Y2M A;  3NQJ B;  3REI A;  5CPI B;  1P3I D;  1P3O C;  3AZG A;  2F8N H;  1S32 A;  4YM6 C;  3AZH D;  3W98 A;  3H0R C;  3AYW B;  1HTA A;  3AYW C;  2HUE B;  4DRB A;  5B2J D;  2JCH A;  3REK B;  4WU8 C;  5BO0 B;  2RVQ C;  3AZL A;  3B6G A;  4J8V D;  2BYK A;  4EO5 C;  1P3F D;  5B1L A;  5GT3 A;  3AZG B;  5BT1 D;  3EPH A;  2LY8 A;  1P3K A;  1S32 B;  3WKJ A;  2Y2J A;  3C1B C;  4ZUX D;  5GXQ C;  4Z2M H;  2L5A A;  1P3I A;  5BNX A;  1BH8 B;  3MGR D;  3B6G B;  2FJ7 C;  5B1M D;  2JSS A;  5B1L B;  5B0Y C;  3AZH A;  1P3P C;  1P3L B;  2NQB A;  2YFV B;  2ZY4 A;  5B2J A;  3WKJ B;  3REJ D;  4J8V A;  1KX3 C;  1P3I B;  2HIO C;  4JJN D;  3AZI D;  2XD1 A;  4H9O A;  4UUZ A;  3REH B;  5B31 D;  3WAA D;  5B24 D;  2NQB B;  1TZY D;  3LZ1 B;  3LZ1 C;  3MGR A;  4X23 C;  2PYO B;  3WA9 B;  3B0B A;  5B1M A;  5BNV B;  3AZM C;  4CSR A;  3P5J B;  4KUD D;  1P3M D;  4XZQ D;  4UUZ B;  3VH5 W;  5JA4 A;  1M18 D;  5AV5 D;  5AV8 A;  1JFI A;  3REJ A;  2W8S A;  3TU4 D;  4Z5T B;  5CPK D;  1P34 C;  2Y2P A;  3UT9 A;  4JJN A;  1F66 B;  3AZI A;  4G92 C;  1F66 C;  4E44 A;  4J8X C;  5B31 A;  1ID3 A;  3WAA A;  3AV2 A;  4CSR B;  1TZY A;  2BYM A;  5JA4 B;  5AV8 B;  5B33 B;  2J8P A;  5AVC D;  5FUG A;  3UT9 B;  3MGQ D;  4KUD A;  2ZY5 A;  1P3M A;  4XZQ A;  2ARO C;  4XUJ D;  1ID3 B;  5B31 B;  1M18 A;  3AV2 B;  5AV5 A;  3MNN C;  3X1V D;  5CP6 A;  5CPK A;  3A6N C;  2ZY2 A;  5G49 B;  4NE5 A;  3AZK A;  1WWS A;  1HQ3 D;  3KWQ B;  3B6F B;  5DNN D;  3X1U D;  3B6F C;  5DNM B;  4LD9 D;  3AZJ D;  5CPJ D;  1P3B A;  2NZD D;  4Z66 A;  3AV1 C;  1EQZ C;  3AZN C;  1U35 B;  3W96 D;  5B32 B;  5CP6 B;  5F99 D;  5B32 C;  5AVC A;  5B40 B;  3REL A;  3MGQ A;  1AOI D;  1B6W A;  3LZ0 D;  3AZK B;  3AL0 C;  4KGC D;  4XUJ A;  1KX4 C;  1P3B B;  3W99 C;  4Z66 B;  3UTB C;  3UTA C;  1HQ3 A;  5CPI D;  1R4V A;  3REL B;  5B31 G;  5E5A A;  4YM6 D;  4LD9 A;  2NZD A;  3VH5 T;  3AYW D;  3W96 A;  2RVQ D;  1TAF A;  3REK D;  5F99 A;  3LZ0 A;  4KGC A;  3B0C W;  1HQ3 B;  3AZG D;  3AN2 C;  5E5A B;  1S32 D;  5GSU C;  5GXQ D;  1P3O A;  4HGA B;  3NQJ A;  4WU9 C;  5CPI A;  4YM6 A;  3LZ0 B;  4KGC B;  3VH6 W;  3MGP C;  5B1L D;  5AY8 C;  3AYW A;  1P3L D;  4QLC B;  3REK A;  3WKJ D;  5BO0 A;  5GT0 C;  1KX3 D;  1P3O B;  4AWL C;  3AZF C;  2CWE A;  3W97 C;  4YM6 B;  1KX5 C;  3REH D;  3LEL C;  1M1A C;  5GXQ A;  5C3I C;  2NQB D;  1W2E A;  3LZ1 D;  4WU8 B;  1BH8 A;  3A1K A;  4EO5 B;  2PYO D;  3WA9 D;  5AVB C;  3O62 C;  1T3U A;  3WTP C;  1P3L A;  1M19 C;  2YFV A;  3C1B B;  3V9R B;  1N1J A;  2ZY3 A;  5GXQ B;  5B0Z C;  3MGS C;  1KX3 A;  4Z5T D;  1P3A C;  1F66 D;  3LJA C;  2FJ7 B;  3REH A;  3H0M C;  5B0Y B;  1P3P B;  2CV5 C;  4G91 C;  3LZ1 A;  1N1J B;  5AV8 D;  4X23 A;  4KHA B;  5B33 D;  3KXB C;  1KX3 B;  2HIO B;  2PYO A;  4YS3 C;  3WA9 A;  3UT9 D;  5BNV A;  3REI C;  1ID3 D;  3AZE C;  3H0L C;  3AV2 D;  4Z5T A;  3W98 C;  1F66 A;  4X23 B;  4NE6 A;  4J8X A;  4WJ3 C;  3KWQ D;  3AZM B;  3B6F D;  3AZL C;  4Z2M G;  5DNM D;  1BFM A;  1P3K C;  5B33 A;  1U35 D;  1P34 B;  5B32 D;  5CP6 D;  4G92 B;  5B40 D;  3AZK D;  4J8X B;  4H9N A;  3MNN A;  1A7W A;  3AZH C;  1P3B D;  2Y2N A;  4Z66 D;  4R8P C;  1PZR A;  1F1E A;  5G49 A;  5B2J C;  3KWQ A;  3B6F A;  2UWX A;  3REL D;  5DNM A;  2ARO B;  5CHL B;  3KUY B;  4J8V C;  3KUY C;  1P3F C;  3X1S C;  4H9N B;  3MNN B;  1EQZ A;  3AZN A;  1U35 A;  3A6N B;  2FFF B;  5B32 A;  5AV9 B;  5B40 A;  4ZUX C;  1WWI A;  5AV9 C;  5AV6 B;  5AV6 C;  2Y2G A;  1ULY A;  3MGR C;  5E5A D;  2Y2H A;  5B1M C;  3AV1 B;  3W99 A;  1EQZ B;  3AZN B;  3REJ C;  1KX4 B;  3C1C B;  4JJN C;  3C1C C;  1ZLA C;  4QLC D;  4J8W C;  3WAA C;  3UTB B;  3W99 B;  4H9S C;  3UTA B;  5B24 C;  4H9P A;  4ZBJ C;  3WTP E;  1TZY C;  1P3O D;  3W97 D;  3AN2 A;  1Q9C A;  2F8N D;  2DQN C;  4J8U C;  5BS7 A;  1M1A D;  2Y2I A;  2IO5 C;  4KUD C;  1P3M C;  4XZQ C;  4WZS B;  4WU8 D;  1M18 C;  5AV5 C;  3TU4 C;  4H9P B;  5B2I B;  4WNN A;  5CPK C;  5AY8 A;  5B2I C;  3O62 D;  3AN2 B;  5GSU B;  3EPL A;  4QLC A;  5B0Z D;  3C1B D;  2F8N K;  5B32 G;  2Y2O A;  4WU9 B;  3AFA B;  1KU5 A;  3LJA D;  3W97 A;  3AFA C;  2F8N A;  2FJ7 D;  2CV5 D;  4WNN B;  3MGP B;  1M1A A;  5B0Y D;  5AY8 B;  5AVC C;  1P3P D;  3MGQ C;  4XUJ C;  4WU8 A;  3KXB D;  5GT0 B;  4NFT A;  4H9Q B;  3X1V C;  4AWL B;  2HIO D;  3AZF B;  3O62 A;  3W97 B;  2F8N B;  3WTP A;  1KX5 B;  3LEL B;  1M19 A;  1M1A B;  5B0Z A;  5DNN C;  3C1B A;  5C3I B;  3X1U C;  3V9R A;  4LD9 C;  5JRG C;  3NQU B;  1P3A A;  2Y2L A;  3AZJ C;  5CPJ C;  3X1T C;  3LJA A;  2NZD C;  3MVD C;  4X23 D;  2FJ7 A;  3W96 C;  2CV5 A;  5AVB B;  5B0Y A;  5F99 C;  3O62 B;  3AZM D;  1P3P A;  1AOI C;  3WTP B;  3VH5 A;  3EPK A;  1M19 B;  3KXB A;  3MGS B;  5B0Z B;  3EPJ A;  4KHA A;  1P34 D;  1P3A B;  1BH9 B;  2HIO A;  2DF4 C;  3LJA B;  1P3G B;  2YFW B;  1P3G C;  4J8X D;  5CPI C;  1B67 A;  4G91 B;  3AZE A;  2CV5 B;  4DRA A;  4R8P D;  3KXB B;  3B0D B;  4WV4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...