3LZ1B

Crystal structure of nucleosome core particle composed of the widom 601 dna sequence (orientation 2)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Crystal structures of nucleosome core particles containing the '601' strong positioning sequence
pubmed doi rcsb
source organism Xenopus laevis
total genus 26
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3lz1B00
3AV2C 4G91C 5B1MA 4QLCA 3REJA 1P3BC 5B40B 3LJAB 5AVBD 5KDMA 5B2IA 3AZLA 2L5AA 3C1CC 3W97B 1F66A 3RELA 5AV8A 2YFWB 1B6WA 4H9PB 1P3KA 1WWSA 4KUDC 3W98B 3UTBD 3AFAD 3AZND 5DNNC 4X23A 3REIA 3LELB 5BS7C 1TZYB 3AZMD 5B1MD 4QLCD 3REJD 1HQ3C 5B2JB 5AY8D 3MGPB 5B2ID 3AZLD 5CPIC 3MNNC 5AV5A 1P34D 3REKB 1F66D 2PYOB 5E5AD 1P3IA 3RELD 2HIOC 3W99A 1EQZB 2BYMB 1P3KD 5B1LB 4UUZA 3WAAD 1ULYA 4Z66B 1P3BA 3B6FB 3MGSA 1P3MA 1P3OB 3X1UC 5B32C 4LD9B 1P3PB 5F99A 3LZ0C 2LY8A 5AV8B 3REID 1ZLAC 1P3LC 4YS3C 5JRGA 1S32B 5B33C 2YFVB 4KUDA 3AZJC 1HTAA 4ZUXB 5BNXA 5AV5D 1KX5B 1P3ID 2NQBA 5G49A 1P3GA 5DNNA 3W99D 4J8WA 3MVDA 5BS7A 3AV2D 3UTAC 5CPKB 5B32G 1P3BD 4H9SA 3MGSD 1P3MD 3C1CD 4KGCB 3KUYB 3AZFA 3O62C 2IO5B 5B31B 4WU8A 2NZDA 4ZBJC 5AV6C 3WTPE 2F8NA 3W96B 5GXQC 3KXBB 3VH6W 3AV1C 5JRGD 2FJ7C 1M18C 4YM6A 1N1JA 4KUDD 3A6NA 3X1UA 5F99B 3AYWA 5BO0A 3MGRB 2NQBD 1P3GD 5DNND 3AZHB 4DRAA 2HUEC 5B0YB 4J8WD 5GT3C 3AN2C 3WKJC 3B6GA 1P3FC 4HGAC 5CP6C 1U35C 5CPID 3MNND 4XUJB 3AZFD 2NZDD 3WTPA 3TU4B 3LJAC 5B40C 1ID3A 2F8ND 1P3AB 4J8XB 4XZQB 3MVDB 3W97C 2CV5C 4J8UB 4YM6D 3AZEA 2RVQC 3A6ND 3X1UD 1H3OB 4J8VB 3AYWD 3LZ0D 4WU8B 3C1BA 5C3IC 3AZIC 1ZLAD 3AZGB 1P3LD 3X1VB 5B33D 4Z5TA 3MGQB 4Z2MH 3LELC 1TZYC 3KWQA 4R8PB 3LZ1B 3REHB 5B2JC 1ID3D 5GSUA 1BH8B 3REKC 2PYOC 3B6GB 3AZED 1JFIB 5DNMB 1EQZC 5B1LC 2JSSA 3O62D 3C1BD 1TAFB 3B6FC 5AVCB 3UTBA 3AV1D 4LD9C 2CV5A 1KX3C 1M18D 4Z5TD 3WA9C 4WU9A 3KWQD 1S32C 1KU5A 2AROA 3AZMA 5CPJB 1AOIB 4ZUXC 5AY8A 4NE5A 5GSUD 3UT9B 1P34A 1KX5C 3AZKB 1P3FD 5E5AA 5CP6D 5AV9A 5FUGA 5CPKC 4WNNA 3WAAA 3NQJA 3R45B 4JJNC 5AVBB 4H9QA 3KUYC 1M19B 2CV5D 2IO5C 1KX4A 3B0DB 3W96C 4WV4B 4WU9D 3KXBC 4G92B 2BYKB 2AROD 5B24A 3AZID 4H9OA 4NE6A 1M1AA 3X1TC 5BT1D 3AFAB 3AZNB 1KX3A 4M6BA 3MGRC 3AZHC 3WA9A 5AV9D 5B0YC 3AV2A 4NE3A 5B2JD 3AZMB 5B1MB 4QLCB 3REJB 5B31G 4WZSB 5AY8B 5KDMB 5B2IB 3AZLB 4XUJC 3C1CA 2CWEA 3REKD 1KX4D 2PYOD 3TU4C 1F66B 1P3AC 4J8XC 4XZQC 3RELB 1P3KB 4J8UC 5B24D 3WAAB 3NQJB 4JJNA 1M1AD 3B6FD 5JA4A 4J8VC 5B0ZC 1KX3D 3WA9D 3VH6T 3AZGC 4X23B 3REIB 4H9OB 3MGQC 1HQ3A 3X1SC 3X1TA 3VH5T 2F8NK 5CPIA 3MNNA 5AV5B 5GT0C 4R8PC 3LZ1C 3REHC 1KX5D 1P3IB 2HIOA 3W99B 1BH9A 4G91B 3AV2B 4UUZB 5DNMC 4JJND 1P3BB 3MGSB 1P3MB 4EO5B 5B32A 3KUYD 3LZ0A 1ZLAA 1P3LA 4YS3A 5JRGB 5B33A 1HQ3D 3X1TD 4KUDB 4CAYA 3AZJA 5BNXB 5B0ZA 5CPJC 1AOIC 2NQBB 2HIOD 5G49B 5DNNB 1A7WA 1P3GB 3NQUA 4J8WB 3UT9C 3B0CT 3UTAA 3AZKC 5B32D 4XUJD 4Z2MG 4H9NA 3O62A 3AZFB 2NZDB 5AV6A 3W98C 4J8XD 2F8NB 5AVBC 5GXQA 1M19C 3VH6A 3AV1A 4YS3D 3B0DC 2FJ7A 4KHAA 1R4VA 1M18A 4YM6B 1N1JB 3A6NB 3AZJD 3X1UB 3VH5A 5B0ZD 1BFMA 3AYWB 3LZ0B 5BO0B 3MGPC 3WKJA 3AN2A 4H9RA 5GT3A 3AFAC 3UTAD 3AZNC 5B33B 1P3FA 3X1SD 5CP6A 1U35A 5GT0D 4Z66C 5B1MC 3WTPB 4AWLB 5AV6D 1F1EA 5B40A 3LJAA 1ID3B 5B2IC 1P3OC 3AZLC 5GXQD 3W97A 1P3PC 1F66C 2FJ7D 3AZEB 5AV8C 2YFWA 4H9PA 3AZIA 3C1BB 4ZBJB 3W98A 3WKJD 3AN2D 5GT3D 3AV1B 1M18B 4Z5TB 4X23C 3REIC 1U35D 3LELA 1TZYA 3KWQB 5B2JA 5B40D 3LJAD 3MGPA 5GSUB 5AV5C 3W97D 4KGCC 4DRBA 3REKA 2PYOA 5B31C 1P3IC 1P3FB 2RVQD 3W99C 1EQZA 2BYMA 5B1LA 4Z66A 3W98D 3B6FA 3MGSC 1P3MC 1P3OA 4EO5C 4CSRA 1M19D 4LD9A 3UTBB 1P3PA 5F99C 2CV5B 3LELD 4WU9B 1TZYD 1S32A 5JRGC 2AROB 3AZIB 2YFVA 5C3IB 3MGPD 4ZUXA 1KX5A 1P34B 2NQBC 5E5AB 1P3GC 1EQZD 5AV9B 4J8WC 5FUGB 5B1LD 3MVDC 5CPKA 4WNNB 4Z66D 4H9SC 3V9RA 1P3OD 4KGCA 4H9QB 4LD9D 3KUYA 1P3PD 3AZFC 1KX4B 5B31A 4WU8C 2NZDC 3W96A 5AV8D 3KXBA 1S32D 3X1VC 5B24B 4YM6C 3A6NC 1M1AB 4NFTA 4ZUXD 4CSRB 3AYWC 5CHLB 3MGRA 1KX3B 3AZHA 4X23D 3WA9B 5B0YA 5BNVA 3B6GC 5CPKD 2F8NG 4KGCD 4XUJA 3C1CB 5B31D 3WTPC 4AWLC 3TU4A 1ID3C 3W96D 1P3AA 4J8XA 4XZQA 3KXBD 5AVCC 4J8UA 3AZEC 2F8NH 4JJNB 3V9RB 1H3OA 5F99D 5JA4B 4J8VA 3C1BC 3MGRD 3AZHD 3AZGA 5B0YD 3X1VA 4Z5TC 3MGQA 3X1SA 1HQ3B 3X1TB 3KWQC 5CPIB 3MNNB 1WWIA 3VH5W 5GT0A 4R8PA 3LZ1A 3REHA 3TU4D 4E45A 1P3AD 5GSUC 4XZQD 2HIOB 3MVDD 1BH8A 5BNVB 1BH9B 4J8UD 1JFIA 5DNMA 4G92C 5B32B 4J8VD 4WU8D 1TAFA 3AZGD 5AVCA 3UTBC 1ZLAB 1P3LB 3X1VD 4YS3B 3MGQD 4WU9C 4CAYB 3KSYA 3AZJB 2AROC 4R8PD 3LZ1D 3REHD 5B0ZB 3AZMC 4QLCC 3REJC 5CPJA 1AOIA 5AY8C 3NQUB 3UT9A 5BT1C 1P34C 3B6GD 4E44A 3UTAB 3AZKA 3B0CW 5E5AC 5DNMD 5AV9C 3X1SB 3RELC 1P3KC 1B67A 1Q9CA 3WAAC 4H9NB 5GT0B 3WTPD 3R45A 3O62B 5AV6B 5AVBA 5AVCD 5GXQB 1M19A 1KX4C 2FJ7B 4KHAB 3B0BA 2BYKA 5B24C 5CPJD 1M1AC 1AOID 2HUEB 3UT9D 3AN2B 4H9RB 5GT3B 3AFAA 3AZKD 3AZNA 3WKJB 4HGAB 5CP6B 1U35B
chains in the Genus database with same CATH superfamily
2Y2IA 3AV2C 4G91C 5B1MA 4QLCA 3REJA 1P3BC 5B40B 3LJAB 5AVBD 5KDMA 5B2IA 3AZLA 2Y2KA 2L5AA 2Y2NA 3C1CC 3W97B 1F66A 2XD1A 2W8SA 3RELA 5AV8A 2YFWB 1B6WA 4H9PB 1P3KA 1WWSA 4KUDC 3W98B 3AL0C 3UTBD 3AFAD 3AZND 5DNNC 4X23A 3REIA 3LELB 5BS7C 1TZYB 2ZY4A 3AZMD 5B1MD 4QLCD 3REJD 1HQ3C 5B2JB 5AY8D 3MGPB 5B2ID 3AZLD 3EPLA 5CPIC 3MNNC 5AV5A 1P34D 3REKB 1F66D 2PYOB 5E5AD 1P3IA 3RELD 2HIOC 3W99A 1EQZB 2BYMB 2JCHA 1P3KD 5B1LB 4UUZA 3WAAD 1ULYA 4Z66B 1P3BA 3B6FB 3MGSA 1P3MA 1P3OB 3X1UC 5B32C 2Y2JA 4LD9B 1P3PB 5F99A 3LZ0C 2LY8A 5AV8B 3REID 1ZLAC 1P3LC 4YS3C 5JRGA 1S32B 5B33C 2YFVB 4KUDA 2RIQA 1HTAA 4ZUXB 5BNXA 3AZJC 5AV5D 1KX5B 1P3ID 2NQBA 5G49A 1P3GA 5DNNA 3W99D 4J8WA 3MVDA 5BS7A 3AV2D 3UTAC 3P5JB 5CPKB 5B32G 1P3BD 4H9SA 3MGSD 1P3MD 2FFFB 3C1CD 4KGCB 3KUYB 3AZFA 3O62C 2IO5B 5B31B 4WU8A 2NZDA 4ZBJC 5AV6C 3WTPE 2F8NA 3W96B 5GXQC 3KXBB 3VH6W 3AV1C 5JRGD 2FJ7C 1M18C 4YM6A 1N1JA 4KUDD 3A6NA 2UWXA 3X1UA 5F99B 3AYWA 5BO0A 3MGRB 2NQBD 1P3GD 5DNND 3AZHB 4DRAA 2HUEC 5B0YB 4J8WD 5GT3C 3AN2C 3WKJC 3B6GA 1P3FC 4HGAC 5CP6C 2ZY5A 1U35C 5CPID 3MNND 4XUJB 3AZFD 2NZDD 3WTPA 3TU4B 3LJAC 5B40C 1ID3A 2F8ND 3A1KA 1P3AB 4J8XB 4XZQB 3MVDB 3W97C 2CV5C 4J8UB 4YM6D 3AZEA 2RVQC 3A6ND 3X1UD 2Y2LA 1H3OB 4J8VB 3AYWD 3LZ0D 4WU8B 3C1BA 5C3IC 2DF4C 3AZIC 1ZLAD 3AZGB 1P3LD 3X1VB 5B33D 4Z5TA 3MGQB 4Z2MH 3KFUG 3LELC 1TZYC 3KWQA 2Y2HA 4R8PB 3LZ1B 3REHB 5B2JC 1ID3D 5GSUA 1BH8B 3REKC 2PYOC 3B6GB 3AZED 1JFIB 5DNMB 1EQZC 5B1LC 2JSSA 3O62D 3C1BD 1TAFB 3B6FC 5AVCB 3UTBA 3AV1D 2Y2OA 4LD9C 2CV5A 1KX3C 1M18D 4Z5TD 2F2AC 3WA9C 1W2EA 4WU9A 3KWQD 3EG5B 1S32C 1KU5A 2AROA 3AZMA 5CPJB 1AOIB 4ZUXC 5AY8A 4NE5A 5GSUD 3UT9B 1P34A 1KX5C 3AZKB 1P3FD 5E5AA 5CP6D 4UPKA 5AV9A 2Y2PA 5FUGA 3EPHA 4DQYB 5CPKC 4WNNA 3WAAA 3NQJA 3R45B 4JJNC 5AVBB 3IP4C 4H9QA 3KUYC 1M19B 2CV5D 2IO5C 1KX4A 3B0DB 3W96C 4WV4B 4WU9D 3KXBC 4G92B 2BYKB 2AROD 5B24A 3AZID 4H9OA 4NE6A 1M1AA 3X1TC 1T3UA 4WJ3C 5BT1D 3AFAB 3AZNB 1KX3A 4M6BA 3MGRC 3AZHC 3WA9A 5AV9D 2BG1A 5B0YC 3AV2A 4NE3A 5B2JD 3AZMB 5B1MB 4QLCB 3REJB 2Y2MA 5B31G 4WZSB 5AY8B 5KDMB 5B2IB 3AZLB 2ZY2A 4XUJC 3C1CA 2CWEA 3REKD 1KX4D 2PYOD 3TU4C 1F66B 1P3AC 4J8XC 4XZQC 3RELB 1P3KB 4J8UC 5B24D 3WAAB 3NQJB 4JJNA 1M1AD 3B6FD 5JA4A 4J8VC 5B0ZC 1KX3D 3WA9D 3VH6T 3AZGC 4X23B 3REIB 4H9OB 3MGQC 2ZM5A 1HQ3A 3X1SC 3X1TA 3VH5T 2F8NK 5CPIA 3MNNA 5AV5B 5GT0C 4R8PC 3LZ1C 3REHC 1KX5D 1P3IB 2HIOA 3W99B 1BH9A 4G91B 3AV2B 4UUZB 5DNMC 4JJND 1P3BB 3MGSB 1P3MB 4EO5B 5B32A 3KUYD 3LZ0A 1ZLAA 1P3LA 4YS3A 5JRGB 5B33A 1HQ3D 3X1TD 4KUDB 4CAYA 3AZJA 5BNXB 5B0ZA 5CPJC 1AOIC 2NQBB 2HIOD 5G49B 5DNNB 1A7WA 1P3GB 3NQUA 4J8WB 3UT9C 3B0CT 3UTAA 3AZKC 5B32D 4XUJD 4Z2MG 4H9NA 3O62A 3AZFB 2NZDB 5AV6A 3W98C 4J8XD 2F8NB 5AVBC 5GXQA 1M19C 3VH6A 3AV1A 4YS3D 3B0DC 2FJ7A 4KHAA 1R4VA 1M18A 4YM6B 1N1JB 3A6NB 1Z2CB 3H0MC 3AZJD 3X1UB 3VH5A 5B0ZD 2Y2GA 3AYWB 3LZ0B 1BFMA 5BO0B 3MGPC 3WKJA 3AN2A 4H9RA 5GT3A 3AFAC 3UTAD 3AZNC 3A1IA 5B33B 1P3FA 3X1SD 5CP6A 1U35A 2JE5A 5GT0D 4Z66C 5B1MC 2XD5A 3WTPB 4AWLB 5AV6D 1F1EA 5B40A 3LJAA 1ID3B 5B2IC 1P3OC 3AZLC 5GXQD 3W97A 1P3PC 1F66C 2FJ7D 3AZEB 5AV8C 2YFWA 4H9PA 3AZIA 3C1BB 4ZBJB 3W98A 3H0LC 3WKJD 3AN2D 5GT3D 3AV1B 1M18B 4Z5TB 4X23C 3REIC 1U35D 3LELA 1TZYA 3KWQB 5B2JA 5B40D 3LJAD 3MGPA 5GSUB 5AV5C 3W97D 4KGCC 4DRBA 3REKA 2PYOA 5B31C 1P3IC 1P3FB 2RVQD 3W99C 2Y2QA 2BYMA 1EQZA 5B1LA 4Z66A 3W98D 3B6FA 3MGSC 1P3MC 1P3OA 4EO5C 4CSRA 1M19D 4LD9A 3UTBB 1P3PA 5F99C 2CV5B 3LELD 4WU9B 1TZYD 1S32A 5JRGC 2AROB 3AZIB 2YFVA 5C3IB 3MGPD 4ZUXA 1KX5A 3EPJA 1P34B 2NQBC 5E5AB 1P3GC 1EQZD 5AV9B 4J8WC 5FUGB 5B1LD 3MVDC 5CPKA 4WNNB 4Z66D 4H9SC 3V9RA 1P3OD 2G5HC 4KGCA 4H9QB 4LD9D 3KUYA 1P3PD 3AZFC 1KX4B 5B31A 4WU8C 2NZDC 3H0RC 3W96A 5AV8D 3KXBA 1S32D 3X1VC 5B24B 4YM6C 3A6NC 1M1AB 4NFTA 4ZUXD 4CSRB 3AYWC 5CHLB 3MGRA 1KX3B 3AZHA 4X23D 3WA9B 1PZRA 5B0YA 5BNVA 3B6GC 5CPKD 2F8NG 4KGCD 2ZY3A 4XUJA 3C1CB 5B31D 3WTPC 3EPKA 4AWLC 3TU4A 1ID3C 3W96D 1P3AA 4J8XA 4XZQA 3KXBD 5AVCC 4J8UA 3AZEC 2F8NH 4JJNB 3V9RB 1H3OA 5F99D 5JA4B 4J8VA 3C1BC 3MGRD 3AZHD 3AZGA 5B0YD 3X1VA 4Z5TC 3MGQA 3X1SA 1HQ3B 3F6TA 3FDDA 3X1TB 3KWQC 2VQRA 5CPIB 3MNNB 1WWIA 3VH5W 5GT0A 4R8PA 3LZ1A 3REHA 3TU4D 4E45A 1P3AD 5GSUC 4XZQD 2HIOB 3MVDD 1BH8A 5BNVB 1BH9B 4J8UD 1JFIA 5DNMA 4G92C 5B32B 4J8VD 4WU8D 1TAFA 3AZGD 2G5IC 5AVCA 3UTBC 1ZLAB 1P3LB 3X1VD 4YS3B 3MGQD 4WU9C 4CAYB 3KSYA 3AZJB 2AROC 4R8PD 3LZ1D 3REHD 5B0ZB 3AZMC 4QLCC 3REJC 5CPJA 2DQNC 1AOIA 5AY8C 3NQUB 3UT9A 5BT1C 1P34C 3B6GD 4E44A 3UTAB 3AZKA 3B0CW 5E5AC 5DNMD 5AV9C 3X1SB 3RELC 1P3KC 1B67A 1Q9CA 3WAAC 4H9NB 5GT0B 3WTPD 3R45A 3O62B 5AV6B 5AVBA 5AVCD 5GXQB 1M19A 1KX4C 2J8PA 2FJ7B 4KHAB 3B0BA 2BYKA 5B24C 5CPJD 1M1AC 1AOID 2HUEB 3UT9D 3AN2B 4H9RB 5GT3B 3AFAA 3AZKD 3AZNA 3WKJB 4HGAB 5CP6B 1U35B
chains in the Genus database with same CATH topology
2Y2IA 3AV2C 4G91C 5B1MA 4QLCA 3REJA 1P3BC 5B40B 3LJAB 5AVBD 5KDMA 5B2IA 3AZLA 2Y2KA 2L5AA 2Y2NA 3C1CC 3W97B 1F66A 2XD1A 2W8SA 3RELA 5AV8A 2YFWB 1B6WA 4H9PB 1P3KA 1WWSA 4KUDC 3W98B 3AL0C 3UTBD 3AFAD 3AZND 5DNNC 4X23A 3REIA 3LELB 5BS7C 1TZYB 2ZY4A 3AZMD 5B1MD 4QLCD 3REJD 1HQ3C 5B2JB 5AY8D 3MGPB 5B2ID 3AZLD 3EPLA 5CPIC 3MNNC 5AV5A 1P34D 3REKB 1F66D 2PYOB 5E5AD 1P3IA 3RELD 2HIOC 3W99A 1EQZB 2BYMB 2JCHA 1P3KD 5B1LB 4UUZA 3WAAD 1ULYA 4Z66B 1P3BA 3B6FB 3MGSA 1P3MA 1P3OB 3X1UC 5B32C 2Y2JA 4LD9B 1P3PB 5F99A 3LZ0C 2LY8A 5AV8B 3REID 1ZLAC 1P3LC 4YS3C 5JRGA 1S32B 5B33C 2YFVB 4KUDA 2RIQA 1HTAA 4ZUXB 5BNXA 3AZJC 5AV5D 1KX5B 1P3ID 2NQBA 5G49A 1P3GA 5DNNA 3W99D 4J8WA 3MVDA 5BS7A 3AV2D 3UTAC 3P5JB 5CPKB 5B32G 1P3BD 4H9SA 3MGSD 1P3MD 2FFFB 3C1CD 4KGCB 3KUYB 3AZFA 3O62C 2IO5B 5B31B 4WU8A 2NZDA 4ZBJC 5AV6C 3WTPE 2F8NA 3W96B 5GXQC 3KXBB 3VH6W 3AV1C 5JRGD 2FJ7C 1M18C 4YM6A 1N1JA 4KUDD 3A6NA 2UWXA 3X1UA 5F99B 3AYWA 5BO0A 3MGRB 2NQBD 1P3GD 5DNND 3AZHB 4DRAA 2HUEC 5B0YB 4J8WD 5GT3C 3AN2C 3WKJC 3B6GA 1P3FC 4HGAC 5CP6C 2ZY5A 1U35C 5CPID 3MNND 4XUJB 3AZFD 2NZDD 3WTPA 3TU4B 3LJAC 5B40C 1ID3A 2F8ND 3A1KA 1P3AB 4J8XB 4XZQB 3MVDB 3W97C 2CV5C 4J8UB 4YM6D 3AZEA 2RVQC 3A6ND 3X1UD 2Y2LA 1H3OB 4J8VB 3AYWD 3LZ0D 4WU8B 3C1BA 5C3IC 2DF4C 3AZIC 1ZLAD 3AZGB 1P3LD 3X1VB 5B33D 4Z5TA 3MGQB 4Z2MH 3KFUG 3LELC 1TZYC 3KWQA 2Y2HA 4R8PB 3LZ1B 3REHB 5B2JC 1ID3D 5GSUA 1BH8B 3REKC 2PYOC 3B6GB 3AZED 1JFIB 5DNMB 1EQZC 5B1LC 2JSSA 3O62D 3C1BD 1TAFB 3B6FC 5AVCB 3UTBA 3AV1D 2Y2OA 4LD9C 2CV5A 1KX3C 1M18D 4Z5TD 2F2AC 3WA9C 1W2EA 4WU9A 3KWQD 3EG5B 1S32C 1KU5A 2AROA 3AZMA 5CPJB 1AOIB 4ZUXC 5AY8A 4NE5A 5GSUD 3UT9B 1P34A 1KX5C 3AZKB 1P3FD 5E5AA 5CP6D 4UPKA 5AV9A 2Y2PA 5FUGA 3EPHA 4DQYB 5CPKC 4WNNA 3WAAA 3NQJA 3R45B 4JJNC 5AVBB 3IP4C 4H9QA 3KUYC 1M19B 2CV5D 2IO5C 1KX4A 3B0DB 3W96C 4WV4B 4WU9D 3KXBC 4G92B 2BYKB 2AROD 5B24A 3AZID 4H9OA 4NE6A 1M1AA 3X1TC 1T3UA 4WJ3C 5BT1D 3AFAB 3AZNB 1KX3A 4M6BA 3MGRC 3AZHC 3WA9A 5AV9D 2BG1A 5B0YC 3AV2A 4NE3A 5B2JD 3AZMB 5B1MB 4QLCB 3REJB 2Y2MA 5B31G 4WZSB 5AY8B 5KDMB 5B2IB 3AZLB 2ZY2A 4XUJC 3C1CA 2CWEA 3REKD 1KX4D 2PYOD 3TU4C 1F66B 1P3AC 4J8XC 4XZQC 3RELB 1P3KB 4J8UC 5B24D 3WAAB 3NQJB 4JJNA 1M1AD 3B6FD 5JA4A 4J8VC 5B0ZC 1KX3D 3WA9D 3VH6T 3AZGC 4X23B 3REIB 4H9OB 3MGQC 2ZM5A 1HQ3A 3X1SC 3X1TA 3VH5T 2F8NK 5CPIA 3MNNA 5AV5B 5GT0C 4R8PC 3LZ1C 3REHC 1KX5D 1P3IB 2HIOA 3W99B 1BH9A 4G91B 3AV2B 4UUZB 5DNMC 4JJND 1P3BB 3MGSB 1P3MB 4EO5B 5B32A 3KUYD 3LZ0A 1ZLAA 1P3LA 4YS3A 5JRGB 5B33A 1HQ3D 3X1TD 4KUDB 4CAYA 3AZJA 5BNXB 5B0ZA 5CPJC 1AOIC 2NQBB 2HIOD 5G49B 5DNNB 1A7WA 1P3GB 3NQUA 4J8WB 3UT9C 3B0CT 3UTAA 3AZKC 5B32D 4XUJD 4Z2MG 4H9NA 3O62A 3AZFB 2NZDB 5AV6A 3W98C 4J8XD 2F8NB 5AVBC 5GXQA 1M19C 3VH6A 3AV1A 4YS3D 3B0DC 2FJ7A 4KHAA 1R4VA 1M18A 4YM6B 1N1JB 3A6NB 1Z2CB 3H0MC 3AZJD 3X1UB 3VH5A 5B0ZD 2Y2GA 3AYWB 3LZ0B 1BFMA 5BO0B 3MGPC 3WKJA 3AN2A 4H9RA 5GT3A 3AFAC 3UTAD 3AZNC 3A1IA 5B33B 1P3FA 3X1SD 5CP6A 1U35A 2JE5A 5GT0D 4Z66C 5B1MC 2XD5A 3WTPB 4AWLB 5AV6D 1F1EA 5B40A 3LJAA 1ID3B 5B2IC 1P3OC 3AZLC 5GXQD 3W97A 1P3PC 1F66C 2FJ7D 3AZEB 5AV8C 2YFWA 4H9PA 3AZIA 3C1BB 4ZBJB 3W98A 3H0LC 3WKJD 3AN2D 5GT3D 3AV1B 1M18B 4Z5TB 4X23C 3REIC 1U35D 3LELA 1TZYA 3KWQB 5B2JA 5B40D 3LJAD 3MGPA 5GSUB 5AV5C 3W97D 4KGCC 4DRBA 3REKA 2PYOA 5B31C 1P3IC 1P3FB 2RVQD 3W99C 2Y2QA 2BYMA 1EQZA 5B1LA 4Z66A 3W98D 3B6FA 3MGSC 1P3MC 1P3OA 4EO5C 4CSRA 1M19D 4LD9A 3UTBB 1P3PA 5F99C 2CV5B 3LELD 4WU9B 1TZYD 1S32A 5JRGC 2AROB 3AZIB 2YFVA 5C3IB 3MGPD 4ZUXA 1KX5A 3EPJA 1P34B 2NQBC 5E5AB 1P3GC 1EQZD 5AV9B 4J8WC 5FUGB 5B1LD 3MVDC 5CPKA 4WNNB 4Z66D 4H9SC 3V9RA 1P3OD 2G5HC 4KGCA 4H9QB 4LD9D 3KUYA 1P3PD 3AZFC 1KX4B 5B31A 4WU8C 2NZDC 3H0RC 3W96A 5AV8D 3KXBA 1S32D 3X1VC 5B24B 4YM6C 3A6NC 1M1AB 4NFTA 4ZUXD 4CSRB 3AYWC 5CHLB 3MGRA 1KX3B 3AZHA 4X23D 3WA9B 1PZRA 5B0YA 5BNVA 3B6GC 5CPKD 2F8NG 4KGCD 2ZY3A 4XUJA 3C1CB 5B31D 3WTPC 3EPKA 4AWLC 3TU4A 1ID3C 3W96D 1P3AA 4J8XA 4XZQA 3KXBD 5AVCC 4J8UA 3AZEC 2F8NH 4JJNB 3V9RB 1H3OA 5F99D 5JA4B 4J8VA 3C1BC 3MGRD 3AZHD 3AZGA 5B0YD 3X1VA 4Z5TC 3MGQA 3X1SA 1HQ3B 3F6TA 3FDDA 3X1TB 3KWQC 2VQRA 5CPIB 3MNNB 1WWIA 3VH5W 5GT0A 4R8PA 3LZ1A 3REHA 3TU4D 4E45A 1P3AD 5GSUC 4XZQD 2HIOB 3MVDD 1BH8A 5BNVB 1BH9B 4J8UD 1JFIA 5DNMA 4G92C 5B32B 4J8VD 4WU8D 1TAFA 3AZGD 2G5IC 5AVCA 3UTBC 1ZLAB 1P3LB 3X1VD 4YS3B 3MGQD 4WU9C 4CAYB 3KSYA 3AZJB 2AROC 4R8PD 3LZ1D 3REHD 5B0ZB 3AZMC 4QLCC 3REJC 5CPJA 2DQNC 1AOIA 5AY8C 3NQUB 3UT9A 5BT1C 1P34C 3B6GD 4E44A 3UTAB 3AZKA 3B0CW 5E5AC 5DNMD 5AV9C 3X1SB 3RELC 1P3KC 1B67A 1Q9CA 3WAAC 4H9NB 5GT0B 3WTPD 3R45A 3O62B 5AV6B 5AVBA 5AVCD 5GXQB 1M19A 1KX4C 2J8PA 2FJ7B 4KHAB 3B0BA 2BYKA 5B24C 5CPJD 1M1AC 1AOID 2HUEB 3UT9D 3AN2B 4H9RB 5GT3B 3AFAA 3AZKD 3AZNA 3WKJB 4HGAB 5CP6B 1U35B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV2 C;  4G91 C;  5B1M A;  4QLC A;  3REJ A;  1P3B C;  5B40 B;  3LJA B;  5AVB D;  5KDM A;  5B2I A;  3AZL A;  2L5A A;  3C1C C;  3W97 B;  1F66 A;  3REL A;  5AV8 A;  2YFW B;  1B6W A;  4H9P B;  1P3K A;  1WWS A;  4KUD C;  3W98 B;  3UTB D;  3AFA D;  3AZN D;  5DNN C;  4X23 A;  3REI A;  3LEL B;  5BS7 C;  1TZY B;  3AZM D;  5B1M D;  4QLC D;  3REJ D;  1HQ3 C;  5B2J B;  5AY8 D;  3MGP B;  5B2I D;  3AZL D;  5CPI C;  3MNN C;  5AV5 A;  1P34 D;  3REK B;  1F66 D;  2PYO B;  5E5A D;  1P3I A;  3REL D;  2HIO C;  3W99 A;  1EQZ B;  2BYM B;  1P3K D;  5B1L B;  4UUZ A;  3WAA D;  1ULY A;  4Z66 B;  1P3B A;  3B6F B;  3MGS A;  1P3M A;  1P3O B;  3X1U C;  5B32 C;  4LD9 B;  1P3P B;  5F99 A;  3LZ0 C;  2LY8 A;  5AV8 B;  3REI D;  1ZLA C;  1P3L C;  4YS3 C;  5JRG A;  1S32 B;  5B33 C;  2YFV B;  4KUD A;  3AZJ C;  1HTA A;  4ZUX B;  5BNX A;  5AV5 D;  1KX5 B;  1P3I D;  2NQB A;  5G49 A;  1P3G A;  5DNN A;  3W99 D;  4J8W A;  3MVD A;  5BS7 A;  3AV2 D;  3UTA C;  5CPK B;  5B32 G;  1P3B D;  4H9S A;  3MGS D;  1P3M D;  3C1C D;  4KGC B;  3KUY B;  3AZF A;  3O62 C;  2IO5 B;  5B31 B;  4WU8 A;  2NZD A;  4ZBJ C;  5AV6 C;  3WTP E;  2F8N A;  3W96 B;  5GXQ C;  3KXB B;  3VH6 W;  3AV1 C;  5JRG D;  2FJ7 C;  1M18 C;  4YM6 A;  1N1J A;  4KUD D;  3A6N A;  3X1U A;  5F99 B;  3AYW A;  5BO0 A;  3MGR B;  2NQB D;  1P3G D;  5DNN D;  3AZH B;  4DRA A;  2HUE C;  5B0Y B;  4J8W D;  5GT3 C;  3AN2 C;  3WKJ C;  3B6G A;  1P3F C;  4HGA C;  5CP6 C;  1U35 C;  5CPI D;  3MNN D;  4XUJ B;  3AZF D;  2NZD D;  3WTP A;  3TU4 B;  3LJA C;  5B40 C;  1ID3 A;  2F8N D;  1P3A B;  4J8X B;  4XZQ B;  3MVD B;  3W97 C;  2CV5 C;  4J8U B;  4YM6 D;  3AZE A;  2RVQ C;  3A6N D;  3X1U D;  1H3O B;  4J8V B;  3AYW D;  3LZ0 D;  4WU8 B;  3C1B A;  5C3I C;  3AZI C;  1ZLA D;  3AZG B;  1P3L D;  3X1V B;  5B33 D;  4Z5T A;  3MGQ B;  4Z2M H;  3LEL C;  1TZY C;  3KWQ A;  4R8P B;  3LZ1 B;  3REH B;  5B2J C;  1ID3 D;  5GSU A;  1BH8 B;  3REK C;  2PYO C;  3B6G B;  3AZE D;  1JFI B;  5DNM B;  1EQZ C;  5B1L C;  2JSS A;  3O62 D;  3C1B D;  1TAF B;  3B6F C;  5AVC B;  3UTB A;  3AV1 D;  4LD9 C;  2CV5 A;  1KX3 C;  1M18 D;  4Z5T D;  3WA9 C;  4WU9 A;  3KWQ D;  1S32 C;  1KU5 A;  2ARO A;  3AZM A;  5CPJ B;  1AOI B;  4ZUX C;  5AY8 A;  4NE5 A;  5GSU D;  3UT9 B;  1P34 A;  1KX5 C;  3AZK B;  1P3F D;  5E5A A;  5CP6 D;  5AV9 A;  5FUG A;  5CPK C;  4WNN A;  3WAA A;  3NQJ A;  3R45 B;  4JJN C;  5AVB B;  4H9Q A;  3KUY C;  1M19 B;  2CV5 D;  2IO5 C;  1KX4 A;  3B0D B;  3W96 C;  4WV4 B;  4WU9 D;  3KXB C;  4G92 B;  2BYK B;  2ARO D;  5B24 A;  3AZI D;  4H9O A;  4NE6 A;  1M1A A;  3X1T C;  5BT1 D;  3AFA B;  3AZN B;  1KX3 A;  4M6B A;  3MGR C;  3AZH C;  3WA9 A;  5AV9 D;  5B0Y C;  3AV2 A;  4NE3 A;  5B2J D;  3AZM B;  5B1M B;  4QLC B;  3REJ B;  5B31 G;  4WZS B;  5AY8 B;  5KDM B;  5B2I B;  3AZL B;  4XUJ C;  3C1C A;  2CWE A;  3REK D;  1KX4 D;  2PYO D;  3TU4 C;  1F66 B;  1P3A C;  4J8X C;  4XZQ C;  3REL B;  1P3K B;  4J8U C;  5B24 D;  3WAA B;  3NQJ B;  4JJN A;  1M1A D;  3B6F D;  5JA4 A;  4J8V C;  5B0Z C;  1KX3 D;  3WA9 D;  3VH6 T;  3AZG C;  4X23 B;  3REI B;  4H9O B;  3MGQ C;  1HQ3 A;  3X1S C;  3X1T A;  3VH5 T;  2F8N K;  5CPI A;  3MNN A;  5AV5 B;  5GT0 C;  4R8P C;  3LZ1 C;  3REH C;  1KX5 D;  1P3I B;  2HIO A;  3W99 B;  1BH9 A;  4G91 B;  3AV2 B;  4UUZ B;  5DNM C;  4JJN D;  1P3B B;  3MGS B;  1P3M B;  4EO5 B;  5B32 A;  3KUY D;  3LZ0 A;  1ZLA A;  1P3L A;  4YS3 A;  5JRG B;  5B33 A;  1HQ3 D;  3X1T D;  4KUD B;  4CAY A;  3AZJ A;  5BNX B;  5B0Z A;  5CPJ C;  1AOI C;  2NQB B;  2HIO D;  5G49 B;  5DNN B;  1A7W A;  1P3G B;  3NQU A;  4J8W B;  3UT9 C;  3B0C T;  3UTA A;  3AZK C;  5B32 D;  4XUJ D;  4Z2M G;  4H9N A;  3O62 A;  3AZF B;  2NZD B;  5AV6 A;  3W98 C;  4J8X D;  2F8N B;  5AVB C;  5GXQ A;  1M19 C;  3VH6 A;  3AV1 A;  4YS3 D;  3B0D C;  2FJ7 A;  4KHA A;  1R4V A;  1M18 A;  4YM6 B;  1N1J B;  3A6N B;  3AZJ D;  3X1U B;  3VH5 A;  5B0Z D;  1BFM A;  3AYW B;  3LZ0 B;  5BO0 B;  3MGP C;  3WKJ A;  3AN2 A;  4H9R A;  5GT3 A;  3AFA C;  3UTA D;  3AZN C;  5B33 B;  1P3F A;  3X1S D;  5CP6 A;  1U35 A;  5GT0 D;  4Z66 C;  5B1M C;  3WTP B;  4AWL B;  5AV6 D;  1F1E A;  5B40 A;  3LJA A;  1ID3 B;  5B2I C;  1P3O C;  3AZL C;  5GXQ D;  3W97 A;  1P3P C;  1F66 C;  2FJ7 D;  3AZE B;  5AV8 C;  2YFW A;  4H9P A;  3AZI A;  3C1B B;  4ZBJ B;  3W98 A;  3WKJ D;  3AN2 D;  5GT3 D;  3AV1 B;  1M18 B;  4Z5T B;  4X23 C;  3REI C;  1U35 D;  3LEL A;  1TZY A;  3KWQ B;  5B2J A;  5B40 D;  3LJA D;  3MGP A;  5GSU B;  5AV5 C;  3W97 D;  4KGC C;  4DRB A;  3REK A;  2PYO A;  5B31 C;  1P3I C;  1P3F B;  2RVQ D;  3W99 C;  1EQZ A;  2BYM A;  5B1L A;  4Z66 A;  3W98 D;  3B6F A;  3MGS C;  1P3M C;  1P3O A;  4EO5 C;  4CSR A;  1M19 D;  4LD9 A;  3UTB B;  1P3P A;  5F99 C;  2CV5 B;  3LEL D;  4WU9 B;  1TZY D;  1S32 A;  5JRG C;  2ARO B;  3AZI B;  2YFV A;  5C3I B;  3MGP D;  4ZUX A;  1KX5 A;  1P34 B;  2NQB C;  5E5A B;  1P3G C;  1EQZ D;  5AV9 B;  4J8W C;  5FUG B;  5B1L D;  3MVD C;  5CPK A;  4WNN B;  4Z66 D;  4H9S C;  3V9R A;  1P3O D;  4KGC A;  4H9Q B;  4LD9 D;  3KUY A;  1P3P D;  3AZF C;  1KX4 B;  5B31 A;  4WU8 C;  2NZD C;  3W96 A;  5AV8 D;  3KXB A;  1S32 D;  3X1V C;  5B24 B;  4YM6 C;  3A6N C;  1M1A B;  4NFT A;  4ZUX D;  4CSR B;  3AYW C;  5CHL B;  3MGR A;  1KX3 B;  3AZH A;  4X23 D;  3WA9 B;  5B0Y A;  5BNV A;  3B6G C;  5CPK D;  2F8N G;  4KGC D;  4XUJ A;  3C1C B;  5B31 D;  3WTP C;  4AWL C;  3TU4 A;  1ID3 C;  3W96 D;  1P3A A;  4J8X A;  4XZQ A;  3KXB D;  5AVC C;  4J8U A;  3AZE C;  2F8N H;  4JJN B;  3V9R B;  1H3O A;  5F99 D;  5JA4 B;  4J8V A;  3C1B C;  3MGR D;  3AZH D;  3AZG A;  5B0Y D;  3X1V A;  4Z5T C;  3MGQ A;  3X1S A;  1HQ3 B;  3X1T B;  3KWQ C;  5CPI B;  3MNN B;  1WWI A;  3VH5 W;  5GT0 A;  4R8P A;  3LZ1 A;  3REH A;  3TU4 D;  4E45 A;  1P3A D;  5GSU C;  4XZQ D;  2HIO B;  3MVD D;  1BH8 A;  5BNV B;  1BH9 B;  4J8U D;  1JFI A;  5DNM A;  4G92 C;  5B32 B;  4J8V D;  4WU8 D;  1TAF A;  3AZG D;  5AVC A;  3UTB C;  1ZLA B;  1P3L B;  3X1V D;  4YS3 B;  3MGQ D;  4WU9 C;  4CAY B;  3KSY A;  3AZJ B;  2ARO C;  4R8P D;  3LZ1 D;  3REH D;  5B0Z B;  3AZM C;  4QLC C;  3REJ C;  5CPJ A;  1AOI A;  5AY8 C;  3NQU B;  3UT9 A;  5BT1 C;  1P34 C;  3B6G D;  4E44 A;  3UTA B;  3AZK A;  3B0C W;  5E5A C;  5DNM D;  5AV9 C;  3X1S B;  3REL C;  1P3K C;  1B67 A;  1Q9C A;  3WAA C;  4H9N B;  5GT0 B;  3WTP D;  3R45 A;  3O62 B;  5AV6 B;  5AVB A;  5AVC D;  5GXQ B;  1M19 A;  1KX4 C;  2FJ7 B;  4KHA B;  3B0B A;  2BYK A;  5B24 C;  5CPJ D;  1M1A C;  1AOI D;  2HUE B;  3UT9 D;  3AN2 B;  4H9R B;  5GT3 B;  3AFA A;  3AZK D;  3AZN A;  3WKJ B;  4HGA B;  5CP6 B;  1U35 B; 
#chains in the Genus database with same CATH topology
 2Y2I A;  3AV2 C;  4G91 C;  5B1M A;  4QLC A;  3REJ A;  1P3B C;  5B40 B;  3LJA B;  5AVB D;  5KDM A;  5B2I A;  3AZL A;  2Y2K A;  2L5A A;  2Y2N A;  3C1C C;  3W97 B;  1F66 A;  2XD1 A;  2W8S A;  3REL A;  5AV8 A;  2YFW B;  1B6W A;  4H9P B;  1P3K A;  1WWS A;  4KUD C;  3W98 B;  3AL0 C;  3UTB D;  3AFA D;  3AZN D;  5DNN C;  4X23 A;  3REI A;  3LEL B;  5BS7 C;  1TZY B;  2ZY4 A;  3AZM D;  5B1M D;  4QLC D;  3REJ D;  1HQ3 C;  5B2J B;  5AY8 D;  3MGP B;  5B2I D;  3AZL D;  3EPL A;  5CPI C;  3MNN C;  5AV5 A;  1P34 D;  3REK B;  1F66 D;  2PYO B;  5E5A D;  1P3I A;  3REL D;  2HIO C;  3W99 A;  1EQZ B;  2BYM B;  2JCH A;  1P3K D;  5B1L B;  4UUZ A;  3WAA D;  1ULY A;  4Z66 B;  1P3B A;  3B6F B;  3MGS A;  1P3M A;  1P3O B;  3X1U C;  5B32 C;  2Y2J A;  4LD9 B;  1P3P B;  5F99 A;  3LZ0 C;  2LY8 A;  5AV8 B;  3REI D;  1ZLA C;  1P3L C;  4YS3 C;  5JRG A;  1S32 B;  5B33 C;  2YFV B;  4KUD A;  2RIQ A;  1HTA A;  4ZUX B;  5BNX A;  3AZJ C;  5AV5 D;  1KX5 B;  1P3I D;  2NQB A;  5G49 A;  1P3G A;  5DNN A;  3W99 D;  4J8W A;  3MVD A;  5BS7 A;  3AV2 D;  3UTA C;  3P5J B;  5CPK B;  5B32 G;  1P3B D;  4H9S A;  3MGS D;  1P3M D;  2FFF B;  3C1C D;  4KGC B;  3KUY B;  3AZF A;  3O62 C;  2IO5 B;  5B31 B;  4WU8 A;  2NZD A;  4ZBJ C;  5AV6 C;  3WTP E;  2F8N A;  3W96 B;  5GXQ C;  3KXB B;  3VH6 W;  3AV1 C;  5JRG D;  2FJ7 C;  1M18 C;  4YM6 A;  1N1J A;  4KUD D;  3A6N A;  2UWX A;  3X1U A;  5F99 B;  3AYW A;  5BO0 A;  3MGR B;  2NQB D;  1P3G D;  5DNN D;  3AZH B;  4DRA A;  2HUE C;  5B0Y B;  4J8W D;  5GT3 C;  3AN2 C;  3WKJ C;  3B6G A;  1P3F C;  4HGA C;  5CP6 C;  2ZY5 A;  1U35 C;  5CPI D;  3MNN D;  4XUJ B;  3AZF D;  2NZD D;  3WTP A;  3TU4 B;  3LJA C;  5B40 C;  1ID3 A;  2F8N D;  3A1K A;  1P3A B;  4J8X B;  4XZQ B;  3MVD B;  3W97 C;  2CV5 C;  4J8U B;  4YM6 D;  3AZE A;  2RVQ C;  3A6N D;  3X1U D;  2Y2L A;  1H3O B;  4J8V B;  3AYW D;  3LZ0 D;  4WU8 B;  3C1B A;  5C3I C;  2DF4 C;  3AZI C;  1ZLA D;  3AZG B;  1P3L D;  3X1V B;  5B33 D;  4Z5T A;  3MGQ B;  4Z2M H;  3KFU G;  3LEL C;  1TZY C;  3KWQ A;  2Y2H A;  4R8P B;  3LZ1 B;  3REH B;  5B2J C;  1ID3 D;  5GSU A;  1BH8 B;  3REK C;  2PYO C;  3B6G B;  3AZE D;  1JFI B;  5DNM B;  1EQZ C;  5B1L C;  2JSS A;  3O62 D;  3C1B D;  1TAF B;  3B6F C;  5AVC B;  3UTB A;  3AV1 D;  2Y2O A;  4LD9 C;  2CV5 A;  1KX3 C;  1M18 D;  4Z5T D;  2F2A C;  3WA9 C;  1W2E A;  4WU9 A;  3KWQ D;  3EG5 B;  1S32 C;  1KU5 A;  2ARO A;  3AZM A;  5CPJ B;  1AOI B;  4ZUX C;  5AY8 A;  4NE5 A;  5GSU D;  3UT9 B;  1P34 A;  1KX5 C;  3AZK B;  1P3F D;  5E5A A;  5CP6 D;  4UPK A;  5AV9 A;  2Y2P A;  5FUG A;  3EPH A;  4DQY B;  5CPK C;  4WNN A;  3WAA A;  3NQJ A;  3R45 B;  4JJN C;  5AVB B;  3IP4 C;  4H9Q A;  3KUY C;  1M19 B;  2CV5 D;  2IO5 C;  1KX4 A;  3B0D B;  3W96 C;  4WV4 B;  4WU9 D;  3KXB C;  4G92 B;  2BYK B;  2ARO D;  5B24 A;  3AZI D;  4H9O A;  4NE6 A;  1M1A A;  3X1T C;  1T3U A;  4WJ3 C;  5BT1 D;  3AFA B;  3AZN B;  1KX3 A;  4M6B A;  3MGR C;  3AZH C;  3WA9 A;  5AV9 D;  2BG1 A;  5B0Y C;  3AV2 A;  4NE3 A;  5B2J D;  3AZM B;  5B1M B;  4QLC B;  3REJ B;  2Y2M A;  5B31 G;  4WZS B;  5AY8 B;  5KDM B;  5B2I B;  3AZL B;  2ZY2 A;  4XUJ C;  3C1C A;  2CWE A;  3REK D;  1KX4 D;  2PYO D;  3TU4 C;  1F66 B;  1P3A C;  4J8X C;  4XZQ C;  3REL B;  1P3K B;  4J8U C;  5B24 D;  3WAA B;  3NQJ B;  4JJN A;  1M1A D;  3B6F D;  5JA4 A;  4J8V C;  5B0Z C;  1KX3 D;  3WA9 D;  3VH6 T;  3AZG C;  4X23 B;  3REI B;  4H9O B;  3MGQ C;  2ZM5 A;  1HQ3 A;  3X1S C;  3X1T A;  3VH5 T;  2F8N K;  5CPI A;  3MNN A;  5AV5 B;  5GT0 C;  4R8P C;  3LZ1 C;  3REH C;  1KX5 D;  1P3I B;  2HIO A;  3W99 B;  1BH9 A;  4G91 B;  3AV2 B;  4UUZ B;  5DNM C;  4JJN D;  1P3B B;  3MGS B;  1P3M B;  4EO5 B;  5B32 A;  3KUY D;  3LZ0 A;  1ZLA A;  1P3L A;  4YS3 A;  5JRG B;  5B33 A;  1HQ3 D;  3X1T D;  4KUD B;  4CAY A;  3AZJ A;  5BNX B;  5B0Z A;  5CPJ C;  1AOI C;  2NQB B;  2HIO D;  5G49 B;  5DNN B;  1A7W A;  1P3G B;  3NQU A;  4J8W B;  3UT9 C;  3B0C T;  3UTA A;  3AZK C;  5B32 D;  4XUJ D;  4Z2M G;  4H9N A;  3O62 A;  3AZF B;  2NZD B;  5AV6 A;  3W98 C;  4J8X D;  2F8N B;  5AVB C;  5GXQ A;  1M19 C;  3VH6 A;  3AV1 A;  4YS3 D;  3B0D C;  2FJ7 A;  4KHA A;  1R4V A;  1M18 A;  4YM6 B;  1N1J B;  3A6N B;  1Z2C B;  3H0M C;  3AZJ D;  3X1U B;  3VH5 A;  5B0Z D;  2Y2G A;  3AYW B;  3LZ0 B;  1BFM A;  5BO0 B;  3MGP C;  3WKJ A;  3AN2 A;  4H9R A;  5GT3 A;  3AFA C;  3UTA D;  3AZN C;  3A1I A;  5B33 B;  1P3F A;  3X1S D;  5CP6 A;  1U35 A;  2JE5 A;  5GT0 D;  4Z66 C;  5B1M C;  2XD5 A;  3WTP B;  4AWL B;  5AV6 D;  1F1E A;  5B40 A;  3LJA A;  1ID3 B;  5B2I C;  1P3O C;  3AZL C;  5GXQ D;  3W97 A;  1P3P C;  1F66 C;  2FJ7 D;  3AZE B;  5AV8 C;  2YFW A;  4H9P A;  3AZI A;  3C1B B;  4ZBJ B;  3W98 A;  3H0L C;  3WKJ D;  3AN2 D;  5GT3 D;  3AV1 B;  1M18 B;  4Z5T B;  4X23 C;  3REI C;  1U35 D;  3LEL A;  1TZY A;  3KWQ B;  5B2J A;  5B40 D;  3LJA D;  3MGP A;  5GSU B;  5AV5 C;  3W97 D;  4KGC C;  4DRB A;  3REK A;  2PYO A;  5B31 C;  1P3I C;  1P3F B;  2RVQ D;  3W99 C;  2Y2Q A;  2BYM A;  1EQZ A;  5B1L A;  4Z66 A;  3W98 D;  3B6F A;  3MGS C;  1P3M C;  1P3O A;  4EO5 C;  4CSR A;  1M19 D;  4LD9 A;  3UTB B;  1P3P A;  5F99 C;  2CV5 B;  3LEL D;  4WU9 B;  1TZY D;  1S32 A;  5JRG C;  2ARO B;  3AZI B;  2YFV A;  5C3I B;  3MGP D;  4ZUX A;  1KX5 A;  3EPJ A;  1P34 B;  2NQB C;  5E5A B;  1P3G C;  1EQZ D;  5AV9 B;  4J8W C;  5FUG B;  5B1L D;  3MVD C;  5CPK A;  4WNN B;  4Z66 D;  4H9S C;  3V9R A;  1P3O D;  2G5H C;  4KGC A;  4H9Q B;  4LD9 D;  3KUY A;  1P3P D;  3AZF C;  1KX4 B;  5B31 A;  4WU8 C;  2NZD C;  3H0R C;  3W96 A;  5AV8 D;  3KXB A;  1S32 D;  3X1V C;  5B24 B;  4YM6 C;  3A6N C;  1M1A B;  4NFT A;  4ZUX D;  4CSR B;  3AYW C;  5CHL B;  3MGR A;  1KX3 B;  3AZH A;  4X23 D;  3WA9 B;  1PZR A;  5B0Y A;  5BNV A;  3B6G C;  5CPK D;  2F8N G;  4KGC D;  2ZY3 A;  4XUJ A;  3C1C B;  5B31 D;  3WTP C;  3EPK A;  4AWL C;  3TU4 A;  1ID3 C;  3W96 D;  1P3A A;  4J8X A;  4XZQ A;  3KXB D;  5AVC C;  4J8U A;  3AZE C;  2F8N H;  4JJN B;  3V9R B;  1H3O A;  5F99 D;  5JA4 B;  4J8V A;  3C1B C;  3MGR D;  3AZH D;  3AZG A;  5B0Y D;  3X1V A;  4Z5T C;  3MGQ A;  3X1S A;  1HQ3 B;  3F6T A;  3FDD A;  3X1T B;  3KWQ C;  2VQR A;  5CPI B;  3MNN B;  1WWI A;  3VH5 W;  5GT0 A;  4R8P A;  3LZ1 A;  3REH A;  3TU4 D;  4E45 A;  1P3A D;  5GSU C;  4XZQ D;  2HIO B;  3MVD D;  1BH8 A;  5BNV B;  1BH9 B;  4J8U D;  1JFI A;  5DNM A;  4G92 C;  5B32 B;  4J8V D;  4WU8 D;  1TAF A;  3AZG D;  2G5I C;  5AVC A;  3UTB C;  1ZLA B;  1P3L B;  3X1V D;  4YS3 B;  3MGQ D;  4WU9 C;  4CAY B;  3KSY A;  3AZJ B;  2ARO C;  4R8P D;  3LZ1 D;  3REH D;  5B0Z B;  3AZM C;  4QLC C;  3REJ C;  5CPJ A;  2DQN C;  1AOI A;  5AY8 C;  3NQU B;  3UT9 A;  5BT1 C;  1P34 C;  3B6G D;  4E44 A;  3UTA B;  3AZK A;  3B0C W;  5E5A C;  5DNM D;  5AV9 C;  3X1S B;  3REL C;  1P3K C;  1B67 A;  1Q9C A;  3WAA C;  4H9N B;  5GT0 B;  3WTP D;  3R45 A;  3O62 B;  5AV6 B;  5AVB A;  5AVC D;  5GXQ B;  1M19 A;  1KX4 C;  2J8P A;  2FJ7 B;  4KHA B;  3B0B A;  2BYK A;  5B24 C;  5CPJ D;  1M1A C;  1AOI D;  2HUE B;  3UT9 D;  3AN2 B;  4H9R B;  5GT3 B;  3AFA A;  3AZK D;  3AZN A;  3WKJ B;  4HGA B;  5CP6 B;  1U35 B; 
#chains in the Genus database with same CATH homology
 2Y2I A;  3AV2 C;  4G91 C;  5B1M A;  4QLC A;  3REJ A;  1P3B C;  5B40 B;  3LJA B;  5AVB D;  5KDM A;  5B2I A;  3AZL A;  2Y2K A;  2L5A A;  2Y2N A;  3C1C C;  3W97 B;  1F66 A;  2XD1 A;  2W8S A;  3REL A;  5AV8 A;  2YFW B;  1B6W A;  4H9P B;  1P3K A;  1WWS A;  4KUD C;  3W98 B;  3AL0 C;  3UTB D;  3AFA D;  3AZN D;  5DNN C;  4X23 A;  3REI A;  3LEL B;  5BS7 C;  1TZY B;  2ZY4 A;  3AZM D;  5B1M D;  4QLC D;  3REJ D;  1HQ3 C;  5B2J B;  5AY8 D;  3MGP B;  5B2I D;  3AZL D;  3EPL A;  5CPI C;  3MNN C;  5AV5 A;  1P34 D;  3REK B;  1F66 D;  2PYO B;  5E5A D;  1P3I A;  3REL D;  2HIO C;  3W99 A;  1EQZ B;  2BYM B;  2JCH A;  1P3K D;  5B1L B;  4UUZ A;  3WAA D;  1ULY A;  4Z66 B;  1P3B A;  3B6F B;  3MGS A;  1P3M A;  1P3O B;  3X1U C;  5B32 C;  2Y2J A;  4LD9 B;  1P3P B;  5F99 A;  3LZ0 C;  2LY8 A;  5AV8 B;  3REI D;  1ZLA C;  1P3L C;  4YS3 C;  5JRG A;  1S32 B;  5B33 C;  2YFV B;  4KUD A;  2RIQ A;  1HTA A;  4ZUX B;  5BNX A;  3AZJ C;  5AV5 D;  1KX5 B;  1P3I D;  2NQB A;  5G49 A;  1P3G A;  5DNN A;  3W99 D;  4J8W A;  3MVD A;  5BS7 A;  3AV2 D;  3UTA C;  3P5J B;  5CPK B;  5B32 G;  1P3B D;  4H9S A;  3MGS D;  1P3M D;  2FFF B;  3C1C D;  4KGC B;  3KUY B;  3AZF A;  3O62 C;  2IO5 B;  5B31 B;  4WU8 A;  2NZD A;  4ZBJ C;  5AV6 C;  3WTP E;  2F8N A;  3W96 B;  5GXQ C;  3KXB B;  3VH6 W;  3AV1 C;  5JRG D;  2FJ7 C;  1M18 C;  4YM6 A;  1N1J A;  4KUD D;  3A6N A;  2UWX A;  3X1U A;  5F99 B;  3AYW A;  5BO0 A;  3MGR B;  2NQB D;  1P3G D;  5DNN D;  3AZH B;  4DRA A;  2HUE C;  5B0Y B;  4J8W D;  5GT3 C;  3AN2 C;  3WKJ C;  3B6G A;  1P3F C;  4HGA C;  5CP6 C;  2ZY5 A;  1U35 C;  5CPI D;  3MNN D;  4XUJ B;  3AZF D;  2NZD D;  3WTP A;  3TU4 B;  3LJA C;  5B40 C;  1ID3 A;  2F8N D;  3A1K A;  1P3A B;  4J8X B;  4XZQ B;  3MVD B;  3W97 C;  2CV5 C;  4J8U B;  4YM6 D;  3AZE A;  2RVQ C;  3A6N D;  3X1U D;  2Y2L A;  1H3O B;  4J8V B;  3AYW D;  3LZ0 D;  4WU8 B;  3C1B A;  5C3I C;  2DF4 C;  3AZI C;  1ZLA D;  3AZG B;  1P3L D;  3X1V B;  5B33 D;  4Z5T A;  3MGQ B;  4Z2M H;  3KFU G;  3LEL C;  1TZY C;  3KWQ A;  2Y2H A;  4R8P B;  3LZ1 B;  3REH B;  5B2J C;  1ID3 D;  5GSU A;  1BH8 B;  3REK C;  2PYO C;  3B6G B;  3AZE D;  1JFI B;  5DNM B;  1EQZ C;  5B1L C;  2JSS A;  3O62 D;  3C1B D;  1TAF B;  3B6F C;  5AVC B;  3UTB A;  3AV1 D;  2Y2O A;  4LD9 C;  2CV5 A;  1KX3 C;  1M18 D;  4Z5T D;  2F2A C;  3WA9 C;  1W2E A;  4WU9 A;  3KWQ D;  3EG5 B;  1S32 C;  1KU5 A;  2ARO A;  3AZM A;  5CPJ B;  1AOI B;  4ZUX C;  5AY8 A;  4NE5 A;  5GSU D;  3UT9 B;  1P34 A;  1KX5 C;  3AZK B;  1P3F D;  5E5A A;  5CP6 D;  4UPK A;  5AV9 A;  2Y2P A;  5FUG A;  3EPH A;  4DQY B;  5CPK C;  4WNN A;  3WAA A;  3NQJ A;  3R45 B;  4JJN C;  5AVB B;  3IP4 C;  4H9Q A;  3KUY C;  1M19 B;  2CV5 D;  2IO5 C;  1KX4 A;  3B0D B;  3W96 C;  4WV4 B;  4WU9 D;  3KXB C;  4G92 B;  2BYK B;  2ARO D;  5B24 A;  3AZI D;  4H9O A;  4NE6 A;  1M1A A;  3X1T C;  1T3U A;  4WJ3 C;  5BT1 D;  3AFA B;  3AZN B;  1KX3 A;  4M6B A;  3MGR C;  3AZH C;  3WA9 A;  5AV9 D;  2BG1 A;  5B0Y C;  3AV2 A;  4NE3 A;  5B2J D;  3AZM B;  5B1M B;  4QLC B;  3REJ B;  2Y2M A;  5B31 G;  4WZS B;  5AY8 B;  5KDM B;  5B2I B;  3AZL B;  2ZY2 A;  4XUJ C;  3C1C A;  2CWE A;  3REK D;  1KX4 D;  2PYO D;  3TU4 C;  1F66 B;  1P3A C;  4J8X C;  4XZQ C;  3REL B;  1P3K B;  4J8U C;  5B24 D;  3WAA B;  3NQJ B;  4JJN A;  1M1A D;  3B6F D;  5JA4 A;  4J8V C;  5B0Z C;  1KX3 D;  3WA9 D;  3VH6 T;  3AZG C;  4X23 B;  3REI B;  4H9O B;  3MGQ C;  2ZM5 A;  1HQ3 A;  3X1S C;  3X1T A;  3VH5 T;  2F8N K;  5CPI A;  3MNN A;  5AV5 B;  5GT0 C;  4R8P C;  3LZ1 C;  3REH C;  1KX5 D;  1P3I B;  2HIO A;  3W99 B;  1BH9 A;  4G91 B;  3AV2 B;  4UUZ B;  5DNM C;  4JJN D;  1P3B B;  3MGS B;  1P3M B;  4EO5 B;  5B32 A;  3KUY D;  3LZ0 A;  1ZLA A;  1P3L A;  4YS3 A;  5JRG B;  5B33 A;  1HQ3 D;  3X1T D;  4KUD B;  4CAY A;  3AZJ A;  5BNX B;  5B0Z A;  5CPJ C;  1AOI C;  2NQB B;  2HIO D;  5G49 B;  5DNN B;  1A7W A;  1P3G B;  3NQU A;  4J8W B;  3UT9 C;  3B0C T;  3UTA A;  3AZK C;  5B32 D;  4XUJ D;  4Z2M G;  4H9N A;  3O62 A;  3AZF B;  2NZD B;  5AV6 A;  3W98 C;  4J8X D;  2F8N B;  5AVB C;  5GXQ A;  1M19 C;  3VH6 A;  3AV1 A;  4YS3 D;  3B0D C;  2FJ7 A;  4KHA A;  1R4V A;  1M18 A;  4YM6 B;  1N1J B;  3A6N B;  1Z2C B;  3H0M C;  3AZJ D;  3X1U B;  3VH5 A;  5B0Z D;  2Y2G A;  3AYW B;  3LZ0 B;  1BFM A;  5BO0 B;  3MGP C;  3WKJ A;  3AN2 A;  4H9R A;  5GT3 A;  3AFA C;  3UTA D;  3AZN C;  3A1I A;  5B33 B;  1P3F A;  3X1S D;  5CP6 A;  1U35 A;  2JE5 A;  5GT0 D;  4Z66 C;  5B1M C;  2XD5 A;  3WTP B;  4AWL B;  5AV6 D;  1F1E A;  5B40 A;  3LJA A;  1ID3 B;  5B2I C;  1P3O C;  3AZL C;  5GXQ D;  3W97 A;  1P3P C;  1F66 C;  2FJ7 D;  3AZE B;  5AV8 C;  2YFW A;  4H9P A;  3AZI A;  3C1B B;  4ZBJ B;  3W98 A;  3H0L C;  3WKJ D;  3AN2 D;  5GT3 D;  3AV1 B;  1M18 B;  4Z5T B;  4X23 C;  3REI C;  1U35 D;  3LEL A;  1TZY A;  3KWQ B;  5B2J A;  5B40 D;  3LJA D;  3MGP A;  5GSU B;  5AV5 C;  3W97 D;  4KGC C;  4DRB A;  3REK A;  2PYO A;  5B31 C;  1P3I C;  1P3F B;  2RVQ D;  3W99 C;  2Y2Q A;  2BYM A;  1EQZ A;  5B1L A;  4Z66 A;  3W98 D;  3B6F A;  3MGS C;  1P3M C;  1P3O A;  4EO5 C;  4CSR A;  1M19 D;  4LD9 A;  3UTB B;  1P3P A;  5F99 C;  2CV5 B;  3LEL D;  4WU9 B;  1TZY D;  1S32 A;  5JRG C;  2ARO B;  3AZI B;  2YFV A;  5C3I B;  3MGP D;  4ZUX A;  1KX5 A;  3EPJ A;  1P34 B;  2NQB C;  5E5A B;  1P3G C;  1EQZ D;  5AV9 B;  4J8W C;  5FUG B;  5B1L D;  3MVD C;  5CPK A;  4WNN B;  4Z66 D;  4H9S C;  3V9R A;  1P3O D;  2G5H C;  4KGC A;  4H9Q B;  4LD9 D;  3KUY A;  1P3P D;  3AZF C;  1KX4 B;  5B31 A;  4WU8 C;  2NZD C;  3H0R C;  3W96 A;  5AV8 D;  3KXB A;  1S32 D;  3X1V C;  5B24 B;  4YM6 C;  3A6N C;  1M1A B;  4NFT A;  4ZUX D;  4CSR B;  3AYW C;  5CHL B;  3MGR A;  1KX3 B;  3AZH A;  4X23 D;  3WA9 B;  1PZR A;  5B0Y A;  5BNV A;  3B6G C;  5CPK D;  2F8N G;  4KGC D;  2ZY3 A;  4XUJ A;  3C1C B;  5B31 D;  3WTP C;  3EPK A;  4AWL C;  3TU4 A;  1ID3 C;  3W96 D;  1P3A A;  4J8X A;  4XZQ A;  3KXB D;  5AVC C;  4J8U A;  3AZE C;  2F8N H;  4JJN B;  3V9R B;  1H3O A;  5F99 D;  5JA4 B;  4J8V A;  3C1B C;  3MGR D;  3AZH D;  3AZG A;  5B0Y D;  3X1V A;  4Z5T C;  3MGQ A;  3X1S A;  1HQ3 B;  3F6T A;  3FDD A;  3X1T B;  3KWQ C;  2VQR A;  5CPI B;  3MNN B;  1WWI A;  3VH5 W;  5GT0 A;  4R8P A;  3LZ1 A;  3REH A;  3TU4 D;  4E45 A;  1P3A D;  5GSU C;  4XZQ D;  2HIO B;  3MVD D;  1BH8 A;  5BNV B;  1BH9 B;  4J8U D;  1JFI A;  5DNM A;  4G92 C;  5B32 B;  4J8V D;  4WU8 D;  1TAF A;  3AZG D;  2G5I C;  5AVC A;  3UTB C;  1ZLA B;  1P3L B;  3X1V D;  4YS3 B;  3MGQ D;  4WU9 C;  4CAY B;  3KSY A;  3AZJ B;  2ARO C;  4R8P D;  3LZ1 D;  3REH D;  5B0Z B;  3AZM C;  4QLC C;  3REJ C;  5CPJ A;  2DQN C;  1AOI A;  5AY8 C;  3NQU B;  3UT9 A;  5BT1 C;  1P34 C;  3B6G D;  4E44 A;  3UTA B;  3AZK A;  3B0C W;  5E5A C;  5DNM D;  5AV9 C;  3X1S B;  3REL C;  1P3K C;  1B67 A;  1Q9C A;  3WAA C;  4H9N B;  5GT0 B;  3WTP D;  3R45 A;  3O62 B;  5AV6 B;  5AVB A;  5AVC D;  5GXQ B;  1M19 A;  1KX4 C;  2J8P A;  2FJ7 B;  4KHA B;  3B0B A;  2BYK A;  5B24 C;  5CPJ D;  1M1A C;  1AOI D;  2HUE B;  3UT9 D;  3AN2 B;  4H9R B;  5GT3 B;  3AFA A;  3AZK D;  3AZN A;  3WKJ B;  4HGA B;  5CP6 B;  1U35 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...