3LZ1B

Crystal structure of nucleosome core particle composed of the widom 601 dna sequence (orientation 2)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
83
structure length
83
Chain Sequence
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Crystal structures of nucleosome core particles containing the '601' strong positioning sequence
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 26
structure length 83
sequence length 83
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3lz1B00
3WA9D 3B0BA 3REHD 3AZIA 1BH9A 3MGPB 4WU9D 3X1TD 2CV5D 1S32A 1P3PA 1ZLAA 1P3BD 1KX3D 5B24A 4G92B 4QLCB 1BH9B 5AV9B 3WTPA 1P3PB 5AV6D 5AV5D 1S32B 2HIOD 1ZLAB 2F8NK 3TU4B 5GSUD 1P3LA 5B40D 3WTPB 1P3AC 1ID3C 5AY8A 5DNND 1U35A 1P34C 3AV2C 5E5AD 4J8WD 2PYOC 5AY8B 1U35B 3AV2A 2F8NG 4H9PA 3B6FD 2PYOA 5B0ZB 1AOID 3WKJB 5C3IC 3B6GD 5B1LD 1M1AC 4H9RA 3REIA 3WAAC 3VH5W 5CP6A 3MNND 1KX4C 3WA9C 3WAAA 3REHC 3REIB 2CV5C 4Z66C 3MGSD 4UUZA 3MVDD 3A6NC 4DRBA 4WU8A 1EQZC 4H9QA 3B0CW 4Z66A 5AV5C 3A6NA 4UUZB 1F66B 4H9SC 1P3ID 3R45B 1EQZA 3X1SB 3REJD 4WU8B 4H9QB 5GSUC 3B0DC 2NQBA 1N1JB 5B2IA 1P3MD 2BYMB 5DNNC 4ZBJB 3LELD 2NQBB 3AZNA 5B2IB 1P3OC 3B6FC 3O62B 5KDMA 3W98C 3AN2A 3KUYA 1P3OA 5JRGD 5B1LC 3UTAD 3AZMA 3W98A 3AN2B 3KUYB 3C1CD 4YS3D 5BT1D 5GXQD 5B0YD 3MNNC 1TZYA 4XZQD 3AZMB 4LD9A 5B32B 3MVDC 5DNMD 1KU5A 2HUEB 1TZYB 3RELA 1HQ3C 4J8UD 3X1VA 4LD9B 4J8XC 4R8PD 1P3IC 3KWQC 4KGCB 3AZFB 1HQ3A 3REJC 3RELB 4Z2MH 4Z5TC 3X1VB 4J8XA 4YM6A 3KWQA 1M19C 2AROD 5AVBA 5B33B 3NQJA 5AV8A 3MGRA 5F99A 5B2JA 4Z5TA 1M19A 4X23A 3AYWB 5AVBB 2RVQC 3VH5T 5AV8B 3MGRB 2BYKA 5F99B 5B2JB 3AFAD 5B1MB 2NZDD 4X23B 4HGAB 4AWLB 5JRGC 3W96A 3LJAC 4WV4B 3W99D 3UTAC 4G91B 2BYKB 2CWEA 3UT9C 4NE3A 4J8VA 1P3FC 3C1CC 4QLCD 5BT1C 5AV9D 3B0CT 3LJAA 3W96B 3AZHA 1Q9CA 4XZQC 3UT9A 4JJNC 4J8VB 5DNMC 3TU4D 3AZKB 3X1UA 3AZHB 3LZ0D 4J8UC 2FJ7A 4JJNA 1M18A 3AZEC 4KHAA 3UTBC 3X1UB 5GT3D 5AY8D 3AZEA 2FJ7B 1M18B 3KXBC 5BNVA 2AROC 3UTBA 1P3KC 4DRAA 5B0ZD 3WKJD 3KXBA 3AZJA 5AVCC 1P3GC 3W97D 3AZIB 4EO5B 4KUDD 1KX5D 5AVCA 2NZDC 3C1BC 3AZJB 5BS7C 3REID 3REKC 1P3GA 5B24B 3W99C 4NE6A 3C1BA 5JA4A 5AV9C 1F66D 1P3LB 5GT0D 5CPJD 1P3AA 1ID3A 3X1SD 4WU8D 1B6WA 5JA4B 1P34A 4XUJD 5CPID 3LZ0C 2F8NA 4WZSB 1P3AB 1ID3B 1P34B 5GT3C 3AV2B 2NQBD 4H9PB 3AZLC 5CPKC 2PYOB 1M1AA 3O62D 3LZ1C 4H9RB 3AZLA 3WKJC 3X1TC 4WU9C 4H9OA 5CP6B 1P3BC 5C3IB 1KX3C 1KX4A 3LZ1A 1M1AB 1JFIA 3WA9A 3W97C 3REHA 2CV5A 3WAAB 3KUYD 3X1TA 4WU9A 4KUDC 4M6BA 5AV6C 4H9OB 1KX5C 2HIOC 1KX3A 1KX4B 3AZMD 1JFIB 5B32D 3WA9B 3REHB 2CV5B 4Z66B 5B40C 5AV5A 1B67A 3A6NB 4H9SA 1BH8A 1EQZB 5GSUA 5E5AC 5GT0C 4J8WC 5B31D 4KGCD 5AV5B 3AZFD 5CPJC 5G49A 3RELD 1BH8B 5DNNA 4NFTA 4XUJC 3X1VD 5E5AA 5CPIC 5GSUB 4J8WA 5FUGA 3NQUA 3B0DB 5B33D 5G49B 3AZNB 1AOIC 5DNNB 3B6GC 3AZGD 3AYWD 5FUGB 3NQUB 4CSRA 3B6FA 3MGQD 5KDMB 1P3OB 5B2JD 3B6GA 5B1LA 5B1MD 2IO5C 3WTPE 3B6FB 4CSRB 3MGSC 3W98B 2LY8A 3MNNA 5B1LB 3MVDA 3MNNB 3AZKD 3MVDB 1P3IA 5B32G 2L5AA 1P3MC 1ULYA 3REJA 3AV1D 1HQ3B 3LELC 5B31C 1WWSA 4J8XB 4YM6B 3KWQB 1P3IB 1P3MA 5B31G 3NQJB 3REJB 4ZUXD 4Z5TB 1M19B 3MGPD 3AZGC 3MGQC 4H9NA 3AZID 4YS3C 5JRGA 5GXQC 5B0YC 3UTAA 1S32D 1P3PD 1ZLAD 5BNXA 1P3FA 5B24D 3C1CA 4H9NB 5B0YA 5GXQA 5JRGB 3LJAB 3WTPD 3UTAB 4XZQA 5BNXB 3UT9B 5CHLB 1P3FB 5DNMA 4R8PC 3C1CB 1P3LD 4Z2MG 4J8UA 4XZQB 1U35D 4JJNB 5DNMB 4KHAB 3AV1C 4J8UB 4CAYA 3AZEB 3AV2D 3VH6W 2AROA 5BNVB 3UTBB 1P3KA 2PYOD 4ZUXC 3AFAC 3KXBB 3MGPC 1P3KB 5CP6D 4G92C 2NZDA 5AVCB 5BS7A 3REKA 3WAAD 4QLCC 1P3GB 1P3PC 1ZLAC 1S32C 3W99A 2NZDB 3C1BB 4QLCA 5AV9A 3REKB 4Z66D 3TU4C 1BFMA 3WTPC 3W99B 3A6ND 4WNNA 1EQZD 3TU4A 1P3LC 3LZ0A 5B2ID 2F8NB 5AY8C 1U35C 4WNNB 5GT3A 3LZ0B 5B0ZC 3AZND 5CPKA 5GT3B 5B0ZA 3VH6A 3AZLB 3AN2D 3WKJA 1P3OD 5CPKB 1P3BA 3REIC 3LZ1B 3W97A 5CP6C 3W98D 4KUDA 3X1TB 4WU9B 5AV6A 1KX5A 2HIOA 3V9RA 1TZYD 1P3BB 1KX3B 1F66C 3W97B 4LD9D 5B40A 4KUDB 5AV6B 1KX5B 2HIOB 3V9RB 3X1SC 4WU8C 1F66A 5GT0A 5B40B 5CPJA 3R45A 3X1SA 1HQ3D 4ZBJC 4XUJA 5CPIA 1N1JA 4J8XD 2NQBC 5E5AB 4YM6D 1H3OA 2BYMA 3VH6T 5BO0A 5GT0B 5B2IC 5AVBD 3KWQD 4J8WB 5CPJB 5AV8D 3MGRD 1AOIA 5F99D 4Z5TD 4XUJB 3O62C 5CPIB 1M19D 1HTAA 3AZNC 1H3OB 5BO0B 4X23D 1AOIB 1TAFA 3B6GB 3O62A 3AN2C 3KUYC 3MGSA 2RVQD 3W96D 1TAFB 2IO5B 3AZMC 5B32C 4J8VD 3MGSB 3LJAD 2HUEC 3AZHD 1TZYC 1F1EA 5B32A 3UT9D 1P3FD 4LD9C 3VH5A 4KGCC 3X1UD 3AZFC 2JSSA 3RELC 2FJ7D 1A7WA 3X1VC 4JJND 3LELA 1M18D 5B31A 4KGCA 3AZFA 5B33C 4E45A 1P3MB 3AZED 2YFVA 3LELB 4YM6C 3AYWC 5B31B 5B33A 3UTBD 5AVBC 5AV8C 3MGRC 5F99C 5B2JC 3KXBD 5B1MC 3AZGA 2YFVB 3AYWA 3AZJD 4X23C 4HGAC 3MGQA 4AWLC 1P3KD 3KSYA 4YS3A 4G91C 5B1MA 4NE5A 3AZGB 5AVCD 1R4VA 3MGQB 1P3GD 3W96C 4YS3B 5GXQB 5B0YB 4E44A 3C1BD 4J8VC 3REKD 3AZKC 1WWIA 4R8PA 3AZHC 1P3AD 1ID3D 3AZKA 1P34D 3X1UC 4R8PB 2F8ND 3AV1A 1M18C 2FJ7C 4CAYB 2AROB 2YFWA 2F8NH 3AV1B 4ZUXA 3AFAA 1M1AD 3AZLD 3MGPA 3AZIC 4EO5C 2YFWB 5CPKD 4ZUXB 3AFAB 3AZJC 1KX4D 5B24C 3LZ1D
chains in the Genus database with same CATH superfamily
3WA9D 3B0BA 3REHD 3AZIA 1BH9A 3MGPB 4WU9D 3X1TD 2CV5D 1S32A 1P3PA 1ZLAA 1P3BD 1KX3D 5B24A 4G92B 4QLCB 1BH9B 5AV9B 3WTPA 1P3PB 5AV6D 5AV5D 1S32B 2HIOD 1ZLAB 2F8NK 3TU4B 5GSUD 1P3LA 5B40D 3WTPB 1P3AC 1ID3C 5AY8A 5DNND 1U35A 1P34C 3AV2C 5E5AD 4J8WD 2PYOC 5AY8B 1U35B 3AV2A 2F8NG 4H9PA 3B6FD 2PYOA 5B0ZB 1AOID 3WKJB 2RIQA 5C3IC 3B6GD 5B1LD 1M1AC 4H9RA 3REIA 3WAAC 3VH5W 5CP6A 2J8PA 2F2AC 3FDDA 3MNND 1KX4C 3WA9C 3WAAA 3REHC 3REIB 2CV5C 4Z66C 3MGSD 4UUZA 3MVDD 3A6NC 4DRBA 4WU8A 1EQZC 4H9QA 3B0CW 4Z66A 5AV5C 3A6NA 4UUZB 1F66B 2Y2OA 4H9SC 1P3ID 3R45B 1EQZA 3X1SB 3REJD 4WU8B 4H9QB 5GSUC 3B0DC 2NQBA 1N1JB 5B2IA 1P3MD 2BYMB 5DNNC 4ZBJB 3LELD 2NQBB 3AZNA 5B2IB 1P3OC 2UWXA 3B6FC 3O62B 5KDMA 3W98C 3AN2A 3KUYA 1P3OA 5JRGD 3H0MC 5B1LC 3UTAD 3AZMA 1W2EA 3W98A 3AN2B 3KUYB 3C1CD 4YS3D 5BT1D 5GXQD 5B0YD 3MNNC 1TZYA 4XZQD 3AZMB 4LD9A 5B32B 3MVDC 4WJ3C 5DNMD 1KU5A 2HUEB 1TZYB 3EPKA 3RELA 1HQ3C 4J8UD 3X1VA 4LD9B 4J8XC 4R8PD 1P3IC 3KWQC 4KGCB 3AZFB 3AL0C 1HQ3A 3REJC 3RELB 4Z2MH 4Z5TC 3X1VB 4J8XA 4YM6A 3KWQA 1M19C 2AROD 5AVBA 5B33B 3NQJA 5AV8A 3MGRA 3EG5B 5F99A 5B2JA 4Z5TA 1M19A 4X23A 3AYWB 5AVBB 2RVQC 3VH5T 5AV8B 3MGRB 2BYKA 5F99B 5B2JB 3AFAD 5B1MB 2NZDD 4X23B 4HGAB 4AWLB 5JRGC 3W96A 3LJAC 4WV4B 3W99D 3UTAC 4G91B 2BYKB 2CWEA 3UT9C 4NE3A 4J8VA 1P3FC 3C1CC 4QLCD 5BT1C 5AV9D 3B0CT 3LJAA 3W96B 3AZHA 1Q9CA 4XZQC 3UT9A 4JJNC 4J8VB 5DNMC 3TU4D 3AZKB 3X1UA 3AZHB 3LZ0D 4J8UC 2FJ7A 4JJNA 1M18A 3AZEC 4KHAA 3UTBC 3X1UB 5GT3D 5AY8D 3AZEA 2FJ7B 1M18B 3KXBC 5BNVA 2AROC 3UTBA 1P3KC 4DRAA 5B0ZD 3WKJD 3KXBA 3AZJA 5AVCC 1P3GC 3W97D 3AZIB 4EO5B 2ZY5A 2Y2GA 4KUDD 1KX5D 5AVCA 2NZDC 3C1BC 3AZJB 5BS7C 3REID 3REKC 1P3GA 4DQYB 5B24B 3W99C 4NE6A 3C1BA 5JA4A 5AV9C 1F66D 1P3LB 5GT0D 5CPJD 1P3AA 1ID3A 3X1SD 4WU8D 1B6WA 5JA4B 1P34A 4XUJD 5CPID 3LZ0C 2F8NA 4WZSB 1P3AB 1ID3B 1P34B 5GT3C 3AV2B 2NQBD 4H9PB 3AZLC 5CPKC 2PYOB 3A1KA 1M1AA 3O62D 3LZ1C 4H9RB 3AZLA 3WKJC 3X1TC 4WU9C 4H9OA 5CP6B 3A1IA 1P3BC 5C3IB 1KX3C 1KX4A 3LZ1A 1M1AB 1JFIA 3WA9A 3W97C 3REHA 2CV5A 3WAAB 3KUYD 3X1TA 4WU9A 4KUDC 4M6BA 5AV6C 4H9OB 1KX5C 2HIOC 2JE5A 1KX3A 1KX4B 3AZMD 1JFIB 5B32D 3WA9B 3REHB 2CV5B 4Z66B 5B40C 5AV5A 1B67A 3A6NB 4H9SA 1BH8A 1EQZB 5GSUA 5E5AC 5GT0C 4J8WC 5B31D 4KGCD 5AV5B 3AZFD 5CPJC 5G49A 3RELD 1BH8B 5DNNA 4NFTA 4XUJC 3X1VD 5E5AA 5CPIC 2ZY2A 5GSUB 5FUGA 3NQUA 3B0DB 3EPLA 4J8WA 5B33D 5G49B 3AZNB 1AOIC 5DNNB 3B6GC 3AZGD 3AYWD 5FUGB 3NQUB 4CSRA 3B6FA 3MGQD 5KDMB 1P3OB 5B2JD 3B6GA 5B1LA 5B1MD 2IO5C 3WTPE 3B6FB 4CSRB 3MGSC 3W98B 2LY8A 3MNNA 5B1LB 4UPKA 2Y2NA 3MVDA 3MNNB 2Y2IA 3AZKD 3MVDB 1P3IA 5B32G 2L5AA 1P3MC 1ULYA 3REJA 3AV1D 1HQ3B 3LELC 5B31C 1WWSA 4J8XB 4YM6B 3KWQB 1P3IB 1P3MA 5B31G 3NQJB 3REJB 3EPHA 4ZUXD 2BG1A 4Z5TB 1M19B 3MGPD 2DQNC 3AZGC 3MGQC 4H9NA 3AZID 4YS3C 5JRGA 5GXQC 5B0YC 3UTAA 1S32D 1P3PD 1ZLAD 3KFUG 5BNXA 1P3FA 3IP4C 5B24D 3C1CA 4H9NB 5B0YA 5GXQA 5JRGB 3LJAB 3WTPD 3UTAB 4XZQA 5BNXB 3F6TA 3UT9B 5CHLB 1P3FB 5DNMA 4R8PC 3C1CB 1P3LD 4Z2MG 4J8UA 4XZQB 1U35D 4JJNB 5DNMB 4KHAB 3AV1C 2ZY3A 4J8UB 4CAYA 3AZEB 3AV2D 3VH6W 2AROA 5BNVB 3UTBB 1P3KA 2PYOD 4ZUXC 3AFAC 3KXBB 3MGPC 1P3KB 5CP6D 3H0RC 2Y2QA 4G92C 2NZDA 5AVCB 5BS7A 3REKA 1Z2CB 3WAAD 4QLCC 1P3GB 1P3PC 1ZLAC 1S32C 3W99A 2NZDB 3C1BB 2G5IC 4QLCA 5AV9A 4Z66D 3REKB 3TU4C 1BFMA 3WTPC 3W99B 3A6ND 4WNNA 1EQZD 3TU4A 1P3LC 3P5JB 3LZ0A 5B2ID 2F8NB 5AY8C 1U35C 4WNNB 2W8SA 2Y2KA 5GT3A 3LZ0B 5B0ZC 3AZND 5CPKA 5GT3B 5B0ZA 3VH6A 3AZLB 3AN2D 3WKJA 1P3OD 5CPKB 1P3BA 3REIC 3LZ1B 3W97A 5CP6C 3W98D 4KUDA 3X1TB 4WU9B 5AV6A 1KX5A 2HIOA 2JCHA 3V9RA 1TZYD 1P3BB 2Y2MA 1KX3B 1F66C 3W97B 4LD9D 2ZM5A 5B40A 4KUDB 5AV6B 1KX5B 2HIOB 3V9RB 3X1SC 4WU8C 1F66A 2ZY4A 5GT0A 5B40B 5CPJA 3R45A 3X1SA 1HQ3D 4ZBJC 4XUJA 5CPIA 1N1JA 4J8XD 2NQBC 5E5AB 4YM6D 1H3OA 2BYMA 3VH6T 5BO0A 5GT0B 5B2IC 5AVBD 3KWQD 4J8WB 5CPJB 5AV8D 3MGRD 1AOIA 5F99D 4Z5TD 4XUJB 3O62C 5CPIB 1M19D 1HTAA 3AZNC 1H3OB 5BO0B 4X23D 1PZRA 1AOIB 1TAFA 3B6GB 3O62A 3AN2C 1T3UA 3MGSA 3KUYC 2RVQD 2XD5A 3W96D 2Y2PA 1TAFB 2XD1A 2IO5B 3AZMC 5B32C 4J8VD 3MGSB 3LJAD 2HUEC 3AZHD 1TZYC 1F1EA 5B32A 3UT9D 1P3FD 4LD9C 3VH5A 4KGCC 3X1UD 3AZFC 2JSSA 3RELC 2Y2HA 2FJ7D 1A7WA 3X1VC 4JJND 3LELA 1M18D 2Y2JA 5B31A 4KGCA 3AZFA 5B33C 4E45A 1P3MB 3AZED 2YFVA 3LELB 4YM6C 3AYWC 5B31B 5B33A 3UTBD 5AVBC 5AV8C 3MGRC 5F99C 5B2JC 3KXBD 5B1MC 3AZGA 2YFVB 3AYWA 3AZJD 4X23C 4HGAC 3MGQA 4AWLC 1P3KD 3KSYA 4YS3A 4G91C 5B1MA 2Y2LA 4NE5A 5AVCD 3AZGB 1R4VA 3MGQB 1P3GD 3W96C 4YS3B 5GXQB 5B0YB 4E44A 2G5HC 3C1BD 4J8VC 3REKD 3AZKC 1WWIA 4R8PA 3AZHC 2FFFB 1P3AD 1ID3D 3AZKA 3H0LC 1P34D 3X1UC 4R8PB 2VQRA 2F8ND 2DF4C 3AV1A 1M18C 2FJ7C 4CAYB 2AROB 2YFWA 2F8NH 3AV1B 4ZUXA 3AFAA 1M1AD 3AZLD 3MGPA 3AZIC 4EO5C 2YFWB 5CPKD 4ZUXB 3AFAB 3AZJC 3EPJA 1KX4D 5B24C 3LZ1D
chains in the Genus database with same CATH topology
3WA9D 3B0BA 3REHD 3AZIA 1BH9A 3MGPB 4WU9D 3X1TD 2CV5D 1S32A 1P3PA 1ZLAA 1P3BD 1KX3D 5B24A 4G92B 4QLCB 1BH9B 5AV9B 3WTPA 1P3PB 5AV6D 5AV5D 1S32B 2HIOD 1ZLAB 2F8NK 3TU4B 5GSUD 1P3LA 5B40D 3WTPB 1P3AC 1ID3C 5AY8A 5DNND 1U35A 1P34C 3AV2C 5E5AD 4J8WD 2PYOC 5AY8B 1U35B 3AV2A 2F8NG 4H9PA 3B6FD 2PYOA 5B0ZB 1AOID 3WKJB 2RIQA 5C3IC 3B6GD 5B1LD 1M1AC 4H9RA 3REIA 3WAAC 3VH5W 5CP6A 2J8PA 2F2AC 3FDDA 3MNND 1KX4C 3WA9C 3WAAA 3REHC 3REIB 2CV5C 4Z66C 3MGSD 4UUZA 3MVDD 3A6NC 4DRBA 4WU8A 1EQZC 4H9QA 3B0CW 4Z66A 5AV5C 3A6NA 4UUZB 1F66B 2Y2OA 4H9SC 1P3ID 3R45B 1EQZA 3X1SB 3REJD 4WU8B 4H9QB 5GSUC 3B0DC 2NQBA 1N1JB 5B2IA 1P3MD 2BYMB 5DNNC 4ZBJB 3LELD 2NQBB 3AZNA 5B2IB 1P3OC 2UWXA 3B6FC 3O62B 5KDMA 3W98C 3AN2A 3KUYA 1P3OA 5JRGD 3H0MC 5B1LC 3UTAD 3AZMA 1W2EA 3W98A 3AN2B 3KUYB 3C1CD 4YS3D 5BT1D 5GXQD 5B0YD 3MNNC 1TZYA 4XZQD 3AZMB 4LD9A 5B32B 3MVDC 4WJ3C 5DNMD 1KU5A 2HUEB 1TZYB 3EPKA 3RELA 1HQ3C 4J8UD 3X1VA 4LD9B 4J8XC 4R8PD 1P3IC 3KWQC 4KGCB 3AZFB 3AL0C 1HQ3A 3REJC 3RELB 4Z2MH 4Z5TC 3X1VB 4J8XA 4YM6A 3KWQA 1M19C 2AROD 5AVBA 5B33B 3NQJA 5AV8A 3MGRA 3EG5B 5F99A 5B2JA 4Z5TA 1M19A 4X23A 3AYWB 5AVBB 2RVQC 3VH5T 5AV8B 3MGRB 2BYKA 5F99B 5B2JB 3AFAD 5B1MB 2NZDD 4X23B 4HGAB 4AWLB 5JRGC 3W96A 3LJAC 4WV4B 3W99D 3UTAC 4G91B 2BYKB 2CWEA 3UT9C 4NE3A 4J8VA 1P3FC 3C1CC 4QLCD 5BT1C 5AV9D 3B0CT 3LJAA 3W96B 3AZHA 1Q9CA 4XZQC 3UT9A 4JJNC 4J8VB 5DNMC 3TU4D 3AZKB 3X1UA 3AZHB 3LZ0D 4J8UC 2FJ7A 4JJNA 1M18A 3AZEC 4KHAA 3UTBC 3X1UB 5GT3D 5AY8D 3AZEA 2FJ7B 1M18B 3KXBC 5BNVA 2AROC 3UTBA 1P3KC 4DRAA 5B0ZD 3WKJD 3KXBA 3AZJA 5AVCC 1P3GC 3W97D 3AZIB 4EO5B 2ZY5A 2Y2GA 4KUDD 1KX5D 5AVCA 2NZDC 3C1BC 3AZJB 5BS7C 3REID 3REKC 1P3GA 4DQYB 5B24B 3W99C 4NE6A 3C1BA 5JA4A 5AV9C 1F66D 1P3LB 5GT0D 5CPJD 1P3AA 1ID3A 3X1SD 4WU8D 1B6WA 5JA4B 1P34A 4XUJD 5CPID 3LZ0C 2F8NA 4WZSB 1P3AB 1ID3B 1P34B 5GT3C 3AV2B 2NQBD 4H9PB 3AZLC 5CPKC 2PYOB 3A1KA 1M1AA 3O62D 3LZ1C 4H9RB 3AZLA 3WKJC 3X1TC 4WU9C 4H9OA 5CP6B 3A1IA 1P3BC 5C3IB 1KX3C 1KX4A 3LZ1A 1M1AB 1JFIA 3WA9A 3W97C 3REHA 2CV5A 3WAAB 3KUYD 3X1TA 4WU9A 4KUDC 4M6BA 5AV6C 4H9OB 1KX5C 2HIOC 2JE5A 1KX3A 1KX4B 3AZMD 1JFIB 5B32D 3WA9B 3REHB 2CV5B 4Z66B 5B40C 5AV5A 1B67A 3A6NB 4H9SA 1BH8A 1EQZB 5GSUA 5E5AC 5GT0C 4J8WC 5B31D 4KGCD 5AV5B 3AZFD 5CPJC 5G49A 3RELD 1BH8B 5DNNA 4NFTA 4XUJC 3X1VD 5E5AA 5CPIC 2ZY2A 5GSUB 5FUGA 3NQUA 3B0DB 3EPLA 4J8WA 5B33D 5G49B 3AZNB 1AOIC 5DNNB 3B6GC 3AZGD 3AYWD 5FUGB 3NQUB 4CSRA 3B6FA 3MGQD 5KDMB 1P3OB 5B2JD 3B6GA 5B1LA 5B1MD 2IO5C 3WTPE 3B6FB 4CSRB 3MGSC 3W98B 2LY8A 3MNNA 5B1LB 4UPKA 2Y2NA 3MVDA 3MNNB 2Y2IA 3AZKD 3MVDB 1P3IA 5B32G 2L5AA 1P3MC 1ULYA 3REJA 3AV1D 1HQ3B 3LELC 5B31C 1WWSA 4J8XB 4YM6B 3KWQB 1P3IB 1P3MA 5B31G 3NQJB 3REJB 3EPHA 4ZUXD 2BG1A 4Z5TB 1M19B 3MGPD 2DQNC 3AZGC 3MGQC 4H9NA 3AZID 4YS3C 5JRGA 5GXQC 5B0YC 3UTAA 1S32D 1P3PD 1ZLAD 3KFUG 5BNXA 1P3FA 3IP4C 5B24D 3C1CA 4H9NB 5B0YA 5GXQA 5JRGB 3LJAB 3WTPD 3UTAB 4XZQA 5BNXB 3F6TA 3UT9B 5CHLB 1P3FB 5DNMA 4R8PC 3C1CB 1P3LD 4Z2MG 4J8UA 4XZQB 1U35D 4JJNB 5DNMB 4KHAB 3AV1C 2ZY3A 4J8UB 4CAYA 3AZEB 3AV2D 3VH6W 2AROA 5BNVB 3UTBB 1P3KA 2PYOD 4ZUXC 3AFAC 3KXBB 3MGPC 1P3KB 5CP6D 3H0RC 2Y2QA 4G92C 2NZDA 5AVCB 5BS7A 3REKA 1Z2CB 3WAAD 4QLCC 1P3GB 1P3PC 1ZLAC 1S32C 3W99A 2NZDB 3C1BB 2G5IC 4QLCA 5AV9A 4Z66D 3REKB 3TU4C 1BFMA 3WTPC 3W99B 3A6ND 4WNNA 1EQZD 3TU4A 1P3LC 3P5JB 3LZ0A 5B2ID 2F8NB 5AY8C 1U35C 4WNNB 2W8SA 2Y2KA 5GT3A 3LZ0B 5B0ZC 3AZND 5CPKA 5GT3B 5B0ZA 3VH6A 3AZLB 3AN2D 3WKJA 1P3OD 5CPKB 1P3BA 3REIC 3LZ1B 3W97A 5CP6C 3W98D 4KUDA 3X1TB 4WU9B 5AV6A 1KX5A 2HIOA 2JCHA 3V9RA 1TZYD 1P3BB 2Y2MA 1KX3B 1F66C 3W97B 4LD9D 2ZM5A 5B40A 4KUDB 5AV6B 1KX5B 2HIOB 3V9RB 3X1SC 4WU8C 1F66A 2ZY4A 5GT0A 5B40B 5CPJA 3R45A 3X1SA 1HQ3D 4ZBJC 4XUJA 5CPIA 1N1JA 4J8XD 2NQBC 5E5AB 4YM6D 1H3OA 2BYMA 3VH6T 5BO0A 5GT0B 5B2IC 5AVBD 3KWQD 4J8WB 5CPJB 5AV8D 3MGRD 1AOIA 5F99D 4Z5TD 4XUJB 3O62C 5CPIB 1M19D 1HTAA 3AZNC 1H3OB 5BO0B 4X23D 1PZRA 1AOIB 1TAFA 3B6GB 3O62A 3AN2C 1T3UA 3MGSA 3KUYC 2RVQD 2XD5A 3W96D 2Y2PA 1TAFB 2XD1A 2IO5B 3AZMC 5B32C 4J8VD 3MGSB 3LJAD 2HUEC 3AZHD 1TZYC 1F1EA 5B32A 3UT9D 1P3FD 4LD9C 3VH5A 4KGCC 3X1UD 3AZFC 2JSSA 3RELC 2Y2HA 2FJ7D 1A7WA 3X1VC 4JJND 3LELA 1M18D 2Y2JA 5B31A 4KGCA 3AZFA 5B33C 4E45A 1P3MB 3AZED 2YFVA 3LELB 4YM6C 3AYWC 5B31B 5B33A 3UTBD 5AVBC 5AV8C 3MGRC 5F99C 5B2JC 3KXBD 5B1MC 3AZGA 2YFVB 3AYWA 3AZJD 4X23C 4HGAC 3MGQA 4AWLC 1P3KD 3KSYA 4YS3A 4G91C 5B1MA 2Y2LA 4NE5A 5AVCD 3AZGB 1R4VA 3MGQB 1P3GD 3W96C 4YS3B 5GXQB 5B0YB 4E44A 2G5HC 3C1BD 4J8VC 3REKD 3AZKC 1WWIA 4R8PA 3AZHC 2FFFB 1P3AD 1ID3D 3AZKA 3H0LC 1P34D 3X1UC 4R8PB 2VQRA 2F8ND 2DF4C 3AV1A 1M18C 2FJ7C 4CAYB 2AROB 2YFWA 2F8NH 3AV1B 4ZUXA 3AFAA 1M1AD 3AZLD 3MGPA 3AZIC 4EO5C 2YFWB 5CPKD 4ZUXB 3AFAB 3AZJC 3EPJA 1KX4D 5B24C 3LZ1D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WA9 D;  3B0B A;  3REH D;  3AZI A;  1BH9 A;  3MGP B;  4WU9 D;  3X1T D;  2CV5 D;  1S32 A;  1P3P A;  1ZLA A;  1P3B D;  1KX3 D;  5B24 A;  4G92 B;  4QLC B;  1BH9 B;  5AV9 B;  3WTP A;  1P3P B;  5AV6 D;  5AV5 D;  1S32 B;  2HIO D;  1ZLA B;  2F8N K;  3TU4 B;  5GSU D;  1P3L A;  5B40 D;  3WTP B;  1P3A C;  1ID3 C;  5AY8 A;  5DNN D;  1U35 A;  1P34 C;  3AV2 C;  5E5A D;  4J8W D;  2PYO C;  5AY8 B;  1U35 B;  3AV2 A;  2F8N G;  4H9P A;  3B6F D;  2PYO A;  5B0Z B;  1AOI D;  3WKJ B;  5C3I C;  3B6G D;  5B1L D;  1M1A C;  4H9R A;  3REI A;  3WAA C;  3VH5 W;  5CP6 A;  3MNN D;  1KX4 C;  3WA9 C;  3WAA A;  3REH C;  3REI B;  2CV5 C;  4Z66 C;  3MGS D;  4UUZ A;  3MVD D;  3A6N C;  4DRB A;  4WU8 A;  1EQZ C;  4H9Q A;  3B0C W;  4Z66 A;  5AV5 C;  3A6N A;  4UUZ B;  1F66 B;  4H9S C;  1P3I D;  3R45 B;  1EQZ A;  3X1S B;  3REJ D;  4WU8 B;  4H9Q B;  5GSU C;  3B0D C;  2NQB A;  1N1J B;  5B2I A;  1P3M D;  2BYM B;  5DNN C;  4ZBJ B;  3LEL D;  2NQB B;  3AZN A;  5B2I B;  1P3O C;  3B6F C;  3O62 B;  5KDM A;  3W98 C;  3AN2 A;  3KUY A;  1P3O A;  5JRG D;  5B1L C;  3UTA D;  3AZM A;  3W98 A;  3AN2 B;  3KUY B;  3C1C D;  4YS3 D;  5BT1 D;  5GXQ D;  5B0Y D;  3MNN C;  1TZY A;  4XZQ D;  3AZM B;  4LD9 A;  5B32 B;  3MVD C;  5DNM D;  1KU5 A;  2HUE B;  1TZY B;  3REL A;  1HQ3 C;  4J8U D;  3X1V A;  4LD9 B;  4J8X C;  4R8P D;  1P3I C;  3KWQ C;  4KGC B;  3AZF B;  1HQ3 A;  3REJ C;  3REL B;  4Z2M H;  4Z5T C;  3X1V B;  4J8X A;  4YM6 A;  3KWQ A;  1M19 C;  2ARO D;  5AVB A;  5B33 B;  3NQJ A;  5AV8 A;  3MGR A;  5F99 A;  5B2J A;  4Z5T A;  1M19 A;  4X23 A;  3AYW B;  5AVB B;  2RVQ C;  3VH5 T;  5AV8 B;  3MGR B;  2BYK A;  5F99 B;  5B2J B;  3AFA D;  5B1M B;  2NZD D;  4X23 B;  4HGA B;  4AWL B;  5JRG C;  3W96 A;  3LJA C;  4WV4 B;  3W99 D;  3UTA C;  4G91 B;  2BYK B;  2CWE A;  3UT9 C;  4NE3 A;  4J8V A;  1P3F C;  3C1C C;  4QLC D;  5BT1 C;  5AV9 D;  3B0C T;  3LJA A;  3W96 B;  3AZH A;  1Q9C A;  4XZQ C;  3UT9 A;  4JJN C;  4J8V B;  5DNM C;  3TU4 D;  3AZK B;  3X1U A;  3AZH B;  3LZ0 D;  4J8U C;  2FJ7 A;  4JJN A;  1M18 A;  3AZE C;  4KHA A;  3UTB C;  3X1U B;  5GT3 D;  5AY8 D;  3AZE A;  2FJ7 B;  1M18 B;  3KXB C;  5BNV A;  2ARO C;  3UTB A;  1P3K C;  4DRA A;  5B0Z D;  3WKJ D;  3KXB A;  3AZJ A;  5AVC C;  1P3G C;  3W97 D;  3AZI B;  4EO5 B;  4KUD D;  1KX5 D;  5AVC A;  2NZD C;  3C1B C;  3AZJ B;  5BS7 C;  3REI D;  3REK C;  1P3G A;  5B24 B;  3W99 C;  4NE6 A;  3C1B A;  5JA4 A;  5AV9 C;  1F66 D;  1P3L B;  5GT0 D;  5CPJ D;  1P3A A;  1ID3 A;  3X1S D;  4WU8 D;  1B6W A;  5JA4 B;  1P34 A;  4XUJ D;  5CPI D;  3LZ0 C;  2F8N A;  4WZS B;  1P3A B;  1ID3 B;  1P34 B;  5GT3 C;  3AV2 B;  2NQB D;  4H9P B;  3AZL C;  5CPK C;  2PYO B;  1M1A A;  3O62 D;  3LZ1 C;  4H9R B;  3AZL A;  3WKJ C;  3X1T C;  4WU9 C;  4H9O A;  5CP6 B;  1P3B C;  5C3I B;  1KX3 C;  1KX4 A;  3LZ1 A;  1M1A B;  1JFI A;  3WA9 A;  3W97 C;  3REH A;  2CV5 A;  3WAA B;  3KUY D;  3X1T A;  4WU9 A;  4KUD C;  4M6B A;  5AV6 C;  4H9O B;  1KX5 C;  2HIO C;  1KX3 A;  1KX4 B;  3AZM D;  1JFI B;  5B32 D;  3WA9 B;  3REH B;  2CV5 B;  4Z66 B;  5B40 C;  5AV5 A;  1B67 A;  3A6N B;  4H9S A;  1BH8 A;  1EQZ B;  5GSU A;  5E5A C;  5GT0 C;  4J8W C;  5B31 D;  4KGC D;  5AV5 B;  3AZF D;  5CPJ C;  5G49 A;  3REL D;  1BH8 B;  5DNN A;  4NFT A;  4XUJ C;  3X1V D;  5E5A A;  5CPI C;  5GSU B;  4J8W A;  5FUG A;  3NQU A;  3B0D B;  5B33 D;  5G49 B;  3AZN B;  1AOI C;  5DNN B;  3B6G C;  3AZG D;  3AYW D;  5FUG B;  3NQU B;  4CSR A;  3B6F A;  3MGQ D;  5KDM B;  1P3O B;  5B2J D;  3B6G A;  5B1L A;  5B1M D;  2IO5 C;  3WTP E;  3B6F B;  4CSR B;  3MGS C;  3W98 B;  2LY8 A;  3MNN A;  5B1L B;  3MVD A;  3MNN B;  3AZK D;  3MVD B;  1P3I A;  5B32 G;  2L5A A;  1P3M C;  1ULY A;  3REJ A;  3AV1 D;  1HQ3 B;  3LEL C;  5B31 C;  1WWS A;  4J8X B;  4YM6 B;  3KWQ B;  1P3I B;  1P3M A;  5B31 G;  3NQJ B;  3REJ B;  4ZUX D;  4Z5T B;  1M19 B;  3MGP D;  3AZG C;  3MGQ C;  4H9N A;  3AZI D;  4YS3 C;  5JRG A;  5GXQ C;  5B0Y C;  3UTA A;  1S32 D;  1P3P D;  1ZLA D;  5BNX A;  1P3F A;  5B24 D;  3C1C A;  4H9N B;  5B0Y A;  5GXQ A;  5JRG B;  3LJA B;  3WTP D;  3UTA B;  4XZQ A;  5BNX B;  3UT9 B;  5CHL B;  1P3F B;  5DNM A;  4R8P C;  3C1C B;  1P3L D;  4Z2M G;  4J8U A;  4XZQ B;  1U35 D;  4JJN B;  5DNM B;  4KHA B;  3AV1 C;  4J8U B;  4CAY A;  3AZE B;  3AV2 D;  3VH6 W;  2ARO A;  5BNV B;  3UTB B;  1P3K A;  2PYO D;  4ZUX C;  3AFA C;  3KXB B;  3MGP C;  1P3K B;  5CP6 D;  4G92 C;  2NZD A;  5AVC B;  5BS7 A;  3REK A;  3WAA D;  4QLC C;  1P3G B;  1P3P C;  1ZLA C;  1S32 C;  3W99 A;  2NZD B;  3C1B B;  4QLC A;  5AV9 A;  3REK B;  4Z66 D;  3TU4 C;  1BFM A;  3WTP C;  3W99 B;  3A6N D;  4WNN A;  1EQZ D;  3TU4 A;  1P3L C;  3LZ0 A;  5B2I D;  2F8N B;  5AY8 C;  1U35 C;  4WNN B;  5GT3 A;  3LZ0 B;  5B0Z C;  3AZN D;  5CPK A;  5GT3 B;  5B0Z A;  3VH6 A;  3AZL B;  3AN2 D;  3WKJ A;  1P3O D;  5CPK B;  1P3B A;  3REI C;  3LZ1 B;  3W97 A;  5CP6 C;  3W98 D;  4KUD A;  3X1T B;  4WU9 B;  5AV6 A;  1KX5 A;  2HIO A;  3V9R A;  1TZY D;  1P3B B;  1KX3 B;  1F66 C;  3W97 B;  4LD9 D;  5B40 A;  4KUD B;  5AV6 B;  1KX5 B;  2HIO B;  3V9R B;  3X1S C;  4WU8 C;  1F66 A;  5GT0 A;  5B40 B;  5CPJ A;  3R45 A;  3X1S A;  1HQ3 D;  4ZBJ C;  4XUJ A;  5CPI A;  1N1J A;  4J8X D;  2NQB C;  5E5A B;  4YM6 D;  1H3O A;  2BYM A;  3VH6 T;  5BO0 A;  5GT0 B;  5B2I C;  5AVB D;  3KWQ D;  4J8W B;  5CPJ B;  5AV8 D;  3MGR D;  1AOI A;  5F99 D;  4Z5T D;  4XUJ B;  3O62 C;  5CPI B;  1M19 D;  1HTA A;  3AZN C;  1H3O B;  5BO0 B;  4X23 D;  1AOI B;  1TAF A;  3B6G B;  3O62 A;  3AN2 C;  3KUY C;  3MGS A;  2RVQ D;  3W96 D;  1TAF B;  2IO5 B;  3AZM C;  5B32 C;  4J8V D;  3MGS B;  3LJA D;  2HUE C;  3AZH D;  1TZY C;  1F1E A;  5B32 A;  3UT9 D;  1P3F D;  4LD9 C;  3VH5 A;  4KGC C;  3X1U D;  3AZF C;  2JSS A;  3REL C;  2FJ7 D;  1A7W A;  3X1V C;  4JJN D;  3LEL A;  1M18 D;  5B31 A;  4KGC A;  3AZF A;  5B33 C;  4E45 A;  1P3M B;  3AZE D;  2YFV A;  3LEL B;  4YM6 C;  3AYW C;  5B31 B;  5B33 A;  3UTB D;  5AVB C;  5AV8 C;  3MGR C;  5F99 C;  5B2J C;  3KXB D;  5B1M C;  3AZG A;  2YFV B;  3AYW A;  3AZJ D;  4X23 C;  4HGA C;  3MGQ A;  4AWL C;  1P3K D;  3KSY A;  4YS3 A;  4G91 C;  5B1M A;  4NE5 A;  3AZG B;  5AVC D;  1R4V A;  3MGQ B;  1P3G D;  3W96 C;  4YS3 B;  5GXQ B;  5B0Y B;  4E44 A;  3C1B D;  4J8V C;  3REK D;  3AZK C;  1WWI A;  4R8P A;  3AZH C;  1P3A D;  1ID3 D;  3AZK A;  1P34 D;  3X1U C;  4R8P B;  2F8N D;  3AV1 A;  1M18 C;  2FJ7 C;  4CAY B;  2ARO B;  2YFW A;  2F8N H;  3AV1 B;  4ZUX A;  3AFA A;  1M1A D;  3AZL D;  3MGP A;  3AZI C;  4EO5 C;  2YFW B;  5CPK D;  4ZUX B;  3AFA B;  3AZJ C;  1KX4 D;  5B24 C;  3LZ1 D; 
#chains in the Genus database with same CATH topology
 3WA9 D;  3B0B A;  3REH D;  3AZI A;  1BH9 A;  3MGP B;  4WU9 D;  3X1T D;  2CV5 D;  1S32 A;  1P3P A;  1ZLA A;  1P3B D;  1KX3 D;  5B24 A;  4G92 B;  4QLC B;  1BH9 B;  5AV9 B;  3WTP A;  1P3P B;  5AV6 D;  5AV5 D;  1S32 B;  2HIO D;  1ZLA B;  2F8N K;  3TU4 B;  5GSU D;  1P3L A;  5B40 D;  3WTP B;  1P3A C;  1ID3 C;  5AY8 A;  5DNN D;  1U35 A;  1P34 C;  3AV2 C;  5E5A D;  4J8W D;  2PYO C;  5AY8 B;  1U35 B;  3AV2 A;  2F8N G;  4H9P A;  3B6F D;  2PYO A;  5B0Z B;  1AOI D;  3WKJ B;  2RIQ A;  5C3I C;  3B6G D;  5B1L D;  1M1A C;  4H9R A;  3REI A;  3WAA C;  3VH5 W;  5CP6 A;  2J8P A;  2F2A C;  3FDD A;  3MNN D;  1KX4 C;  3WA9 C;  3WAA A;  3REH C;  3REI B;  2CV5 C;  4Z66 C;  3MGS D;  4UUZ A;  3MVD D;  3A6N C;  4DRB A;  4WU8 A;  1EQZ C;  4H9Q A;  3B0C W;  4Z66 A;  5AV5 C;  3A6N A;  4UUZ B;  1F66 B;  2Y2O A;  4H9S C;  1P3I D;  3R45 B;  1EQZ A;  3X1S B;  3REJ D;  4WU8 B;  4H9Q B;  5GSU C;  3B0D C;  2NQB A;  1N1J B;  5B2I A;  1P3M D;  2BYM B;  5DNN C;  4ZBJ B;  3LEL D;  2NQB B;  3AZN A;  5B2I B;  1P3O C;  2UWX A;  3B6F C;  3O62 B;  5KDM A;  3W98 C;  3AN2 A;  3KUY A;  1P3O A;  5JRG D;  3H0M C;  5B1L C;  3UTA D;  3AZM A;  1W2E A;  3W98 A;  3AN2 B;  3KUY B;  3C1C D;  4YS3 D;  5BT1 D;  5GXQ D;  5B0Y D;  3MNN C;  1TZY A;  4XZQ D;  3AZM B;  4LD9 A;  5B32 B;  3MVD C;  4WJ3 C;  5DNM D;  1KU5 A;  2HUE B;  1TZY B;  3EPK A;  3REL A;  1HQ3 C;  4J8U D;  3X1V A;  4LD9 B;  4J8X C;  4R8P D;  1P3I C;  3KWQ C;  4KGC B;  3AZF B;  3AL0 C;  1HQ3 A;  3REJ C;  3REL B;  4Z2M H;  4Z5T C;  3X1V B;  4J8X A;  4YM6 A;  3KWQ A;  1M19 C;  2ARO D;  5AVB A;  5B33 B;  3NQJ A;  5AV8 A;  3MGR A;  3EG5 B;  5F99 A;  5B2J A;  4Z5T A;  1M19 A;  4X23 A;  3AYW B;  5AVB B;  2RVQ C;  3VH5 T;  5AV8 B;  3MGR B;  2BYK A;  5F99 B;  5B2J B;  3AFA D;  5B1M B;  2NZD D;  4X23 B;  4HGA B;  4AWL B;  5JRG C;  3W96 A;  3LJA C;  4WV4 B;  3W99 D;  3UTA C;  4G91 B;  2BYK B;  2CWE A;  3UT9 C;  4NE3 A;  4J8V A;  1P3F C;  3C1C C;  4QLC D;  5BT1 C;  5AV9 D;  3B0C T;  3LJA A;  3W96 B;  3AZH A;  1Q9C A;  4XZQ C;  3UT9 A;  4JJN C;  4J8V B;  5DNM C;  3TU4 D;  3AZK B;  3X1U A;  3AZH B;  3LZ0 D;  4J8U C;  2FJ7 A;  4JJN A;  1M18 A;  3AZE C;  4KHA A;  3UTB C;  3X1U B;  5GT3 D;  5AY8 D;  3AZE A;  2FJ7 B;  1M18 B;  3KXB C;  5BNV A;  2ARO C;  3UTB A;  1P3K C;  4DRA A;  5B0Z D;  3WKJ D;  3KXB A;  3AZJ A;  5AVC C;  1P3G C;  3W97 D;  3AZI B;  4EO5 B;  2ZY5 A;  2Y2G A;  4KUD D;  1KX5 D;  5AVC A;  2NZD C;  3C1B C;  3AZJ B;  5BS7 C;  3REI D;  3REK C;  1P3G A;  4DQY B;  5B24 B;  3W99 C;  4NE6 A;  3C1B A;  5JA4 A;  5AV9 C;  1F66 D;  1P3L B;  5GT0 D;  5CPJ D;  1P3A A;  1ID3 A;  3X1S D;  4WU8 D;  1B6W A;  5JA4 B;  1P34 A;  4XUJ D;  5CPI D;  3LZ0 C;  2F8N A;  4WZS B;  1P3A B;  1ID3 B;  1P34 B;  5GT3 C;  3AV2 B;  2NQB D;  4H9P B;  3AZL C;  5CPK C;  2PYO B;  3A1K A;  1M1A A;  3O62 D;  3LZ1 C;  4H9R B;  3AZL A;  3WKJ C;  3X1T C;  4WU9 C;  4H9O A;  5CP6 B;  3A1I A;  1P3B C;  5C3I B;  1KX3 C;  1KX4 A;  3LZ1 A;  1M1A B;  1JFI A;  3WA9 A;  3W97 C;  3REH A;  2CV5 A;  3WAA B;  3KUY D;  3X1T A;  4WU9 A;  4KUD C;  4M6B A;  5AV6 C;  4H9O B;  1KX5 C;  2HIO C;  2JE5 A;  1KX3 A;  1KX4 B;  3AZM D;  1JFI B;  5B32 D;  3WA9 B;  3REH B;  2CV5 B;  4Z66 B;  5B40 C;  5AV5 A;  1B67 A;  3A6N B;  4H9S A;  1BH8 A;  1EQZ B;  5GSU A;  5E5A C;  5GT0 C;  4J8W C;  5B31 D;  4KGC D;  5AV5 B;  3AZF D;  5CPJ C;  5G49 A;  3REL D;  1BH8 B;  5DNN A;  4NFT A;  4XUJ C;  3X1V D;  5E5A A;  5CPI C;  2ZY2 A;  5GSU B;  5FUG A;  3NQU A;  3B0D B;  3EPL A;  4J8W A;  5B33 D;  5G49 B;  3AZN B;  1AOI C;  5DNN B;  3B6G C;  3AZG D;  3AYW D;  5FUG B;  3NQU B;  4CSR A;  3B6F A;  3MGQ D;  5KDM B;  1P3O B;  5B2J D;  3B6G A;  5B1L A;  5B1M D;  2IO5 C;  3WTP E;  3B6F B;  4CSR B;  3MGS C;  3W98 B;  2LY8 A;  3MNN A;  5B1L B;  4UPK A;  2Y2N A;  3MVD A;  3MNN B;  2Y2I A;  3AZK D;  3MVD B;  1P3I A;  5B32 G;  2L5A A;  1P3M C;  1ULY A;  3REJ A;  3AV1 D;  1HQ3 B;  3LEL C;  5B31 C;  1WWS A;  4J8X B;  4YM6 B;  3KWQ B;  1P3I B;  1P3M A;  5B31 G;  3NQJ B;  3REJ B;  3EPH A;  4ZUX D;  2BG1 A;  4Z5T B;  1M19 B;  3MGP D;  2DQN C;  3AZG C;  3MGQ C;  4H9N A;  3AZI D;  4YS3 C;  5JRG A;  5GXQ C;  5B0Y C;  3UTA A;  1S32 D;  1P3P D;  1ZLA D;  3KFU G;  5BNX A;  1P3F A;  3IP4 C;  5B24 D;  3C1C A;  4H9N B;  5B0Y A;  5GXQ A;  5JRG B;  3LJA B;  3WTP D;  3UTA B;  4XZQ A;  5BNX B;  3F6T A;  3UT9 B;  5CHL B;  1P3F B;  5DNM A;  4R8P C;  3C1C B;  1P3L D;  4Z2M G;  4J8U A;  4XZQ B;  1U35 D;  4JJN B;  5DNM B;  4KHA B;  3AV1 C;  2ZY3 A;  4J8U B;  4CAY A;  3AZE B;  3AV2 D;  3VH6 W;  2ARO A;  5BNV B;  3UTB B;  1P3K A;  2PYO D;  4ZUX C;  3AFA C;  3KXB B;  3MGP C;  1P3K B;  5CP6 D;  3H0R C;  2Y2Q A;  4G92 C;  2NZD A;  5AVC B;  5BS7 A;  3REK A;  1Z2C B;  3WAA D;  4QLC C;  1P3G B;  1P3P C;  1ZLA C;  1S32 C;  3W99 A;  2NZD B;  3C1B B;  2G5I C;  4QLC A;  5AV9 A;  4Z66 D;  3REK B;  3TU4 C;  1BFM A;  3WTP C;  3W99 B;  3A6N D;  4WNN A;  1EQZ D;  3TU4 A;  1P3L C;  3P5J B;  3LZ0 A;  5B2I D;  2F8N B;  5AY8 C;  1U35 C;  4WNN B;  2W8S A;  2Y2K A;  5GT3 A;  3LZ0 B;  5B0Z C;  3AZN D;  5CPK A;  5GT3 B;  5B0Z A;  3VH6 A;  3AZL B;  3AN2 D;  3WKJ A;  1P3O D;  5CPK B;  1P3B A;  3REI C;  3LZ1 B;  3W97 A;  5CP6 C;  3W98 D;  4KUD A;  3X1T B;  4WU9 B;  5AV6 A;  1KX5 A;  2HIO A;  2JCH A;  3V9R A;  1TZY D;  1P3B B;  2Y2M A;  1KX3 B;  1F66 C;  3W97 B;  4LD9 D;  2ZM5 A;  5B40 A;  4KUD B;  5AV6 B;  1KX5 B;  2HIO B;  3V9R B;  3X1S C;  4WU8 C;  1F66 A;  2ZY4 A;  5GT0 A;  5B40 B;  5CPJ A;  3R45 A;  3X1S A;  1HQ3 D;  4ZBJ C;  4XUJ A;  5CPI A;  1N1J A;  4J8X D;  2NQB C;  5E5A B;  4YM6 D;  1H3O A;  2BYM A;  3VH6 T;  5BO0 A;  5GT0 B;  5B2I C;  5AVB D;  3KWQ D;  4J8W B;  5CPJ B;  5AV8 D;  3MGR D;  1AOI A;  5F99 D;  4Z5T D;  4XUJ B;  3O62 C;  5CPI B;  1M19 D;  1HTA A;  3AZN C;  1H3O B;  5BO0 B;  4X23 D;  1PZR A;  1AOI B;  1TAF A;  3B6G B;  3O62 A;  3AN2 C;  1T3U A;  3MGS A;  3KUY C;  2RVQ D;  2XD5 A;  3W96 D;  2Y2P A;  1TAF B;  2XD1 A;  2IO5 B;  3AZM C;  5B32 C;  4J8V D;  3MGS B;  3LJA D;  2HUE C;  3AZH D;  1TZY C;  1F1E A;  5B32 A;  3UT9 D;  1P3F D;  4LD9 C;  3VH5 A;  4KGC C;  3X1U D;  3AZF C;  2JSS A;  3REL C;  2Y2H A;  2FJ7 D;  1A7W A;  3X1V C;  4JJN D;  3LEL A;  1M18 D;  2Y2J A;  5B31 A;  4KGC A;  3AZF A;  5B33 C;  4E45 A;  1P3M B;  3AZE D;  2YFV A;  3LEL B;  4YM6 C;  3AYW C;  5B31 B;  5B33 A;  3UTB D;  5AVB C;  5AV8 C;  3MGR C;  5F99 C;  5B2J C;  3KXB D;  5B1M C;  3AZG A;  2YFV B;  3AYW A;  3AZJ D;  4X23 C;  4HGA C;  3MGQ A;  4AWL C;  1P3K D;  3KSY A;  4YS3 A;  4G91 C;  5B1M A;  2Y2L A;  4NE5 A;  5AVC D;  3AZG B;  1R4V A;  3MGQ B;  1P3G D;  3W96 C;  4YS3 B;  5GXQ B;  5B0Y B;  4E44 A;  2G5H C;  3C1B D;  4J8V C;  3REK D;  3AZK C;  1WWI A;  4R8P A;  3AZH C;  2FFF B;  1P3A D;  1ID3 D;  3AZK A;  3H0L C;  1P34 D;  3X1U C;  4R8P B;  2VQR A;  2F8N D;  2DF4 C;  3AV1 A;  1M18 C;  2FJ7 C;  4CAY B;  2ARO B;  2YFW A;  2F8N H;  3AV1 B;  4ZUX A;  3AFA A;  1M1A D;  3AZL D;  3MGP A;  3AZI C;  4EO5 C;  2YFW B;  5CPK D;  4ZUX B;  3AFA B;  3AZJ C;  3EPJ A;  1KX4 D;  5B24 C;  3LZ1 D; 
#chains in the Genus database with same CATH homology
 3WA9 D;  3B0B A;  3REH D;  3AZI A;  1BH9 A;  3MGP B;  4WU9 D;  3X1T D;  2CV5 D;  1S32 A;  1P3P A;  1ZLA A;  1P3B D;  1KX3 D;  5B24 A;  4G92 B;  4QLC B;  1BH9 B;  5AV9 B;  3WTP A;  1P3P B;  5AV6 D;  5AV5 D;  1S32 B;  2HIO D;  1ZLA B;  2F8N K;  3TU4 B;  5GSU D;  1P3L A;  5B40 D;  3WTP B;  1P3A C;  1ID3 C;  5AY8 A;  5DNN D;  1U35 A;  1P34 C;  3AV2 C;  5E5A D;  4J8W D;  2PYO C;  5AY8 B;  1U35 B;  3AV2 A;  2F8N G;  4H9P A;  3B6F D;  2PYO A;  5B0Z B;  1AOI D;  3WKJ B;  2RIQ A;  5C3I C;  3B6G D;  5B1L D;  1M1A C;  4H9R A;  3REI A;  3WAA C;  3VH5 W;  5CP6 A;  2J8P A;  2F2A C;  3FDD A;  3MNN D;  1KX4 C;  3WA9 C;  3WAA A;  3REH C;  3REI B;  2CV5 C;  4Z66 C;  3MGS D;  4UUZ A;  3MVD D;  3A6N C;  4DRB A;  4WU8 A;  1EQZ C;  4H9Q A;  3B0C W;  4Z66 A;  5AV5 C;  3A6N A;  4UUZ B;  1F66 B;  2Y2O A;  4H9S C;  1P3I D;  3R45 B;  1EQZ A;  3X1S B;  3REJ D;  4WU8 B;  4H9Q B;  5GSU C;  3B0D C;  2NQB A;  1N1J B;  5B2I A;  1P3M D;  2BYM B;  5DNN C;  4ZBJ B;  3LEL D;  2NQB B;  3AZN A;  5B2I B;  1P3O C;  2UWX A;  3B6F C;  3O62 B;  5KDM A;  3W98 C;  3AN2 A;  3KUY A;  1P3O A;  5JRG D;  3H0M C;  5B1L C;  3UTA D;  3AZM A;  1W2E A;  3W98 A;  3AN2 B;  3KUY B;  3C1C D;  4YS3 D;  5BT1 D;  5GXQ D;  5B0Y D;  3MNN C;  1TZY A;  4XZQ D;  3AZM B;  4LD9 A;  5B32 B;  3MVD C;  4WJ3 C;  5DNM D;  1KU5 A;  2HUE B;  1TZY B;  3EPK A;  3REL A;  1HQ3 C;  4J8U D;  3X1V A;  4LD9 B;  4J8X C;  4R8P D;  1P3I C;  3KWQ C;  4KGC B;  3AZF B;  3AL0 C;  1HQ3 A;  3REJ C;  3REL B;  4Z2M H;  4Z5T C;  3X1V B;  4J8X A;  4YM6 A;  3KWQ A;  1M19 C;  2ARO D;  5AVB A;  5B33 B;  3NQJ A;  5AV8 A;  3MGR A;  3EG5 B;  5F99 A;  5B2J A;  4Z5T A;  1M19 A;  4X23 A;  3AYW B;  5AVB B;  2RVQ C;  3VH5 T;  5AV8 B;  3MGR B;  2BYK A;  5F99 B;  5B2J B;  3AFA D;  5B1M B;  2NZD D;  4X23 B;  4HGA B;  4AWL B;  5JRG C;  3W96 A;  3LJA C;  4WV4 B;  3W99 D;  3UTA C;  4G91 B;  2BYK B;  2CWE A;  3UT9 C;  4NE3 A;  4J8V A;  1P3F C;  3C1C C;  4QLC D;  5BT1 C;  5AV9 D;  3B0C T;  3LJA A;  3W96 B;  3AZH A;  1Q9C A;  4XZQ C;  3UT9 A;  4JJN C;  4J8V B;  5DNM C;  3TU4 D;  3AZK B;  3X1U A;  3AZH B;  3LZ0 D;  4J8U C;  2FJ7 A;  4JJN A;  1M18 A;  3AZE C;  4KHA A;  3UTB C;  3X1U B;  5GT3 D;  5AY8 D;  3AZE A;  2FJ7 B;  1M18 B;  3KXB C;  5BNV A;  2ARO C;  3UTB A;  1P3K C;  4DRA A;  5B0Z D;  3WKJ D;  3KXB A;  3AZJ A;  5AVC C;  1P3G C;  3W97 D;  3AZI B;  4EO5 B;  2ZY5 A;  2Y2G A;  4KUD D;  1KX5 D;  5AVC A;  2NZD C;  3C1B C;  3AZJ B;  5BS7 C;  3REI D;  3REK C;  1P3G A;  4DQY B;  5B24 B;  3W99 C;  4NE6 A;  3C1B A;  5JA4 A;  5AV9 C;  1F66 D;  1P3L B;  5GT0 D;  5CPJ D;  1P3A A;  1ID3 A;  3X1S D;  4WU8 D;  1B6W A;  5JA4 B;  1P34 A;  4XUJ D;  5CPI D;  3LZ0 C;  2F8N A;  4WZS B;  1P3A B;  1ID3 B;  1P34 B;  5GT3 C;  3AV2 B;  2NQB D;  4H9P B;  3AZL C;  5CPK C;  2PYO B;  3A1K A;  1M1A A;  3O62 D;  3LZ1 C;  4H9R B;  3AZL A;  3WKJ C;  3X1T C;  4WU9 C;  4H9O A;  5CP6 B;  3A1I A;  1P3B C;  5C3I B;  1KX3 C;  1KX4 A;  3LZ1 A;  1M1A B;  1JFI A;  3WA9 A;  3W97 C;  3REH A;  2CV5 A;  3WAA B;  3KUY D;  3X1T A;  4WU9 A;  4KUD C;  4M6B A;  5AV6 C;  4H9O B;  1KX5 C;  2HIO C;  2JE5 A;  1KX3 A;  1KX4 B;  3AZM D;  1JFI B;  5B32 D;  3WA9 B;  3REH B;  2CV5 B;  4Z66 B;  5B40 C;  5AV5 A;  1B67 A;  3A6N B;  4H9S A;  1BH8 A;  1EQZ B;  5GSU A;  5E5A C;  5GT0 C;  4J8W C;  5B31 D;  4KGC D;  5AV5 B;  3AZF D;  5CPJ C;  5G49 A;  3REL D;  1BH8 B;  5DNN A;  4NFT A;  4XUJ C;  3X1V D;  5E5A A;  5CPI C;  2ZY2 A;  5GSU B;  5FUG A;  3NQU A;  3B0D B;  3EPL A;  4J8W A;  5B33 D;  5G49 B;  3AZN B;  1AOI C;  5DNN B;  3B6G C;  3AZG D;  3AYW D;  5FUG B;  3NQU B;  4CSR A;  3B6F A;  3MGQ D;  5KDM B;  1P3O B;  5B2J D;  3B6G A;  5B1L A;  5B1M D;  2IO5 C;  3WTP E;  3B6F B;  4CSR B;  3MGS C;  3W98 B;  2LY8 A;  3MNN A;  5B1L B;  4UPK A;  2Y2N A;  3MVD A;  3MNN B;  2Y2I A;  3AZK D;  3MVD B;  1P3I A;  5B32 G;  2L5A A;  1P3M C;  1ULY A;  3REJ A;  3AV1 D;  1HQ3 B;  3LEL C;  5B31 C;  1WWS A;  4J8X B;  4YM6 B;  3KWQ B;  1P3I B;  1P3M A;  5B31 G;  3NQJ B;  3REJ B;  3EPH A;  4ZUX D;  2BG1 A;  4Z5T B;  1M19 B;  3MGP D;  2DQN C;  3AZG C;  3MGQ C;  4H9N A;  3AZI D;  4YS3 C;  5JRG A;  5GXQ C;  5B0Y C;  3UTA A;  1S32 D;  1P3P D;  1ZLA D;  3KFU G;  5BNX A;  1P3F A;  3IP4 C;  5B24 D;  3C1C A;  4H9N B;  5B0Y A;  5GXQ A;  5JRG B;  3LJA B;  3WTP D;  3UTA B;  4XZQ A;  5BNX B;  3F6T A;  3UT9 B;  5CHL B;  1P3F B;  5DNM A;  4R8P C;  3C1C B;  1P3L D;  4Z2M G;  4J8U A;  4XZQ B;  1U35 D;  4JJN B;  5DNM B;  4KHA B;  3AV1 C;  2ZY3 A;  4J8U B;  4CAY A;  3AZE B;  3AV2 D;  3VH6 W;  2ARO A;  5BNV B;  3UTB B;  1P3K A;  2PYO D;  4ZUX C;  3AFA C;  3KXB B;  3MGP C;  1P3K B;  5CP6 D;  3H0R C;  2Y2Q A;  4G92 C;  2NZD A;  5AVC B;  5BS7 A;  3REK A;  1Z2C B;  3WAA D;  4QLC C;  1P3G B;  1P3P C;  1ZLA C;  1S32 C;  3W99 A;  2NZD B;  3C1B B;  2G5I C;  4QLC A;  5AV9 A;  4Z66 D;  3REK B;  3TU4 C;  1BFM A;  3WTP C;  3W99 B;  3A6N D;  4WNN A;  1EQZ D;  3TU4 A;  1P3L C;  3P5J B;  3LZ0 A;  5B2I D;  2F8N B;  5AY8 C;  1U35 C;  4WNN B;  2W8S A;  2Y2K A;  5GT3 A;  3LZ0 B;  5B0Z C;  3AZN D;  5CPK A;  5GT3 B;  5B0Z A;  3VH6 A;  3AZL B;  3AN2 D;  3WKJ A;  1P3O D;  5CPK B;  1P3B A;  3REI C;  3LZ1 B;  3W97 A;  5CP6 C;  3W98 D;  4KUD A;  3X1T B;  4WU9 B;  5AV6 A;  1KX5 A;  2HIO A;  2JCH A;  3V9R A;  1TZY D;  1P3B B;  2Y2M A;  1KX3 B;  1F66 C;  3W97 B;  4LD9 D;  2ZM5 A;  5B40 A;  4KUD B;  5AV6 B;  1KX5 B;  2HIO B;  3V9R B;  3X1S C;  4WU8 C;  1F66 A;  2ZY4 A;  5GT0 A;  5B40 B;  5CPJ A;  3R45 A;  3X1S A;  1HQ3 D;  4ZBJ C;  4XUJ A;  5CPI A;  1N1J A;  4J8X D;  2NQB C;  5E5A B;  4YM6 D;  1H3O A;  2BYM A;  3VH6 T;  5BO0 A;  5GT0 B;  5B2I C;  5AVB D;  3KWQ D;  4J8W B;  5CPJ B;  5AV8 D;  3MGR D;  1AOI A;  5F99 D;  4Z5T D;  4XUJ B;  3O62 C;  5CPI B;  1M19 D;  1HTA A;  3AZN C;  1H3O B;  5BO0 B;  4X23 D;  1PZR A;  1AOI B;  1TAF A;  3B6G B;  3O62 A;  3AN2 C;  1T3U A;  3MGS A;  3KUY C;  2RVQ D;  2XD5 A;  3W96 D;  2Y2P A;  1TAF B;  2XD1 A;  2IO5 B;  3AZM C;  5B32 C;  4J8V D;  3MGS B;  3LJA D;  2HUE C;  3AZH D;  1TZY C;  1F1E A;  5B32 A;  3UT9 D;  1P3F D;  4LD9 C;  3VH5 A;  4KGC C;  3X1U D;  3AZF C;  2JSS A;  3REL C;  2Y2H A;  2FJ7 D;  1A7W A;  3X1V C;  4JJN D;  3LEL A;  1M18 D;  2Y2J A;  5B31 A;  4KGC A;  3AZF A;  5B33 C;  4E45 A;  1P3M B;  3AZE D;  2YFV A;  3LEL B;  4YM6 C;  3AYW C;  5B31 B;  5B33 A;  3UTB D;  5AVB C;  5AV8 C;  3MGR C;  5F99 C;  5B2J C;  3KXB D;  5B1M C;  3AZG A;  2YFV B;  3AYW A;  3AZJ D;  4X23 C;  4HGA C;  3MGQ A;  4AWL C;  1P3K D;  3KSY A;  4YS3 A;  4G91 C;  5B1M A;  2Y2L A;  4NE5 A;  5AVC D;  3AZG B;  1R4V A;  3MGQ B;  1P3G D;  3W96 C;  4YS3 B;  5GXQ B;  5B0Y B;  4E44 A;  2G5H C;  3C1B D;  4J8V C;  3REK D;  3AZK C;  1WWI A;  4R8P A;  3AZH C;  2FFF B;  1P3A D;  1ID3 D;  3AZK A;  3H0L C;  1P34 D;  3X1U C;  4R8P B;  2VQR A;  2F8N D;  2DF4 C;  3AV1 A;  1M18 C;  2FJ7 C;  4CAY B;  2ARO B;  2YFW A;  2F8N H;  3AV1 B;  4ZUX A;  3AFA A;  1M1A D;  3AZL D;  3MGP A;  3AZI C;  4EO5 C;  2YFW B;  5CPK D;  4ZUX B;  3AFA B;  3AZJ C;  3EPJ A;  1KX4 D;  5B24 C;  3LZ1 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...