5B32A

The crystal structure of the heterotypic h2az/h2a nucleosome with h3.3.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b32A00
5KDMB 2HUEB 5AV8B 5JRGC 4LD9A 4J8XB 5CPJC 1P3IC 5CP6A 3AZEC 5B31B 3O62B 4Z5TB 5DNMD 2FJ7B 1U35D 4XUJC 5AVBA 3AV2A 4Z2MH 3VH5W 3LELD 1KX3C 3KWQD 2NQBD 5C3IC 3NQUA 3WKJB 5AY8D 3UTAC 3RELC 4KUDC 3B6FC 1EQZC 5B40C 5AV8A 3A6NA 3AZMD 5E5AA 3AFAC 3AN2B 5B31A 5DNNB 2RVQD 1P3MC 3MNND 3VH6T 1P3AA 1TZYA 5F99D 5AVCC 3MGPD 3WTPE 3KXBB 3TU4A 2BYKB 5B2IB 3REHD 2AROA 5AV5B 4J8UB 5FUGB 5GT0C 1P34D 3AN2A 3AZHB 5DNNA 3R45B 5B24C 3MVDB 4Z66B 4ZUXA 1P3OB 5B32A 3REKD 3W97B 2NZDB 3WA9C 5B2JC 1P3BA 4X23D 3AZJD 5B0YD 1KX4B 3UTBD 3B0DC 5GXQC 5B2IA 4WNNB 1M19B 3MGRB 4AWLB 3W99A 3AZHA 3C1CA 5B1LD 4WU8C 3MVDA 4Z66A 1P3OA 2NZDA 1B6WA 5B33C 1M18B 3WAAD 1P3KA 3W98C 5GT3A 5B0ZA 4J8XC 1KX4A 4Z5TC 3AZGB 3W96A 3WTPA 2FJ7C 1KX5B 5GSUC 5CP6D 1TAFA 1S32C 4XZQA 3X1TC 1AOID 3C1BB 4R8PB 5JRGB 5AVBD 3AV2D 3WKJC 1A7WA 4H9PB 5CPJB 3AZEB 4NFTA 4J8WA 5CPKC 4WV4B 3AYWD 3X1SA 5BNXB 4XUJB 1H3OA 3AZGA 5AV8D 3A6ND 1KX5A 5E5AD 3MGSD 1KX3B 3AZLD 5B31D 5C3IB 4CSRA 3KUYD 4J8VC 3RELB 3UTAB 4KUDB 3KXBC 1P3GA 1P3AD 3B6FB 1TZYD 3C1BA 1BH9A 1EQZB 5JRGA 3B0BA 4H9PA 5CPJA 1P3IA 3AZEA 1R4VA 4KGCC 3TU4D 4J8UC 2PYOA 2AROD 3X1UB 1KX3A 5BT1C 2F8NK 5DNND 3AV1C 2LY8A 3UTAA 3RELA 4ZUXD 5B32D 3B6FA 1EQZA 5B40A 3AFAA 3AZIA 4JJNA 1P3BD 5B24B 1P3MA 1HTAA 5AVCA 3WA9B 5B2ID 5CHLB 5AV6A 3W99D 3LJAC 3C1CD 3MVDD 3B0DB 1M18C 2F8NB 5GT0A 4H9SC 5CPIB 1P3KD 3AZNA 5GT3D 5B0ZD 4HGAC 3VH5A 1KX4D 4EO5C 3WA9A 5B2JA 3WTPD 3W96D 5B33B 3W98B 4R8PC 4XZQD 5GXQA 2F8NA 4E44A 5GSUB 1S32B 3AZKC 3X1TB 4J8WD 1U35C 1F66B 4WU8A 3LZ1D 3X1SD 3LELC 3KWQC 1P3LD 4QLCA 2NQBC 2YFWB 5B33A 1KX5D 4NE6A 3W98A 5KDMA 5CPKB 2F8NH 4J8XA 1P3GD 3O62A 4Z5TA 5JRGD 3X1VB 2FJ7A 2RVQC 1P3ID 5GSUA 3MNNC 1HQ3C 5BS7C 1ID3C 5F99C 4J8VB 3AZFC 3X1UC 2PYOD 3WKJA 4KHAB 4KGCB 1JFIB 3RELD 2CV5D 3B6FD 3REID 1EQZD 5B40D 5B1MB 3AFAD 3AZID 4JJND 4YS3C 3AV1B 1P3MD 2HIOB 5BNVB 3KXBA 1M1AB 5AVCD 2L5AA 4KHAA 1P3FD 5AV6D 2BYKA 5B0YC 4YM6D 3UTBC 4KGCA 5AV5A 4J8UA 1BFMA 5FUGA 3REJC 5CPIC 3R45A 5GT0D 3LZ0B 3LJAB 3B6GC 3AZND 3W97A 5BNVA 3WA9D 5B2JD 1M19A 4WNNA 4LD9D 4HGAB 3MGRA 4DRBA 5GXQD 4EO5B 5CP6C 2BYMB 1F66C 1AOIC 3LJAA 4WU8D 3AV2C 1M18A 3B0CW 4UUZB 4QLCD 1WWIA 5B33D 3AZKB 3AYWC 1U35B 3W98D 3X1VC 4J8XD 3LELB 1Q9CA 5E5AC 3O62D 4Z5TD 2IO5C 3KWQB 3MGSC 3AZLC 1N1JB 2NQBB 2FJ7D 5AY8B 3KUYC 4R8PA 4G92C 1TZYC 3VH6W 3AZMB 1ULYA 2YFVB 4Z2MG 3WKJD 3VH5T 1HQ3B 3MNNB 3TU4C 1WWSA 5BNXA 4XUJA 3AZKA 1ID3B 1U35A 5F99B 3MGPB 5B1MC 3AZFB 3AN2D 1N1JA 2HIOC 4KUDA 1M1AC 5AV9C 3KXBD 1P34B 4E45A 1P3BC 3MNNA 1HQ3A 5BS7A 4YS3B 1ID3A 4KGCD 3V9RB 5AV5D 4J8UD 4H9QB 3AZFA 3X1UA 4WU9C 3LZ0C 4H9NB 3AZHD 4X23B 5B31G 3C1CC 4Z66D 1P3OD 5B0YB 5G49B 5BT1D 3UTBB 3W97D 2NZDD 1ZLAC 3REJB 3MGQC 5B24A 1P3PC 1P3KC 3B6GB 3UT9C 4YS3A 5BO0B 1M19D 3V9RA 4H9QA 3MGRD 3W96C 3WTPC 4G91C 4NE3A 5G49A 5B32G 3UTBA 5DNMC 3REJA 1M18D 5CPIA 5CP6B 4J8WC 1AOIB 3LZ1C 3B6GA 3AZGD 3X1SC 3AV2B 1P3LC 5AY8C 1BH8B 3AZMC 3AYWB 3C1BD 4R8PD 1P3GC 5CPJD 3A6NB 3AZED 1S32A 5E5AB 3MGSB 2IO5B 3AZLB 3X1TA 1F66A 3MGPC 3KUYB 1AOIA 3AZKD 4XUJD 1P3AB 4G92B 1TZYB 3B0CT 2PYOC 2YFWA 1KX3D 1BH8A 5CPKA 3REHC 3UTAD 3TU4B 3KSYA 4KUDD 3AYWA 2CV5C 1P34C 3REIC 3X1VA 2AROB 3MGSA 3AZIC 3AZLA 4J8VA 4JJNC 3REKC 3KUYA 1HQ3D 4ZUXB 5B32B 1ID3D 4X23C 3AZJC 5AV9B 3AZFD 4M6BA 4DRAA 3X1UD 1P3FC 5AV6C 1P3BB 4YM6C 1JFIA 4ZBJC 1F1EA 5B1MA 5B1LC 4WU9B 3W99B 5B24D 3AV1A 3C1CB 2HIOA 3AZNC 1M1AA 3WAAC 4YS3D 1ZLAB 5AV9A 3MGQB 5JA4B 1P3PB 1P3KB 4LD9C 5GT3B 5B0ZB 3UT9B 2F8ND 2CWEA 3W96B 3WTPB 3REJD 4WU9A 4G91B 3LZ0A 5CPID 1TAFB 1B67A 4XZQB 5AVBC 3VH6A 3B6GD 1ZLAA 5DNMB 4H9SA 4QLCC 3MGQA 5JA4A 1P3PA 4J8WB 2HUEC 5AV8C 3A6NC 3LZ1B 3UT9A 3X1SB 2JSSA 1H3OB 2BYMA 5B31C 3O62C 1P3LB 5GSUD 1S32D 3X1TD 1P3AC 1F66D 4CSRB 1P3GB 4UUZA 1BH9B 5DNMA 1P3IB 5CPKD 2AROC 3LELA 3LZ1A 3KWQA 3AN2C 2PYOB 2NQBA 4CAYB 3X1VD 2F8NG 5DNNC 1P3LA 5AY8A 4ZUXC 5B32C 4J8VD 3REHB 3AZMA 2YFVA 2CV5B 3REIB 5B40B 3NQJB 3AFAB 3AZIB 5F99A 3MGPA 4JJNB 3REKB 1P3MB 4H9OB 5B2IC 5AV5C 3W99C 5AVCB 3AZJB 5B1MD 4CAYA 3AZHC 1P3FB 3MVDC 4Z66C 5AV6B 1P3OC 4YM6B 3AV1D 1KU5A 4H9RB 3REHA 2HIOD 4ZBJB 3W97C 2NZDC 1M1AD 2CV5A 1P34A 3REIA 5B1LB 4WZSB 5AV9D 3NQJA 5GT0B 5GT3C 5B0ZC 1KX4C 3AZNB 3REKA 4H9OA 1M19C 3WAAB 3MGRC 4H9NA 4X23A 4AWLC 4XZQC 3AZJA 5B2JB 1P3FA 5B0YA 4WU9D 4NE5A 3LZ0D 3LJAD 4YM6A 4H9RA 4LD9B 5GXQB 5B1LA 1ZLAD 3MGQD 5BO0A 1P3PD 5AVBB 3AZGC 4WU8B 1KX5C 3UT9D 3WAAA 3NQUB 4QLCB 3C1BC
chains in the Genus database with same CATH superfamily
5KDMB 2HUEB 5AV8B 5JRGC 4LD9A 4J8XB 5CPJC 1P3IC 5CP6A 3AZEC 5B31B 3O62B 3KFUG 4Z5TB 3H0LC 5DNMD 2FJ7B 1U35D 2Y2IA 4XUJC 5AVBA 3AV2A 4Z2MH 3VH5W 3LELD 1KX3C 3KWQD 2NQBD 5C3IC 3NQUA 3WKJB 3AL0C 2F2AC 5AY8D 3RELC 3UTAC 4KUDC 3B6FC 2ZY3A 1EQZC 5B40C 5AV8A 3A6NA 3AZMD 5E5AA 2DF4C 3AFAC 3AN2B 5B31A 5DNNB 2RVQD 1P3MC 2Y2GA 3MNND 2DQNC 3VH6T 1P3AA 1TZYA 5F99D 5AVCC 3MGPD 2Y2MA 3WTPE 3KXBB 3TU4A 2BYKB 2Y2KA 5B2IB 3REHD 2AROA 5AV5B 4J8UB 5FUGB 5GT0C 1P34D 3AN2A 3AZHB 5DNNA 3R45B 5B24C 3MVDB 4Z66B 4ZUXA 1P3OB 5B32A 3REKD 3W97B 2NZDB 3WA9C 5B2JC 1P3BA 4X23D 3AZJD 5B0YD 1KX4B 3UTBD 3B0DC 5GXQC 5B2IA 4WNNB 1M19B 3MGRB 4AWLB 3W99A 3AZHA 3C1CA 5B1LD 4WU8C 3MVDA 4Z66A 1P3OA 2NZDA 1B6WA 5B33C 1M18B 3WAAD 1P3KA 3W98C 5GT3A 5B0ZA 4J8XC 1KX4A 4Z5TC 3AZGB 3W96A 3WTPA 2FJ7C 1KX5B 5GSUC 5CP6D 1TAFA 1S32C 4XZQA 3X1TC 1AOID 3C1BB 4R8PB 5JRGB 5AVBD 3AV2D 3WKJC 1A7WA 4H9PB 5CPJB 3FDDA 3AZEB 4NFTA 4J8WA 5CPKC 4WV4B 3AYWD 3X1SA 5BNXB 4XUJB 1H3OA 2G5HC 3AZGA 5AV8D 3A6ND 1KX5A 5E5AD 3MGSD 1KX3B 3AZLD 5B31D 3F6TA 5C3IB 4CSRA 3KUYD 4J8VC 3RELB 3UTAB 4KUDB 3KXBC 1P3GA 1P3AD 3B6FB 1TZYD 3C1BA 1BH9A 1EQZB 5JRGA 3B0BA 4H9PA 5CPJA 1P3IA 3AZEA 1R4VA 4KGCC 3TU4D 4J8UC 2PYOA 2AROD 3X1UB 1KX3A 5BT1C 2RIQA 2F8NK 5DNND 3AV1C 2LY8A 3UTAA 3RELA 4ZUXD 5B32D 3B6FA 1EQZA 5B40A 3AFAA 3AZIA 4JJNA 1P3BD 5B24B 1P3MA 1HTAA 3P5JB 3EPKA 5AVCA 3WA9B 5B2ID 2Y2QA 5CHLB 5AV6A 3W99D 3LJAC 3C1CD 2XD5A 3MVDD 3B0DB 1M18C 2F8NB 5GT0A 4H9SC 5CPIB 4UPKA 1P3KD 3AZNA 5GT3D 5B0ZD 4HGAC 3VH5A 1KX4D 3A1IA 4EO5C 3WA9A 5B2JA 3WTPD 3W96D 5B33B 3W98B 4R8PC 4XZQD 5GXQA 2F8NA 4E44A 5GSUB 1S32B 3AZKC 3X1TB 4J8WD 1U35C 1F66B 4WU8A 3LZ1D 3X1SD 3LELC 3KWQC 1P3LD 4QLCA 2NQBC 2YFWB 5B33A 1KX5D 4NE6A 3W98A 5KDMA 5CPKB 2F8NH 4J8XA 1P3GD 3O62A 4Z5TA 5JRGD 2BG1A 3X1VB 2FJ7A 2RVQC 1P3ID 5GSUA 3MNNC 1HQ3C 5BS7C 1ID3C 5F99C 4J8VB 3AZFC 3X1UC 2PYOD 3WKJA 4KHAB 4KGCB 1JFIB 3RELD 2CV5D 3B6FD 3REID 1EQZD 5B40D 5B1MB 3AFAD 3AZID 1W2EA 4JJND 4YS3C 3AV1B 1P3MD 2HIOB 5BNVB 3KXBA 1M1AB 5AVCD 2L5AA 4KHAA 1P3FD 5AV6D 2BYKA 5B0YC 4YM6D 3UTBC 4KGCA 5AV5A 4J8UA 1BFMA 3EG5B 5FUGA 3REJC 5CPIC 3R45A 5GT0D 2ZY2A 3LZ0B 3LJAB 3B6GC 3AZND 3W97A 5BNVA 2Y2HA 3WA9D 5B2JD 2JCHA 1M19A 4WNNA 4LD9D 4HGAB 3MGRA 4DRBA 5GXQD 4EO5B 5CP6C 2BYMB 1F66C 1AOIC 3LJAA 4WU8D 3AV2C 1M18A 3B0CW 4UUZB 4QLCD 1WWIA 5B33D 3AZKB 3AYWC 1U35B 3W98D 3X1VC 4J8XD 3LELB 1Q9CA 5E5AC 3O62D 4Z5TD 2IO5C 3H0RC 3KWQB 3MGSC 1N1JB 3AZLC 2FJ7D 2NQBB 5AY8B 3KUYC 4R8PA 4G92C 1TZYC 3VH6W 3AZMB 1ULYA 2YFVB 4Z2MG 3WKJD 3VH5T 1HQ3B 3MNNB 3TU4C 1WWSA 5BNXA 4XUJA 3AZKA 1ID3B 1U35A 5F99B 3MGPB 5B1MC 3AZFB 3AN2D 2Y2PA 1N1JA 2HIOC 4KUDA 1M1AC 5AV9C 3KXBD 1P34B 4E45A 1P3BC 4WJ3C 3MNNA 1HQ3A 5BS7A 4YS3B 1ID3A 4KGCD 2ZY4A 3V9RB 5AV5D 4J8UD 4H9QB 3AZFA 3X1UA 4WU9C 3LZ0C 4H9NB 3AZHD 4X23B 5B31G 3C1CC 4Z66D 1P3OD 5B0YB 5G49B 5BT1D 3UTBB 3EPLA 2FFFB 3W97D 2NZDD 1ZLAC 3REJB 3MGQC 5B24A 2W8SA 1P3PC 1P3KC 3B6GB 3UT9C 4YS3A 5BO0B 4DQYB 1M19D 3V9RA 1Z2CB 4H9QA 3W96C 3WTPC 3MGRD 4G91C 4NE3A 5G49A 5B32G 3UTBA 5DNMC 3REJA 1M18D 5CPIA 5CP6B 4J8WC 1AOIB 3LZ1C 3B6GA 3AZGD 3X1SC 3AV2B 1P3LC 5AY8C 1BH8B 3AZMC 3AYWB 3C1BD 4R8PD 1P3GC 5CPJD 3A6NB 3AZED 1S32A 5E5AB 3MGSB 2IO5B 3AZLB 3X1TA 1F66A 3MGPC 2XD1A 3KUYB 1AOIA 3AZKD 4XUJD 1P3AB 4G92B 1TZYB 3A1KA 3B0CT 2PYOC 2YFWA 1KX3D 1BH8A 5CPKA 2J8PA 3REHC 3UTAD 3TU4B 3KSYA 4KUDD 3AYWA 2CV5C 1P34C 3REIC 3X1VA 2AROB 3MGSA 3AZIC 3AZLA 4J8VA 2Y2LA 4JJNC 3REKC 3KUYA 1HQ3D 4ZUXB 5B32B 1ID3D 1PZRA 4X23C 3AZJC 5AV9B 3AZFD 4M6BA 4DRAA 3X1UD 1P3FC 5AV6C 1P3BB 4YM6C 1JFIA 2JE5A 2Y2NA 4ZBJC 1F1EA 2ZY5A 2G5IC 5B1MA 5B1LC 4WU9B 3W99B 5B24D 3AV1A 3C1CB 2HIOA 3AZNC 1M1AA 3WAAC 4YS3D 1ZLAB 5AV9A 3MGQB 5JA4B 1P3PB 1P3KB 4LD9C 5GT3B 5B0ZB 3UT9B 2F8ND 2CWEA 3W96B 3WTPB 3REJD 4WU9A 4G91B 3LZ0A 5CPID 1TAFB 1B67A 4XZQB 5AVBC 3EPJA 3VH6A 3B6GD 1ZLAA 3IP4C 5DNMB 4H9SA 4QLCC 3MGQA 5JA4A 1P3PA 4J8WB 2HUEC 5AV8C 3A6NC 3LZ1B 3UT9A 3X1SB 2JSSA 1H3OB 2BYMA 5B31C 3O62C 1P3LB 5GSUD 1S32D 3X1TD 1P3AC 1F66D 4CSRB 2ZM5A 1P3GB 4UUZA 1BH9B 2UWXA 5DNMA 1P3IB 5CPKD 2AROC 2VQRA 3LELA 3LZ1A 3KWQA 3AN2C 2PYOB 2NQBA 4CAYB 3X1VD 2F8NG 5DNNC 1P3LA 5AY8A 4ZUXC 3H0MC 5B32C 4J8VD 3REHB 3AZMA 2YFVA 2CV5B 3REIB 5B40B 3NQJB 3AFAB 3AZIB 5F99A 3MGPA 4JJNB 3REKB 1P3MB 4H9OB 5B2IC 5AV5C 3W99C 5AVCB 3AZJB 5B1MD 4CAYA 3AZHC 1P3FB 3MVDC 4Z66C 5AV6B 1P3OC 4YM6B 3AV1D 1KU5A 3EPHA 4H9RB 3REHA 2HIOD 4ZBJB 3W97C 2NZDC 1M1AD 2CV5A 1P34A 3REIA 5B1LB 4WZSB 5AV9D 3NQJA 5GT0B 5GT3C 5B0ZC 1KX4C 1T3UA 3AZNB 3REKA 4H9OA 1M19C 3WAAB 3MGRC 4H9NA 4X23A 4AWLC 4XZQC 3AZJA 5B2JB 1P3FA 5B0YA 4WU9D 4NE5A 3LZ0D 3LJAD 4YM6A 4H9RA 4LD9B 5GXQB 5B1LA 1ZLAD 3MGQD 5BO0A 1P3PD 5AVBB 3AZGC 4WU8B 1KX5C 3UT9D 3WAAA 3NQUB 4QLCB 2Y2JA 2Y2OA 3C1BC
chains in the Genus database with same CATH topology
5KDMB 2HUEB 5AV8B 5JRGC 4LD9A 4J8XB 5CPJC 1P3IC 5CP6A 3AZEC 5B31B 3O62B 3KFUG 4Z5TB 3H0LC 5DNMD 2FJ7B 1U35D 2Y2IA 4XUJC 5AVBA 3AV2A 4Z2MH 3VH5W 3LELD 1KX3C 3KWQD 2NQBD 5C3IC 3NQUA 3WKJB 3AL0C 2F2AC 5AY8D 3RELC 3UTAC 4KUDC 3B6FC 2ZY3A 1EQZC 5B40C 5AV8A 3A6NA 3AZMD 5E5AA 2DF4C 3AFAC 3AN2B 5B31A 5DNNB 2RVQD 1P3MC 2Y2GA 3MNND 2DQNC 3VH6T 1P3AA 1TZYA 5F99D 5AVCC 3MGPD 2Y2MA 3WTPE 3KXBB 3TU4A 2BYKB 2Y2KA 5B2IB 3REHD 2AROA 5AV5B 4J8UB 5FUGB 5GT0C 1P34D 3AN2A 3AZHB 5DNNA 3R45B 5B24C 3MVDB 4Z66B 4ZUXA 1P3OB 5B32A 3REKD 3W97B 2NZDB 3WA9C 5B2JC 1P3BA 4X23D 3AZJD 5B0YD 1KX4B 3UTBD 3B0DC 5GXQC 5B2IA 4WNNB 1M19B 3MGRB 4AWLB 3W99A 3AZHA 3C1CA 5B1LD 4WU8C 3MVDA 4Z66A 1P3OA 2NZDA 1B6WA 5B33C 1M18B 3WAAD 1P3KA 3W98C 5GT3A 5B0ZA 4J8XC 1KX4A 4Z5TC 3AZGB 3W96A 3WTPA 2FJ7C 1KX5B 5GSUC 5CP6D 1TAFA 1S32C 4XZQA 3X1TC 1AOID 3C1BB 4R8PB 5JRGB 5AVBD 3AV2D 3WKJC 1A7WA 4H9PB 5CPJB 3FDDA 3AZEB 4NFTA 4J8WA 5CPKC 4WV4B 3AYWD 3X1SA 5BNXB 4XUJB 1H3OA 2G5HC 3AZGA 5AV8D 3A6ND 1KX5A 5E5AD 3MGSD 1KX3B 3AZLD 5B31D 3F6TA 5C3IB 4CSRA 3KUYD 4J8VC 3RELB 3UTAB 4KUDB 3KXBC 1P3GA 1P3AD 3B6FB 1TZYD 3C1BA 1BH9A 1EQZB 5JRGA 3B0BA 4H9PA 5CPJA 1P3IA 3AZEA 1R4VA 4KGCC 3TU4D 4J8UC 2PYOA 2AROD 3X1UB 1KX3A 5BT1C 2RIQA 2F8NK 5DNND 3AV1C 2LY8A 3UTAA 3RELA 4ZUXD 5B32D 3B6FA 1EQZA 5B40A 3AFAA 3AZIA 4JJNA 1P3BD 5B24B 1P3MA 1HTAA 3P5JB 3EPKA 5AVCA 3WA9B 5B2ID 2Y2QA 5CHLB 5AV6A 3W99D 3LJAC 3C1CD 2XD5A 3MVDD 3B0DB 1M18C 2F8NB 5GT0A 4H9SC 5CPIB 4UPKA 1P3KD 3AZNA 5GT3D 5B0ZD 4HGAC 3VH5A 1KX4D 3A1IA 4EO5C 3WA9A 5B2JA 3WTPD 3W96D 5B33B 3W98B 4R8PC 4XZQD 5GXQA 2F8NA 4E44A 5GSUB 1S32B 3AZKC 3X1TB 4J8WD 1U35C 1F66B 4WU8A 3LZ1D 3X1SD 3LELC 3KWQC 1P3LD 4QLCA 2NQBC 2YFWB 5B33A 1KX5D 4NE6A 3W98A 5KDMA 5CPKB 2F8NH 4J8XA 1P3GD 3O62A 4Z5TA 5JRGD 2BG1A 3X1VB 2FJ7A 2RVQC 1P3ID 5GSUA 3MNNC 1HQ3C 5BS7C 1ID3C 5F99C 4J8VB 3AZFC 3X1UC 2PYOD 3WKJA 4KHAB 4KGCB 1JFIB 3RELD 2CV5D 3B6FD 3REID 1EQZD 5B40D 5B1MB 3AFAD 3AZID 1W2EA 4JJND 4YS3C 3AV1B 1P3MD 2HIOB 5BNVB 3KXBA 1M1AB 5AVCD 2L5AA 4KHAA 1P3FD 5AV6D 2BYKA 5B0YC 4YM6D 3UTBC 4KGCA 5AV5A 4J8UA 1BFMA 3EG5B 5FUGA 3REJC 5CPIC 3R45A 5GT0D 2ZY2A 3LZ0B 3LJAB 3B6GC 3AZND 3W97A 5BNVA 2Y2HA 3WA9D 5B2JD 2JCHA 1M19A 4WNNA 4LD9D 4HGAB 3MGRA 4DRBA 5GXQD 4EO5B 5CP6C 2BYMB 1F66C 1AOIC 3LJAA 4WU8D 3AV2C 1M18A 3B0CW 4UUZB 4QLCD 1WWIA 5B33D 3AZKB 3AYWC 1U35B 3W98D 3X1VC 4J8XD 3LELB 1Q9CA 5E5AC 3O62D 4Z5TD 2IO5C 3H0RC 3KWQB 3MGSC 1N1JB 3AZLC 2FJ7D 2NQBB 5AY8B 3KUYC 4R8PA 4G92C 1TZYC 3VH6W 3AZMB 1ULYA 2YFVB 4Z2MG 3WKJD 3VH5T 1HQ3B 3MNNB 3TU4C 1WWSA 5BNXA 4XUJA 3AZKA 1ID3B 1U35A 5F99B 3MGPB 5B1MC 3AZFB 3AN2D 2Y2PA 1N1JA 2HIOC 4KUDA 1M1AC 5AV9C 3KXBD 1P34B 4E45A 1P3BC 4WJ3C 3MNNA 1HQ3A 5BS7A 4YS3B 1ID3A 4KGCD 2ZY4A 3V9RB 5AV5D 4J8UD 4H9QB 3AZFA 3X1UA 4WU9C 3LZ0C 4H9NB 3AZHD 4X23B 5B31G 3C1CC 4Z66D 1P3OD 5B0YB 5G49B 5BT1D 3UTBB 3EPLA 2FFFB 3W97D 2NZDD 1ZLAC 3REJB 3MGQC 5B24A 2W8SA 1P3PC 1P3KC 3B6GB 3UT9C 4YS3A 5BO0B 4DQYB 1M19D 3V9RA 1Z2CB 4H9QA 3W96C 3WTPC 3MGRD 4G91C 4NE3A 5G49A 5B32G 3UTBA 5DNMC 3REJA 1M18D 5CPIA 5CP6B 4J8WC 1AOIB 3LZ1C 3B6GA 3AZGD 3X1SC 3AV2B 1P3LC 5AY8C 1BH8B 3AZMC 3AYWB 3C1BD 4R8PD 1P3GC 5CPJD 3A6NB 3AZED 1S32A 5E5AB 3MGSB 2IO5B 3AZLB 3X1TA 1F66A 3MGPC 2XD1A 3KUYB 1AOIA 3AZKD 4XUJD 1P3AB 4G92B 1TZYB 3A1KA 3B0CT 2PYOC 2YFWA 1KX3D 1BH8A 5CPKA 2J8PA 3REHC 3UTAD 3TU4B 3KSYA 4KUDD 3AYWA 2CV5C 1P34C 3REIC 3X1VA 2AROB 3MGSA 3AZIC 3AZLA 4J8VA 2Y2LA 4JJNC 3REKC 3KUYA 1HQ3D 4ZUXB 5B32B 1ID3D 1PZRA 4X23C 3AZJC 5AV9B 3AZFD 4M6BA 4DRAA 3X1UD 1P3FC 5AV6C 1P3BB 4YM6C 1JFIA 2JE5A 2Y2NA 4ZBJC 1F1EA 2ZY5A 2G5IC 5B1MA 5B1LC 4WU9B 3W99B 5B24D 3AV1A 3C1CB 2HIOA 3AZNC 1M1AA 3WAAC 4YS3D 1ZLAB 5AV9A 3MGQB 5JA4B 1P3PB 1P3KB 4LD9C 5GT3B 5B0ZB 3UT9B 2F8ND 2CWEA 3W96B 3WTPB 3REJD 4WU9A 4G91B 3LZ0A 5CPID 1TAFB 1B67A 4XZQB 5AVBC 3EPJA 3VH6A 3B6GD 1ZLAA 3IP4C 5DNMB 4H9SA 4QLCC 3MGQA 5JA4A 1P3PA 4J8WB 2HUEC 5AV8C 3A6NC 3LZ1B 3UT9A 3X1SB 2JSSA 1H3OB 2BYMA 5B31C 3O62C 1P3LB 5GSUD 1S32D 3X1TD 1P3AC 1F66D 4CSRB 2ZM5A 1P3GB 4UUZA 1BH9B 2UWXA 5DNMA 1P3IB 5CPKD 2AROC 2VQRA 3LELA 3LZ1A 3KWQA 3AN2C 2PYOB 2NQBA 4CAYB 3X1VD 2F8NG 5DNNC 1P3LA 5AY8A 4ZUXC 3H0MC 5B32C 4J8VD 3REHB 3AZMA 2YFVA 2CV5B 3REIB 5B40B 3NQJB 3AFAB 3AZIB 5F99A 3MGPA 4JJNB 3REKB 1P3MB 4H9OB 5B2IC 5AV5C 3W99C 5AVCB 3AZJB 5B1MD 4CAYA 3AZHC 1P3FB 3MVDC 4Z66C 5AV6B 1P3OC 4YM6B 3AV1D 1KU5A 3EPHA 4H9RB 3REHA 2HIOD 4ZBJB 3W97C 2NZDC 1M1AD 2CV5A 1P34A 3REIA 5B1LB 4WZSB 5AV9D 3NQJA 5GT0B 5GT3C 5B0ZC 1KX4C 1T3UA 3AZNB 3REKA 4H9OA 1M19C 3WAAB 3MGRC 4H9NA 4X23A 4AWLC 4XZQC 3AZJA 5B2JB 1P3FA 5B0YA 4WU9D 4NE5A 3LZ0D 3LJAD 4YM6A 4H9RA 4LD9B 5GXQB 5B1LA 1ZLAD 3MGQD 5BO0A 1P3PD 5AVBB 3AZGC 4WU8B 1KX5C 3UT9D 3WAAA 3NQUB 4QLCB 2Y2JA 2Y2OA 3C1BC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KDM B;  2HUE B;  5AV8 B;  5JRG C;  4LD9 A;  4J8X B;  5CPJ C;  1P3I C;  5CP6 A;  3AZE C;  5B31 B;  3O62 B;  4Z5T B;  5DNM D;  2FJ7 B;  1U35 D;  4XUJ C;  5AVB A;  3AV2 A;  4Z2M H;  3VH5 W;  3LEL D;  1KX3 C;  3KWQ D;  2NQB D;  5C3I C;  3NQU A;  3WKJ B;  5AY8 D;  3UTA C;  3REL C;  4KUD C;  3B6F C;  1EQZ C;  5B40 C;  5AV8 A;  3A6N A;  3AZM D;  5E5A A;  3AFA C;  3AN2 B;  5B31 A;  5DNN B;  2RVQ D;  1P3M C;  3MNN D;  3VH6 T;  1P3A A;  1TZY A;  5F99 D;  5AVC C;  3MGP D;  3WTP E;  3KXB B;  3TU4 A;  2BYK B;  5B2I B;  3REH D;  2ARO A;  5AV5 B;  4J8U B;  5FUG B;  5GT0 C;  1P34 D;  3AN2 A;  3AZH B;  5DNN A;  3R45 B;  5B24 C;  3MVD B;  4Z66 B;  4ZUX A;  1P3O B;  5B32 A;  3REK D;  3W97 B;  2NZD B;  3WA9 C;  5B2J C;  1P3B A;  4X23 D;  3AZJ D;  5B0Y D;  1KX4 B;  3UTB D;  3B0D C;  5GXQ C;  5B2I A;  4WNN B;  1M19 B;  3MGR B;  4AWL B;  3W99 A;  3AZH A;  3C1C A;  5B1L D;  4WU8 C;  3MVD A;  4Z66 A;  1P3O A;  2NZD A;  1B6W A;  5B33 C;  1M18 B;  3WAA D;  1P3K A;  3W98 C;  5GT3 A;  5B0Z A;  4J8X C;  1KX4 A;  4Z5T C;  3AZG B;  3W96 A;  3WTP A;  2FJ7 C;  1KX5 B;  5GSU C;  5CP6 D;  1TAF A;  1S32 C;  4XZQ A;  3X1T C;  1AOI D;  3C1B B;  4R8P B;  5JRG B;  5AVB D;  3AV2 D;  3WKJ C;  1A7W A;  4H9P B;  5CPJ B;  3AZE B;  4NFT A;  4J8W A;  5CPK C;  4WV4 B;  3AYW D;  3X1S A;  5BNX B;  4XUJ B;  1H3O A;  3AZG A;  5AV8 D;  3A6N D;  1KX5 A;  5E5A D;  3MGS D;  1KX3 B;  3AZL D;  5B31 D;  5C3I B;  4CSR A;  3KUY D;  4J8V C;  3REL B;  3UTA B;  4KUD B;  3KXB C;  1P3G A;  1P3A D;  3B6F B;  1TZY D;  3C1B A;  1BH9 A;  1EQZ B;  5JRG A;  3B0B A;  4H9P A;  5CPJ A;  1P3I A;  3AZE A;  1R4V A;  4KGC C;  3TU4 D;  4J8U C;  2PYO A;  2ARO D;  3X1U B;  1KX3 A;  5BT1 C;  2F8N K;  5DNN D;  3AV1 C;  2LY8 A;  3UTA A;  3REL A;  4ZUX D;  5B32 D;  3B6F A;  1EQZ A;  5B40 A;  3AFA A;  3AZI A;  4JJN A;  1P3B D;  5B24 B;  1P3M A;  1HTA A;  5AVC A;  3WA9 B;  5B2I D;  5CHL B;  5AV6 A;  3W99 D;  3LJA C;  3C1C D;  3MVD D;  3B0D B;  1M18 C;  2F8N B;  5GT0 A;  4H9S C;  5CPI B;  1P3K D;  3AZN A;  5GT3 D;  5B0Z D;  4HGA C;  3VH5 A;  1KX4 D;  4EO5 C;  3WA9 A;  5B2J A;  3WTP D;  3W96 D;  5B33 B;  3W98 B;  4R8P C;  4XZQ D;  5GXQ A;  2F8N A;  4E44 A;  5GSU B;  1S32 B;  3AZK C;  3X1T B;  4J8W D;  1U35 C;  1F66 B;  4WU8 A;  3LZ1 D;  3X1S D;  3LEL C;  3KWQ C;  1P3L D;  4QLC A;  2NQB C;  2YFW B;  5B33 A;  1KX5 D;  4NE6 A;  3W98 A;  5KDM A;  5CPK B;  2F8N H;  4J8X A;  1P3G D;  3O62 A;  4Z5T A;  5JRG D;  3X1V B;  2FJ7 A;  2RVQ C;  1P3I D;  5GSU A;  3MNN C;  1HQ3 C;  5BS7 C;  1ID3 C;  5F99 C;  4J8V B;  3AZF C;  3X1U C;  2PYO D;  3WKJ A;  4KHA B;  4KGC B;  1JFI B;  3REL D;  2CV5 D;  3B6F D;  3REI D;  1EQZ D;  5B40 D;  5B1M B;  3AFA D;  3AZI D;  4JJN D;  4YS3 C;  3AV1 B;  1P3M D;  2HIO B;  5BNV B;  3KXB A;  1M1A B;  5AVC D;  2L5A A;  4KHA A;  1P3F D;  5AV6 D;  2BYK A;  5B0Y C;  4YM6 D;  3UTB C;  4KGC A;  5AV5 A;  4J8U A;  1BFM A;  5FUG A;  3REJ C;  5CPI C;  3R45 A;  5GT0 D;  3LZ0 B;  3LJA B;  3B6G C;  3AZN D;  3W97 A;  5BNV A;  3WA9 D;  5B2J D;  1M19 A;  4WNN A;  4LD9 D;  4HGA B;  3MGR A;  4DRB A;  5GXQ D;  4EO5 B;  5CP6 C;  2BYM B;  1F66 C;  1AOI C;  3LJA A;  4WU8 D;  3AV2 C;  1M18 A;  3B0C W;  4UUZ B;  4QLC D;  1WWI A;  5B33 D;  3AZK B;  3AYW C;  1U35 B;  3W98 D;  3X1V C;  4J8X D;  3LEL B;  1Q9C A;  5E5A C;  3O62 D;  4Z5T D;  2IO5 C;  3KWQ B;  3MGS C;  3AZL C;  1N1J B;  2NQB B;  2FJ7 D;  5AY8 B;  3KUY C;  4R8P A;  4G92 C;  1TZY C;  3VH6 W;  3AZM B;  1ULY A;  2YFV B;  4Z2M G;  3WKJ D;  3VH5 T;  1HQ3 B;  3MNN B;  3TU4 C;  1WWS A;  5BNX A;  4XUJ A;  3AZK A;  1ID3 B;  1U35 A;  5F99 B;  3MGP B;  5B1M C;  3AZF B;  3AN2 D;  1N1J A;  2HIO C;  4KUD A;  1M1A C;  5AV9 C;  3KXB D;  1P34 B;  4E45 A;  1P3B C;  3MNN A;  1HQ3 A;  5BS7 A;  4YS3 B;  1ID3 A;  4KGC D;  3V9R B;  5AV5 D;  4J8U D;  4H9Q B;  3AZF A;  3X1U A;  4WU9 C;  3LZ0 C;  4H9N B;  3AZH D;  4X23 B;  5B31 G;  3C1C C;  4Z66 D;  1P3O D;  5B0Y B;  5G49 B;  5BT1 D;  3UTB B;  3W97 D;  2NZD D;  1ZLA C;  3REJ B;  3MGQ C;  5B24 A;  1P3P C;  1P3K C;  3B6G B;  3UT9 C;  4YS3 A;  5BO0 B;  1M19 D;  3V9R A;  4H9Q A;  3MGR D;  3W96 C;  3WTP C;  4G91 C;  4NE3 A;  5G49 A;  5B32 G;  3UTB A;  5DNM C;  3REJ A;  1M18 D;  5CPI A;  5CP6 B;  4J8W C;  1AOI B;  3LZ1 C;  3B6G A;  3AZG D;  3X1S C;  3AV2 B;  1P3L C;  5AY8 C;  1BH8 B;  3AZM C;  3AYW B;  3C1B D;  4R8P D;  1P3G C;  5CPJ D;  3A6N B;  3AZE D;  1S32 A;  5E5A B;  3MGS B;  2IO5 B;  3AZL B;  3X1T A;  1F66 A;  3MGP C;  3KUY B;  1AOI A;  3AZK D;  4XUJ D;  1P3A B;  4G92 B;  1TZY B;  3B0C T;  2PYO C;  2YFW A;  1KX3 D;  1BH8 A;  5CPK A;  3REH C;  3UTA D;  3TU4 B;  3KSY A;  4KUD D;  3AYW A;  2CV5 C;  1P34 C;  3REI C;  3X1V A;  2ARO B;  3MGS A;  3AZI C;  3AZL A;  4J8V A;  4JJN C;  3REK C;  3KUY A;  1HQ3 D;  4ZUX B;  5B32 B;  1ID3 D;  4X23 C;  3AZJ C;  5AV9 B;  3AZF D;  4M6B A;  4DRA A;  3X1U D;  1P3F C;  5AV6 C;  1P3B B;  4YM6 C;  1JFI A;  4ZBJ C;  1F1E A;  5B1M A;  5B1L C;  4WU9 B;  3W99 B;  5B24 D;  3AV1 A;  3C1C B;  2HIO A;  3AZN C;  1M1A A;  3WAA C;  4YS3 D;  1ZLA B;  5AV9 A;  3MGQ B;  5JA4 B;  1P3P B;  1P3K B;  4LD9 C;  5GT3 B;  5B0Z B;  3UT9 B;  2F8N D;  2CWE A;  3W96 B;  3WTP B;  3REJ D;  4WU9 A;  4G91 B;  3LZ0 A;  5CPI D;  1TAF B;  1B67 A;  4XZQ B;  5AVB C;  3VH6 A;  3B6G D;  1ZLA A;  5DNM B;  4H9S A;  4QLC C;  3MGQ A;  5JA4 A;  1P3P A;  4J8W B;  2HUE C;  5AV8 C;  3A6N C;  3LZ1 B;  3UT9 A;  3X1S B;  2JSS A;  1H3O B;  2BYM A;  5B31 C;  3O62 C;  1P3L B;  5GSU D;  1S32 D;  3X1T D;  1P3A C;  1F66 D;  4CSR B;  1P3G B;  4UUZ A;  1BH9 B;  5DNM A;  1P3I B;  5CPK D;  2ARO C;  3LEL A;  3LZ1 A;  3KWQ A;  3AN2 C;  2PYO B;  2NQB A;  4CAY B;  3X1V D;  2F8N G;  5DNN C;  1P3L A;  5AY8 A;  4ZUX C;  5B32 C;  4J8V D;  3REH B;  3AZM A;  2YFV A;  2CV5 B;  3REI B;  5B40 B;  3NQJ B;  3AFA B;  3AZI B;  5F99 A;  3MGP A;  4JJN B;  3REK B;  1P3M B;  4H9O B;  5B2I C;  5AV5 C;  3W99 C;  5AVC B;  3AZJ B;  5B1M D;  4CAY A;  3AZH C;  1P3F B;  3MVD C;  4Z66 C;  5AV6 B;  1P3O C;  4YM6 B;  3AV1 D;  1KU5 A;  4H9R B;  3REH A;  2HIO D;  4ZBJ B;  3W97 C;  2NZD C;  1M1A D;  2CV5 A;  1P34 A;  3REI A;  5B1L B;  4WZS B;  5AV9 D;  3NQJ A;  5GT0 B;  5GT3 C;  5B0Z C;  1KX4 C;  3AZN B;  3REK A;  4H9O A;  1M19 C;  3WAA B;  3MGR C;  4H9N A;  4X23 A;  4AWL C;  4XZQ C;  3AZJ A;  5B2J B;  1P3F A;  5B0Y A;  4WU9 D;  4NE5 A;  3LZ0 D;  3LJA D;  4YM6 A;  4H9R A;  4LD9 B;  5GXQ B;  5B1L A;  1ZLA D;  3MGQ D;  5BO0 A;  1P3P D;  5AVB B;  3AZG C;  4WU8 B;  1KX5 C;  3UT9 D;  3WAA A;  3NQU B;  4QLC B;  3C1B C; 
#chains in the Genus database with same CATH topology
 5KDM B;  2HUE B;  5AV8 B;  5JRG C;  4LD9 A;  4J8X B;  5CPJ C;  1P3I C;  5CP6 A;  3AZE C;  5B31 B;  3O62 B;  3KFU G;  4Z5T B;  3H0L C;  5DNM D;  2FJ7 B;  1U35 D;  2Y2I A;  4XUJ C;  5AVB A;  3AV2 A;  4Z2M H;  3VH5 W;  3LEL D;  1KX3 C;  3KWQ D;  2NQB D;  5C3I C;  3NQU A;  3WKJ B;  3AL0 C;  2F2A C;  5AY8 D;  3REL C;  3UTA C;  4KUD C;  3B6F C;  2ZY3 A;  1EQZ C;  5B40 C;  5AV8 A;  3A6N A;  3AZM D;  5E5A A;  2DF4 C;  3AFA C;  3AN2 B;  5B31 A;  5DNN B;  2RVQ D;  1P3M C;  2Y2G A;  3MNN D;  2DQN C;  3VH6 T;  1P3A A;  1TZY A;  5F99 D;  5AVC C;  3MGP D;  2Y2M A;  3WTP E;  3KXB B;  3TU4 A;  2BYK B;  2Y2K A;  5B2I B;  3REH D;  2ARO A;  5AV5 B;  4J8U B;  5FUG B;  5GT0 C;  1P34 D;  3AN2 A;  3AZH B;  5DNN A;  3R45 B;  5B24 C;  3MVD B;  4Z66 B;  4ZUX A;  1P3O B;  5B32 A;  3REK D;  3W97 B;  2NZD B;  3WA9 C;  5B2J C;  1P3B A;  4X23 D;  3AZJ D;  5B0Y D;  1KX4 B;  3UTB D;  3B0D C;  5GXQ C;  5B2I A;  4WNN B;  1M19 B;  3MGR B;  4AWL B;  3W99 A;  3AZH A;  3C1C A;  5B1L D;  4WU8 C;  3MVD A;  4Z66 A;  1P3O A;  2NZD A;  1B6W A;  5B33 C;  1M18 B;  3WAA D;  1P3K A;  3W98 C;  5GT3 A;  5B0Z A;  4J8X C;  1KX4 A;  4Z5T C;  3AZG B;  3W96 A;  3WTP A;  2FJ7 C;  1KX5 B;  5GSU C;  5CP6 D;  1TAF A;  1S32 C;  4XZQ A;  3X1T C;  1AOI D;  3C1B B;  4R8P B;  5JRG B;  5AVB D;  3AV2 D;  3WKJ C;  1A7W A;  4H9P B;  5CPJ B;  3FDD A;  3AZE B;  4NFT A;  4J8W A;  5CPK C;  4WV4 B;  3AYW D;  3X1S A;  5BNX B;  4XUJ B;  1H3O A;  2G5H C;  3AZG A;  5AV8 D;  3A6N D;  1KX5 A;  5E5A D;  3MGS D;  1KX3 B;  3AZL D;  5B31 D;  3F6T A;  5C3I B;  4CSR A;  3KUY D;  4J8V C;  3REL B;  3UTA B;  4KUD B;  3KXB C;  1P3G A;  1P3A D;  3B6F B;  1TZY D;  3C1B A;  1BH9 A;  1EQZ B;  5JRG A;  3B0B A;  4H9P A;  5CPJ A;  1P3I A;  3AZE A;  1R4V A;  4KGC C;  3TU4 D;  4J8U C;  2PYO A;  2ARO D;  3X1U B;  1KX3 A;  5BT1 C;  2RIQ A;  2F8N K;  5DNN D;  3AV1 C;  2LY8 A;  3UTA A;  3REL A;  4ZUX D;  5B32 D;  3B6F A;  1EQZ A;  5B40 A;  3AFA A;  3AZI A;  4JJN A;  1P3B D;  5B24 B;  1P3M A;  1HTA A;  3P5J B;  3EPK A;  5AVC A;  3WA9 B;  5B2I D;  2Y2Q A;  5CHL B;  5AV6 A;  3W99 D;  3LJA C;  3C1C D;  2XD5 A;  3MVD D;  3B0D B;  1M18 C;  2F8N B;  5GT0 A;  4H9S C;  5CPI B;  4UPK A;  1P3K D;  3AZN A;  5GT3 D;  5B0Z D;  4HGA C;  3VH5 A;  1KX4 D;  3A1I A;  4EO5 C;  3WA9 A;  5B2J A;  3WTP D;  3W96 D;  5B33 B;  3W98 B;  4R8P C;  4XZQ D;  5GXQ A;  2F8N A;  4E44 A;  5GSU B;  1S32 B;  3AZK C;  3X1T B;  4J8W D;  1U35 C;  1F66 B;  4WU8 A;  3LZ1 D;  3X1S D;  3LEL C;  3KWQ C;  1P3L D;  4QLC A;  2NQB C;  2YFW B;  5B33 A;  1KX5 D;  4NE6 A;  3W98 A;  5KDM A;  5CPK B;  2F8N H;  4J8X A;  1P3G D;  3O62 A;  4Z5T A;  5JRG D;  2BG1 A;  3X1V B;  2FJ7 A;  2RVQ C;  1P3I D;  5GSU A;  3MNN C;  1HQ3 C;  5BS7 C;  1ID3 C;  5F99 C;  4J8V B;  3AZF C;  3X1U C;  2PYO D;  3WKJ A;  4KHA B;  4KGC B;  1JFI B;  3REL D;  2CV5 D;  3B6F D;  3REI D;  1EQZ D;  5B40 D;  5B1M B;  3AFA D;  3AZI D;  1W2E A;  4JJN D;  4YS3 C;  3AV1 B;  1P3M D;  2HIO B;  5BNV B;  3KXB A;  1M1A B;  5AVC D;  2L5A A;  4KHA A;  1P3F D;  5AV6 D;  2BYK A;  5B0Y C;  4YM6 D;  3UTB C;  4KGC A;  5AV5 A;  4J8U A;  1BFM A;  3EG5 B;  5FUG A;  3REJ C;  5CPI C;  3R45 A;  5GT0 D;  2ZY2 A;  3LZ0 B;  3LJA B;  3B6G C;  3AZN D;  3W97 A;  5BNV A;  2Y2H A;  3WA9 D;  5B2J D;  2JCH A;  1M19 A;  4WNN A;  4LD9 D;  4HGA B;  3MGR A;  4DRB A;  5GXQ D;  4EO5 B;  5CP6 C;  2BYM B;  1F66 C;  1AOI C;  3LJA A;  4WU8 D;  3AV2 C;  1M18 A;  3B0C W;  4UUZ B;  4QLC D;  1WWI A;  5B33 D;  3AZK B;  3AYW C;  1U35 B;  3W98 D;  3X1V C;  4J8X D;  3LEL B;  1Q9C A;  5E5A C;  3O62 D;  4Z5T D;  2IO5 C;  3H0R C;  3KWQ B;  3MGS C;  1N1J B;  3AZL C;  2FJ7 D;  2NQB B;  5AY8 B;  3KUY C;  4R8P A;  4G92 C;  1TZY C;  3VH6 W;  3AZM B;  1ULY A;  2YFV B;  4Z2M G;  3WKJ D;  3VH5 T;  1HQ3 B;  3MNN B;  3TU4 C;  1WWS A;  5BNX A;  4XUJ A;  3AZK A;  1ID3 B;  1U35 A;  5F99 B;  3MGP B;  5B1M C;  3AZF B;  3AN2 D;  2Y2P A;  1N1J A;  2HIO C;  4KUD A;  1M1A C;  5AV9 C;  3KXB D;  1P34 B;  4E45 A;  1P3B C;  4WJ3 C;  3MNN A;  1HQ3 A;  5BS7 A;  4YS3 B;  1ID3 A;  4KGC D;  2ZY4 A;  3V9R B;  5AV5 D;  4J8U D;  4H9Q B;  3AZF A;  3X1U A;  4WU9 C;  3LZ0 C;  4H9N B;  3AZH D;  4X23 B;  5B31 G;  3C1C C;  4Z66 D;  1P3O D;  5B0Y B;  5G49 B;  5BT1 D;  3UTB B;  3EPL A;  2FFF B;  3W97 D;  2NZD D;  1ZLA C;  3REJ B;  3MGQ C;  5B24 A;  2W8S A;  1P3P C;  1P3K C;  3B6G B;  3UT9 C;  4YS3 A;  5BO0 B;  4DQY B;  1M19 D;  3V9R A;  1Z2C B;  4H9Q A;  3W96 C;  3WTP C;  3MGR D;  4G91 C;  4NE3 A;  5G49 A;  5B32 G;  3UTB A;  5DNM C;  3REJ A;  1M18 D;  5CPI A;  5CP6 B;  4J8W C;  1AOI B;  3LZ1 C;  3B6G A;  3AZG D;  3X1S C;  3AV2 B;  1P3L C;  5AY8 C;  1BH8 B;  3AZM C;  3AYW B;  3C1B D;  4R8P D;  1P3G C;  5CPJ D;  3A6N B;  3AZE D;  1S32 A;  5E5A B;  3MGS B;  2IO5 B;  3AZL B;  3X1T A;  1F66 A;  3MGP C;  2XD1 A;  3KUY B;  1AOI A;  3AZK D;  4XUJ D;  1P3A B;  4G92 B;  1TZY B;  3A1K A;  3B0C T;  2PYO C;  2YFW A;  1KX3 D;  1BH8 A;  5CPK A;  2J8P A;  3REH C;  3UTA D;  3TU4 B;  3KSY A;  4KUD D;  3AYW A;  2CV5 C;  1P34 C;  3REI C;  3X1V A;  2ARO B;  3MGS A;  3AZI C;  3AZL A;  4J8V A;  2Y2L A;  4JJN C;  3REK C;  3KUY A;  1HQ3 D;  4ZUX B;  5B32 B;  1ID3 D;  1PZR A;  4X23 C;  3AZJ C;  5AV9 B;  3AZF D;  4M6B A;  4DRA A;  3X1U D;  1P3F C;  5AV6 C;  1P3B B;  4YM6 C;  1JFI A;  2JE5 A;  2Y2N A;  4ZBJ C;  1F1E A;  2ZY5 A;  2G5I C;  5B1M A;  5B1L C;  4WU9 B;  3W99 B;  5B24 D;  3AV1 A;  3C1C B;  2HIO A;  3AZN C;  1M1A A;  3WAA C;  4YS3 D;  1ZLA B;  5AV9 A;  3MGQ B;  5JA4 B;  1P3P B;  1P3K B;  4LD9 C;  5GT3 B;  5B0Z B;  3UT9 B;  2F8N D;  2CWE A;  3W96 B;  3WTP B;  3REJ D;  4WU9 A;  4G91 B;  3LZ0 A;  5CPI D;  1TAF B;  1B67 A;  4XZQ B;  5AVB C;  3EPJ A;  3VH6 A;  3B6G D;  1ZLA A;  3IP4 C;  5DNM B;  4H9S A;  4QLC C;  3MGQ A;  5JA4 A;  1P3P A;  4J8W B;  2HUE C;  5AV8 C;  3A6N C;  3LZ1 B;  3UT9 A;  3X1S B;  2JSS A;  1H3O B;  2BYM A;  5B31 C;  3O62 C;  1P3L B;  5GSU D;  1S32 D;  3X1T D;  1P3A C;  1F66 D;  4CSR B;  2ZM5 A;  1P3G B;  4UUZ A;  1BH9 B;  2UWX A;  5DNM A;  1P3I B;  5CPK D;  2ARO C;  2VQR A;  3LEL A;  3LZ1 A;  3KWQ A;  3AN2 C;  2PYO B;  2NQB A;  4CAY B;  3X1V D;  2F8N G;  5DNN C;  1P3L A;  5AY8 A;  4ZUX C;  3H0M C;  5B32 C;  4J8V D;  3REH B;  3AZM A;  2YFV A;  2CV5 B;  3REI B;  5B40 B;  3NQJ B;  3AFA B;  3AZI B;  5F99 A;  3MGP A;  4JJN B;  3REK B;  1P3M B;  4H9O B;  5B2I C;  5AV5 C;  3W99 C;  5AVC B;  3AZJ B;  5B1M D;  4CAY A;  3AZH C;  1P3F B;  3MVD C;  4Z66 C;  5AV6 B;  1P3O C;  4YM6 B;  3AV1 D;  1KU5 A;  3EPH A;  4H9R B;  3REH A;  2HIO D;  4ZBJ B;  3W97 C;  2NZD C;  1M1A D;  2CV5 A;  1P34 A;  3REI A;  5B1L B;  4WZS B;  5AV9 D;  3NQJ A;  5GT0 B;  5GT3 C;  5B0Z C;  1KX4 C;  1T3U A;  3AZN B;  3REK A;  4H9O A;  1M19 C;  3WAA B;  3MGR C;  4H9N A;  4X23 A;  4AWL C;  4XZQ C;  3AZJ A;  5B2J B;  1P3F A;  5B0Y A;  4WU9 D;  4NE5 A;  3LZ0 D;  3LJA D;  4YM6 A;  4H9R A;  4LD9 B;  5GXQ B;  5B1L A;  1ZLA D;  3MGQ D;  5BO0 A;  1P3P D;  5AVB B;  3AZG C;  4WU8 B;  1KX5 C;  3UT9 D;  3WAA A;  3NQU B;  4QLC B;  2Y2J A;  2Y2O A;  3C1B C; 
#chains in the Genus database with same CATH homology
 5KDM B;  2HUE B;  5AV8 B;  5JRG C;  4LD9 A;  4J8X B;  5CPJ C;  1P3I C;  5CP6 A;  3AZE C;  5B31 B;  3O62 B;  3KFU G;  4Z5T B;  3H0L C;  5DNM D;  2FJ7 B;  1U35 D;  2Y2I A;  4XUJ C;  5AVB A;  3AV2 A;  4Z2M H;  3VH5 W;  3LEL D;  1KX3 C;  3KWQ D;  2NQB D;  5C3I C;  3NQU A;  3WKJ B;  3AL0 C;  2F2A C;  5AY8 D;  3REL C;  3UTA C;  4KUD C;  3B6F C;  2ZY3 A;  1EQZ C;  5B40 C;  5AV8 A;  3A6N A;  3AZM D;  5E5A A;  2DF4 C;  3AFA C;  3AN2 B;  5B31 A;  5DNN B;  2RVQ D;  1P3M C;  2Y2G A;  3MNN D;  2DQN C;  3VH6 T;  1P3A A;  1TZY A;  5F99 D;  5AVC C;  3MGP D;  2Y2M A;  3WTP E;  3KXB B;  3TU4 A;  2BYK B;  2Y2K A;  5B2I B;  3REH D;  2ARO A;  5AV5 B;  4J8U B;  5FUG B;  5GT0 C;  1P34 D;  3AN2 A;  3AZH B;  5DNN A;  3R45 B;  5B24 C;  3MVD B;  4Z66 B;  4ZUX A;  1P3O B;  5B32 A;  3REK D;  3W97 B;  2NZD B;  3WA9 C;  5B2J C;  1P3B A;  4X23 D;  3AZJ D;  5B0Y D;  1KX4 B;  3UTB D;  3B0D C;  5GXQ C;  5B2I A;  4WNN B;  1M19 B;  3MGR B;  4AWL B;  3W99 A;  3AZH A;  3C1C A;  5B1L D;  4WU8 C;  3MVD A;  4Z66 A;  1P3O A;  2NZD A;  1B6W A;  5B33 C;  1M18 B;  3WAA D;  1P3K A;  3W98 C;  5GT3 A;  5B0Z A;  4J8X C;  1KX4 A;  4Z5T C;  3AZG B;  3W96 A;  3WTP A;  2FJ7 C;  1KX5 B;  5GSU C;  5CP6 D;  1TAF A;  1S32 C;  4XZQ A;  3X1T C;  1AOI D;  3C1B B;  4R8P B;  5JRG B;  5AVB D;  3AV2 D;  3WKJ C;  1A7W A;  4H9P B;  5CPJ B;  3FDD A;  3AZE B;  4NFT A;  4J8W A;  5CPK C;  4WV4 B;  3AYW D;  3X1S A;  5BNX B;  4XUJ B;  1H3O A;  2G5H C;  3AZG A;  5AV8 D;  3A6N D;  1KX5 A;  5E5A D;  3MGS D;  1KX3 B;  3AZL D;  5B31 D;  3F6T A;  5C3I B;  4CSR A;  3KUY D;  4J8V C;  3REL B;  3UTA B;  4KUD B;  3KXB C;  1P3G A;  1P3A D;  3B6F B;  1TZY D;  3C1B A;  1BH9 A;  1EQZ B;  5JRG A;  3B0B A;  4H9P A;  5CPJ A;  1P3I A;  3AZE A;  1R4V A;  4KGC C;  3TU4 D;  4J8U C;  2PYO A;  2ARO D;  3X1U B;  1KX3 A;  5BT1 C;  2RIQ A;  2F8N K;  5DNN D;  3AV1 C;  2LY8 A;  3UTA A;  3REL A;  4ZUX D;  5B32 D;  3B6F A;  1EQZ A;  5B40 A;  3AFA A;  3AZI A;  4JJN A;  1P3B D;  5B24 B;  1P3M A;  1HTA A;  3P5J B;  3EPK A;  5AVC A;  3WA9 B;  5B2I D;  2Y2Q A;  5CHL B;  5AV6 A;  3W99 D;  3LJA C;  3C1C D;  2XD5 A;  3MVD D;  3B0D B;  1M18 C;  2F8N B;  5GT0 A;  4H9S C;  5CPI B;  4UPK A;  1P3K D;  3AZN A;  5GT3 D;  5B0Z D;  4HGA C;  3VH5 A;  1KX4 D;  3A1I A;  4EO5 C;  3WA9 A;  5B2J A;  3WTP D;  3W96 D;  5B33 B;  3W98 B;  4R8P C;  4XZQ D;  5GXQ A;  2F8N A;  4E44 A;  5GSU B;  1S32 B;  3AZK C;  3X1T B;  4J8W D;  1U35 C;  1F66 B;  4WU8 A;  3LZ1 D;  3X1S D;  3LEL C;  3KWQ C;  1P3L D;  4QLC A;  2NQB C;  2YFW B;  5B33 A;  1KX5 D;  4NE6 A;  3W98 A;  5KDM A;  5CPK B;  2F8N H;  4J8X A;  1P3G D;  3O62 A;  4Z5T A;  5JRG D;  2BG1 A;  3X1V B;  2FJ7 A;  2RVQ C;  1P3I D;  5GSU A;  3MNN C;  1HQ3 C;  5BS7 C;  1ID3 C;  5F99 C;  4J8V B;  3AZF C;  3X1U C;  2PYO D;  3WKJ A;  4KHA B;  4KGC B;  1JFI B;  3REL D;  2CV5 D;  3B6F D;  3REI D;  1EQZ D;  5B40 D;  5B1M B;  3AFA D;  3AZI D;  1W2E A;  4JJN D;  4YS3 C;  3AV1 B;  1P3M D;  2HIO B;  5BNV B;  3KXB A;  1M1A B;  5AVC D;  2L5A A;  4KHA A;  1P3F D;  5AV6 D;  2BYK A;  5B0Y C;  4YM6 D;  3UTB C;  4KGC A;  5AV5 A;  4J8U A;  1BFM A;  3EG5 B;  5FUG A;  3REJ C;  5CPI C;  3R45 A;  5GT0 D;  2ZY2 A;  3LZ0 B;  3LJA B;  3B6G C;  3AZN D;  3W97 A;  5BNV A;  2Y2H A;  3WA9 D;  5B2J D;  2JCH A;  1M19 A;  4WNN A;  4LD9 D;  4HGA B;  3MGR A;  4DRB A;  5GXQ D;  4EO5 B;  5CP6 C;  2BYM B;  1F66 C;  1AOI C;  3LJA A;  4WU8 D;  3AV2 C;  1M18 A;  3B0C W;  4UUZ B;  4QLC D;  1WWI A;  5B33 D;  3AZK B;  3AYW C;  1U35 B;  3W98 D;  3X1V C;  4J8X D;  3LEL B;  1Q9C A;  5E5A C;  3O62 D;  4Z5T D;  2IO5 C;  3H0R C;  3KWQ B;  3MGS C;  1N1J B;  3AZL C;  2FJ7 D;  2NQB B;  5AY8 B;  3KUY C;  4R8P A;  4G92 C;  1TZY C;  3VH6 W;  3AZM B;  1ULY A;  2YFV B;  4Z2M G;  3WKJ D;  3VH5 T;  1HQ3 B;  3MNN B;  3TU4 C;  1WWS A;  5BNX A;  4XUJ A;  3AZK A;  1ID3 B;  1U35 A;  5F99 B;  3MGP B;  5B1M C;  3AZF B;  3AN2 D;  2Y2P A;  1N1J A;  2HIO C;  4KUD A;  1M1A C;  5AV9 C;  3KXB D;  1P34 B;  4E45 A;  1P3B C;  4WJ3 C;  3MNN A;  1HQ3 A;  5BS7 A;  4YS3 B;  1ID3 A;  4KGC D;  2ZY4 A;  3V9R B;  5AV5 D;  4J8U D;  4H9Q B;  3AZF A;  3X1U A;  4WU9 C;  3LZ0 C;  4H9N B;  3AZH D;  4X23 B;  5B31 G;  3C1C C;  4Z66 D;  1P3O D;  5B0Y B;  5G49 B;  5BT1 D;  3UTB B;  3EPL A;  2FFF B;  3W97 D;  2NZD D;  1ZLA C;  3REJ B;  3MGQ C;  5B24 A;  2W8S A;  1P3P C;  1P3K C;  3B6G B;  3UT9 C;  4YS3 A;  5BO0 B;  4DQY B;  1M19 D;  3V9R A;  1Z2C B;  4H9Q A;  3W96 C;  3WTP C;  3MGR D;  4G91 C;  4NE3 A;  5G49 A;  5B32 G;  3UTB A;  5DNM C;  3REJ A;  1M18 D;  5CPI A;  5CP6 B;  4J8W C;  1AOI B;  3LZ1 C;  3B6G A;  3AZG D;  3X1S C;  3AV2 B;  1P3L C;  5AY8 C;  1BH8 B;  3AZM C;  3AYW B;  3C1B D;  4R8P D;  1P3G C;  5CPJ D;  3A6N B;  3AZE D;  1S32 A;  5E5A B;  3MGS B;  2IO5 B;  3AZL B;  3X1T A;  1F66 A;  3MGP C;  2XD1 A;  3KUY B;  1AOI A;  3AZK D;  4XUJ D;  1P3A B;  4G92 B;  1TZY B;  3A1K A;  3B0C T;  2PYO C;  2YFW A;  1KX3 D;  1BH8 A;  5CPK A;  2J8P A;  3REH C;  3UTA D;  3TU4 B;  3KSY A;  4KUD D;  3AYW A;  2CV5 C;  1P34 C;  3REI C;  3X1V A;  2ARO B;  3MGS A;  3AZI C;  3AZL A;  4J8V A;  2Y2L A;  4JJN C;  3REK C;  3KUY A;  1HQ3 D;  4ZUX B;  5B32 B;  1ID3 D;  1PZR A;  4X23 C;  3AZJ C;  5AV9 B;  3AZF D;  4M6B A;  4DRA A;  3X1U D;  1P3F C;  5AV6 C;  1P3B B;  4YM6 C;  1JFI A;  2JE5 A;  2Y2N A;  4ZBJ C;  1F1E A;  2ZY5 A;  2G5I C;  5B1M A;  5B1L C;  4WU9 B;  3W99 B;  5B24 D;  3AV1 A;  3C1C B;  2HIO A;  3AZN C;  1M1A A;  3WAA C;  4YS3 D;  1ZLA B;  5AV9 A;  3MGQ B;  5JA4 B;  1P3P B;  1P3K B;  4LD9 C;  5GT3 B;  5B0Z B;  3UT9 B;  2F8N D;  2CWE A;  3W96 B;  3WTP B;  3REJ D;  4WU9 A;  4G91 B;  3LZ0 A;  5CPI D;  1TAF B;  1B67 A;  4XZQ B;  5AVB C;  3EPJ A;  3VH6 A;  3B6G D;  1ZLA A;  3IP4 C;  5DNM B;  4H9S A;  4QLC C;  3MGQ A;  5JA4 A;  1P3P A;  4J8W B;  2HUE C;  5AV8 C;  3A6N C;  3LZ1 B;  3UT9 A;  3X1S B;  2JSS A;  1H3O B;  2BYM A;  5B31 C;  3O62 C;  1P3L B;  5GSU D;  1S32 D;  3X1T D;  1P3A C;  1F66 D;  4CSR B;  2ZM5 A;  1P3G B;  4UUZ A;  1BH9 B;  2UWX A;  5DNM A;  1P3I B;  5CPK D;  2ARO C;  2VQR A;  3LEL A;  3LZ1 A;  3KWQ A;  3AN2 C;  2PYO B;  2NQB A;  4CAY B;  3X1V D;  2F8N G;  5DNN C;  1P3L A;  5AY8 A;  4ZUX C;  3H0M C;  5B32 C;  4J8V D;  3REH B;  3AZM A;  2YFV A;  2CV5 B;  3REI B;  5B40 B;  3NQJ B;  3AFA B;  3AZI B;  5F99 A;  3MGP A;  4JJN B;  3REK B;  1P3M B;  4H9O B;  5B2I C;  5AV5 C;  3W99 C;  5AVC B;  3AZJ B;  5B1M D;  4CAY A;  3AZH C;  1P3F B;  3MVD C;  4Z66 C;  5AV6 B;  1P3O C;  4YM6 B;  3AV1 D;  1KU5 A;  3EPH A;  4H9R B;  3REH A;  2HIO D;  4ZBJ B;  3W97 C;  2NZD C;  1M1A D;  2CV5 A;  1P34 A;  3REI A;  5B1L B;  4WZS B;  5AV9 D;  3NQJ A;  5GT0 B;  5GT3 C;  5B0Z C;  1KX4 C;  1T3U A;  3AZN B;  3REK A;  4H9O A;  1M19 C;  3WAA B;  3MGR C;  4H9N A;  4X23 A;  4AWL C;  4XZQ C;  3AZJ A;  5B2J B;  1P3F A;  5B0Y A;  4WU9 D;  4NE5 A;  3LZ0 D;  3LJA D;  4YM6 A;  4H9R A;  4LD9 B;  5GXQ B;  5B1L A;  1ZLA D;  3MGQ D;  5BO0 A;  1P3P D;  5AVB B;  3AZG C;  4WU8 B;  1KX5 C;  3UT9 D;  3WAA A;  3NQU B;  4QLC B;  2Y2J A;  2Y2O A;  3C1B C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...