5B32A

The crystal structure of the heterotypic h2az/h2a nucleosome with h3.3.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title Crystal structures of heterotypic nucleosomes containing histones H2A.Z and H2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5b32A00
5B32D 3UTAA 3C1BA 2NZDB 5C3IB 5KDMB 2CV5C 3MGQA 3NQJA 5AV9A 3W97C 3AZMC 3LJAD 3NQJB 3MGRB 3B6FC 5B32G 2NZDD 5GT0B 5B2JA 4LD9C 3C1BD 3REIC 5B2IB 3A6NB 3MGQD 3MGRD 1P3LB 3WAAA 1F66B 5E5AA 4G92B 3AZGB 3AZIC 3MGSC 5B0YA 3A6ND 5B2JD 3AZHC 1H3OB 4R8PC 1TZYB 4YS3A 3V9RB 5DNMB 4ZBJB 3AZLC 3WAAD 5BT1C 5E5AD 5F99A 1P3KC 4H9PB 1TZYD 2BYKA 4X23B 5DNMD 1KX3A 3R45A 3B0CW 3O62A 3B6GB 5AV5A 1WWSA 3LJAC 3AZFA 2NZDC 5GXQB 3C1BC 4WNNB 3VH6T 5AV8B 3X1SB 3KWQB 3O62D 3W98A 3KXBB 5AV5D 3MGQC 3MGRC 3AN2A 3AYWA 5GXQD 1M1AA 5B0ZA 3AZFD 3AZEB 3A6NC 4UUZA 5B2JC 5AV8D 3X1SD 3AFAB 3KWQD 1M1AB 4KGCB 3KXBD 1ID3A 2F8NK 4JJNA 4G92C 4AWLB 3AV1B 5FUGB 2YFWA 3WAAC 3AYWD 3AZED 5E5AC 1M1AD 3AFAD 4WU9A 4KGCD 5DNNA 4CSRB 3NQUA 5AVCA 3X1VB 1HQ3B 5B31A 3LELA 1TZYC 1P3PA 5DNNB 5DNMC 4ZBJC 3AZNA 3AV1D 4JJND 3UT9A 3KUYA 1KX4A 4WU9D 4H9QA 5DNND 2YFVB 5B40B 5AVCD 1WWIA 1ZLAB 1N1JB 4M6BA 3O62C 4Z66A 5AV5C 4KHAA 5GXQC 3KUYD 3AZFC 5G49B 5AV8C 3KWQC 3X1SC 3KXBC 4J8VA 2CV5A 1BH9B 4Z66D 3AZMA 4KUDA 4J8UB 3WTPB 3AZEC 3AYWC 5B1MB 1M1AC 4KGCC 1P3AB 4H9NA 5BO0B 3REIA 4H9OA 4AWLC 4J8VD 1P3MA 3AV1C 4WZSB 3B0DB 1M18A 4JJNC 4J8UD 3W99B 5AVBA 1B67A 1P3AD 4KUDD 3AZIA 4WU9C 5DNNC 4G91C 5AVCC 4R8PA 3RELA 1P3MD 1M18D 3WA9B 3C1CA 2PYOB 5AVBD 1P3IA 1KX5A 3KUYC 5B32A 1P3BA 3W96A 3X1TB 4Z2MH 3RELD 4EO5B 2PYOD 2RVQD 2HIOB 4Z66C 3C1CD 1P3ID 3X1TD 2NZDA 4NFTA 5CPKB 1KX5D 1P3BD 3W96D 5KDMA 1Q9CA 4J8VC 5B24B 3MGRA 4J8UC 5GT0A 1P3AC 4KUDC 4YM6B 4HGAB 5B2IA 3A6NA 2HUEC 3B0DC 1P3LA 1F66A 1P3MC 3AZGA 1M18C 4WU8B 5GT0D 1P3GB 5JRGB 5CPIB 5AVBC 5CPJB 1H3OA 5B2ID 1TZYA 5GT3B 3V9RA 1U35B 5BNVB 5DNMA 3RELC 1P3LD 1F66D 1P3GD 2PYOC 5JRGD 2RVQC 3VH5A 3AZGD 3UTBB 1B6WA 3C1CC 4H9PA 1P3IC 4X23A 3X1TC 1KX5C 5B32C 1P3BC 3W96C 3B6GA 1KU5A 3MVDA 3MNNB 5GXQA 3MVDB 4X23D 5C3IC 4WNNA 3X1SA 5AV8A 3KWQA 3B6GD 3KXBA 3MGPB 3AZJB 5B1LB 4QLCB 2FJ7B 5BS7C 3MVDD 1P3FB 4HGAC 5GT0C 3AZEA 3AFAA 4KGCA 2IO5B 3AZJD 5B1LD 5B2IC 2F8NH 1BH8B 4QLCD 3AV1A 1P3LC 5FUGA 4J8XB 1P3FD 1F66C 1P3GC 5AY8B 5JRGC 3AZGC 4CSRA 3X1VA 1HQ3A 3WKJB 4J8XD 5AY8D 4NE3A 4Z2MG 3LZ0B 5B40A 2YFVA 1JFIB 3X1VD 1HQ3D 1ZLAA 4X23C 1N1JA 3REHB 3B6GC 2AROB 4CAYB 1P34B 5CP6B 3AZKB 1M19A 3MVDC 2BYMB 1ULYA 5G49A 4Z5TB 5B40D 3REHD 1ZLAD 1M19B 3AZJC 2AROD 5B1LC 1BH9A 3VH6W 4QLCC 5CP6D 1P3FC 4J8UA 4Z5TD 3WTPA 5B1MA 1R4VA 1M19D 2IO5C 1P3AA 5BO0A 3X1UA 3AFAC 4XZQB 3LZ1B 4ZUXA 3X1UB 4J8XC 3W99A 2NQBB 5AY8C 4ZUXB 5B33B 3WTPD 5B1MD 1TAFA 4XZQD 3TU4B 3X1VC 1HQ3C 3X1UD 3REJB 3B0BA 3REKA 1TAFB 5B31G 4XUJB 4ZUXD 5B33D 3REKB 3W99D 5BNXB 3WA9A 2PYOA 3TU4D 2F8NB 3REJD 1BFMA 5B40C 3X1TA 3W97B 4XUJD 3REHC 1ZLAC 1A7WA 3REKD 3B6FB 2AROC 4LD9B 5CP6C 2HIOA 3WA9D 3WTPE 4Z5TC 5CPKA 1M19C 5JA4B 3VH6A 2LY8A 5B24A 2F8NG 2HIOD 3AZHB 5BS7A 4YM6A 3WTPC 5CPKD 5B1MC 5GSUB 4XZQC 3AZLB 3X1UC 1EQZA 1P3KB 4ZUXC 5B24D 3W99C 4WU8A 1EQZB 1P3GA 5GSUD 3AV2A 5JRGA 5CPIA 4J8WA 5AV6B 4H9SC 3TU4C 4YM6D 5CPJA 3REJC 3AV2B 4H9RB 5GT3A 4J8WB 1U35A 4XUJC 5BNVA 3REKC 3LJAB 1EQZD 1S32A 3UTAB 2L5AA 3C1BB 5AV6D 3UTBA 4WU8D 3WA9C 3AV2D 1S32B 5CPID 4J8WD 5CPJD 3MGQB 5AV9B 5GT3D 1U35D 3UTAD 4EO5C 1S32D 5B2JB 3UTBD 3MNNA 2HIOC 5AV9D 5CPKC 3AZJA 3MGPA 3WAAB 5B1LA 5E5AB 4QLCA 5B24C 2FJ7A 5B0YB 1P3FA 3MNND 5GSUC 2CWEA 4YM6C 4YS3B 5CHLB 1BH8A 3MGPD 5B0YD 1EQZC 5F99B 4J8XA 5AY8A 2FJ7D 5AV6C 4WU8C 2JSSA 2BYKB 4YS3D 3AV2C 5CPIC 1KX3B 3R45B 4J8WC 5CPJC 3O62B 3WKJA 5AV5B 5F99D 1F1EA 5GT3C 1U35C 3UTAC 1P3OA 3AZFB 1S32C 3LZ0A 4NE6A 1P3OB 1KX3D 3UTBC 1JFIA 5AV9C 3REHA 3W98B 3WKJD 3AN2B 3AYWB 2AROA 4CAYA 1P34A 1P3OD 5B0ZB 5CP6A 3AZKA 3LZ0D 4UUZB 2BYMA 4Z5TA 3MNNC 3W98D 1ID3B 4JJNB 3AN2D 5B0ZD 4E44A 2YFWB 3MGPC 5B0YC 1P34D 4WU9B 3NQUB 3AZKD 4G91B 5AVCB 1ID3D 5B31B 3LELB 1AOIA 2FJ7C 4YS3C 1P3PB 4E45A 4XZQA 3AZNB 1AOIB 3LZ1A 3UT9B 3VH5T 5F99C 2NQBA 3KUYB 5B31D 3LELD 1KX4B 5B33A 4H9QB 1P3PD 1KX3C 3AZND 1AOID 3TU4A 4H9SA 3UT9D 3REJA 4XUJA 4Z66B 3LZ1D 1KX4D 3WKJC 2NQBD 5BNXA 4KHAB 1P3OC 2F8NA 3LZ0C 3W97A 3W98C 4J8VB 2CV5B 3B6FA 4NE5A 3AN2C 3AZMB 5B0ZC 4LD9A 4KUDB 4DRAA 1P34C 3AZKC 4H9NB 4DRBA 2F8ND 2CV5D 3REIB 1ID3C 2HUEB 4H9OB 3W97D 5JA4A 3AZMD 1P3MB 4WV4B 1M18B 3B6FD 3MGSA 4LD9D 5AVBB 3AZIB 3AZHA 5B31C 3LELC 3MGSB 3REID 1P3PC 5GSUA 3AZNC 4R8PB 3AZLA 1AOIC 3RELB 3UT9C 3KSYA 3VH5W 1P3KA 3AZID 3LZ1C 1KX4C 3MGSD 2NQBC 3C1CB 1P3IB 1HTAA 3AZHD 1KX5B 5B32B 4R8PD 1P3BB 5B33C 5AV6A 3W96B 3AZLD 4H9RA 3B0CT 5BT1D 3LJAA 1P3KD
chains in the Genus database with same CATH superfamily
5B32D 3UTAA 3C1BA 2NZDB 5C3IB 5KDMB 2CV5C 3MGQA 3NQJA 5AV9A 3W97C 3AL0C 3AZMC 2W8SA 3NQJB 3LJAD 3MGRB 3B6FC 2DF4C 5B32G 2NZDD 5GT0B 5B2JA 4LD9C 3C1BD 3REIC 5B2IB 3A6NB 3MGQD 3MGRD 2G5HC 1P3LB 3WAAA 1F66B 5E5AA 4G92B 3AZGB 3AZIC 3MGSC 5B0YA 3A6ND 5B2JD 3AZHC 1H3OB 2FFFB 4R8PC 3H0RC 1TZYB 4YS3A 3V9RB 5DNMB 4ZBJB 3AZLC 3WAAD 5BT1C 5E5AD 5F99A 1P3KC 4H9PB 1TZYD 2BYKA 4X23B 5DNMD 1KX3A 3R45A 3B0CW 3O62A 3B6GB 5AV5A 1WWSA 3LJAC 3AZFA 2NZDC 5GXQB 3C1BC 4WNNB 3VH6T 5AV8B 3X1SB 3KWQB 3O62D 3W98A 3KXBB 5AV5D 3MGQC 3MGRC 3AN2A 3AYWA 5GXQD 1M1AA 5B0ZA 3AZFD 3AZEB 3A6NC 4UUZA 5B2JC 5AV8D 3X1SD 2JE5A 3AFAB 3KWQD 1M1AB 4KGCB 3KXBD 1ID3A 2Y2IA 2F8NK 4JJNA 4G92C 4AWLB 3AV1B 5FUGB 2YFWA 3WAAC 3AYWD 3AZED 5E5AC 1M1AD 3AFAD 4WU9A 4KGCD 5DNNA 4CSRB 3NQUA 5AVCA 3X1VB 1HQ3B 5B31A 3LELA 2JCHA 1TZYC 1P3PA 5DNNB 5DNMC 4ZBJC 3AZNA 3AV1D 4JJND 3UT9A 3KUYA 1KX4A 4WU9D 4H9QA 2XD5A 5DNND 2YFVB 5B40B 5AVCD 1WWIA 1ZLAB 1N1JB 4M6BA 3O62C 4Z66A 5AV5C 4KHAA 5GXQC 3KUYD 3AZFC 5G49B 5AV8C 3KWQC 3X1SC 2ZY5A 3KXBC 4J8VA 2CV5A 1BH9B 4Z66D 3AZMA 4KUDA 2UWXA 4J8UB 3WTPB 3AZEC 3AYWC 5B1MB 1M1AC 4KGCC 1P3AB 4H9NA 5BO0B 3REIA 4H9OA 4AWLC 4J8VD 1P3MA 3AV1C 4WZSB 3B0DB 1M18A 4JJNC 4J8UD 3W99B 5AVBA 1B67A 1P3AD 4KUDD 3AZIA 4WU9C 5DNNC 4G91C 5AVCC 4R8PA 3RELA 1P3MD 1M18D 3WA9B 3C1CA 2PYOB 5AVBD 1P3IA 3EPJA 1KX5A 3KUYC 5B32A 1P3BA 3W96A 3X1TB 4Z2MH 3RELD 4EO5B 2F2AC 2PYOD 2RVQD 2HIOB 4Z66C 3C1CD 1P3ID 3X1TD 2NZDA 4NFTA 5CPKB 1KX5D 1P3BD 3W96D 5KDMA 1Q9CA 4J8VC 5B24B 3MGRA 4J8UC 5GT0A 1P3AC 4KUDC 2Y2JA 4YM6B 4HGAB 5B2IA 3A6NA 2HUEC 3B0DC 1P3LA 1F66A 1P3MC 3AZGA 1M18C 4WU8B 5GT0D 1P3GB 5JRGB 5CPIB 5AVBC 5CPJB 1H3OA 5B2ID 1TZYA 5GT3B 3V9RA 1U35B 5BNVB 5DNMA 3RELC 1P3LD 1F66D 1P3GD 2PYOC 5JRGD 2RVQC 3VH5A 3AZGD 3UTBB 1B6WA 3C1CC 4H9PA 1P3IC 4X23A 3X1TC 1KX5C 5B32C 1P3BC 3W96C 3B6GA 3H0MC 2BG1A 1KU5A 3MVDA 2J8PA 3MNNB 5GXQA 3MVDB 4X23D 5C3IC 3F6TA 4WNNA 3X1SA 5AV8A 3KWQA 3B6GD 3KXBA 3MGPB 3AZJB 5B1LB 4QLCB 2FJ7B 5BS7C 3MVDD 1P3FB 3A1KA 4HGAC 5GT0C 3AZEA 3AFAA 4KGCA 2IO5B 3AZJD 5B1LD 5B2IC 2F8NH 1BH8B 4QLCD 3AV1A 1Z2CB 1P3LC 2DQNC 5FUGA 4J8XB 1P3FD 1P3GC 1F66C 5AY8B 5JRGC 3AZGC 4CSRA 3X1VA 1HQ3A 2VQRA 3WKJB 4J8XD 5AY8D 4NE3A 4Z2MG 3LZ0B 5B40A 2YFVA 1JFIB 3X1VD 1HQ3D 1ZLAA 4X23C 1N1JA 3REHB 3B6GC 2AROB 4CAYB 1P34B 2XD1A 5CP6B 3AZKB 2Y2PA 1M19A 3MVDC 2BYMB 1ULYA 2Y2HA 5G49A 4Z5TB 5B40D 3REHD 1ZLAD 1M19B 3AZJC 2AROD 5B1LC 1BH9A 3VH6W 4QLCC 5CP6D 1P3FC 4J8UA 4Z5TD 3WTPA 5B1MA 1PZRA 1R4VA 1M19D 2IO5C 1P3AA 3KFUG 5BO0A 3X1UA 3AFAC 4XZQB 3LZ1B 4ZUXA 3X1UB 4J8XC 3W99A 2NQBB 2Y2OA 5AY8C 4ZUXB 5B33B 3WTPD 5B1MD 1TAFA 4XZQD 3TU4B 3X1VC 1HQ3C 3X1UD 3REJB 3B0BA 3REKA 1TAFB 5B31G 4XUJB 4ZUXD 5B33D 3REKB 3W99D 3FDDA 5BNXB 3WA9A 2PYOA 3TU4D 2F8NB 3REJD 4DQYB 1BFMA 5B40C 3X1TA 3W97B 4XUJD 3REHC 1ZLAC 1A7WA 3REKD 3B6FB 2AROC 4LD9B 5CP6C 2HIOA 3WA9D 3WTPE 4Z5TC 5CPKA 1M19C 5JA4B 3VH6A 2LY8A 5B24A 2F8NG 2HIOD 3AZHB 5BS7A 4YM6A 3WTPC 5CPKD 5B1MC 5GSUB 4XZQC 3AZLB 3IP4C 3X1UC 1EQZA 1P3KB 4ZUXC 5B24D 3W99C 4WU8A 1EQZB 2ZY2A 1P3GA 5GSUD 3AV2A 5JRGA 5CPIA 4J8WA 5AV6B 4H9SC 3TU4C 4YM6D 5CPJA 3REJC 3AV2B 4H9RB 5GT3A 4J8WB 1U35A 4XUJC 5BNVA 3P5JB 3REKC 3LJAB 2ZM5A 1EQZD 1S32A 3UTAB 2L5AA 3C1BB 5AV6D 3UTBA 4WU8D 3WA9C 3AV2D 1S32B 2Y2NA 5CPID 4J8WD 5CPJD 3MGQB 5AV9B 3EG5B 5GT3D 1U35D 3UTAD 4EO5C 1S32D 5B2JB 3UTBD 3MNNA 2HIOC 5AV9D 5CPKC 3AZJA 3MGPA 3WAAB 5B1LA 5E5AB 4QLCA 5B24C 2FJ7A 5B0YB 1P3FA 3MNND 5GSUC 2CWEA 4YM6C 4YS3B 5CHLB 1BH8A 3MGPD 5B0YD 1EQZC 5F99B 4J8XA 5AY8A 2FJ7D 5AV6C 4WU8C 2JSSA 2BYKB 4YS3D 3AV2C 5CPIC 1KX3B 3R45B 4J8WC 5CPJC 2G5IC 3O62B 3WKJA 5AV5B 5F99D 1F1EA 5GT3C 1U35C 3UTAC 1P3OA 2Y2GA 3AZFB 1S32C 3LZ0A 4NE6A 1P3OB 4UPKA 1KX3D 3UTBC 1JFIA 5AV9C 2Y2MA 3REHA 3W98B 3WKJD 3AN2B 3AYWB 2AROA 4CAYA 1P34A 1P3OD 5B0ZB 4WJ3C 5CP6A 3AZKA 3LZ0D 4UUZB 2BYMA 1W2EA 4Z5TA 3MNNC 3W98D 1ID3B 4JJNB 3AN2D 3EPKA 5B0ZD 4E44A 2YFWB 3MGPC 5B0YC 1P34D 4WU9B 3NQUB 2Y2QA 3AZKD 4G91B 5AVCB 1ID3D 5B31B 3LELB 1AOIA 2FJ7C 4YS3C 1P3PB 4E45A 4XZQA 3AZNB 1AOIB 3LZ1A 3UT9B 3VH5T 5F99C 2NQBA 3KUYB 5B31D 3LELD 1KX4B 5B33A 4H9QB 1P3PD 1KX3C 3AZND 1AOID 3TU4A 4H9SA 3UT9D 3REJA 2ZY3A 4XUJA 4Z66B 3LZ1D 1KX4D 3WKJC 2NQBD 5BNXA 4KHAB 1P3OC 2F8NA 3LZ0C 3W97A 3W98C 4J8VB 2CV5B 1T3UA 3EPLA 3B6FA 4NE5A 3AN2C 2ZY4A 3AZMB 5B0ZC 4LD9A 2Y2LA 4KUDB 4DRAA 1P34C 3AZKC 4H9NB 4DRBA 2F8ND 2CV5D 2Y2KA 3REIB 2HUEB 4H9OB 1ID3C 3W97D 5JA4A 3AZMD 1P3MB 4WV4B 1M18B 3B6FD 3MGSA 4LD9D 5AVBB 2RIQA 3AZIB 3AZHA 5B31C 3LELC 3MGSB 3REID 3H0LC 1P3PC 3EPHA 5GSUA 3AZNC 4R8PB 3AZLA 1AOIC 3RELB 3UT9C 3KSYA 3VH5W 1P3KA 3AZID 3LZ1C 1KX4C 3MGSD 2NQBC 3C1CB 1P3IB 1HTAA 3AZHD 1KX5B 5B32B 4R8PD 1P3BB 5B33C 5AV6A 3W96B 3A1IA 3AZLD 4H9RA 3B0CT 5BT1D 3LJAA 1P3KD
chains in the Genus database with same CATH topology
5B32D 3UTAA 3C1BA 2NZDB 5C3IB 5KDMB 2CV5C 3MGQA 3NQJA 5AV9A 3W97C 3AL0C 3AZMC 2W8SA 3NQJB 3LJAD 3MGRB 3B6FC 2DF4C 5B32G 2NZDD 5GT0B 5B2JA 4LD9C 3C1BD 3REIC 5B2IB 3A6NB 3MGQD 3MGRD 2G5HC 1P3LB 3WAAA 1F66B 5E5AA 4G92B 3AZGB 3AZIC 3MGSC 5B0YA 3A6ND 5B2JD 3AZHC 1H3OB 2FFFB 4R8PC 3H0RC 1TZYB 4YS3A 3V9RB 5DNMB 4ZBJB 3AZLC 3WAAD 5BT1C 5E5AD 5F99A 1P3KC 4H9PB 1TZYD 2BYKA 4X23B 5DNMD 1KX3A 3R45A 3B0CW 3O62A 3B6GB 5AV5A 1WWSA 3LJAC 3AZFA 2NZDC 5GXQB 3C1BC 4WNNB 3VH6T 5AV8B 3X1SB 3KWQB 3O62D 3W98A 3KXBB 5AV5D 3MGQC 3MGRC 3AN2A 3AYWA 5GXQD 1M1AA 5B0ZA 3AZFD 3AZEB 3A6NC 4UUZA 5B2JC 5AV8D 3X1SD 2JE5A 3AFAB 3KWQD 1M1AB 4KGCB 3KXBD 1ID3A 2Y2IA 2F8NK 4JJNA 4G92C 4AWLB 3AV1B 5FUGB 2YFWA 3WAAC 3AYWD 3AZED 5E5AC 1M1AD 3AFAD 4WU9A 4KGCD 5DNNA 4CSRB 3NQUA 5AVCA 3X1VB 1HQ3B 5B31A 3LELA 2JCHA 1TZYC 1P3PA 5DNNB 5DNMC 4ZBJC 3AZNA 3AV1D 4JJND 3UT9A 3KUYA 1KX4A 4WU9D 4H9QA 2XD5A 5DNND 2YFVB 5B40B 5AVCD 1WWIA 1ZLAB 1N1JB 4M6BA 3O62C 4Z66A 5AV5C 4KHAA 5GXQC 3KUYD 3AZFC 5G49B 5AV8C 3KWQC 3X1SC 2ZY5A 3KXBC 4J8VA 2CV5A 1BH9B 4Z66D 3AZMA 4KUDA 2UWXA 4J8UB 3WTPB 3AZEC 3AYWC 5B1MB 1M1AC 4KGCC 1P3AB 4H9NA 5BO0B 3REIA 4H9OA 4AWLC 4J8VD 1P3MA 3AV1C 4WZSB 3B0DB 1M18A 4JJNC 4J8UD 3W99B 5AVBA 1B67A 1P3AD 4KUDD 3AZIA 4WU9C 5DNNC 4G91C 5AVCC 4R8PA 3RELA 1P3MD 1M18D 3WA9B 3C1CA 2PYOB 5AVBD 1P3IA 3EPJA 1KX5A 3KUYC 5B32A 1P3BA 3W96A 3X1TB 4Z2MH 3RELD 4EO5B 2F2AC 2PYOD 2RVQD 2HIOB 4Z66C 3C1CD 1P3ID 3X1TD 2NZDA 4NFTA 5CPKB 1KX5D 1P3BD 3W96D 5KDMA 1Q9CA 4J8VC 5B24B 3MGRA 4J8UC 5GT0A 1P3AC 4KUDC 2Y2JA 4YM6B 4HGAB 5B2IA 3A6NA 2HUEC 3B0DC 1P3LA 1F66A 1P3MC 3AZGA 1M18C 4WU8B 5GT0D 1P3GB 5JRGB 5CPIB 5AVBC 5CPJB 1H3OA 5B2ID 1TZYA 5GT3B 3V9RA 1U35B 5BNVB 5DNMA 3RELC 1P3LD 1F66D 1P3GD 2PYOC 5JRGD 2RVQC 3VH5A 3AZGD 3UTBB 1B6WA 3C1CC 4H9PA 1P3IC 4X23A 3X1TC 1KX5C 5B32C 1P3BC 3W96C 3B6GA 3H0MC 2BG1A 1KU5A 3MVDA 2J8PA 3MNNB 5GXQA 3MVDB 4X23D 5C3IC 3F6TA 4WNNA 3X1SA 5AV8A 3KWQA 3B6GD 3KXBA 3MGPB 3AZJB 5B1LB 4QLCB 2FJ7B 5BS7C 3MVDD 1P3FB 3A1KA 4HGAC 5GT0C 3AZEA 3AFAA 4KGCA 2IO5B 3AZJD 5B1LD 5B2IC 2F8NH 1BH8B 4QLCD 3AV1A 1Z2CB 1P3LC 2DQNC 5FUGA 4J8XB 1P3FD 1P3GC 1F66C 5AY8B 5JRGC 3AZGC 4CSRA 3X1VA 1HQ3A 2VQRA 3WKJB 4J8XD 5AY8D 4NE3A 4Z2MG 3LZ0B 5B40A 2YFVA 1JFIB 3X1VD 1HQ3D 1ZLAA 4X23C 1N1JA 3REHB 3B6GC 2AROB 4CAYB 1P34B 2XD1A 5CP6B 3AZKB 2Y2PA 1M19A 3MVDC 2BYMB 1ULYA 2Y2HA 5G49A 4Z5TB 5B40D 3REHD 1ZLAD 1M19B 3AZJC 2AROD 5B1LC 1BH9A 3VH6W 4QLCC 5CP6D 1P3FC 4J8UA 4Z5TD 3WTPA 5B1MA 1PZRA 1R4VA 1M19D 2IO5C 1P3AA 3KFUG 5BO0A 3X1UA 3AFAC 4XZQB 3LZ1B 4ZUXA 3X1UB 4J8XC 3W99A 2NQBB 2Y2OA 5AY8C 4ZUXB 5B33B 3WTPD 5B1MD 1TAFA 4XZQD 3TU4B 3X1VC 1HQ3C 3X1UD 3REJB 3B0BA 3REKA 1TAFB 5B31G 4XUJB 4ZUXD 5B33D 3REKB 3W99D 3FDDA 5BNXB 3WA9A 2PYOA 3TU4D 2F8NB 3REJD 4DQYB 1BFMA 5B40C 3X1TA 3W97B 4XUJD 3REHC 1ZLAC 1A7WA 3REKD 3B6FB 2AROC 4LD9B 5CP6C 2HIOA 3WA9D 3WTPE 4Z5TC 5CPKA 1M19C 5JA4B 3VH6A 2LY8A 5B24A 2F8NG 2HIOD 3AZHB 5BS7A 4YM6A 3WTPC 5CPKD 5B1MC 5GSUB 4XZQC 3AZLB 3IP4C 3X1UC 1EQZA 1P3KB 4ZUXC 5B24D 3W99C 4WU8A 1EQZB 2ZY2A 1P3GA 5GSUD 3AV2A 5JRGA 5CPIA 4J8WA 5AV6B 4H9SC 3TU4C 4YM6D 5CPJA 3REJC 3AV2B 4H9RB 5GT3A 4J8WB 1U35A 4XUJC 5BNVA 3P5JB 3REKC 3LJAB 2ZM5A 1EQZD 1S32A 3UTAB 2L5AA 3C1BB 5AV6D 3UTBA 4WU8D 3WA9C 3AV2D 1S32B 2Y2NA 5CPID 4J8WD 5CPJD 3MGQB 5AV9B 3EG5B 5GT3D 1U35D 3UTAD 4EO5C 1S32D 5B2JB 3UTBD 3MNNA 2HIOC 5AV9D 5CPKC 3AZJA 3MGPA 3WAAB 5B1LA 5E5AB 4QLCA 5B24C 2FJ7A 5B0YB 1P3FA 3MNND 5GSUC 2CWEA 4YM6C 4YS3B 5CHLB 1BH8A 3MGPD 5B0YD 1EQZC 5F99B 4J8XA 5AY8A 2FJ7D 5AV6C 4WU8C 2JSSA 2BYKB 4YS3D 3AV2C 5CPIC 1KX3B 3R45B 4J8WC 5CPJC 2G5IC 3O62B 3WKJA 5AV5B 5F99D 1F1EA 5GT3C 1U35C 3UTAC 1P3OA 2Y2GA 3AZFB 1S32C 3LZ0A 4NE6A 1P3OB 4UPKA 1KX3D 3UTBC 1JFIA 5AV9C 2Y2MA 3REHA 3W98B 3WKJD 3AN2B 3AYWB 2AROA 4CAYA 1P34A 1P3OD 5B0ZB 4WJ3C 5CP6A 3AZKA 3LZ0D 4UUZB 2BYMA 1W2EA 4Z5TA 3MNNC 3W98D 1ID3B 4JJNB 3AN2D 3EPKA 5B0ZD 4E44A 2YFWB 3MGPC 5B0YC 1P34D 4WU9B 3NQUB 2Y2QA 3AZKD 4G91B 5AVCB 1ID3D 5B31B 3LELB 1AOIA 2FJ7C 4YS3C 1P3PB 4E45A 4XZQA 3AZNB 1AOIB 3LZ1A 3UT9B 3VH5T 5F99C 2NQBA 3KUYB 5B31D 3LELD 1KX4B 5B33A 4H9QB 1P3PD 1KX3C 3AZND 1AOID 3TU4A 4H9SA 3UT9D 3REJA 2ZY3A 4XUJA 4Z66B 3LZ1D 1KX4D 3WKJC 2NQBD 5BNXA 4KHAB 1P3OC 2F8NA 3LZ0C 3W97A 3W98C 4J8VB 2CV5B 1T3UA 3EPLA 3B6FA 4NE5A 3AN2C 2ZY4A 3AZMB 5B0ZC 4LD9A 2Y2LA 4KUDB 4DRAA 1P34C 3AZKC 4H9NB 4DRBA 2F8ND 2CV5D 2Y2KA 3REIB 2HUEB 4H9OB 1ID3C 3W97D 5JA4A 3AZMD 1P3MB 4WV4B 1M18B 3B6FD 3MGSA 4LD9D 5AVBB 2RIQA 3AZIB 3AZHA 5B31C 3LELC 3MGSB 3REID 3H0LC 1P3PC 3EPHA 5GSUA 3AZNC 4R8PB 3AZLA 1AOIC 3RELB 3UT9C 3KSYA 3VH5W 1P3KA 3AZID 3LZ1C 1KX4C 3MGSD 2NQBC 3C1CB 1P3IB 1HTAA 3AZHD 1KX5B 5B32B 4R8PD 1P3BB 5B33C 5AV6A 3W96B 3A1IA 3AZLD 4H9RA 3B0CT 5BT1D 3LJAA 1P3KD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B32 D;  3UTA A;  3C1B A;  2NZD B;  5C3I B;  5KDM B;  2CV5 C;  3MGQ A;  3NQJ A;  5AV9 A;  3W97 C;  3AZM C;  3LJA D;  3NQJ B;  3MGR B;  3B6F C;  5B32 G;  2NZD D;  5GT0 B;  5B2J A;  4LD9 C;  3C1B D;  3REI C;  5B2I B;  3A6N B;  3MGQ D;  3MGR D;  1P3L B;  3WAA A;  1F66 B;  5E5A A;  4G92 B;  3AZG B;  3AZI C;  3MGS C;  5B0Y A;  3A6N D;  5B2J D;  3AZH C;  1H3O B;  4R8P C;  1TZY B;  4YS3 A;  3V9R B;  5DNM B;  4ZBJ B;  3AZL C;  3WAA D;  5BT1 C;  5E5A D;  5F99 A;  1P3K C;  4H9P B;  1TZY D;  2BYK A;  4X23 B;  5DNM D;  1KX3 A;  3R45 A;  3B0C W;  3O62 A;  3B6G B;  5AV5 A;  1WWS A;  3LJA C;  3AZF A;  2NZD C;  5GXQ B;  3C1B C;  4WNN B;  3VH6 T;  5AV8 B;  3X1S B;  3KWQ B;  3O62 D;  3W98 A;  3KXB B;  5AV5 D;  3MGQ C;  3MGR C;  3AN2 A;  3AYW A;  5GXQ D;  1M1A A;  5B0Z A;  3AZF D;  3AZE B;  3A6N C;  4UUZ A;  5B2J C;  5AV8 D;  3X1S D;  3AFA B;  3KWQ D;  1M1A B;  4KGC B;  3KXB D;  1ID3 A;  2F8N K;  4JJN A;  4G92 C;  4AWL B;  3AV1 B;  5FUG B;  2YFW A;  3WAA C;  3AYW D;  3AZE D;  5E5A C;  1M1A D;  3AFA D;  4WU9 A;  4KGC D;  5DNN A;  4CSR B;  3NQU A;  5AVC A;  3X1V B;  1HQ3 B;  5B31 A;  3LEL A;  1TZY C;  1P3P A;  5DNN B;  5DNM C;  4ZBJ C;  3AZN A;  3AV1 D;  4JJN D;  3UT9 A;  3KUY A;  1KX4 A;  4WU9 D;  4H9Q A;  5DNN D;  2YFV B;  5B40 B;  5AVC D;  1WWI A;  1ZLA B;  1N1J B;  4M6B A;  3O62 C;  4Z66 A;  5AV5 C;  4KHA A;  5GXQ C;  3KUY D;  3AZF C;  5G49 B;  5AV8 C;  3KWQ C;  3X1S C;  3KXB C;  4J8V A;  2CV5 A;  1BH9 B;  4Z66 D;  3AZM A;  4KUD A;  4J8U B;  3WTP B;  3AZE C;  3AYW C;  5B1M B;  1M1A C;  4KGC C;  1P3A B;  4H9N A;  5BO0 B;  3REI A;  4H9O A;  4AWL C;  4J8V D;  1P3M A;  3AV1 C;  4WZS B;  3B0D B;  1M18 A;  4JJN C;  4J8U D;  3W99 B;  5AVB A;  1B67 A;  1P3A D;  4KUD D;  3AZI A;  4WU9 C;  5DNN C;  4G91 C;  5AVC C;  4R8P A;  3REL A;  1P3M D;  1M18 D;  3WA9 B;  3C1C A;  2PYO B;  5AVB D;  1P3I A;  1KX5 A;  3KUY C;  5B32 A;  1P3B A;  3W96 A;  3X1T B;  4Z2M H;  3REL D;  4EO5 B;  2PYO D;  2RVQ D;  2HIO B;  4Z66 C;  3C1C D;  1P3I D;  3X1T D;  2NZD A;  4NFT A;  5CPK B;  1KX5 D;  1P3B D;  3W96 D;  5KDM A;  1Q9C A;  4J8V C;  5B24 B;  3MGR A;  4J8U C;  5GT0 A;  1P3A C;  4KUD C;  4YM6 B;  4HGA B;  5B2I A;  3A6N A;  2HUE C;  3B0D C;  1P3L A;  1F66 A;  1P3M C;  3AZG A;  1M18 C;  4WU8 B;  5GT0 D;  1P3G B;  5JRG B;  5CPI B;  5AVB C;  5CPJ B;  1H3O A;  5B2I D;  1TZY A;  5GT3 B;  3V9R A;  1U35 B;  5BNV B;  5DNM A;  3REL C;  1P3L D;  1F66 D;  1P3G D;  2PYO C;  5JRG D;  2RVQ C;  3VH5 A;  3AZG D;  3UTB B;  1B6W A;  3C1C C;  4H9P A;  1P3I C;  4X23 A;  3X1T C;  1KX5 C;  5B32 C;  1P3B C;  3W96 C;  3B6G A;  1KU5 A;  3MVD A;  3MNN B;  5GXQ A;  3MVD B;  4X23 D;  5C3I C;  4WNN A;  3X1S A;  5AV8 A;  3KWQ A;  3B6G D;  3KXB A;  3MGP B;  3AZJ B;  5B1L B;  4QLC B;  2FJ7 B;  5BS7 C;  3MVD D;  1P3F B;  4HGA C;  5GT0 C;  3AZE A;  3AFA A;  4KGC A;  2IO5 B;  3AZJ D;  5B1L D;  5B2I C;  2F8N H;  1BH8 B;  4QLC D;  3AV1 A;  1P3L C;  5FUG A;  4J8X B;  1P3F D;  1F66 C;  1P3G C;  5AY8 B;  5JRG C;  3AZG C;  4CSR A;  3X1V A;  1HQ3 A;  3WKJ B;  4J8X D;  5AY8 D;  4NE3 A;  4Z2M G;  3LZ0 B;  5B40 A;  2YFV A;  1JFI B;  3X1V D;  1HQ3 D;  1ZLA A;  4X23 C;  1N1J A;  3REH B;  3B6G C;  2ARO B;  4CAY B;  1P34 B;  5CP6 B;  3AZK B;  1M19 A;  3MVD C;  2BYM B;  1ULY A;  5G49 A;  4Z5T B;  5B40 D;  3REH D;  1ZLA D;  1M19 B;  3AZJ C;  2ARO D;  5B1L C;  1BH9 A;  3VH6 W;  4QLC C;  5CP6 D;  1P3F C;  4J8U A;  4Z5T D;  3WTP A;  5B1M A;  1R4V A;  1M19 D;  2IO5 C;  1P3A A;  5BO0 A;  3X1U A;  3AFA C;  4XZQ B;  3LZ1 B;  4ZUX A;  3X1U B;  4J8X C;  3W99 A;  2NQB B;  5AY8 C;  4ZUX B;  5B33 B;  3WTP D;  5B1M D;  1TAF A;  4XZQ D;  3TU4 B;  3X1V C;  1HQ3 C;  3X1U D;  3REJ B;  3B0B A;  3REK A;  1TAF B;  5B31 G;  4XUJ B;  4ZUX D;  5B33 D;  3REK B;  3W99 D;  5BNX B;  3WA9 A;  2PYO A;  3TU4 D;  2F8N B;  3REJ D;  1BFM A;  5B40 C;  3X1T A;  3W97 B;  4XUJ D;  3REH C;  1ZLA C;  1A7W A;  3REK D;  3B6F B;  2ARO C;  4LD9 B;  5CP6 C;  2HIO A;  3WA9 D;  3WTP E;  4Z5T C;  5CPK A;  1M19 C;  5JA4 B;  3VH6 A;  2LY8 A;  5B24 A;  2F8N G;  2HIO D;  3AZH B;  5BS7 A;  4YM6 A;  3WTP C;  5CPK D;  5B1M C;  5GSU B;  4XZQ C;  3AZL B;  3X1U C;  1EQZ A;  1P3K B;  4ZUX C;  5B24 D;  3W99 C;  4WU8 A;  1EQZ B;  1P3G A;  5GSU D;  3AV2 A;  5JRG A;  5CPI A;  4J8W A;  5AV6 B;  4H9S C;  3TU4 C;  4YM6 D;  5CPJ A;  3REJ C;  3AV2 B;  4H9R B;  5GT3 A;  4J8W B;  1U35 A;  4XUJ C;  5BNV A;  3REK C;  3LJA B;  1EQZ D;  1S32 A;  3UTA B;  2L5A A;  3C1B B;  5AV6 D;  3UTB A;  4WU8 D;  3WA9 C;  3AV2 D;  1S32 B;  5CPI D;  4J8W D;  5CPJ D;  3MGQ B;  5AV9 B;  5GT3 D;  1U35 D;  3UTA D;  4EO5 C;  1S32 D;  5B2J B;  3UTB D;  3MNN A;  2HIO C;  5AV9 D;  5CPK C;  3AZJ A;  3MGP A;  3WAA B;  5B1L A;  5E5A B;  4QLC A;  5B24 C;  2FJ7 A;  5B0Y B;  1P3F A;  3MNN D;  5GSU C;  2CWE A;  4YM6 C;  4YS3 B;  5CHL B;  1BH8 A;  3MGP D;  5B0Y D;  1EQZ C;  5F99 B;  4J8X A;  5AY8 A;  2FJ7 D;  5AV6 C;  4WU8 C;  2JSS A;  2BYK B;  4YS3 D;  3AV2 C;  5CPI C;  1KX3 B;  3R45 B;  4J8W C;  5CPJ C;  3O62 B;  3WKJ A;  5AV5 B;  5F99 D;  1F1E A;  5GT3 C;  1U35 C;  3UTA C;  1P3O A;  3AZF B;  1S32 C;  3LZ0 A;  4NE6 A;  1P3O B;  1KX3 D;  3UTB C;  1JFI A;  5AV9 C;  3REH A;  3W98 B;  3WKJ D;  3AN2 B;  3AYW B;  2ARO A;  4CAY A;  1P34 A;  1P3O D;  5B0Z B;  5CP6 A;  3AZK A;  3LZ0 D;  4UUZ B;  2BYM A;  4Z5T A;  3MNN C;  3W98 D;  1ID3 B;  4JJN B;  3AN2 D;  5B0Z D;  4E44 A;  2YFW B;  3MGP C;  5B0Y C;  1P34 D;  4WU9 B;  3NQU B;  3AZK D;  4G91 B;  5AVC B;  1ID3 D;  5B31 B;  3LEL B;  1AOI A;  2FJ7 C;  4YS3 C;  1P3P B;  4E45 A;  4XZQ A;  3AZN B;  1AOI B;  3LZ1 A;  3UT9 B;  3VH5 T;  5F99 C;  2NQB A;  3KUY B;  5B31 D;  3LEL D;  1KX4 B;  5B33 A;  4H9Q B;  1P3P D;  1KX3 C;  3AZN D;  1AOI D;  3TU4 A;  4H9S A;  3UT9 D;  3REJ A;  4XUJ A;  4Z66 B;  3LZ1 D;  1KX4 D;  3WKJ C;  2NQB D;  5BNX A;  4KHA B;  1P3O C;  2F8N A;  3LZ0 C;  3W97 A;  3W98 C;  4J8V B;  2CV5 B;  3B6F A;  4NE5 A;  3AN2 C;  3AZM B;  5B0Z C;  4LD9 A;  4KUD B;  4DRA A;  1P34 C;  3AZK C;  4H9N B;  4DRB A;  2F8N D;  2CV5 D;  3REI B;  1ID3 C;  2HUE B;  4H9O B;  3W97 D;  5JA4 A;  3AZM D;  1P3M B;  4WV4 B;  1M18 B;  3B6F D;  3MGS A;  4LD9 D;  5AVB B;  3AZI B;  3AZH A;  5B31 C;  3LEL C;  3MGS B;  3REI D;  1P3P C;  5GSU A;  3AZN C;  4R8P B;  3AZL A;  1AOI C;  3REL B;  3UT9 C;  3KSY A;  3VH5 W;  1P3K A;  3AZI D;  3LZ1 C;  1KX4 C;  3MGS D;  2NQB C;  3C1C B;  1P3I B;  1HTA A;  3AZH D;  1KX5 B;  5B32 B;  4R8P D;  1P3B B;  5B33 C;  5AV6 A;  3W96 B;  3AZL D;  4H9R A;  3B0C T;  5BT1 D;  3LJA A;  1P3K D; 
#chains in the Genus database with same CATH topology
 5B32 D;  3UTA A;  3C1B A;  2NZD B;  5C3I B;  5KDM B;  2CV5 C;  3MGQ A;  3NQJ A;  5AV9 A;  3W97 C;  3AL0 C;  3AZM C;  2W8S A;  3NQJ B;  3LJA D;  3MGR B;  3B6F C;  2DF4 C;  5B32 G;  2NZD D;  5GT0 B;  5B2J A;  4LD9 C;  3C1B D;  3REI C;  5B2I B;  3A6N B;  3MGQ D;  3MGR D;  2G5H C;  1P3L B;  3WAA A;  1F66 B;  5E5A A;  4G92 B;  3AZG B;  3AZI C;  3MGS C;  5B0Y A;  3A6N D;  5B2J D;  3AZH C;  1H3O B;  2FFF B;  4R8P C;  3H0R C;  1TZY B;  4YS3 A;  3V9R B;  5DNM B;  4ZBJ B;  3AZL C;  3WAA D;  5BT1 C;  5E5A D;  5F99 A;  1P3K C;  4H9P B;  1TZY D;  2BYK A;  4X23 B;  5DNM D;  1KX3 A;  3R45 A;  3B0C W;  3O62 A;  3B6G B;  5AV5 A;  1WWS A;  3LJA C;  3AZF A;  2NZD C;  5GXQ B;  3C1B C;  4WNN B;  3VH6 T;  5AV8 B;  3X1S B;  3KWQ B;  3O62 D;  3W98 A;  3KXB B;  5AV5 D;  3MGQ C;  3MGR C;  3AN2 A;  3AYW A;  5GXQ D;  1M1A A;  5B0Z A;  3AZF D;  3AZE B;  3A6N C;  4UUZ A;  5B2J C;  5AV8 D;  3X1S D;  2JE5 A;  3AFA B;  3KWQ D;  1M1A B;  4KGC B;  3KXB D;  1ID3 A;  2Y2I A;  2F8N K;  4JJN A;  4G92 C;  4AWL B;  3AV1 B;  5FUG B;  2YFW A;  3WAA C;  3AYW D;  3AZE D;  5E5A C;  1M1A D;  3AFA D;  4WU9 A;  4KGC D;  5DNN A;  4CSR B;  3NQU A;  5AVC A;  3X1V B;  1HQ3 B;  5B31 A;  3LEL A;  2JCH A;  1TZY C;  1P3P A;  5DNN B;  5DNM C;  4ZBJ C;  3AZN A;  3AV1 D;  4JJN D;  3UT9 A;  3KUY A;  1KX4 A;  4WU9 D;  4H9Q A;  2XD5 A;  5DNN D;  2YFV B;  5B40 B;  5AVC D;  1WWI A;  1ZLA B;  1N1J B;  4M6B A;  3O62 C;  4Z66 A;  5AV5 C;  4KHA A;  5GXQ C;  3KUY D;  3AZF C;  5G49 B;  5AV8 C;  3KWQ C;  3X1S C;  2ZY5 A;  3KXB C;  4J8V A;  2CV5 A;  1BH9 B;  4Z66 D;  3AZM A;  4KUD A;  2UWX A;  4J8U B;  3WTP B;  3AZE C;  3AYW C;  5B1M B;  1M1A C;  4KGC C;  1P3A B;  4H9N A;  5BO0 B;  3REI A;  4H9O A;  4AWL C;  4J8V D;  1P3M A;  3AV1 C;  4WZS B;  3B0D B;  1M18 A;  4JJN C;  4J8U D;  3W99 B;  5AVB A;  1B67 A;  1P3A D;  4KUD D;  3AZI A;  4WU9 C;  5DNN C;  4G91 C;  5AVC C;  4R8P A;  3REL A;  1P3M D;  1M18 D;  3WA9 B;  3C1C A;  2PYO B;  5AVB D;  1P3I A;  3EPJ A;  1KX5 A;  3KUY C;  5B32 A;  1P3B A;  3W96 A;  3X1T B;  4Z2M H;  3REL D;  4EO5 B;  2F2A C;  2PYO D;  2RVQ D;  2HIO B;  4Z66 C;  3C1C D;  1P3I D;  3X1T D;  2NZD A;  4NFT A;  5CPK B;  1KX5 D;  1P3B D;  3W96 D;  5KDM A;  1Q9C A;  4J8V C;  5B24 B;  3MGR A;  4J8U C;  5GT0 A;  1P3A C;  4KUD C;  2Y2J A;  4YM6 B;  4HGA B;  5B2I A;  3A6N A;  2HUE C;  3B0D C;  1P3L A;  1F66 A;  1P3M C;  3AZG A;  1M18 C;  4WU8 B;  5GT0 D;  1P3G B;  5JRG B;  5CPI B;  5AVB C;  5CPJ B;  1H3O A;  5B2I D;  1TZY A;  5GT3 B;  3V9R A;  1U35 B;  5BNV B;  5DNM A;  3REL C;  1P3L D;  1F66 D;  1P3G D;  2PYO C;  5JRG D;  2RVQ C;  3VH5 A;  3AZG D;  3UTB B;  1B6W A;  3C1C C;  4H9P A;  1P3I C;  4X23 A;  3X1T C;  1KX5 C;  5B32 C;  1P3B C;  3W96 C;  3B6G A;  3H0M C;  2BG1 A;  1KU5 A;  3MVD A;  2J8P A;  3MNN B;  5GXQ A;  3MVD B;  4X23 D;  5C3I C;  3F6T A;  4WNN A;  3X1S A;  5AV8 A;  3KWQ A;  3B6G D;  3KXB A;  3MGP B;  3AZJ B;  5B1L B;  4QLC B;  2FJ7 B;  5BS7 C;  3MVD D;  1P3F B;  3A1K A;  4HGA C;  5GT0 C;  3AZE A;  3AFA A;  4KGC A;  2IO5 B;  3AZJ D;  5B1L D;  5B2I C;  2F8N H;  1BH8 B;  4QLC D;  3AV1 A;  1Z2C B;  1P3L C;  2DQN C;  5FUG A;  4J8X B;  1P3F D;  1P3G C;  1F66 C;  5AY8 B;  5JRG C;  3AZG C;  4CSR A;  3X1V A;  1HQ3 A;  2VQR A;  3WKJ B;  4J8X D;  5AY8 D;  4NE3 A;  4Z2M G;  3LZ0 B;  5B40 A;  2YFV A;  1JFI B;  3X1V D;  1HQ3 D;  1ZLA A;  4X23 C;  1N1J A;  3REH B;  3B6G C;  2ARO B;  4CAY B;  1P34 B;  2XD1 A;  5CP6 B;  3AZK B;  2Y2P A;  1M19 A;  3MVD C;  2BYM B;  1ULY A;  2Y2H A;  5G49 A;  4Z5T B;  5B40 D;  3REH D;  1ZLA D;  1M19 B;  3AZJ C;  2ARO D;  5B1L C;  1BH9 A;  3VH6 W;  4QLC C;  5CP6 D;  1P3F C;  4J8U A;  4Z5T D;  3WTP A;  5B1M A;  1PZR A;  1R4V A;  1M19 D;  2IO5 C;  1P3A A;  3KFU G;  5BO0 A;  3X1U A;  3AFA C;  4XZQ B;  3LZ1 B;  4ZUX A;  3X1U B;  4J8X C;  3W99 A;  2NQB B;  2Y2O A;  5AY8 C;  4ZUX B;  5B33 B;  3WTP D;  5B1M D;  1TAF A;  4XZQ D;  3TU4 B;  3X1V C;  1HQ3 C;  3X1U D;  3REJ B;  3B0B A;  3REK A;  1TAF B;  5B31 G;  4XUJ B;  4ZUX D;  5B33 D;  3REK B;  3W99 D;  3FDD A;  5BNX B;  3WA9 A;  2PYO A;  3TU4 D;  2F8N B;  3REJ D;  4DQY B;  1BFM A;  5B40 C;  3X1T A;  3W97 B;  4XUJ D;  3REH C;  1ZLA C;  1A7W A;  3REK D;  3B6F B;  2ARO C;  4LD9 B;  5CP6 C;  2HIO A;  3WA9 D;  3WTP E;  4Z5T C;  5CPK A;  1M19 C;  5JA4 B;  3VH6 A;  2LY8 A;  5B24 A;  2F8N G;  2HIO D;  3AZH B;  5BS7 A;  4YM6 A;  3WTP C;  5CPK D;  5B1M C;  5GSU B;  4XZQ C;  3AZL B;  3IP4 C;  3X1U C;  1EQZ A;  1P3K B;  4ZUX C;  5B24 D;  3W99 C;  4WU8 A;  1EQZ B;  2ZY2 A;  1P3G A;  5GSU D;  3AV2 A;  5JRG A;  5CPI A;  4J8W A;  5AV6 B;  4H9S C;  3TU4 C;  4YM6 D;  5CPJ A;  3REJ C;  3AV2 B;  4H9R B;  5GT3 A;  4J8W B;  1U35 A;  4XUJ C;  5BNV A;  3P5J B;  3REK C;  3LJA B;  2ZM5 A;  1EQZ D;  1S32 A;  3UTA B;  2L5A A;  3C1B B;  5AV6 D;  3UTB A;  4WU8 D;  3WA9 C;  3AV2 D;  1S32 B;  2Y2N A;  5CPI D;  4J8W D;  5CPJ D;  3MGQ B;  5AV9 B;  3EG5 B;  5GT3 D;  1U35 D;  3UTA D;  4EO5 C;  1S32 D;  5B2J B;  3UTB D;  3MNN A;  2HIO C;  5AV9 D;  5CPK C;  3AZJ A;  3MGP A;  3WAA B;  5B1L A;  5E5A B;  4QLC A;  5B24 C;  2FJ7 A;  5B0Y B;  1P3F A;  3MNN D;  5GSU C;  2CWE A;  4YM6 C;  4YS3 B;  5CHL B;  1BH8 A;  3MGP D;  5B0Y D;  1EQZ C;  5F99 B;  4J8X A;  5AY8 A;  2FJ7 D;  5AV6 C;  4WU8 C;  2JSS A;  2BYK B;  4YS3 D;  3AV2 C;  5CPI C;  1KX3 B;  3R45 B;  4J8W C;  5CPJ C;  2G5I C;  3O62 B;  3WKJ A;  5AV5 B;  5F99 D;  1F1E A;  5GT3 C;  1U35 C;  3UTA C;  1P3O A;  2Y2G A;  3AZF B;  1S32 C;  3LZ0 A;  4NE6 A;  1P3O B;  4UPK A;  1KX3 D;  3UTB C;  1JFI A;  5AV9 C;  2Y2M A;  3REH A;  3W98 B;  3WKJ D;  3AN2 B;  3AYW B;  2ARO A;  4CAY A;  1P34 A;  1P3O D;  5B0Z B;  4WJ3 C;  5CP6 A;  3AZK A;  3LZ0 D;  4UUZ B;  2BYM A;  1W2E A;  4Z5T A;  3MNN C;  3W98 D;  1ID3 B;  4JJN B;  3AN2 D;  3EPK A;  5B0Z D;  4E44 A;  2YFW B;  3MGP C;  5B0Y C;  1P34 D;  4WU9 B;  3NQU B;  2Y2Q A;  3AZK D;  4G91 B;  5AVC B;  1ID3 D;  5B31 B;  3LEL B;  1AOI A;  2FJ7 C;  4YS3 C;  1P3P B;  4E45 A;  4XZQ A;  3AZN B;  1AOI B;  3LZ1 A;  3UT9 B;  3VH5 T;  5F99 C;  2NQB A;  3KUY B;  5B31 D;  3LEL D;  1KX4 B;  5B33 A;  4H9Q B;  1P3P D;  1KX3 C;  3AZN D;  1AOI D;  3TU4 A;  4H9S A;  3UT9 D;  3REJ A;  2ZY3 A;  4XUJ A;  4Z66 B;  3LZ1 D;  1KX4 D;  3WKJ C;  2NQB D;  5BNX A;  4KHA B;  1P3O C;  2F8N A;  3LZ0 C;  3W97 A;  3W98 C;  4J8V B;  2CV5 B;  1T3U A;  3EPL A;  3B6F A;  4NE5 A;  3AN2 C;  2ZY4 A;  3AZM B;  5B0Z C;  4LD9 A;  2Y2L A;  4KUD B;  4DRA A;  1P34 C;  3AZK C;  4H9N B;  4DRB A;  2F8N D;  2CV5 D;  2Y2K A;  3REI B;  2HUE B;  4H9O B;  1ID3 C;  3W97 D;  5JA4 A;  3AZM D;  1P3M B;  4WV4 B;  1M18 B;  3B6F D;  3MGS A;  4LD9 D;  5AVB B;  2RIQ A;  3AZI B;  3AZH A;  5B31 C;  3LEL C;  3MGS B;  3REI D;  3H0L C;  1P3P C;  3EPH A;  5GSU A;  3AZN C;  4R8P B;  3AZL A;  1AOI C;  3REL B;  3UT9 C;  3KSY A;  3VH5 W;  1P3K A;  3AZI D;  3LZ1 C;  1KX4 C;  3MGS D;  2NQB C;  3C1C B;  1P3I B;  1HTA A;  3AZH D;  1KX5 B;  5B32 B;  4R8P D;  1P3B B;  5B33 C;  5AV6 A;  3W96 B;  3A1I A;  3AZL D;  4H9R A;  3B0C T;  5BT1 D;  3LJA A;  1P3K D; 
#chains in the Genus database with same CATH homology
 5B32 D;  3UTA A;  3C1B A;  2NZD B;  5C3I B;  5KDM B;  2CV5 C;  3MGQ A;  3NQJ A;  5AV9 A;  3W97 C;  3AL0 C;  3AZM C;  2W8S A;  3NQJ B;  3LJA D;  3MGR B;  3B6F C;  2DF4 C;  5B32 G;  2NZD D;  5GT0 B;  5B2J A;  4LD9 C;  3C1B D;  3REI C;  5B2I B;  3A6N B;  3MGQ D;  3MGR D;  2G5H C;  1P3L B;  3WAA A;  1F66 B;  5E5A A;  4G92 B;  3AZG B;  3AZI C;  3MGS C;  5B0Y A;  3A6N D;  5B2J D;  3AZH C;  1H3O B;  2FFF B;  4R8P C;  3H0R C;  1TZY B;  4YS3 A;  3V9R B;  5DNM B;  4ZBJ B;  3AZL C;  3WAA D;  5BT1 C;  5E5A D;  5F99 A;  1P3K C;  4H9P B;  1TZY D;  2BYK A;  4X23 B;  5DNM D;  1KX3 A;  3R45 A;  3B0C W;  3O62 A;  3B6G B;  5AV5 A;  1WWS A;  3LJA C;  3AZF A;  2NZD C;  5GXQ B;  3C1B C;  4WNN B;  3VH6 T;  5AV8 B;  3X1S B;  3KWQ B;  3O62 D;  3W98 A;  3KXB B;  5AV5 D;  3MGQ C;  3MGR C;  3AN2 A;  3AYW A;  5GXQ D;  1M1A A;  5B0Z A;  3AZF D;  3AZE B;  3A6N C;  4UUZ A;  5B2J C;  5AV8 D;  3X1S D;  2JE5 A;  3AFA B;  3KWQ D;  1M1A B;  4KGC B;  3KXB D;  1ID3 A;  2Y2I A;  2F8N K;  4JJN A;  4G92 C;  4AWL B;  3AV1 B;  5FUG B;  2YFW A;  3WAA C;  3AYW D;  3AZE D;  5E5A C;  1M1A D;  3AFA D;  4WU9 A;  4KGC D;  5DNN A;  4CSR B;  3NQU A;  5AVC A;  3X1V B;  1HQ3 B;  5B31 A;  3LEL A;  2JCH A;  1TZY C;  1P3P A;  5DNN B;  5DNM C;  4ZBJ C;  3AZN A;  3AV1 D;  4JJN D;  3UT9 A;  3KUY A;  1KX4 A;  4WU9 D;  4H9Q A;  2XD5 A;  5DNN D;  2YFV B;  5B40 B;  5AVC D;  1WWI A;  1ZLA B;  1N1J B;  4M6B A;  3O62 C;  4Z66 A;  5AV5 C;  4KHA A;  5GXQ C;  3KUY D;  3AZF C;  5G49 B;  5AV8 C;  3KWQ C;  3X1S C;  2ZY5 A;  3KXB C;  4J8V A;  2CV5 A;  1BH9 B;  4Z66 D;  3AZM A;  4KUD A;  2UWX A;  4J8U B;  3WTP B;  3AZE C;  3AYW C;  5B1M B;  1M1A C;  4KGC C;  1P3A B;  4H9N A;  5BO0 B;  3REI A;  4H9O A;  4AWL C;  4J8V D;  1P3M A;  3AV1 C;  4WZS B;  3B0D B;  1M18 A;  4JJN C;  4J8U D;  3W99 B;  5AVB A;  1B67 A;  1P3A D;  4KUD D;  3AZI A;  4WU9 C;  5DNN C;  4G91 C;  5AVC C;  4R8P A;  3REL A;  1P3M D;  1M18 D;  3WA9 B;  3C1C A;  2PYO B;  5AVB D;  1P3I A;  3EPJ A;  1KX5 A;  3KUY C;  5B32 A;  1P3B A;  3W96 A;  3X1T B;  4Z2M H;  3REL D;  4EO5 B;  2F2A C;  2PYO D;  2RVQ D;  2HIO B;  4Z66 C;  3C1C D;  1P3I D;  3X1T D;  2NZD A;  4NFT A;  5CPK B;  1KX5 D;  1P3B D;  3W96 D;  5KDM A;  1Q9C A;  4J8V C;  5B24 B;  3MGR A;  4J8U C;  5GT0 A;  1P3A C;  4KUD C;  2Y2J A;  4YM6 B;  4HGA B;  5B2I A;  3A6N A;  2HUE C;  3B0D C;  1P3L A;  1F66 A;  1P3M C;  3AZG A;  1M18 C;  4WU8 B;  5GT0 D;  1P3G B;  5JRG B;  5CPI B;  5AVB C;  5CPJ B;  1H3O A;  5B2I D;  1TZY A;  5GT3 B;  3V9R A;  1U35 B;  5BNV B;  5DNM A;  3REL C;  1P3L D;  1F66 D;  1P3G D;  2PYO C;  5JRG D;  2RVQ C;  3VH5 A;  3AZG D;  3UTB B;  1B6W A;  3C1C C;  4H9P A;  1P3I C;  4X23 A;  3X1T C;  1KX5 C;  5B32 C;  1P3B C;  3W96 C;  3B6G A;  3H0M C;  2BG1 A;  1KU5 A;  3MVD A;  2J8P A;  3MNN B;  5GXQ A;  3MVD B;  4X23 D;  5C3I C;  3F6T A;  4WNN A;  3X1S A;  5AV8 A;  3KWQ A;  3B6G D;  3KXB A;  3MGP B;  3AZJ B;  5B1L B;  4QLC B;  2FJ7 B;  5BS7 C;  3MVD D;  1P3F B;  3A1K A;  4HGA C;  5GT0 C;  3AZE A;  3AFA A;  4KGC A;  2IO5 B;  3AZJ D;  5B1L D;  5B2I C;  2F8N H;  1BH8 B;  4QLC D;  3AV1 A;  1Z2C B;  1P3L C;  2DQN C;  5FUG A;  4J8X B;  1P3F D;  1P3G C;  1F66 C;  5AY8 B;  5JRG C;  3AZG C;  4CSR A;  3X1V A;  1HQ3 A;  2VQR A;  3WKJ B;  4J8X D;  5AY8 D;  4NE3 A;  4Z2M G;  3LZ0 B;  5B40 A;  2YFV A;  1JFI B;  3X1V D;  1HQ3 D;  1ZLA A;  4X23 C;  1N1J A;  3REH B;  3B6G C;  2ARO B;  4CAY B;  1P34 B;  2XD1 A;  5CP6 B;  3AZK B;  2Y2P A;  1M19 A;  3MVD C;  2BYM B;  1ULY A;  2Y2H A;  5G49 A;  4Z5T B;  5B40 D;  3REH D;  1ZLA D;  1M19 B;  3AZJ C;  2ARO D;  5B1L C;  1BH9 A;  3VH6 W;  4QLC C;  5CP6 D;  1P3F C;  4J8U A;  4Z5T D;  3WTP A;  5B1M A;  1PZR A;  1R4V A;  1M19 D;  2IO5 C;  1P3A A;  3KFU G;  5BO0 A;  3X1U A;  3AFA C;  4XZQ B;  3LZ1 B;  4ZUX A;  3X1U B;  4J8X C;  3W99 A;  2NQB B;  2Y2O A;  5AY8 C;  4ZUX B;  5B33 B;  3WTP D;  5B1M D;  1TAF A;  4XZQ D;  3TU4 B;  3X1V C;  1HQ3 C;  3X1U D;  3REJ B;  3B0B A;  3REK A;  1TAF B;  5B31 G;  4XUJ B;  4ZUX D;  5B33 D;  3REK B;  3W99 D;  3FDD A;  5BNX B;  3WA9 A;  2PYO A;  3TU4 D;  2F8N B;  3REJ D;  4DQY B;  1BFM A;  5B40 C;  3X1T A;  3W97 B;  4XUJ D;  3REH C;  1ZLA C;  1A7W A;  3REK D;  3B6F B;  2ARO C;  4LD9 B;  5CP6 C;  2HIO A;  3WA9 D;  3WTP E;  4Z5T C;  5CPK A;  1M19 C;  5JA4 B;  3VH6 A;  2LY8 A;  5B24 A;  2F8N G;  2HIO D;  3AZH B;  5BS7 A;  4YM6 A;  3WTP C;  5CPK D;  5B1M C;  5GSU B;  4XZQ C;  3AZL B;  3IP4 C;  3X1U C;  1EQZ A;  1P3K B;  4ZUX C;  5B24 D;  3W99 C;  4WU8 A;  1EQZ B;  2ZY2 A;  1P3G A;  5GSU D;  3AV2 A;  5JRG A;  5CPI A;  4J8W A;  5AV6 B;  4H9S C;  3TU4 C;  4YM6 D;  5CPJ A;  3REJ C;  3AV2 B;  4H9R B;  5GT3 A;  4J8W B;  1U35 A;  4XUJ C;  5BNV A;  3P5J B;  3REK C;  3LJA B;  2ZM5 A;  1EQZ D;  1S32 A;  3UTA B;  2L5A A;  3C1B B;  5AV6 D;  3UTB A;  4WU8 D;  3WA9 C;  3AV2 D;  1S32 B;  2Y2N A;  5CPI D;  4J8W D;  5CPJ D;  3MGQ B;  5AV9 B;  3EG5 B;  5GT3 D;  1U35 D;  3UTA D;  4EO5 C;  1S32 D;  5B2J B;  3UTB D;  3MNN A;  2HIO C;  5AV9 D;  5CPK C;  3AZJ A;  3MGP A;  3WAA B;  5B1L A;  5E5A B;  4QLC A;  5B24 C;  2FJ7 A;  5B0Y B;  1P3F A;  3MNN D;  5GSU C;  2CWE A;  4YM6 C;  4YS3 B;  5CHL B;  1BH8 A;  3MGP D;  5B0Y D;  1EQZ C;  5F99 B;  4J8X A;  5AY8 A;  2FJ7 D;  5AV6 C;  4WU8 C;  2JSS A;  2BYK B;  4YS3 D;  3AV2 C;  5CPI C;  1KX3 B;  3R45 B;  4J8W C;  5CPJ C;  2G5I C;  3O62 B;  3WKJ A;  5AV5 B;  5F99 D;  1F1E A;  5GT3 C;  1U35 C;  3UTA C;  1P3O A;  2Y2G A;  3AZF B;  1S32 C;  3LZ0 A;  4NE6 A;  1P3O B;  4UPK A;  1KX3 D;  3UTB C;  1JFI A;  5AV9 C;  2Y2M A;  3REH A;  3W98 B;  3WKJ D;  3AN2 B;  3AYW B;  2ARO A;  4CAY A;  1P34 A;  1P3O D;  5B0Z B;  4WJ3 C;  5CP6 A;  3AZK A;  3LZ0 D;  4UUZ B;  2BYM A;  1W2E A;  4Z5T A;  3MNN C;  3W98 D;  1ID3 B;  4JJN B;  3AN2 D;  3EPK A;  5B0Z D;  4E44 A;  2YFW B;  3MGP C;  5B0Y C;  1P34 D;  4WU9 B;  3NQU B;  2Y2Q A;  3AZK D;  4G91 B;  5AVC B;  1ID3 D;  5B31 B;  3LEL B;  1AOI A;  2FJ7 C;  4YS3 C;  1P3P B;  4E45 A;  4XZQ A;  3AZN B;  1AOI B;  3LZ1 A;  3UT9 B;  3VH5 T;  5F99 C;  2NQB A;  3KUY B;  5B31 D;  3LEL D;  1KX4 B;  5B33 A;  4H9Q B;  1P3P D;  1KX3 C;  3AZN D;  1AOI D;  3TU4 A;  4H9S A;  3UT9 D;  3REJ A;  2ZY3 A;  4XUJ A;  4Z66 B;  3LZ1 D;  1KX4 D;  3WKJ C;  2NQB D;  5BNX A;  4KHA B;  1P3O C;  2F8N A;  3LZ0 C;  3W97 A;  3W98 C;  4J8V B;  2CV5 B;  1T3U A;  3EPL A;  3B6F A;  4NE5 A;  3AN2 C;  2ZY4 A;  3AZM B;  5B0Z C;  4LD9 A;  2Y2L A;  4KUD B;  4DRA A;  1P34 C;  3AZK C;  4H9N B;  4DRB A;  2F8N D;  2CV5 D;  2Y2K A;  3REI B;  2HUE B;  4H9O B;  1ID3 C;  3W97 D;  5JA4 A;  3AZM D;  1P3M B;  4WV4 B;  1M18 B;  3B6F D;  3MGS A;  4LD9 D;  5AVB B;  2RIQ A;  3AZI B;  3AZH A;  5B31 C;  3LEL C;  3MGS B;  3REI D;  3H0L C;  1P3P C;  3EPH A;  5GSU A;  3AZN C;  4R8P B;  3AZL A;  1AOI C;  3REL B;  3UT9 C;  3KSY A;  3VH5 W;  1P3K A;  3AZI D;  3LZ1 C;  1KX4 C;  3MGS D;  2NQB C;  3C1C B;  1P3I B;  1HTA A;  3AZH D;  1KX5 B;  5B32 B;  4R8P D;  1P3B B;  5B33 C;  5AV6 A;  3W96 B;  3A1I A;  3AZL D;  4H9R A;  3B0C T;  5BT1 D;  3LJA A;  1P3K D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...