5B32A

The crystal structure of the heterotypic h2az/h2a nucleosome with h3.3.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Histone H3.3
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b32A00
1F1EA 4NE3A 3A6NB 3REKC 3B0CT 5AV6C 2IO5B 3X1SB 1P3LD 3KUYD 3MGSD 3LZ1A 4WU9C 3AV1D 1ID3B 1P3OA 3UTBD 4Z2MH 5AVCA 1KU5A 1AOID 5AY8C 4Z66B 5JRGD 5B31D 3LELA 4LD9A 3X1TA 3R45A 4KGCC 5FUGA 2CV5B 4KHAB 3LELD 3WKJB 4QLCC 5DNMA 3B0BA 3AYWB 1N1JA 3UT9B 2HIOA 3W96D 4Z5TB 3AZLD 4Z2MG 3C1BC 3VH5T 5AV8D 4H9RB 3REIC 4R8PC 3RELC 5AV9A 1M18C 5B2JC 4EO5B 5B1MD 3UTAB 2AROA 3WAAA 5F99C 4XUJC 4NFTA 4JJNB 1HQ3B 3B6GD 1P3BC 3AZGA 4G92B 5AV5B 3AZKC 5JA4A 1KX3B 1M1AB 5BS7C 3LJAA 3W97B 2FJ7B 3W98C 5CPJD 5JRGC 4J8UA 5BT1C 5CP6B 2NQBB 1S32D 1P3AD 3WA9D 5GT0D 3KXBD 5CHLB 3MVDA 5GXQC 4J8XB 4J8WB 2LY8A 5AVBB 3AZND 3MGRD 2PYOA 4J8VB 5BO0B 1KX5A 3X1VA 3AN2D 5DNNB 4WU8A 4X23D 1EQZC 3AFAA 3TU4C 5B0ZB 3MGPA 3REJB 3WTPB 1TZYB 5BNVA 1P3MB 3AV2D 1P3GA 1ZLAB 4ZUXB 4YM6D 4E45A 3LZ0B 3MGPD 5B0YC 2L5AA 5CPIB 3O62B 5B40D 1U35A 1P34A 3MGQA 3AZHB 5B1LD 3W99C 3AZJB 5GSUD 4H9NB 5C3IB 1P3FB 1P3IA 3MGQD 1P3KA 5AV6A 4ZBJB 4XZQA 3B0CW 5GT3A 4H9SA 3A6NC 2F8NH 3REKD 4DRBA 1KX4B 3AZEB 4KUDA 2IO5C 1B67A 3C1CB 3X1SC 1JFIB 1F66B 4WU9D 1ID3C 5G49A 5B24A 3NQUB 4Z66C 5AY8D 2BYKB 2NZDA 4CSRA 1P3PA 4G91B 2CV5C 4KGCD 1BH9A 1BH8A 3WKJC 5CPKA 4QLCD 5E5AA 3LZ1B 5BNXA 3AZIA 1P3OB 2F8NG 3AYWC 3UT9C 5AVCB 4YS3A 3VH5W 5B33A 1M18A 4LD9B 3X1TB 4Z5TC 3C1BD 3R45B 5FUGB 5B32A 5B32G 3REID 3KWQB 4R8PD 3RELD 5DNMB 3REJD 3AZMA 1M18D 5KDMA 5B2JD 1M19B 4EO5C 3REHB 3UTAC 1N1JB 5F99D 4XUJD 2HIOB 1P3LA 2BYMA 3KUYA 3MGSA 1HQ3C 4JJNC 3AV1A 3UTBA 1P3BD 4G92C 1AOIA 5AV5C 3AZKD 5JRGA 5B31A 5B31G 1M1AC 1KX3C 3W97C 2FJ7C 2AROB 4H9OA 3W98D 5CP6C 5BT1D 2NQBC 5GXQD 4J8XC 3AZGB 4J8WC 3KSYA 5AVBC 1Q9CA 4H9QA 3W96A 3AZLA 4J8VC 5AV8A 5DNNC 5B1MA 3MVDB 1EQZD 3TU4D 5B0ZC 3REJC 1ZLAC 3WTPC 1TZYC 1P3MC 4ZUXC 2PYOB 3B6GA 3LZ0C 1KX5B 5B0YD 4NE5A 3X1VB 3VH6A 5CPIC 3O62C 3VH6T 4WU8B 4UUZB 3AZHC 3AFAB 3W99D 3KWQD 5CPJA 5BNVB 3AZJC 1P3GB 5C3IC 1P3FC 1M19D 3REHD 1S32A 1P3AA 3WA9A 5GT0A 3KXBA 2JSSA 4ZBJC 3MNNB 4DRAA 3A6ND 1TAFB 3AZNA 1KX4C 3MGRA 3AZEC 1P34B 1U35B 1WWSA 3X1SD 3C1CC 2HUEB 1F66C 3AZFB 1ID3D 1P3IB 3AN2A 1P3KB 4XZQB 4Z66D 4HGAB 4X23A 5GT3B 3AV2A 4KUDB 2YFWA 4G91C 4YM6A 2CV5D 3WKJD 3NQJA 3LZ1C 1P3OC 5B24B 5B40A 1A7WA 5AVCC 3UT9D 4WZSB 3AYWD 5B1LA 4LD9C 2NZDB 3X1TC 4Z5TD 5GSUA 4CSRB 1P3PB 2RVQC 1BH9B 1BH8B 3KWQC 5DNMC 5CPKB 5B2IB 5E5AB 5BNXB 3AZIB 3B0DB 1M19C 3REHC 2F8NB 3REKA 3UTAD 4YS3B 3X1UB 2HIOC 3B6FB 4H9PA 5B33B 4JJND 1HQ3D 4WU9A 4WV4B 5B32B 4CAYA 5AV5D 3AZMB 1KX3D 5AY8A 1M1AD 5KDMB 3W97D 2FJ7D 2AROC 4KGCA 3MNND 5CP6D 2NQBD 4QLCA 1P3LB 2BYMB 3KUYB 3MGSB 3AV1B 3UTBB 4J8XD 3AZGC 1AOIB 4J8WD 5B31B 5AVBD 3AZFD 3WTPE 4J8VD 3C1BA 4H9OB 3LELB 3REIA 4R8PA 3RELA 3REJA 5B2JA 5DNND 3MVDC 5B0ZD 5F99A 3WTPD 1TZYD 4XUJA 1P3MD 1ZLAD 4ZUXD 2PYOC 3W96B 3AZLB 3LZ0D 1P3BA 5AV8B 1KX5C 3X1VC 3VH6W 4WNNA 3AZKA 5CPID 3O62D 5BS7A 5B1MB 3AZHD 3AFAC 2YFVA 3W98A 5AV9B 5B2ID 3AZJD 1P3GC 1P3FD 3B6GB 1HTAA 3MNNC 3WAAB 5GXQA 3V9RA 3B6FD 1ULYA 1KX4D 4E44A 3AZED 1P34C 1U35C 3C1CD 2HUEC 1F66D 5CPJB 5JA4B 3AZFC 3LJAB 1P3IC 1S32B 1P3AB 3WA9B 5GT0B 3KXBB 1P3KC 4XZQC 4J8UB 4HGAC 1EQZA 3TU4A 5GT3C 4H9SC 3AZNB 4KUDC 3MGRB 4AWLB 5B0YA 3LZ1D 1P3OD 3AN2B 5B24C 2F8NK 5AVCD 1H3OA 4X23B 3KWQA 3W99A 4LD9D 2NZDC 3X1TD 3AV2B 2YFWB 1P3PC 1M19A 3REHA 4YM6B 2RVQD 5CPKC 3NQJB 5DNMD 5B2IC 3MGPB 4M6BA 5E5AC 3AZIC 3B0DC 3A6NA 3VH5A 5B40B 4YS3C 3X1UC 3X1SA 3B6FC 2HIOD 5B33C 5B1LB 1ID3A 5GSUB 5B32C 3MGQB 5AV9D 3AZMC 4Z66A 1BFMA 3REKB 2AROD 5AV6B 2CV5A 4KHAA 3WAAD 3WKJA 1P3LC 4H9PB 3KUYC 3MGSC 4WU9B 3AV1C 3UTBC 3AYWA 3UT9A 3AZGD 4CAYB 1AOIC 5B31C 5AY8B 3LJAD 5G49B 4Z5TA 4KGCB 3LELC 4J8UD 4H9RA 4QLCB 3MVDD 3UTAA 4JJNA 1HQ3A 3W96C 3AZLC 2PYOD 3C1BB 5AV8C 1KX5D 4UUZA 3X1VD 3REIB 4R8PB 5AV5A 3RELB 1M18B 1KX3A 1M1AA 5B2JB 2CWEA 3W97A 2FJ7A 5B1MC 4WU8D 3AFAD 5AV9C 3MNNA 5F99B 5CP6A 4XUJB 4NE6A 1P3GD 2NQBA 1TAFA 3B6GC 3WAAC 1P3BB 4J8XA 4WNNB 4J8WA 3AZKB 5AVBA 3AZFA 1P34D 1U35D 4J8VA 5BO0A 2YFVB 3W98B 5CPJC 5JRGB 3LJAC 1P3ID 1S32C 5DNNA 1P3AC 3WA9C 5GT0C 3KXBC 1P3KD 5AV6D 4XZQD 4J8UC 5GXQB 3V9RB 5GT3D 5B0ZA 1ZLAA 3WTPA 1TZYA 3AZNC 1P3MA 4KUDD 3MGRC 4ZUXA 3LZ0A 4AWLC 4H9QB 3AN2C 3O62A 5CPIA 5B24D 1R4VA 3AZHA 4X23C 1EQZB 3TU4B 2NZDD 5B2IA 3AZJA 4H9NA 3AV2C 1B6WA 1P3FA 1P3PD 2F8NA 4YM6C 4WU8C 5CPKD 3MGPC 3X1UA 5E5AD 5B0YB 3AZID 3B6FA 2F8ND 1KX4A 3AZEA 5B40C 4YS3D 3X1UD 1H3OB 3C1CA 1JFIA 5B1LC 5B33D 1F66A 3W99B 5GSUC 1WWIA 5B32D 3MGQC 3NQUA 3AZMD 2BYKA
chains in the Genus database with same CATH superfamily
1F1EA 4NE3A 3A6NB 3REKC 3B0CT 5AV6C 2IO5B 2VQRA 3X1SB 1P3LD 3KUYD 3MGSD 3LZ1A 4WU9C 3AV1D 1ID3B 1P3OA 3UTBD 4Z2MH 3H0RC 5AVCA 1KU5A 1AOID 5AY8C 4Z66B 5JRGD 5B31D 3LELA 2Y2QA 4LD9A 3X1TA 3R45A 4KGCC 5FUGA 2CV5B 4KHAB 3LELD 3WKJB 4QLCC 5DNMA 3B0BA 3AYWB 1N1JA 3UT9B 2HIOA 3W96D 4Z5TB 3AZLD 4Z2MG 2JE5A 3C1BC 3VH5T 5AV8D 4H9RB 3REIC 4R8PC 3RELC 5AV9A 1M18C 5B2JC 4EO5B 5B1MD 3UTAB 2AROA 3WAAA 2BYKA 5F99C 4XUJC 4NFTA 4JJNB 1HQ3B 3B6GD 1P3BC 3AZGA 4G92B 5AV5B 3AZKC 5JA4A 1KX3B 1M1AB 5BS7C 3LJAA 3W97B 2FJ7B 3W98C 5CPJD 5JRGC 4J8UA 5BT1C 5CP6B 2NQBB 1S32D 1P3AD 3WA9D 5GT0D 3KXBD 5CHLB 3MVDA 5GXQC 4J8XB 4J8WB 2LY8A 5AVBB 3AZND 3MGRD 2F2AC 2Y2MA 2PYOA 4J8VB 3IP4C 5BO0B 1KX5A 3X1VA 3AN2D 5DNNB 4WU8A 4X23D 1EQZC 3AFAA 3TU4C 5B0ZB 3MGPA 3REJB 3WTPB 1TZYB 5BNVA 1P3MB 3AV2D 1P3GA 1ZLAB 4ZUXB 4YM6D 4E45A 3LZ0B 3MGPD 5B0YC 3EPHA 2L5AA 3EG5B 5CPIB 3O62B 5B40D 1U35A 1P34A 3MGQA 3AZHB 5B1LD 3W99C 3F6TA 5GSUD 4H9NB 5C3IB 3AZJB 1P3FB 1P3IA 3MGQD 1P3KA 5AV6A 4ZBJB 4XZQA 3B0CW 5GT3A 4H9SA 3A6NC 2F8NH 3REKD 4DRBA 1KX4B 3AZEB 4KUDA 2IO5C 2Y2LA 1B67A 3C1CB 3X1SC 1JFIB 1F66B 3AL0C 4WU9D 1ID3C 5G49A 5B24A 3NQUB 4Z66C 5AY8D 2BYKB 2NZDA 4CSRA 1P3PA 3P5JB 4G91B 2CV5C 4KGCD 1BH9A 1BH8A 3WKJC 5CPKA 4QLCD 5E5AA 3EPLA 3LZ1B 5BNXA 3AZIA 1P3OB 2F8NG 3AYWC 3UT9C 5AVCB 4YS3A 3VH5W 5B33A 3A1IA 1M18A 4LD9B 3X1TB 4Z5TC 1T3UA 3C1BD 3R45B 2XD1A 5FUGB 5B32A 5B32G 3REID 3KWQB 4R8PD 3RELD 5DNMB 3REJD 3AZMA 1M18D 5KDMA 5B2JD 1M19B 4EO5C 3REHB 1W2EA 3UTAC 3H0MC 1N1JB 5F99D 4XUJD 2HIOB 1P3LA 2BYMA 3KUYA 3MGSA 1HQ3C 2Y2OA 4JJNC 3AV1A 3UTBA 1P3BD 4G92C 1AOIA 5AV5C 3AZKD 5JRGA 5B31A 5B31G 1M1AC 1KX3C 3W97C 2FJ7C 2ZY2A 2AROB 4H9OA 3W98D 5CP6C 5BT1D 2NQBC 5GXQD 2JCHA 4J8XC 3AZGB 2G5HC 4J8WC 3KSYA 5AVBC 1Q9CA 4H9QA 3W96A 3AZLA 4J8VC 5AV8A 3A1KA 5DNNC 5B1MA 3MVDB 1EQZD 3TU4D 5B0ZC 3REJC 1ZLAC 3WTPC 1TZYC 2ZY4A 1P3MC 4ZUXC 2PYOB 3B6GA 3LZ0C 1KX5B 2J8PA 5B0YD 4NE5A 3X1VB 3VH6A 5CPIC 3O62C 3VH6T 4WU8B 4UUZB 3AZHC 3AFAB 3W99D 3KWQD 5CPJA 5BNVB 3AZJC 1P3GB 5C3IC 1P3FC 1M19D 3REHD 1S32A 1P3AA 3WA9A 5GT0A 3KXBA 2JSSA 4ZBJC 3MNNB 4DRAA 3A6ND 1TAFB 3AZNA 1KX4C 3MGRA 3AZEC 1P34B 1U35B 1WWSA 3X1SD 3C1CC 2HUEB 1F66C 3AZFB 1ID3D 1P3IB 3AN2A 1P3KB 4XZQB 4Z66D 4HGAB 4X23A 2RIQA 5GT3B 3AV2A 4KUDB 2YFWA 4G91C 4YM6A 1Z2CB 2CV5D 3EPJA 3WKJD 3NQJA 3LZ1C 1P3OC 5B40A 5B24B 1A7WA 2G5IC 5AVCC 4WZSB 3UT9D 3AYWD 2ZY3A 5B1LA 4LD9C 2NZDB 3X1TC 4Z5TD 5GSUA 4CSRB 1P3PB 2RVQC 1BH9B 1BH8B 3KWQC 5DNMC 5CPKB 5B2IB 4DQYB 5E5AB 5BNXB 3AZIB 2Y2GA 3B0DB 1M19C 3REHC 2F8NB 3REKA 3UTAD 4YS3B 3X1UB 2HIOC 3B6FB 4H9PA 5B33B 4JJND 1HQ3D 4WU9A 4WV4B 5B32B 4UPKA 4CAYA 5AV5D 3AZMB 1KX3D 5AY8A 1M1AD 5KDMB 3W97D 2FJ7D 2UWXA 2AROC 4KGCA 3MNND 5CP6D 2NQBD 4QLCA 1P3LB 2BYMB 3KUYB 3MGSB 3AV1B 3UTBB 4J8XD 3AZGC 1AOIB 4J8WD 5B31B 5AVBD 3AZFD 3WTPE 4J8VD 3C1BA 4H9OB 3LELB 3REIA 4R8PA 3RELA 3REJA 5B2JA 5DNND 3MVDC 5B0ZD 5F99A 3WTPD 1TZYD 4XUJA 1P3MD 1ZLAD 4ZUXD 2PYOC 3W96B 3AZLB 2Y2NA 3LZ0D 1P3BA 5AV8B 1KX5C 3X1VC 3VH6W 4WNNA 2ZM5A 3AZKA 5CPID 3O62D 5BS7A 5B1MB 3AZHD 4WJ3C 3AFAC 2YFVA 3W98A 5AV9B 5B2ID 3AZJD 1P3GC 2DQNC 1P3FD 3B6GB 3EPKA 1HTAA 3MNNC 3WAAB 5GXQA 3V9RA 3B6FD 1ULYA 1KX4D 4E44A 3AZED 1P34C 1U35C 3C1CD 2HUEC 1F66D 5CPJB 5JA4B 3AZFC 3LJAB 1P3IC 1S32B 1P3AB 3WA9B 5GT0B 3KXBB 1P3KC 4XZQC 2DF4C 4J8UB 4HGAC 1EQZA 3TU4A 5GT3C 4H9SC 3AZNB 4KUDC 3MGRB 4AWLB 1PZRA 2ZY5A 5B0YA 3LZ1D 1P3OD 3AN2B 5B24C 2F8NK 5AVCD 1H3OA 3FDDA 4X23B 3KWQA 3W99A 4LD9D 2NZDC 3X1TD 3AV2B 2YFWB 1P3PC 1M19A 3REHA 4YM6B 2RVQD 5CPKC 3NQJB 5DNMD 5B2IC 3MGPB 4M6BA 5E5AC 3AZIC 3B0DC 3A6NA 3VH5A 5B40B 4YS3C 2Y2HA 3X1UC 3X1SA 3B6FC 2HIOD 5B33C 5B1LB 1ID3A 5GSUB 5B32C 3MGQB 2XD5A 5AV9D 3AZMC 4Z66A 1BFMA 3REKB 2AROD 5AV6B 2CV5A 4KHAA 3WAAD 3WKJA 1P3LC 4H9PB 3KUYC 3MGSC 4WU9B 3AV1C 3UTBC 3AYWA 3UT9A 3AZGD 4CAYB 1AOIC 3KFUG 5B31C 5AY8B 2Y2IA 3LJAD 5G49B 4Z5TA 4KGCB 3LELC 4J8UD 4H9RA 4QLCB 3MVDD 3UTAA 4JJNA 1HQ3A 3W96C 3AZLC 2PYOD 3C1BB 5AV8C 1KX5D 4UUZA 3X1VD 3REIB 4R8PB 5AV5A 3RELB 1M18B 2Y2JA 1M1AA 1KX3A 5B2JB 2CWEA 3W97A 2FJ7A 5B1MC 4WU8D 2FFFB 3AFAD 5AV9C 3MNNA 5F99B 5CP6A 4XUJB 4NE6A 1P3GD 2NQBA 1TAFA 3B6GC 3WAAC 1P3BB 4J8XA 4WNNB 4J8WA 3AZKB 5AVBA 3AZFA 1P34D 1U35D 4J8VA 5BO0A 2YFVB 3W98B 5CPJC 5JRGB 3LJAC 1P3ID 1S32C 5DNNA 1P3AC 3WA9C 5GT0C 3KXBC 1P3KD 5AV6D 4XZQD 4J8UC 3H0LC 5GXQB 3V9RB 5GT3D 5B0ZA 1ZLAA 3WTPA 1TZYA 3AZNC 1P3MA 4KUDD 3MGRC 4ZUXA 3LZ0A 4AWLC 4H9QB 3AN2C 3O62A 5CPIA 5B24D 1R4VA 3AZHA 4X23C 1EQZB 3TU4B 2Y2PA 5B2IA 2NZDD 3AZJA 4H9NA 3AV2C 1B6WA 1P3FA 1P3PD 2F8NA 4YM6C 2W8SA 4WU8C 5CPKD 3MGPC 3X1UA 2Y2KA 5E5AD 5B0YB 3AZID 3B6FA 2F8ND 1KX4A 3AZEA 5B40C 4YS3D 3X1UD 1H3OB 3C1CA 1JFIA 5B1LC 5B33D 1F66A 3W99B 5GSUC 1WWIA 5B32D 3MGQC 3NQUA 3AZMD 2BG1A
chains in the Genus database with same CATH topology
1F1EA 4NE3A 3A6NB 3REKC 3B0CT 5AV6C 2IO5B 2VQRA 3X1SB 1P3LD 3KUYD 3MGSD 3LZ1A 4WU9C 3AV1D 1ID3B 1P3OA 3UTBD 4Z2MH 3H0RC 5AVCA 1KU5A 1AOID 5AY8C 4Z66B 5JRGD 5B31D 3LELA 2Y2QA 4LD9A 3X1TA 3R45A 4KGCC 5FUGA 2CV5B 4KHAB 3LELD 3WKJB 4QLCC 5DNMA 3B0BA 3AYWB 1N1JA 3UT9B 2HIOA 3W96D 4Z5TB 3AZLD 4Z2MG 2JE5A 3C1BC 3VH5T 5AV8D 4H9RB 3REIC 4R8PC 3RELC 5AV9A 1M18C 5B2JC 4EO5B 5B1MD 3UTAB 2AROA 3WAAA 2BYKA 5F99C 4XUJC 4NFTA 4JJNB 1HQ3B 3B6GD 1P3BC 3AZGA 4G92B 5AV5B 3AZKC 5JA4A 1KX3B 1M1AB 5BS7C 3LJAA 3W97B 2FJ7B 3W98C 5CPJD 5JRGC 4J8UA 5BT1C 5CP6B 2NQBB 1S32D 1P3AD 3WA9D 5GT0D 3KXBD 5CHLB 3MVDA 5GXQC 4J8XB 4J8WB 2LY8A 5AVBB 3AZND 3MGRD 2F2AC 2Y2MA 2PYOA 4J8VB 3IP4C 5BO0B 1KX5A 3X1VA 3AN2D 5DNNB 4WU8A 4X23D 1EQZC 3AFAA 3TU4C 5B0ZB 3MGPA 3REJB 3WTPB 1TZYB 5BNVA 1P3MB 3AV2D 1P3GA 1ZLAB 4ZUXB 4YM6D 4E45A 3LZ0B 3MGPD 5B0YC 3EPHA 2L5AA 3EG5B 5CPIB 3O62B 5B40D 1U35A 1P34A 3MGQA 3AZHB 5B1LD 3W99C 3F6TA 5GSUD 4H9NB 5C3IB 3AZJB 1P3FB 1P3IA 3MGQD 1P3KA 5AV6A 4ZBJB 4XZQA 3B0CW 5GT3A 4H9SA 3A6NC 2F8NH 3REKD 4DRBA 1KX4B 3AZEB 4KUDA 2IO5C 2Y2LA 1B67A 3C1CB 3X1SC 1JFIB 1F66B 3AL0C 4WU9D 1ID3C 5G49A 5B24A 3NQUB 4Z66C 5AY8D 2BYKB 2NZDA 4CSRA 1P3PA 3P5JB 4G91B 2CV5C 4KGCD 1BH9A 1BH8A 3WKJC 5CPKA 4QLCD 5E5AA 3EPLA 3LZ1B 5BNXA 3AZIA 1P3OB 2F8NG 3AYWC 3UT9C 5AVCB 4YS3A 3VH5W 5B33A 3A1IA 1M18A 4LD9B 3X1TB 4Z5TC 1T3UA 3C1BD 3R45B 2XD1A 5FUGB 5B32A 5B32G 3REID 3KWQB 4R8PD 3RELD 5DNMB 3REJD 3AZMA 1M18D 5KDMA 5B2JD 1M19B 4EO5C 3REHB 1W2EA 3UTAC 3H0MC 1N1JB 5F99D 4XUJD 2HIOB 1P3LA 2BYMA 3KUYA 3MGSA 1HQ3C 2Y2OA 4JJNC 3AV1A 3UTBA 1P3BD 4G92C 1AOIA 5AV5C 3AZKD 5JRGA 5B31A 5B31G 1M1AC 1KX3C 3W97C 2FJ7C 2ZY2A 2AROB 4H9OA 3W98D 5CP6C 5BT1D 2NQBC 5GXQD 2JCHA 4J8XC 3AZGB 2G5HC 4J8WC 3KSYA 5AVBC 1Q9CA 4H9QA 3W96A 3AZLA 4J8VC 5AV8A 3A1KA 5DNNC 5B1MA 3MVDB 1EQZD 3TU4D 5B0ZC 3REJC 1ZLAC 3WTPC 1TZYC 2ZY4A 1P3MC 4ZUXC 2PYOB 3B6GA 3LZ0C 1KX5B 2J8PA 5B0YD 4NE5A 3X1VB 3VH6A 5CPIC 3O62C 3VH6T 4WU8B 4UUZB 3AZHC 3AFAB 3W99D 3KWQD 5CPJA 5BNVB 3AZJC 1P3GB 5C3IC 1P3FC 1M19D 3REHD 1S32A 1P3AA 3WA9A 5GT0A 3KXBA 2JSSA 4ZBJC 3MNNB 4DRAA 3A6ND 1TAFB 3AZNA 1KX4C 3MGRA 3AZEC 1P34B 1U35B 1WWSA 3X1SD 3C1CC 2HUEB 1F66C 3AZFB 1ID3D 1P3IB 3AN2A 1P3KB 4XZQB 4Z66D 4HGAB 4X23A 2RIQA 5GT3B 3AV2A 4KUDB 2YFWA 4G91C 4YM6A 1Z2CB 2CV5D 3EPJA 3WKJD 3NQJA 3LZ1C 1P3OC 5B40A 5B24B 1A7WA 2G5IC 5AVCC 4WZSB 3UT9D 3AYWD 2ZY3A 5B1LA 4LD9C 2NZDB 3X1TC 4Z5TD 5GSUA 4CSRB 1P3PB 2RVQC 1BH9B 1BH8B 3KWQC 5DNMC 5CPKB 5B2IB 4DQYB 5E5AB 5BNXB 3AZIB 2Y2GA 3B0DB 1M19C 3REHC 2F8NB 3REKA 3UTAD 4YS3B 3X1UB 2HIOC 3B6FB 4H9PA 5B33B 4JJND 1HQ3D 4WU9A 4WV4B 5B32B 4UPKA 4CAYA 5AV5D 3AZMB 1KX3D 5AY8A 1M1AD 5KDMB 3W97D 2FJ7D 2UWXA 2AROC 4KGCA 3MNND 5CP6D 2NQBD 4QLCA 1P3LB 2BYMB 3KUYB 3MGSB 3AV1B 3UTBB 4J8XD 3AZGC 1AOIB 4J8WD 5B31B 5AVBD 3AZFD 3WTPE 4J8VD 3C1BA 4H9OB 3LELB 3REIA 4R8PA 3RELA 3REJA 5B2JA 5DNND 3MVDC 5B0ZD 5F99A 3WTPD 1TZYD 4XUJA 1P3MD 1ZLAD 4ZUXD 2PYOC 3W96B 3AZLB 2Y2NA 3LZ0D 1P3BA 5AV8B 1KX5C 3X1VC 3VH6W 4WNNA 2ZM5A 3AZKA 5CPID 3O62D 5BS7A 5B1MB 3AZHD 4WJ3C 3AFAC 2YFVA 3W98A 5AV9B 5B2ID 3AZJD 1P3GC 2DQNC 1P3FD 3B6GB 3EPKA 1HTAA 3MNNC 3WAAB 5GXQA 3V9RA 3B6FD 1ULYA 1KX4D 4E44A 3AZED 1P34C 1U35C 3C1CD 2HUEC 1F66D 5CPJB 5JA4B 3AZFC 3LJAB 1P3IC 1S32B 1P3AB 3WA9B 5GT0B 3KXBB 1P3KC 4XZQC 2DF4C 4J8UB 4HGAC 1EQZA 3TU4A 5GT3C 4H9SC 3AZNB 4KUDC 3MGRB 4AWLB 1PZRA 2ZY5A 5B0YA 3LZ1D 1P3OD 3AN2B 5B24C 2F8NK 5AVCD 1H3OA 3FDDA 4X23B 3KWQA 3W99A 4LD9D 2NZDC 3X1TD 3AV2B 2YFWB 1P3PC 1M19A 3REHA 4YM6B 2RVQD 5CPKC 3NQJB 5DNMD 5B2IC 3MGPB 4M6BA 5E5AC 3AZIC 3B0DC 3A6NA 3VH5A 5B40B 4YS3C 2Y2HA 3X1UC 3X1SA 3B6FC 2HIOD 5B33C 5B1LB 1ID3A 5GSUB 5B32C 3MGQB 2XD5A 5AV9D 3AZMC 4Z66A 1BFMA 3REKB 2AROD 5AV6B 2CV5A 4KHAA 3WAAD 3WKJA 1P3LC 4H9PB 3KUYC 3MGSC 4WU9B 3AV1C 3UTBC 3AYWA 3UT9A 3AZGD 4CAYB 1AOIC 3KFUG 5B31C 5AY8B 2Y2IA 3LJAD 5G49B 4Z5TA 4KGCB 3LELC 4J8UD 4H9RA 4QLCB 3MVDD 3UTAA 4JJNA 1HQ3A 3W96C 3AZLC 2PYOD 3C1BB 5AV8C 1KX5D 4UUZA 3X1VD 3REIB 4R8PB 5AV5A 3RELB 1M18B 2Y2JA 1M1AA 1KX3A 5B2JB 2CWEA 3W97A 2FJ7A 5B1MC 4WU8D 2FFFB 3AFAD 5AV9C 3MNNA 5F99B 5CP6A 4XUJB 4NE6A 1P3GD 2NQBA 1TAFA 3B6GC 3WAAC 1P3BB 4J8XA 4WNNB 4J8WA 3AZKB 5AVBA 3AZFA 1P34D 1U35D 4J8VA 5BO0A 2YFVB 3W98B 5CPJC 5JRGB 3LJAC 1P3ID 1S32C 5DNNA 1P3AC 3WA9C 5GT0C 3KXBC 1P3KD 5AV6D 4XZQD 4J8UC 3H0LC 5GXQB 3V9RB 5GT3D 5B0ZA 1ZLAA 3WTPA 1TZYA 3AZNC 1P3MA 4KUDD 3MGRC 4ZUXA 3LZ0A 4AWLC 4H9QB 3AN2C 3O62A 5CPIA 5B24D 1R4VA 3AZHA 4X23C 1EQZB 3TU4B 2Y2PA 5B2IA 2NZDD 3AZJA 4H9NA 3AV2C 1B6WA 1P3FA 1P3PD 2F8NA 4YM6C 2W8SA 4WU8C 5CPKD 3MGPC 3X1UA 2Y2KA 5E5AD 5B0YB 3AZID 3B6FA 2F8ND 1KX4A 3AZEA 5B40C 4YS3D 3X1UD 1H3OB 3C1CA 1JFIA 5B1LC 5B33D 1F66A 3W99B 5GSUC 1WWIA 5B32D 3MGQC 3NQUA 3AZMD 2BG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F1E A;  4NE3 A;  3A6N B;  3REK C;  3B0C T;  5AV6 C;  2IO5 B;  3X1S B;  1P3L D;  3KUY D;  3MGS D;  3LZ1 A;  4WU9 C;  3AV1 D;  1ID3 B;  1P3O A;  3UTB D;  4Z2M H;  5AVC A;  1KU5 A;  1AOI D;  5AY8 C;  4Z66 B;  5JRG D;  5B31 D;  3LEL A;  4LD9 A;  3X1T A;  3R45 A;  4KGC C;  5FUG A;  2CV5 B;  4KHA B;  3LEL D;  3WKJ B;  4QLC C;  5DNM A;  3B0B A;  3AYW B;  1N1J A;  3UT9 B;  2HIO A;  3W96 D;  4Z5T B;  3AZL D;  4Z2M G;  3C1B C;  3VH5 T;  5AV8 D;  4H9R B;  3REI C;  4R8P C;  3REL C;  5AV9 A;  1M18 C;  5B2J C;  4EO5 B;  5B1M D;  3UTA B;  2ARO A;  3WAA A;  5F99 C;  4XUJ C;  4NFT A;  4JJN B;  1HQ3 B;  3B6G D;  1P3B C;  3AZG A;  4G92 B;  5AV5 B;  3AZK C;  5JA4 A;  1KX3 B;  1M1A B;  5BS7 C;  3LJA A;  3W97 B;  2FJ7 B;  3W98 C;  5CPJ D;  5JRG C;  4J8U A;  5BT1 C;  5CP6 B;  2NQB B;  1S32 D;  1P3A D;  3WA9 D;  5GT0 D;  3KXB D;  5CHL B;  3MVD A;  5GXQ C;  4J8X B;  4J8W B;  2LY8 A;  5AVB B;  3AZN D;  3MGR D;  2PYO A;  4J8V B;  5BO0 B;  1KX5 A;  3X1V A;  3AN2 D;  5DNN B;  4WU8 A;  4X23 D;  1EQZ C;  3AFA A;  3TU4 C;  5B0Z B;  3MGP A;  3REJ B;  3WTP B;  1TZY B;  5BNV A;  1P3M B;  3AV2 D;  1P3G A;  1ZLA B;  4ZUX B;  4YM6 D;  4E45 A;  3LZ0 B;  3MGP D;  5B0Y C;  2L5A A;  5CPI B;  3O62 B;  5B40 D;  1U35 A;  1P34 A;  3MGQ A;  3AZH B;  5B1L D;  3W99 C;  3AZJ B;  5GSU D;  4H9N B;  5C3I B;  1P3F B;  1P3I A;  3MGQ D;  1P3K A;  5AV6 A;  4ZBJ B;  4XZQ A;  3B0C W;  5GT3 A;  4H9S A;  3A6N C;  2F8N H;  3REK D;  4DRB A;  1KX4 B;  3AZE B;  4KUD A;  2IO5 C;  1B67 A;  3C1C B;  3X1S C;  1JFI B;  1F66 B;  4WU9 D;  1ID3 C;  5G49 A;  5B24 A;  3NQU B;  4Z66 C;  5AY8 D;  2BYK B;  2NZD A;  4CSR A;  1P3P A;  4G91 B;  2CV5 C;  4KGC D;  1BH9 A;  1BH8 A;  3WKJ C;  5CPK A;  4QLC D;  5E5A A;  3LZ1 B;  5BNX A;  3AZI A;  1P3O B;  2F8N G;  3AYW C;  3UT9 C;  5AVC B;  4YS3 A;  3VH5 W;  5B33 A;  1M18 A;  4LD9 B;  3X1T B;  4Z5T C;  3C1B D;  3R45 B;  5FUG B;  5B32 A;  5B32 G;  3REI D;  3KWQ B;  4R8P D;  3REL D;  5DNM B;  3REJ D;  3AZM A;  1M18 D;  5KDM A;  5B2J D;  1M19 B;  4EO5 C;  3REH B;  3UTA C;  1N1J B;  5F99 D;  4XUJ D;  2HIO B;  1P3L A;  2BYM A;  3KUY A;  3MGS A;  1HQ3 C;  4JJN C;  3AV1 A;  3UTB A;  1P3B D;  4G92 C;  1AOI A;  5AV5 C;  3AZK D;  5JRG A;  5B31 A;  5B31 G;  1M1A C;  1KX3 C;  3W97 C;  2FJ7 C;  2ARO B;  4H9O A;  3W98 D;  5CP6 C;  5BT1 D;  2NQB C;  5GXQ D;  4J8X C;  3AZG B;  4J8W C;  3KSY A;  5AVB C;  1Q9C A;  4H9Q A;  3W96 A;  3AZL A;  4J8V C;  5AV8 A;  5DNN C;  5B1M A;  3MVD B;  1EQZ D;  3TU4 D;  5B0Z C;  3REJ C;  1ZLA C;  3WTP C;  1TZY C;  1P3M C;  4ZUX C;  2PYO B;  3B6G A;  3LZ0 C;  1KX5 B;  5B0Y D;  4NE5 A;  3X1V B;  3VH6 A;  5CPI C;  3O62 C;  3VH6 T;  4WU8 B;  4UUZ B;  3AZH C;  3AFA B;  3W99 D;  3KWQ D;  5CPJ A;  5BNV B;  3AZJ C;  1P3G B;  5C3I C;  1P3F C;  1M19 D;  3REH D;  1S32 A;  1P3A A;  3WA9 A;  5GT0 A;  3KXB A;  2JSS A;  4ZBJ C;  3MNN B;  4DRA A;  3A6N D;  1TAF B;  3AZN A;  1KX4 C;  3MGR A;  3AZE C;  1P34 B;  1U35 B;  1WWS A;  3X1S D;  3C1C C;  2HUE B;  1F66 C;  3AZF B;  1ID3 D;  1P3I B;  3AN2 A;  1P3K B;  4XZQ B;  4Z66 D;  4HGA B;  4X23 A;  5GT3 B;  3AV2 A;  4KUD B;  2YFW A;  4G91 C;  4YM6 A;  2CV5 D;  3WKJ D;  3NQJ A;  3LZ1 C;  1P3O C;  5B24 B;  5B40 A;  1A7W A;  5AVC C;  3UT9 D;  4WZS B;  3AYW D;  5B1L A;  4LD9 C;  2NZD B;  3X1T C;  4Z5T D;  5GSU A;  4CSR B;  1P3P B;  2RVQ C;  1BH9 B;  1BH8 B;  3KWQ C;  5DNM C;  5CPK B;  5B2I B;  5E5A B;  5BNX B;  3AZI B;  3B0D B;  1M19 C;  3REH C;  2F8N B;  3REK A;  3UTA D;  4YS3 B;  3X1U B;  2HIO C;  3B6F B;  4H9P A;  5B33 B;  4JJN D;  1HQ3 D;  4WU9 A;  4WV4 B;  5B32 B;  4CAY A;  5AV5 D;  3AZM B;  1KX3 D;  5AY8 A;  1M1A D;  5KDM B;  3W97 D;  2FJ7 D;  2ARO C;  4KGC A;  3MNN D;  5CP6 D;  2NQB D;  4QLC A;  1P3L B;  2BYM B;  3KUY B;  3MGS B;  3AV1 B;  3UTB B;  4J8X D;  3AZG C;  1AOI B;  4J8W D;  5B31 B;  5AVB D;  3AZF D;  3WTP E;  4J8V D;  3C1B A;  4H9O B;  3LEL B;  3REI A;  4R8P A;  3REL A;  3REJ A;  5B2J A;  5DNN D;  3MVD C;  5B0Z D;  5F99 A;  3WTP D;  1TZY D;  4XUJ A;  1P3M D;  1ZLA D;  4ZUX D;  2PYO C;  3W96 B;  3AZL B;  3LZ0 D;  1P3B A;  5AV8 B;  1KX5 C;  3X1V C;  3VH6 W;  4WNN A;  3AZK A;  5CPI D;  3O62 D;  5BS7 A;  5B1M B;  3AZH D;  3AFA C;  2YFV A;  3W98 A;  5AV9 B;  5B2I D;  3AZJ D;  1P3G C;  1P3F D;  3B6G B;  1HTA A;  3MNN C;  3WAA B;  5GXQ A;  3V9R A;  3B6F D;  1ULY A;  1KX4 D;  4E44 A;  3AZE D;  1P34 C;  1U35 C;  3C1C D;  2HUE C;  1F66 D;  5CPJ B;  5JA4 B;  3AZF C;  3LJA B;  1P3I C;  1S32 B;  1P3A B;  3WA9 B;  5GT0 B;  3KXB B;  1P3K C;  4XZQ C;  4J8U B;  4HGA C;  1EQZ A;  3TU4 A;  5GT3 C;  4H9S C;  3AZN B;  4KUD C;  3MGR B;  4AWL B;  5B0Y A;  3LZ1 D;  1P3O D;  3AN2 B;  5B24 C;  2F8N K;  5AVC D;  1H3O A;  4X23 B;  3KWQ A;  3W99 A;  4LD9 D;  2NZD C;  3X1T D;  3AV2 B;  2YFW B;  1P3P C;  1M19 A;  3REH A;  4YM6 B;  2RVQ D;  5CPK C;  3NQJ B;  5DNM D;  5B2I C;  3MGP B;  4M6B A;  5E5A C;  3AZI C;  3B0D C;  3A6N A;  3VH5 A;  5B40 B;  4YS3 C;  3X1U C;  3X1S A;  3B6F C;  2HIO D;  5B33 C;  5B1L B;  1ID3 A;  5GSU B;  5B32 C;  3MGQ B;  5AV9 D;  3AZM C;  4Z66 A;  1BFM A;  3REK B;  2ARO D;  5AV6 B;  2CV5 A;  4KHA A;  3WAA D;  3WKJ A;  1P3L C;  4H9P B;  3KUY C;  3MGS C;  4WU9 B;  3AV1 C;  3UTB C;  3AYW A;  3UT9 A;  3AZG D;  4CAY B;  1AOI C;  5B31 C;  5AY8 B;  3LJA D;  5G49 B;  4Z5T A;  4KGC B;  3LEL C;  4J8U D;  4H9R A;  4QLC B;  3MVD D;  3UTA A;  4JJN A;  1HQ3 A;  3W96 C;  3AZL C;  2PYO D;  3C1B B;  5AV8 C;  1KX5 D;  4UUZ A;  3X1V D;  3REI B;  4R8P B;  5AV5 A;  3REL B;  1M18 B;  1KX3 A;  1M1A A;  5B2J B;  2CWE A;  3W97 A;  2FJ7 A;  5B1M C;  4WU8 D;  3AFA D;  5AV9 C;  3MNN A;  5F99 B;  5CP6 A;  4XUJ B;  4NE6 A;  1P3G D;  2NQB A;  1TAF A;  3B6G C;  3WAA C;  1P3B B;  4J8X A;  4WNN B;  4J8W A;  3AZK B;  5AVB A;  3AZF A;  1P34 D;  1U35 D;  4J8V A;  5BO0 A;  2YFV B;  3W98 B;  5CPJ C;  5JRG B;  3LJA C;  1P3I D;  1S32 C;  5DNN A;  1P3A C;  3WA9 C;  5GT0 C;  3KXB C;  1P3K D;  5AV6 D;  4XZQ D;  4J8U C;  5GXQ B;  3V9R B;  5GT3 D;  5B0Z A;  1ZLA A;  3WTP A;  1TZY A;  3AZN C;  1P3M A;  4KUD D;  3MGR C;  4ZUX A;  3LZ0 A;  4AWL C;  4H9Q B;  3AN2 C;  3O62 A;  5CPI A;  5B24 D;  1R4V A;  3AZH A;  4X23 C;  1EQZ B;  3TU4 B;  2NZD D;  5B2I A;  3AZJ A;  4H9N A;  3AV2 C;  1B6W A;  1P3F A;  1P3P D;  2F8N A;  4YM6 C;  4WU8 C;  5CPK D;  3MGP C;  3X1U A;  5E5A D;  5B0Y B;  3AZI D;  3B6F A;  2F8N D;  1KX4 A;  3AZE A;  5B40 C;  4YS3 D;  3X1U D;  1H3O B;  3C1C A;  1JFI A;  5B1L C;  5B33 D;  1F66 A;  3W99 B;  5GSU C;  1WWI A;  5B32 D;  3MGQ C;  3NQU A;  3AZM D;  2BYK A; 
#chains in the Genus database with same CATH topology
 1F1E A;  4NE3 A;  3A6N B;  3REK C;  3B0C T;  5AV6 C;  2IO5 B;  2VQR A;  3X1S B;  1P3L D;  3KUY D;  3MGS D;  3LZ1 A;  4WU9 C;  3AV1 D;  1ID3 B;  1P3O A;  3UTB D;  4Z2M H;  3H0R C;  5AVC A;  1KU5 A;  1AOI D;  5AY8 C;  4Z66 B;  5JRG D;  5B31 D;  3LEL A;  2Y2Q A;  4LD9 A;  3X1T A;  3R45 A;  4KGC C;  5FUG A;  2CV5 B;  4KHA B;  3LEL D;  3WKJ B;  4QLC C;  5DNM A;  3B0B A;  3AYW B;  1N1J A;  3UT9 B;  2HIO A;  3W96 D;  4Z5T B;  3AZL D;  4Z2M G;  2JE5 A;  3C1B C;  3VH5 T;  5AV8 D;  4H9R B;  3REI C;  4R8P C;  3REL C;  5AV9 A;  1M18 C;  5B2J C;  4EO5 B;  5B1M D;  3UTA B;  2ARO A;  3WAA A;  2BYK A;  5F99 C;  4XUJ C;  4NFT A;  4JJN B;  1HQ3 B;  3B6G D;  1P3B C;  3AZG A;  4G92 B;  5AV5 B;  3AZK C;  5JA4 A;  1KX3 B;  1M1A B;  5BS7 C;  3LJA A;  3W97 B;  2FJ7 B;  3W98 C;  5CPJ D;  5JRG C;  4J8U A;  5BT1 C;  5CP6 B;  2NQB B;  1S32 D;  1P3A D;  3WA9 D;  5GT0 D;  3KXB D;  5CHL B;  3MVD A;  5GXQ C;  4J8X B;  4J8W B;  2LY8 A;  5AVB B;  3AZN D;  3MGR D;  2F2A C;  2Y2M A;  2PYO A;  4J8V B;  3IP4 C;  5BO0 B;  1KX5 A;  3X1V A;  3AN2 D;  5DNN B;  4WU8 A;  4X23 D;  1EQZ C;  3AFA A;  3TU4 C;  5B0Z B;  3MGP A;  3REJ B;  3WTP B;  1TZY B;  5BNV A;  1P3M B;  3AV2 D;  1P3G A;  1ZLA B;  4ZUX B;  4YM6 D;  4E45 A;  3LZ0 B;  3MGP D;  5B0Y C;  3EPH A;  2L5A A;  3EG5 B;  5CPI B;  3O62 B;  5B40 D;  1U35 A;  1P34 A;  3MGQ A;  3AZH B;  5B1L D;  3W99 C;  3F6T A;  5GSU D;  4H9N B;  5C3I B;  3AZJ B;  1P3F B;  1P3I A;  3MGQ D;  1P3K A;  5AV6 A;  4ZBJ B;  4XZQ A;  3B0C W;  5GT3 A;  4H9S A;  3A6N C;  2F8N H;  3REK D;  4DRB A;  1KX4 B;  3AZE B;  4KUD A;  2IO5 C;  2Y2L A;  1B67 A;  3C1C B;  3X1S C;  1JFI B;  1F66 B;  3AL0 C;  4WU9 D;  1ID3 C;  5G49 A;  5B24 A;  3NQU B;  4Z66 C;  5AY8 D;  2BYK B;  2NZD A;  4CSR A;  1P3P A;  3P5J B;  4G91 B;  2CV5 C;  4KGC D;  1BH9 A;  1BH8 A;  3WKJ C;  5CPK A;  4QLC D;  5E5A A;  3EPL A;  3LZ1 B;  5BNX A;  3AZI A;  1P3O B;  2F8N G;  3AYW C;  3UT9 C;  5AVC B;  4YS3 A;  3VH5 W;  5B33 A;  3A1I A;  1M18 A;  4LD9 B;  3X1T B;  4Z5T C;  1T3U A;  3C1B D;  3R45 B;  2XD1 A;  5FUG B;  5B32 A;  5B32 G;  3REI D;  3KWQ B;  4R8P D;  3REL D;  5DNM B;  3REJ D;  3AZM A;  1M18 D;  5KDM A;  5B2J D;  1M19 B;  4EO5 C;  3REH B;  1W2E A;  3UTA C;  3H0M C;  1N1J B;  5F99 D;  4XUJ D;  2HIO B;  1P3L A;  2BYM A;  3KUY A;  3MGS A;  1HQ3 C;  2Y2O A;  4JJN C;  3AV1 A;  3UTB A;  1P3B D;  4G92 C;  1AOI A;  5AV5 C;  3AZK D;  5JRG A;  5B31 A;  5B31 G;  1M1A C;  1KX3 C;  3W97 C;  2FJ7 C;  2ZY2 A;  2ARO B;  4H9O A;  3W98 D;  5CP6 C;  5BT1 D;  2NQB C;  5GXQ D;  2JCH A;  4J8X C;  3AZG B;  2G5H C;  4J8W C;  3KSY A;  5AVB C;  1Q9C A;  4H9Q A;  3W96 A;  3AZL A;  4J8V C;  5AV8 A;  3A1K A;  5DNN C;  5B1M A;  3MVD B;  1EQZ D;  3TU4 D;  5B0Z C;  3REJ C;  1ZLA C;  3WTP C;  1TZY C;  2ZY4 A;  1P3M C;  4ZUX C;  2PYO B;  3B6G A;  3LZ0 C;  1KX5 B;  2J8P A;  5B0Y D;  4NE5 A;  3X1V B;  3VH6 A;  5CPI C;  3O62 C;  3VH6 T;  4WU8 B;  4UUZ B;  3AZH C;  3AFA B;  3W99 D;  3KWQ D;  5CPJ A;  5BNV B;  3AZJ C;  1P3G B;  5C3I C;  1P3F C;  1M19 D;  3REH D;  1S32 A;  1P3A A;  3WA9 A;  5GT0 A;  3KXB A;  2JSS A;  4ZBJ C;  3MNN B;  4DRA A;  3A6N D;  1TAF B;  3AZN A;  1KX4 C;  3MGR A;  3AZE C;  1P34 B;  1U35 B;  1WWS A;  3X1S D;  3C1C C;  2HUE B;  1F66 C;  3AZF B;  1ID3 D;  1P3I B;  3AN2 A;  1P3K B;  4XZQ B;  4Z66 D;  4HGA B;  4X23 A;  2RIQ A;  5GT3 B;  3AV2 A;  4KUD B;  2YFW A;  4G91 C;  4YM6 A;  1Z2C B;  2CV5 D;  3EPJ A;  3WKJ D;  3NQJ A;  3LZ1 C;  1P3O C;  5B40 A;  5B24 B;  1A7W A;  2G5I C;  5AVC C;  4WZS B;  3UT9 D;  3AYW D;  2ZY3 A;  5B1L A;  4LD9 C;  2NZD B;  3X1T C;  4Z5T D;  5GSU A;  4CSR B;  1P3P B;  2RVQ C;  1BH9 B;  1BH8 B;  3KWQ C;  5DNM C;  5CPK B;  5B2I B;  4DQY B;  5E5A B;  5BNX B;  3AZI B;  2Y2G A;  3B0D B;  1M19 C;  3REH C;  2F8N B;  3REK A;  3UTA D;  4YS3 B;  3X1U B;  2HIO C;  3B6F B;  4H9P A;  5B33 B;  4JJN D;  1HQ3 D;  4WU9 A;  4WV4 B;  5B32 B;  4UPK A;  4CAY A;  5AV5 D;  3AZM B;  1KX3 D;  5AY8 A;  1M1A D;  5KDM B;  3W97 D;  2FJ7 D;  2UWX A;  2ARO C;  4KGC A;  3MNN D;  5CP6 D;  2NQB D;  4QLC A;  1P3L B;  2BYM B;  3KUY B;  3MGS B;  3AV1 B;  3UTB B;  4J8X D;  3AZG C;  1AOI B;  4J8W D;  5B31 B;  5AVB D;  3AZF D;  3WTP E;  4J8V D;  3C1B A;  4H9O B;  3LEL B;  3REI A;  4R8P A;  3REL A;  3REJ A;  5B2J A;  5DNN D;  3MVD C;  5B0Z D;  5F99 A;  3WTP D;  1TZY D;  4XUJ A;  1P3M D;  1ZLA D;  4ZUX D;  2PYO C;  3W96 B;  3AZL B;  2Y2N A;  3LZ0 D;  1P3B A;  5AV8 B;  1KX5 C;  3X1V C;  3VH6 W;  4WNN A;  2ZM5 A;  3AZK A;  5CPI D;  3O62 D;  5BS7 A;  5B1M B;  3AZH D;  4WJ3 C;  3AFA C;  2YFV A;  3W98 A;  5AV9 B;  5B2I D;  3AZJ D;  1P3G C;  2DQN C;  1P3F D;  3B6G B;  3EPK A;  1HTA A;  3MNN C;  3WAA B;  5GXQ A;  3V9R A;  3B6F D;  1ULY A;  1KX4 D;  4E44 A;  3AZE D;  1P34 C;  1U35 C;  3C1C D;  2HUE C;  1F66 D;  5CPJ B;  5JA4 B;  3AZF C;  3LJA B;  1P3I C;  1S32 B;  1P3A B;  3WA9 B;  5GT0 B;  3KXB B;  1P3K C;  4XZQ C;  2DF4 C;  4J8U B;  4HGA C;  1EQZ A;  3TU4 A;  5GT3 C;  4H9S C;  3AZN B;  4KUD C;  3MGR B;  4AWL B;  1PZR A;  2ZY5 A;  5B0Y A;  3LZ1 D;  1P3O D;  3AN2 B;  5B24 C;  2F8N K;  5AVC D;  1H3O A;  3FDD A;  4X23 B;  3KWQ A;  3W99 A;  4LD9 D;  2NZD C;  3X1T D;  3AV2 B;  2YFW B;  1P3P C;  1M19 A;  3REH A;  4YM6 B;  2RVQ D;  5CPK C;  3NQJ B;  5DNM D;  5B2I C;  3MGP B;  4M6B A;  5E5A C;  3AZI C;  3B0D C;  3A6N A;  3VH5 A;  5B40 B;  4YS3 C;  2Y2H A;  3X1U C;  3X1S A;  3B6F C;  2HIO D;  5B33 C;  5B1L B;  1ID3 A;  5GSU B;  5B32 C;  3MGQ B;  2XD5 A;  5AV9 D;  3AZM C;  4Z66 A;  1BFM A;  3REK B;  2ARO D;  5AV6 B;  2CV5 A;  4KHA A;  3WAA D;  3WKJ A;  1P3L C;  4H9P B;  3KUY C;  3MGS C;  4WU9 B;  3AV1 C;  3UTB C;  3AYW A;  3UT9 A;  3AZG D;  4CAY B;  1AOI C;  3KFU G;  5B31 C;  5AY8 B;  2Y2I A;  3LJA D;  5G49 B;  4Z5T A;  4KGC B;  3LEL C;  4J8U D;  4H9R A;  4QLC B;  3MVD D;  3UTA A;  4JJN A;  1HQ3 A;  3W96 C;  3AZL C;  2PYO D;  3C1B B;  5AV8 C;  1KX5 D;  4UUZ A;  3X1V D;  3REI B;  4R8P B;  5AV5 A;  3REL B;  1M18 B;  2Y2J A;  1M1A A;  1KX3 A;  5B2J B;  2CWE A;  3W97 A;  2FJ7 A;  5B1M C;  4WU8 D;  2FFF B;  3AFA D;  5AV9 C;  3MNN A;  5F99 B;  5CP6 A;  4XUJ B;  4NE6 A;  1P3G D;  2NQB A;  1TAF A;  3B6G C;  3WAA C;  1P3B B;  4J8X A;  4WNN B;  4J8W A;  3AZK B;  5AVB A;  3AZF A;  1P34 D;  1U35 D;  4J8V A;  5BO0 A;  2YFV B;  3W98 B;  5CPJ C;  5JRG B;  3LJA C;  1P3I D;  1S32 C;  5DNN A;  1P3A C;  3WA9 C;  5GT0 C;  3KXB C;  1P3K D;  5AV6 D;  4XZQ D;  4J8U C;  3H0L C;  5GXQ B;  3V9R B;  5GT3 D;  5B0Z A;  1ZLA A;  3WTP A;  1TZY A;  3AZN C;  1P3M A;  4KUD D;  3MGR C;  4ZUX A;  3LZ0 A;  4AWL C;  4H9Q B;  3AN2 C;  3O62 A;  5CPI A;  5B24 D;  1R4V A;  3AZH A;  4X23 C;  1EQZ B;  3TU4 B;  2Y2P A;  5B2I A;  2NZD D;  3AZJ A;  4H9N A;  3AV2 C;  1B6W A;  1P3F A;  1P3P D;  2F8N A;  4YM6 C;  2W8S A;  4WU8 C;  5CPK D;  3MGP C;  3X1U A;  2Y2K A;  5E5A D;  5B0Y B;  3AZI D;  3B6F A;  2F8N D;  1KX4 A;  3AZE A;  5B40 C;  4YS3 D;  3X1U D;  1H3O B;  3C1C A;  1JFI A;  5B1L C;  5B33 D;  1F66 A;  3W99 B;  5GSU C;  1WWI A;  5B32 D;  3MGQ C;  3NQU A;  3AZM D;  2BG1 A; 
#chains in the Genus database with same CATH homology
 1F1E A;  4NE3 A;  3A6N B;  3REK C;  3B0C T;  5AV6 C;  2IO5 B;  2VQR A;  3X1S B;  1P3L D;  3KUY D;  3MGS D;  3LZ1 A;  4WU9 C;  3AV1 D;  1ID3 B;  1P3O A;  3UTB D;  4Z2M H;  3H0R C;  5AVC A;  1KU5 A;  1AOI D;  5AY8 C;  4Z66 B;  5JRG D;  5B31 D;  3LEL A;  2Y2Q A;  4LD9 A;  3X1T A;  3R45 A;  4KGC C;  5FUG A;  2CV5 B;  4KHA B;  3LEL D;  3WKJ B;  4QLC C;  5DNM A;  3B0B A;  3AYW B;  1N1J A;  3UT9 B;  2HIO A;  3W96 D;  4Z5T B;  3AZL D;  4Z2M G;  2JE5 A;  3C1B C;  3VH5 T;  5AV8 D;  4H9R B;  3REI C;  4R8P C;  3REL C;  5AV9 A;  1M18 C;  5B2J C;  4EO5 B;  5B1M D;  3UTA B;  2ARO A;  3WAA A;  2BYK A;  5F99 C;  4XUJ C;  4NFT A;  4JJN B;  1HQ3 B;  3B6G D;  1P3B C;  3AZG A;  4G92 B;  5AV5 B;  3AZK C;  5JA4 A;  1KX3 B;  1M1A B;  5BS7 C;  3LJA A;  3W97 B;  2FJ7 B;  3W98 C;  5CPJ D;  5JRG C;  4J8U A;  5BT1 C;  5CP6 B;  2NQB B;  1S32 D;  1P3A D;  3WA9 D;  5GT0 D;  3KXB D;  5CHL B;  3MVD A;  5GXQ C;  4J8X B;  4J8W B;  2LY8 A;  5AVB B;  3AZN D;  3MGR D;  2F2A C;  2Y2M A;  2PYO A;  4J8V B;  3IP4 C;  5BO0 B;  1KX5 A;  3X1V A;  3AN2 D;  5DNN B;  4WU8 A;  4X23 D;  1EQZ C;  3AFA A;  3TU4 C;  5B0Z B;  3MGP A;  3REJ B;  3WTP B;  1TZY B;  5BNV A;  1P3M B;  3AV2 D;  1P3G A;  1ZLA B;  4ZUX B;  4YM6 D;  4E45 A;  3LZ0 B;  3MGP D;  5B0Y C;  3EPH A;  2L5A A;  3EG5 B;  5CPI B;  3O62 B;  5B40 D;  1U35 A;  1P34 A;  3MGQ A;  3AZH B;  5B1L D;  3W99 C;  3F6T A;  5GSU D;  4H9N B;  5C3I B;  3AZJ B;  1P3F B;  1P3I A;  3MGQ D;  1P3K A;  5AV6 A;  4ZBJ B;  4XZQ A;  3B0C W;  5GT3 A;  4H9S A;  3A6N C;  2F8N H;  3REK D;  4DRB A;  1KX4 B;  3AZE B;  4KUD A;  2IO5 C;  2Y2L A;  1B67 A;  3C1C B;  3X1S C;  1JFI B;  1F66 B;  3AL0 C;  4WU9 D;  1ID3 C;  5G49 A;  5B24 A;  3NQU B;  4Z66 C;  5AY8 D;  2BYK B;  2NZD A;  4CSR A;  1P3P A;  3P5J B;  4G91 B;  2CV5 C;  4KGC D;  1BH9 A;  1BH8 A;  3WKJ C;  5CPK A;  4QLC D;  5E5A A;  3EPL A;  3LZ1 B;  5BNX A;  3AZI A;  1P3O B;  2F8N G;  3AYW C;  3UT9 C;  5AVC B;  4YS3 A;  3VH5 W;  5B33 A;  3A1I A;  1M18 A;  4LD9 B;  3X1T B;  4Z5T C;  1T3U A;  3C1B D;  3R45 B;  2XD1 A;  5FUG B;  5B32 A;  5B32 G;  3REI D;  3KWQ B;  4R8P D;  3REL D;  5DNM B;  3REJ D;  3AZM A;  1M18 D;  5KDM A;  5B2J D;  1M19 B;  4EO5 C;  3REH B;  1W2E A;  3UTA C;  3H0M C;  1N1J B;  5F99 D;  4XUJ D;  2HIO B;  1P3L A;  2BYM A;  3KUY A;  3MGS A;  1HQ3 C;  2Y2O A;  4JJN C;  3AV1 A;  3UTB A;  1P3B D;  4G92 C;  1AOI A;  5AV5 C;  3AZK D;  5JRG A;  5B31 A;  5B31 G;  1M1A C;  1KX3 C;  3W97 C;  2FJ7 C;  2ZY2 A;  2ARO B;  4H9O A;  3W98 D;  5CP6 C;  5BT1 D;  2NQB C;  5GXQ D;  2JCH A;  4J8X C;  3AZG B;  2G5H C;  4J8W C;  3KSY A;  5AVB C;  1Q9C A;  4H9Q A;  3W96 A;  3AZL A;  4J8V C;  5AV8 A;  3A1K A;  5DNN C;  5B1M A;  3MVD B;  1EQZ D;  3TU4 D;  5B0Z C;  3REJ C;  1ZLA C;  3WTP C;  1TZY C;  2ZY4 A;  1P3M C;  4ZUX C;  2PYO B;  3B6G A;  3LZ0 C;  1KX5 B;  2J8P A;  5B0Y D;  4NE5 A;  3X1V B;  3VH6 A;  5CPI C;  3O62 C;  3VH6 T;  4WU8 B;  4UUZ B;  3AZH C;  3AFA B;  3W99 D;  3KWQ D;  5CPJ A;  5BNV B;  3AZJ C;  1P3G B;  5C3I C;  1P3F C;  1M19 D;  3REH D;  1S32 A;  1P3A A;  3WA9 A;  5GT0 A;  3KXB A;  2JSS A;  4ZBJ C;  3MNN B;  4DRA A;  3A6N D;  1TAF B;  3AZN A;  1KX4 C;  3MGR A;  3AZE C;  1P34 B;  1U35 B;  1WWS A;  3X1S D;  3C1C C;  2HUE B;  1F66 C;  3AZF B;  1ID3 D;  1P3I B;  3AN2 A;  1P3K B;  4XZQ B;  4Z66 D;  4HGA B;  4X23 A;  2RIQ A;  5GT3 B;  3AV2 A;  4KUD B;  2YFW A;  4G91 C;  4YM6 A;  1Z2C B;  2CV5 D;  3EPJ A;  3WKJ D;  3NQJ A;  3LZ1 C;  1P3O C;  5B40 A;  5B24 B;  1A7W A;  2G5I C;  5AVC C;  4WZS B;  3UT9 D;  3AYW D;  2ZY3 A;  5B1L A;  4LD9 C;  2NZD B;  3X1T C;  4Z5T D;  5GSU A;  4CSR B;  1P3P B;  2RVQ C;  1BH9 B;  1BH8 B;  3KWQ C;  5DNM C;  5CPK B;  5B2I B;  4DQY B;  5E5A B;  5BNX B;  3AZI B;  2Y2G A;  3B0D B;  1M19 C;  3REH C;  2F8N B;  3REK A;  3UTA D;  4YS3 B;  3X1U B;  2HIO C;  3B6F B;  4H9P A;  5B33 B;  4JJN D;  1HQ3 D;  4WU9 A;  4WV4 B;  5B32 B;  4UPK A;  4CAY A;  5AV5 D;  3AZM B;  1KX3 D;  5AY8 A;  1M1A D;  5KDM B;  3W97 D;  2FJ7 D;  2UWX A;  2ARO C;  4KGC A;  3MNN D;  5CP6 D;  2NQB D;  4QLC A;  1P3L B;  2BYM B;  3KUY B;  3MGS B;  3AV1 B;  3UTB B;  4J8X D;  3AZG C;  1AOI B;  4J8W D;  5B31 B;  5AVB D;  3AZF D;  3WTP E;  4J8V D;  3C1B A;  4H9O B;  3LEL B;  3REI A;  4R8P A;  3REL A;  3REJ A;  5B2J A;  5DNN D;  3MVD C;  5B0Z D;  5F99 A;  3WTP D;  1TZY D;  4XUJ A;  1P3M D;  1ZLA D;  4ZUX D;  2PYO C;  3W96 B;  3AZL B;  2Y2N A;  3LZ0 D;  1P3B A;  5AV8 B;  1KX5 C;  3X1V C;  3VH6 W;  4WNN A;  2ZM5 A;  3AZK A;  5CPI D;  3O62 D;  5BS7 A;  5B1M B;  3AZH D;  4WJ3 C;  3AFA C;  2YFV A;  3W98 A;  5AV9 B;  5B2I D;  3AZJ D;  1P3G C;  2DQN C;  1P3F D;  3B6G B;  3EPK A;  1HTA A;  3MNN C;  3WAA B;  5GXQ A;  3V9R A;  3B6F D;  1ULY A;  1KX4 D;  4E44 A;  3AZE D;  1P34 C;  1U35 C;  3C1C D;  2HUE C;  1F66 D;  5CPJ B;  5JA4 B;  3AZF C;  3LJA B;  1P3I C;  1S32 B;  1P3A B;  3WA9 B;  5GT0 B;  3KXB B;  1P3K C;  4XZQ C;  2DF4 C;  4J8U B;  4HGA C;  1EQZ A;  3TU4 A;  5GT3 C;  4H9S C;  3AZN B;  4KUD C;  3MGR B;  4AWL B;  1PZR A;  2ZY5 A;  5B0Y A;  3LZ1 D;  1P3O D;  3AN2 B;  5B24 C;  2F8N K;  5AVC D;  1H3O A;  3FDD A;  4X23 B;  3KWQ A;  3W99 A;  4LD9 D;  2NZD C;  3X1T D;  3AV2 B;  2YFW B;  1P3P C;  1M19 A;  3REH A;  4YM6 B;  2RVQ D;  5CPK C;  3NQJ B;  5DNM D;  5B2I C;  3MGP B;  4M6B A;  5E5A C;  3AZI C;  3B0D C;  3A6N A;  3VH5 A;  5B40 B;  4YS3 C;  2Y2H A;  3X1U C;  3X1S A;  3B6F C;  2HIO D;  5B33 C;  5B1L B;  1ID3 A;  5GSU B;  5B32 C;  3MGQ B;  2XD5 A;  5AV9 D;  3AZM C;  4Z66 A;  1BFM A;  3REK B;  2ARO D;  5AV6 B;  2CV5 A;  4KHA A;  3WAA D;  3WKJ A;  1P3L C;  4H9P B;  3KUY C;  3MGS C;  4WU9 B;  3AV1 C;  3UTB C;  3AYW A;  3UT9 A;  3AZG D;  4CAY B;  1AOI C;  3KFU G;  5B31 C;  5AY8 B;  2Y2I A;  3LJA D;  5G49 B;  4Z5T A;  4KGC B;  3LEL C;  4J8U D;  4H9R A;  4QLC B;  3MVD D;  3UTA A;  4JJN A;  1HQ3 A;  3W96 C;  3AZL C;  2PYO D;  3C1B B;  5AV8 C;  1KX5 D;  4UUZ A;  3X1V D;  3REI B;  4R8P B;  5AV5 A;  3REL B;  1M18 B;  2Y2J A;  1M1A A;  1KX3 A;  5B2J B;  2CWE A;  3W97 A;  2FJ7 A;  5B1M C;  4WU8 D;  2FFF B;  3AFA D;  5AV9 C;  3MNN A;  5F99 B;  5CP6 A;  4XUJ B;  4NE6 A;  1P3G D;  2NQB A;  1TAF A;  3B6G C;  3WAA C;  1P3B B;  4J8X A;  4WNN B;  4J8W A;  3AZK B;  5AVB A;  3AZF A;  1P34 D;  1U35 D;  4J8V A;  5BO0 A;  2YFV B;  3W98 B;  5CPJ C;  5JRG B;  3LJA C;  1P3I D;  1S32 C;  5DNN A;  1P3A C;  3WA9 C;  5GT0 C;  3KXB C;  1P3K D;  5AV6 D;  4XZQ D;  4J8U C;  3H0L C;  5GXQ B;  3V9R B;  5GT3 D;  5B0Z A;  1ZLA A;  3WTP A;  1TZY A;  3AZN C;  1P3M A;  4KUD D;  3MGR C;  4ZUX A;  3LZ0 A;  4AWL C;  4H9Q B;  3AN2 C;  3O62 A;  5CPI A;  5B24 D;  1R4V A;  3AZH A;  4X23 C;  1EQZ B;  3TU4 B;  2Y2P A;  5B2I A;  2NZD D;  3AZJ A;  4H9N A;  3AV2 C;  1B6W A;  1P3F A;  1P3P D;  2F8N A;  4YM6 C;  2W8S A;  4WU8 C;  5CPK D;  3MGP C;  3X1U A;  2Y2K A;  5E5A D;  5B0Y B;  3AZI D;  3B6F A;  2F8N D;  1KX4 A;  3AZE A;  5B40 C;  4YS3 D;  3X1U D;  1H3O B;  3C1C A;  1JFI A;  5B1L C;  5B33 D;  1F66 A;  3W99 B;  5GSU C;  1WWI A;  5B32 D;  3MGQ C;  3NQU A;  3AZM D;  2BG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...