4YM6C

Crystal structure of the human nucleosome containing 6-4pp (outside)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Structural basis of pyrimidine-pyrimidone (6-4) photoproduct recognition by UV-DDB in the nucleosome
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4ym6C00
4QLCC 3B0CW 5B32A 3C1CB 3AZGC 3KUYB 4WU8A 5B0ZD 4ZBJB 1HQ3B 3AV2D 3UTBC 5CPKD 3X1UA 3X1TC 3MVDA 1M19D 2HUEC 4J8VD 5B0ZC 4E45A 3AV2C 1P3AA 2F8NA 3AV1B 4J8WD 1M19C 4J8VC 2BYMB 5CPID 5F99A 4J8UD 1P3OB 5B2JA 5AV9A 3RELB 3UT9B 3AZIA 1P3GA 4J8WC 3AYWA 5CPIC 3V9RB 4J8UC 4XUJB 5C3IB 5FUGB 3AZHA 3VH6A 1N1JA 5B32D 4Z66A 5BS7A 3LZ0A 1S32A 4WU8D 2HIOC 1WWSA 3AZLB 1P3LA 5AV8B 5B32C 5G49B 3X1UD 3MVDD 2CV5A 4WU8C 4KUDB 5AV5B 4AWLB 3MGPA 3REKB 1P3AD 3X1UC 2F8ND 4XZQC 3MVDC 1P3FC 5F99D 5B2JD 5AV9D 1P3AC 3AZID 5BNVB 1P3GD 3X1VA 3AYWD 3REJB 4WNNB 1R4VA 5F99C 3UTBB 4H9SA 5B2JC 5AV9C 3X1TB 3AZHD 3AZIC 1P3OA 2HUEB 3AYWC 5B0ZB 4Z66D 3AV2B 3LZ0D 3V9RA 4CAYA 1S32D 4XUJA 5GT0A 5FUGA 3AZHC 3W96B 1TAFB 1P3LD 2PYOC 4Z66C 5BS7C 5B31A 3LZ0C 1S32C 2CV5D 1P3LC 3MGPD 4H9OA 5CPIB 3AZLA 4J8UB 3MGRA 2CV5C 3LZ1C 3R45B 2IO5C 5AV5A 5DNNC 3MGPC 2AROA 1U35A 1KX5A 4CSRA 3REKA 4X23B 2NQBA 2HIOB 5JA4B 3REHA 4EO5C 5B32B 1P3OD 3AZJA 3X1VC 4WU8B 3REJA 4WNNA 4H9SC 3UTAA 3UTBA 4XUJD 5GT0D 1P3BA 1P3OC 4XZQB 3MVDB 3X1TA 1M1AB 1P3FB 2CWEA 1P3IA 5B31D 5GT0C 1KU5A 4KHAA 3W96A 1TAFA 3AZLD 5F99B 5B31C 5AY8A 5AV9B 3LJAC 3MGRD 3B0CT 4KUDD 5AV5D 3AZLC 2AROD 1U35D 1KX5D 3REKD 2NQBD 3VH5W 3MGRC 3AZHB 4H9PB 3REHD 1N1JB 2PYOB 4LD9A 5B33B 2AROC 1U35C 1KX5C 3WKJC 3AZJD 3REKC 1S32B 2NQBC 1TZYB 4X23A 2HIOA 1P3LB 4UUZB 3REJD 3REHC 5JA4A 3WAAC 3UTAD 3UTBD 1P3BD 3AZJC 4NFTA 3X1TD 3AFAA 2CV5B 4H9RA 5B2IC 3LZ1B 1P3ID 3MGPB 2IO5B 5DNNB 3REJC 3UTAC 1P3BC 4H9QA 4XZQA 3AZFC 1M1AA 3W96D 1F66C 1P3IC 1P3FA 2NZDA 4EO5B 4NE3A 5AY8D 3X1VB 3W96C 5AVBB 5AY8C 3AZNC 3AZKC 4ZUXA 4LD9D 3KWQA 5CPJC 3W97A 4CAYB 5GT0B 5BO0A 4HGAC 4X23D 2HIOD 4H9PA 4LD9C 2PYOA 5B31B 5B33A 3REIA 3AFAD 3LJAB 2YFVA 4X23C 1TZYA 1EQZB 4H9OB 2LY8A 4UUZA 3W98A 5E5AA 5DNMC 3B0BA 3NQJA 3AFAC 3MGRB 4XZQD 1M1AD 2NZDD 1P3FD 3LZ1A 2AROB 5DNNA 1U35B 1KX5B 3WKJB 4CSRB 2NQBB 1KX3B 3MGSA 1M1AC 2NZDC 3REHB 3WAAB 5GSUA 3AZJB 4ZUXD 5B1LA 3B6GB 5B2IB 3KWQD 5AVBA 3W97D 3UTAB 4YS3B 1P3BB 4ZUXC 3KXBB 1AOIA 4KGCC 3AZFB 1F66B 3KWQC 1P3IB 2PYOD 5B33D 3REID 3AZMB 3W97C 4WV4B 4KHAB 2FJ7A 1TZYD 3W98D 5E5AD 4G92B 4R8PA 3REIC 5B33C 5B1MA 3TU4C 5AY8B 2RVQD 3AZNB 3AZKB 3LJAA 1TZYC 3LZ1D 1EQZA 3W98C 5E5AC 5DNND 1KX4C 4WU9A 5CPJB 1A7WA 3AN2A 2RVQC 5GT3A 1P34A 4HGAB 3MGSD 1BFMA 4LD9B 3KSYA 5GSUD 3WKJA 5B1LD 5AVCA 3LELA 3MGSC 3X1VD 1KX3A 5AVBD 5DNMB 5GSUC 3WAAA 5B1LC 3AFAB 1AOID 3B6GA 4H9RB 5B2IA 5AVBC 1JFIB 4YS3A 4H9QB 2FJ7D 1AOIC 3KXBA 2NZDB 1B67A 4E44A 3MGQA 3AZFA 4R8PD 1F66A 5B1MD 3VH5T 5BT1D 4DRBA 3AZMA 3X1SA 3LJAD 2FJ7C 5GXQA 1EQZD 4H9NB 4R8PC 4WU9D 5B1MC 3AN2D 5GT3D 5BT1C 1P34D 4ZUXB 3WA9B 1BH9B 3AZKA 3AZNA 4KGCB 2BYKA 4Z2MH 3KWQB 3NQUA 1EQZC 1P3PC 4WU9C 3W97B 3WKJD 3AN2C 5CPJA 5GT3C 2JSSA 5AVCD 5BO0B 3LELD 1P34C 1KX3D 3W99C 3REIB 3WAAD 3TU4B 1ID3A 5AVCC 3LELC 2YFVB 3B6GD 5CHLB 5AV6A 1KX3C 5B2ID 3W98B 5E5AB 5B40C 1KX4B 5DNMA 3NQJB 4YS3D 5B24C 4Z2MG 3B6GC 3KXBD 3MGQD 4Z5TC 3AZFD 1F66D 5JRGA 3AZMD 3AZEC 1M18A 4YS3C 3MNNA 3X1SD 1JFIA 3MGSB 3WTPE 3KXBC 5GXQD 3C1BA 3MGQC 5CP6A 3A6NA 5GSUB 3AZMC 3VH5A 5B1LB 3X1SC 3AZND 3AZKD 5GXQC 5KDMA 3WTPA 4H9NA 4G92C 5CPJD 3O62A 1P3KC 1AOIB 3WA9A 1BH9A 4KGCA 4G91B 1ID3D 2FJ7B 3VH6W 5AV6D 1Q9CA 5BNXB 4R8PB 5B1MB 5DNMD 1ID3C 3TU4A 5AV6C 5CPKC 3B0DC 1P3PB 5JRGD 1HTAA 4WU9B 1M18D 3AN2B 1KX4A 3MNND 5GT3B 1P3MB 4JJNB 1P34B 2F8NH 3C1BD 3W99B 5B32G 5CP6D 5B0YA 3A6ND 5JRGC 1M18C 3MNNC 5AVCB 3LELB 3C1BC 1BH8A 2YFWB 3WTPD 5B40B 5CP6C 3A6NC 3O62D 1F1EA 5B24B 4J8XB 3B6FA 3WA9D 4KGCD 4Z5TB 3WTPC 4YM6A 3AZEB 1ZLAB 3O62C 2F8NG 3WA9C 1H3OB 3MGQB 3C1CA 3KUYA 3TU4D 3X1SB 1HQ3A 5GXQB 5BNXA 1KX4D 4QLCB 1P3KB 2BYKB 3AZGB 3NQUB 5B0YD 1P3PA 3AV1A 1WWIA 1P3MA 4JJNA 2BYMA 5B0YC 3W99A 1P3GC 3RELA 3UT9A 1ID3B 3B6FD 4NE6A 5AV6B 2F8NK 5CPKB 3B0DB 2YFWA 4YM6D 2L5AA 5B40A 1M19B 4J8VB 3B6FC 5B24A 4J8XA 3C1CD 3KUYD 4Z5TA 4YM6C 5JRGB 1M18B 4J8WB 3MNNB 3AZEA 1ZLAA 1HQ3D 5AV8A 3C1BB 5G49A 3C1CC 3KUYC 1H3OA 4G91C 5CP6B 3A6NB 4KUDA 4M6BA 1HQ3C 4ZBJC 5KDMB 3WTPB 1P3PD 3AV1D 3O62B 1P3MD 4JJND 4QLCA 1P3KA 3AZGA 3W99D 5B31G 3RELD 3UT9D 5BNVA 3AV1C 1P3MC 4JJNC 3X1UB 5B40D 3RELC 3UT9C 5B24D 5B0ZA 4J8XD 3AV2A 1P3AB 4Z5TD 4XUJC 5C3IC 5CPKA 2F8NB 4WZSB 1ULYA 3AZED 1ZLAD 4NE5A 1M19A 4J8VA 5AV8D 4J8XC 5B2JB 5B0YB 1B6WA 3AZIB 1P3GB 3AYWB 1ZLAC 4J8WA 5AV8C 5CPIA 1BH8B 4J8UA 4DRAA 4KUDC 3VH6T 5AV5C 4AWLC 4QLCD 4Z66B 1P3KD 3R45A 3B6FB 3LZ0B 3AZGD 4YM6B
chains in the Genus database with same CATH superfamily
4QLCC 3B0CW 5B32A 3C1CB 3AZGC 3KUYB 3H0MC 4WU8A 5B0ZD 4ZBJB 1HQ3B 3AV2D 3UTBC 5CPKD 3X1UA 3X1TC 3MVDA 1M19D 2HUEC 4J8VD 5B0ZC 4E45A 3AV2C 1P3AA 2F8NA 3AV1B 4J8WD 1M19C 4J8VC 2BYMB 5CPID 5F99A 4J8UD 1P3OB 5B2JA 5AV9A 3RELB 3UT9B 3AZIA 1P3GA 2Y2JA 4J8WC 3AYWA 5CPIC 3V9RB 4J8UC 4XUJB 5C3IB 5FUGB 3AZHA 3VH6A 1N1JA 2UWXA 5B32D 4Z66A 5BS7A 3LZ0A 1S32A 4WU8D 2HIOC 1WWSA 3AZLB 1P3LA 5AV8B 5B32C 5G49B 3X1UD 3MVDD 2CV5A 4WU8C 4KUDB 5AV5B 4AWLB 3MGPA 3REKB 1P3AD 3X1UC 2F8ND 4XZQC 3MVDC 1P3FC 5F99D 5B2JD 5AV9D 1P3AC 3AZID 5BNVB 1P3GD 3X1VA 3AYWD 3REJB 4WNNB 1R4VA 5F99C 3UTBB 4H9SA 2Y2HA 5B2JC 5AV9C 3X1TB 3AZHD 3AZIC 1P3OA 2HUEB 3AYWC 5B0ZB 4Z66D 3AV2B 3LZ0D 3V9RA 4CAYA 1S32D 4XUJA 5GT0A 5FUGA 3AZHC 3W96B 1TAFB 1P3LD 2PYOC 4Z66C 5BS7C 5B31A 3LZ0C 1S32C 2CV5D 3A1IA 1P3LC 3MGPD 4H9OA 5CPIB 3AZLA 4J8UB 3A1KA 3MGRA 2CV5C 3LZ1C 3R45B 2IO5C 5AV5A 5DNNC 3MGPC 2AROA 1U35A 1KX5A 4CSRA 3REKA 4X23B 2NQBA 2HIOB 5JA4B 3REHA 2J8PA 2W8SA 4EO5C 5B32B 4UPKA 1P3OD 3AZJA 3X1VC 4WU8B 3REJA 4WNNA 4H9SC 3UTAA 3UTBA 4XUJD 5GT0D 1P3BA 1P3OC 4XZQB 3MVDB 3X1TA 1M1AB 1P3FB 2CWEA 1P3IA 5B31D 5GT0C 1KU5A 4KHAA 3W96A 1TAFA 3AZLD 5F99B 5B31C 5AY8A 5AV9B 3LJAC 3MGRD 2ZM5A 3B0CT 4KUDD 5AV5D 3AZLC 2AROD 1U35D 1KX5D 3IP4C 3REKD 2NQBD 3VH5W 3MGRC 3AZHB 4H9PB 3REHD 1N1JB 2PYOB 4LD9A 5B33B 2AROC 1U35C 1KX5C 3WKJC 3AZJD 3REKC 1S32B 2NQBC 1TZYB 4X23A 2HIOA 1P3LB 4UUZB 3REJD 3REHC 5JA4A 3WAAC 3UTAD 3UTBD 2G5IC 3AZJC 1P3BD 4NFTA 3X1TD 3AFAA 2CV5B 4H9RA 5B2IC 3LZ1B 1P3ID 3MGPB 2IO5B 5DNNB 3REJC 3UTAC 1P3BC 2Y2MA 4H9QA 4XZQA 3AZFC 1M1AA 3W96D 1F66C 1P3IC 1P3FA 2NZDA 4EO5B 4NE3A 5AY8D 3EPKA 3X1VB 3W96C 5AVBB 5AY8C 2XD1A 3AZNC 3AZKC 4ZUXA 4LD9D 3KWQA 1PZRA 5CPJC 3P5JB 3W97A 4CAYB 5GT0B 5BO0A 4HGAC 4X23D 2HIOD 4H9PA 4LD9C 2PYOA 3EPLA 5B31B 5B33A 3REIA 3AFAD 3LJAB 2YFVA 4X23C 1TZYA 1EQZB 4H9OB 2LY8A 4UUZA 3W98A 5E5AA 5DNMC 3B0BA 3NQJA 3AFAC 3MGRB 4XZQD 1M1AD 2NZDD 1P3FD 3LZ1A 2AROB 5DNNA 1U35B 1KX5B 3WKJB 4CSRB 2NQBB 1KX3B 3MGSA 1M1AC 2NZDC 3REHB 3WAAB 5GSUA 3AZJB 4ZUXD 5B1LA 3B6GB 5B2IB 3KWQD 5AVBA 3W97D 3UTAB 4YS3B 2Y2OA 1P3BB 4ZUXC 3KXBB 1AOIA 4KGCC 3AZFB 1F66B 3KWQC 1P3IB 2PYOD 5B33D 3REID 3AZMB 3W97C 4WV4B 4KHAB 2FJ7A 1TZYD 3AL0C 2DQNC 3W98D 5E5AD 4G92B 4R8PA 3REIC 5B33C 5B1MA 3TU4C 5AY8B 2RVQD 3AZNB 3AZKB 3LJAA 1TZYC 3LZ1D 2Y2QA 1EQZA 3W98C 5E5AC 5DNND 1KX4C 4WU9A 5CPJB 1A7WA 3AN2A 2RVQC 5GT3A 1P34A 4HGAB 3MGSD 1BFMA 4LD9B 3KSYA 5GSUD 3WKJA 2Y2NA 5B1LD 5AVCA 3LELA 3MGSC 3X1VD 1KX3A 5AVBD 1W2EA 5DNMB 5GSUC 3WAAA 2Y2KA 5B1LC 3AFAB 1AOID 3B6GA 4H9RB 5B2IA 5AVBC 1JFIB 4YS3A 4H9QB 2FJ7D 1AOIC 3KXBA 2NZDB 1B67A 4E44A 3MGQA 3AZFA 4R8PD 1F66A 5B1MD 3VH5T 5BT1D 4DRBA 3AZMA 3X1SA 3LJAD 2FJ7C 5GXQA 1EQZD 4H9NB 4R8PC 4WU9D 5B1MC 3AN2D 5GT3D 5BT1C 1P34D 4ZUXB 2ZY2A 3WA9B 1BH9B 3AZKA 3AZNA 4KGCB 2BYKA 4Z2MH 3KWQB 3NQUA 1EQZC 1P3PC 4WU9C 3W97B 3WKJD 3AN2C 5CPJA 5GT3C 2JSSA 5AVCD 5BO0B 3LELD 1P34C 3EPHA 1KX3D 3W99C 3REIB 3WAAD 3TU4B 1ID3A 5AVCC 3LELC 2YFVB 3B6GD 5CHLB 5AV6A 1KX3C 5B2ID 3W98B 5E5AB 5B40C 1KX4B 5DNMA 3NQJB 4YS3D 5B24C 4Z2MG 3B6GC 3KXBD 3MGQD 4Z5TC 3AZFD 1F66D 5JRGA 3AZMD 3AZEC 1M18A 4YS3C 3MNNA 3X1SD 1JFIA 3MGSB 4WJ3C 3WTPE 3KXBC 5GXQD 3C1BA 3MGQC 5CP6A 3A6NA 5GSUB 3AZMC 3VH5A 5B1LB 3X1SC 3AZND 3AZKD 2G5HC 5GXQC 5KDMA 3WTPA 4H9NA 4G92C 5CPJD 3O62A 1P3KC 1AOIB 3WA9A 1BH9A 4KGCA 4G91B 1ID3D 2FJ7B 3VH6W 5AV6D 3H0RC 1Q9CA 5BNXB 4R8PB 5B1MB 5DNMD 1ID3C 2Y2IA 3TU4A 5AV6C 3H0LC 5CPKC 3B0DC 3EPJA 1P3PB 5JRGD 1HTAA 4WU9B 1M18D 3FDDA 3AN2B 3MNND 5GT3B 1KX4A 1P3MB 4JJNB 1P34B 2F8NH 3C1BD 2ZY4A 3W99B 5B32G 5CP6D 5B0YA 3A6ND 5JRGC 1T3UA 1M18C 3MNNC 5AVCB 3LELB 3C1BC 1BH8A 2YFWB 3WTPD 5B40B 5CP6C 3A6NC 3O62D 1F1EA 2Y2LA 5B24B 4J8XB 3B6FA 3WA9D 4KGCD 4Z5TB 3WTPC 4YM6A 3AZEB 1ZLAB 3O62C 2F8NG 3WA9C 1H3OB 2Y2GA 3MGQB 3C1CA 3KUYA 3TU4D 4DQYB 1Z2CB 3X1SB 1HQ3A 5GXQB 5BNXA 1KX4D 4QLCB 1P3KB 2BYKB 2RIQA 3AZGB 3NQUB 5B0YD 2Y2PA 1P3PA 3AV1A 1WWIA 1P3MA 4JJNA 2BYMA 5B0YC 3W99A 1P3GC 3RELA 3UT9A 1ID3B 3B6FD 4NE6A 5AV6B 2F8NK 5CPKB 3B0DB 2YFWA 4YM6D 3KFUG 2L5AA 5B40A 1M19B 4J8VB 3B6FC 5B24A 4J8XA 3C1CD 3KUYD 4Z5TA 4YM6C 5JRGB 1M18B 4J8WB 3MNNB 3AZEA 1ZLAA 1HQ3D 5AV8A 3C1BB 5G49A 3C1CC 3KUYC 1H3OA 4G91C 5CP6B 2F2AC 2BG1A 3A6NB 2ZY3A 4KUDA 4M6BA 1HQ3C 4ZBJC 5KDMB 3WTPB 1P3PD 3AV1D 3O62B 1P3MD 4JJND 4QLCA 1P3KA 3AZGA 3W99D 5B31G 3RELD 3UT9D 2JCHA 5BNVA 3AV1C 1P3MC 4JJNC 3X1UB 5B40D 3RELC 2FFFB 3UT9C 5B24D 5B0ZA 4J8XD 3AV2A 1P3AB 4Z5TD 4XUJC 5C3IC 5CPKA 2F8NB 4WZSB 1ULYA 2VQRA 3AZED 1ZLAD 4NE5A 1M19A 4J8VA 5AV8D 4J8XC 5B2JB 5B0YB 1B6WA 3AZIB 1P3GB 3AYWB 1ZLAC 4J8WA 5AV8C 5CPIA 1BH8B 4J8UA 2JE5A 2ZY5A 4DRAA 2DF4C 4KUDC 3VH6T 5AV5C 4AWLC 4QLCD 4Z66B 1P3KD 3R45A 3B6FB 3LZ0B 3AZGD 2XD5A 3F6TA 4YM6B 3EG5B
chains in the Genus database with same CATH topology
4QLCC 3B0CW 5B32A 3C1CB 3AZGC 3KUYB 3H0MC 4WU8A 5B0ZD 4ZBJB 1HQ3B 3AV2D 3UTBC 5CPKD 3X1UA 3X1TC 3MVDA 1M19D 2HUEC 4J8VD 5B0ZC 4E45A 3AV2C 1P3AA 2F8NA 3AV1B 4J8WD 1M19C 4J8VC 2BYMB 5CPID 5F99A 4J8UD 1P3OB 5B2JA 5AV9A 3RELB 3UT9B 3AZIA 1P3GA 2Y2JA 4J8WC 3AYWA 5CPIC 3V9RB 4J8UC 4XUJB 5C3IB 5FUGB 3AZHA 3VH6A 1N1JA 2UWXA 5B32D 4Z66A 5BS7A 3LZ0A 1S32A 4WU8D 2HIOC 1WWSA 3AZLB 1P3LA 5AV8B 5B32C 5G49B 3X1UD 3MVDD 2CV5A 4WU8C 4KUDB 5AV5B 4AWLB 3MGPA 3REKB 1P3AD 3X1UC 2F8ND 4XZQC 3MVDC 1P3FC 5F99D 5B2JD 5AV9D 1P3AC 3AZID 5BNVB 1P3GD 3X1VA 3AYWD 3REJB 4WNNB 1R4VA 5F99C 3UTBB 4H9SA 2Y2HA 5B2JC 5AV9C 3X1TB 3AZHD 3AZIC 1P3OA 2HUEB 3AYWC 5B0ZB 4Z66D 3AV2B 3LZ0D 3V9RA 4CAYA 1S32D 4XUJA 5GT0A 5FUGA 3AZHC 3W96B 1TAFB 1P3LD 2PYOC 4Z66C 5BS7C 5B31A 3LZ0C 1S32C 2CV5D 3A1IA 1P3LC 3MGPD 4H9OA 5CPIB 3AZLA 4J8UB 3A1KA 3MGRA 2CV5C 3LZ1C 3R45B 2IO5C 5AV5A 5DNNC 3MGPC 2AROA 1U35A 1KX5A 4CSRA 3REKA 4X23B 2NQBA 2HIOB 5JA4B 3REHA 2J8PA 2W8SA 4EO5C 5B32B 4UPKA 1P3OD 3AZJA 3X1VC 4WU8B 3REJA 4WNNA 4H9SC 3UTAA 3UTBA 4XUJD 5GT0D 1P3BA 1P3OC 4XZQB 3MVDB 3X1TA 1M1AB 1P3FB 2CWEA 1P3IA 5B31D 5GT0C 1KU5A 4KHAA 3W96A 1TAFA 3AZLD 5F99B 5B31C 5AY8A 5AV9B 3LJAC 3MGRD 2ZM5A 3B0CT 4KUDD 5AV5D 3AZLC 2AROD 1U35D 1KX5D 3IP4C 3REKD 2NQBD 3VH5W 3MGRC 3AZHB 4H9PB 3REHD 1N1JB 2PYOB 4LD9A 5B33B 2AROC 1U35C 1KX5C 3WKJC 3AZJD 3REKC 1S32B 2NQBC 1TZYB 4X23A 2HIOA 1P3LB 4UUZB 3REJD 3REHC 5JA4A 3WAAC 3UTAD 3UTBD 2G5IC 3AZJC 1P3BD 4NFTA 3X1TD 3AFAA 2CV5B 4H9RA 5B2IC 3LZ1B 1P3ID 3MGPB 2IO5B 5DNNB 3REJC 3UTAC 1P3BC 2Y2MA 4H9QA 4XZQA 3AZFC 1M1AA 3W96D 1F66C 1P3IC 1P3FA 2NZDA 4EO5B 4NE3A 5AY8D 3EPKA 3X1VB 3W96C 5AVBB 5AY8C 2XD1A 3AZNC 3AZKC 4ZUXA 4LD9D 3KWQA 1PZRA 5CPJC 3P5JB 3W97A 4CAYB 5GT0B 5BO0A 4HGAC 4X23D 2HIOD 4H9PA 4LD9C 2PYOA 3EPLA 5B31B 5B33A 3REIA 3AFAD 3LJAB 2YFVA 4X23C 1TZYA 1EQZB 4H9OB 2LY8A 4UUZA 3W98A 5E5AA 5DNMC 3B0BA 3NQJA 3AFAC 3MGRB 4XZQD 1M1AD 2NZDD 1P3FD 3LZ1A 2AROB 5DNNA 1U35B 1KX5B 3WKJB 4CSRB 2NQBB 1KX3B 3MGSA 1M1AC 2NZDC 3REHB 3WAAB 5GSUA 3AZJB 4ZUXD 5B1LA 3B6GB 5B2IB 3KWQD 5AVBA 3W97D 3UTAB 4YS3B 2Y2OA 1P3BB 4ZUXC 3KXBB 1AOIA 4KGCC 3AZFB 1F66B 3KWQC 1P3IB 2PYOD 5B33D 3REID 3AZMB 3W97C 4WV4B 4KHAB 2FJ7A 1TZYD 3AL0C 2DQNC 3W98D 5E5AD 4G92B 4R8PA 3REIC 5B33C 5B1MA 3TU4C 5AY8B 2RVQD 3AZNB 3AZKB 3LJAA 1TZYC 3LZ1D 2Y2QA 1EQZA 3W98C 5E5AC 5DNND 1KX4C 4WU9A 5CPJB 1A7WA 3AN2A 2RVQC 5GT3A 1P34A 4HGAB 3MGSD 1BFMA 4LD9B 3KSYA 5GSUD 3WKJA 2Y2NA 5B1LD 5AVCA 3LELA 3MGSC 3X1VD 1KX3A 5AVBD 1W2EA 5DNMB 5GSUC 3WAAA 2Y2KA 5B1LC 3AFAB 1AOID 3B6GA 4H9RB 5B2IA 5AVBC 1JFIB 4YS3A 4H9QB 2FJ7D 1AOIC 3KXBA 2NZDB 1B67A 4E44A 3MGQA 3AZFA 4R8PD 1F66A 5B1MD 3VH5T 5BT1D 4DRBA 3AZMA 3X1SA 3LJAD 2FJ7C 5GXQA 1EQZD 4H9NB 4R8PC 4WU9D 5B1MC 3AN2D 5GT3D 5BT1C 1P34D 4ZUXB 2ZY2A 3WA9B 1BH9B 3AZKA 3AZNA 4KGCB 2BYKA 4Z2MH 3KWQB 3NQUA 1EQZC 1P3PC 4WU9C 3W97B 3WKJD 3AN2C 5CPJA 5GT3C 2JSSA 5AVCD 5BO0B 3LELD 1P34C 3EPHA 1KX3D 3W99C 3REIB 3WAAD 3TU4B 1ID3A 5AVCC 3LELC 2YFVB 3B6GD 5CHLB 5AV6A 1KX3C 5B2ID 3W98B 5E5AB 5B40C 1KX4B 5DNMA 3NQJB 4YS3D 5B24C 4Z2MG 3B6GC 3KXBD 3MGQD 4Z5TC 3AZFD 1F66D 5JRGA 3AZMD 3AZEC 1M18A 4YS3C 3MNNA 3X1SD 1JFIA 3MGSB 4WJ3C 3WTPE 3KXBC 5GXQD 3C1BA 3MGQC 5CP6A 3A6NA 5GSUB 3AZMC 3VH5A 5B1LB 3X1SC 3AZND 3AZKD 2G5HC 5GXQC 5KDMA 3WTPA 4H9NA 4G92C 5CPJD 3O62A 1P3KC 1AOIB 3WA9A 1BH9A 4KGCA 4G91B 1ID3D 2FJ7B 3VH6W 5AV6D 3H0RC 1Q9CA 5BNXB 4R8PB 5B1MB 5DNMD 1ID3C 2Y2IA 3TU4A 5AV6C 3H0LC 5CPKC 3B0DC 3EPJA 1P3PB 5JRGD 1HTAA 4WU9B 1M18D 3FDDA 3AN2B 3MNND 5GT3B 1KX4A 1P3MB 4JJNB 1P34B 2F8NH 3C1BD 2ZY4A 3W99B 5B32G 5CP6D 5B0YA 3A6ND 5JRGC 1T3UA 1M18C 3MNNC 5AVCB 3LELB 3C1BC 1BH8A 2YFWB 3WTPD 5B40B 5CP6C 3A6NC 3O62D 1F1EA 2Y2LA 5B24B 4J8XB 3B6FA 3WA9D 4KGCD 4Z5TB 3WTPC 4YM6A 3AZEB 1ZLAB 3O62C 2F8NG 3WA9C 1H3OB 2Y2GA 3MGQB 3C1CA 3KUYA 3TU4D 4DQYB 1Z2CB 3X1SB 1HQ3A 5GXQB 5BNXA 1KX4D 4QLCB 1P3KB 2BYKB 2RIQA 3AZGB 3NQUB 5B0YD 2Y2PA 1P3PA 3AV1A 1WWIA 1P3MA 4JJNA 2BYMA 5B0YC 3W99A 1P3GC 3RELA 3UT9A 1ID3B 3B6FD 4NE6A 5AV6B 2F8NK 5CPKB 3B0DB 2YFWA 4YM6D 3KFUG 2L5AA 5B40A 1M19B 4J8VB 3B6FC 5B24A 4J8XA 3C1CD 3KUYD 4Z5TA 4YM6C 5JRGB 1M18B 4J8WB 3MNNB 3AZEA 1ZLAA 1HQ3D 5AV8A 3C1BB 5G49A 3C1CC 3KUYC 1H3OA 4G91C 5CP6B 2F2AC 2BG1A 3A6NB 2ZY3A 4KUDA 4M6BA 1HQ3C 4ZBJC 5KDMB 3WTPB 1P3PD 3AV1D 3O62B 1P3MD 4JJND 4QLCA 1P3KA 3AZGA 3W99D 5B31G 3RELD 3UT9D 2JCHA 5BNVA 3AV1C 1P3MC 4JJNC 3X1UB 5B40D 3RELC 2FFFB 3UT9C 5B24D 5B0ZA 4J8XD 3AV2A 1P3AB 4Z5TD 4XUJC 5C3IC 5CPKA 2F8NB 4WZSB 1ULYA 2VQRA 3AZED 1ZLAD 4NE5A 1M19A 4J8VA 5AV8D 4J8XC 5B2JB 5B0YB 1B6WA 3AZIB 1P3GB 3AYWB 1ZLAC 4J8WA 5AV8C 5CPIA 1BH8B 4J8UA 2JE5A 2ZY5A 4DRAA 2DF4C 4KUDC 3VH6T 5AV5C 4AWLC 4QLCD 4Z66B 1P3KD 3R45A 3B6FB 3LZ0B 3AZGD 2XD5A 3F6TA 4YM6B 3EG5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QLC C;  3B0C W;  5B32 A;  3C1C B;  3AZG C;  3KUY B;  4WU8 A;  5B0Z D;  4ZBJ B;  1HQ3 B;  3AV2 D;  3UTB C;  5CPK D;  3X1U A;  3X1T C;  3MVD A;  1M19 D;  2HUE C;  4J8V D;  5B0Z C;  4E45 A;  3AV2 C;  1P3A A;  2F8N A;  3AV1 B;  4J8W D;  1M19 C;  4J8V C;  2BYM B;  5CPI D;  5F99 A;  4J8U D;  1P3O B;  5B2J A;  5AV9 A;  3REL B;  3UT9 B;  3AZI A;  1P3G A;  4J8W C;  3AYW A;  5CPI C;  3V9R B;  4J8U C;  4XUJ B;  5C3I B;  5FUG B;  3AZH A;  3VH6 A;  1N1J A;  5B32 D;  4Z66 A;  5BS7 A;  3LZ0 A;  1S32 A;  4WU8 D;  2HIO C;  1WWS A;  3AZL B;  1P3L A;  5AV8 B;  5B32 C;  5G49 B;  3X1U D;  3MVD D;  2CV5 A;  4WU8 C;  4KUD B;  5AV5 B;  4AWL B;  3MGP A;  3REK B;  1P3A D;  3X1U C;  2F8N D;  4XZQ C;  3MVD C;  1P3F C;  5F99 D;  5B2J D;  5AV9 D;  1P3A C;  3AZI D;  5BNV B;  1P3G D;  3X1V A;  3AYW D;  3REJ B;  4WNN B;  1R4V A;  5F99 C;  3UTB B;  4H9S A;  5B2J C;  5AV9 C;  3X1T B;  3AZH D;  3AZI C;  1P3O A;  2HUE B;  3AYW C;  5B0Z B;  4Z66 D;  3AV2 B;  3LZ0 D;  3V9R A;  4CAY A;  1S32 D;  4XUJ A;  5GT0 A;  5FUG A;  3AZH C;  3W96 B;  1TAF B;  1P3L D;  2PYO C;  4Z66 C;  5BS7 C;  5B31 A;  3LZ0 C;  1S32 C;  2CV5 D;  1P3L C;  3MGP D;  4H9O A;  5CPI B;  3AZL A;  4J8U B;  3MGR A;  2CV5 C;  3LZ1 C;  3R45 B;  2IO5 C;  5AV5 A;  5DNN C;  3MGP C;  2ARO A;  1U35 A;  1KX5 A;  4CSR A;  3REK A;  4X23 B;  2NQB A;  2HIO B;  5JA4 B;  3REH A;  4EO5 C;  5B32 B;  1P3O D;  3AZJ A;  3X1V C;  4WU8 B;  3REJ A;  4WNN A;  4H9S C;  3UTA A;  3UTB A;  4XUJ D;  5GT0 D;  1P3B A;  1P3O C;  4XZQ B;  3MVD B;  3X1T A;  1M1A B;  1P3F B;  2CWE A;  1P3I A;  5B31 D;  5GT0 C;  1KU5 A;  4KHA A;  3W96 A;  1TAF A;  3AZL D;  5F99 B;  5B31 C;  5AY8 A;  5AV9 B;  3LJA C;  3MGR D;  3B0C T;  4KUD D;  5AV5 D;  3AZL C;  2ARO D;  1U35 D;  1KX5 D;  3REK D;  2NQB D;  3VH5 W;  3MGR C;  3AZH B;  4H9P B;  3REH D;  1N1J B;  2PYO B;  4LD9 A;  5B33 B;  2ARO C;  1U35 C;  1KX5 C;  3WKJ C;  3AZJ D;  3REK C;  1S32 B;  2NQB C;  1TZY B;  4X23 A;  2HIO A;  1P3L B;  4UUZ B;  3REJ D;  3REH C;  5JA4 A;  3WAA C;  3UTA D;  3UTB D;  1P3B D;  3AZJ C;  4NFT A;  3X1T D;  3AFA A;  2CV5 B;  4H9R A;  5B2I C;  3LZ1 B;  1P3I D;  3MGP B;  2IO5 B;  5DNN B;  3REJ C;  3UTA C;  1P3B C;  4H9Q A;  4XZQ A;  3AZF C;  1M1A A;  3W96 D;  1F66 C;  1P3I C;  1P3F A;  2NZD A;  4EO5 B;  4NE3 A;  5AY8 D;  3X1V B;  3W96 C;  5AVB B;  5AY8 C;  3AZN C;  3AZK C;  4ZUX A;  4LD9 D;  3KWQ A;  5CPJ C;  3W97 A;  4CAY B;  5GT0 B;  5BO0 A;  4HGA C;  4X23 D;  2HIO D;  4H9P A;  4LD9 C;  2PYO A;  5B31 B;  5B33 A;  3REI A;  3AFA D;  3LJA B;  2YFV A;  4X23 C;  1TZY A;  1EQZ B;  4H9O B;  2LY8 A;  4UUZ A;  3W98 A;  5E5A A;  5DNM C;  3B0B A;  3NQJ A;  3AFA C;  3MGR B;  4XZQ D;  1M1A D;  2NZD D;  1P3F D;  3LZ1 A;  2ARO B;  5DNN A;  1U35 B;  1KX5 B;  3WKJ B;  4CSR B;  2NQB B;  1KX3 B;  3MGS A;  1M1A C;  2NZD C;  3REH B;  3WAA B;  5GSU A;  3AZJ B;  4ZUX D;  5B1L A;  3B6G B;  5B2I B;  3KWQ D;  5AVB A;  3W97 D;  3UTA B;  4YS3 B;  1P3B B;  4ZUX C;  3KXB B;  1AOI A;  4KGC C;  3AZF B;  1F66 B;  3KWQ C;  1P3I B;  2PYO D;  5B33 D;  3REI D;  3AZM B;  3W97 C;  4WV4 B;  4KHA B;  2FJ7 A;  1TZY D;  3W98 D;  5E5A D;  4G92 B;  4R8P A;  3REI C;  5B33 C;  5B1M A;  3TU4 C;  5AY8 B;  2RVQ D;  3AZN B;  3AZK B;  3LJA A;  1TZY C;  3LZ1 D;  1EQZ A;  3W98 C;  5E5A C;  5DNN D;  1KX4 C;  4WU9 A;  5CPJ B;  1A7W A;  3AN2 A;  2RVQ C;  5GT3 A;  1P34 A;  4HGA B;  3MGS D;  1BFM A;  4LD9 B;  3KSY A;  5GSU D;  3WKJ A;  5B1L D;  5AVC A;  3LEL A;  3MGS C;  3X1V D;  1KX3 A;  5AVB D;  5DNM B;  5GSU C;  3WAA A;  5B1L C;  3AFA B;  1AOI D;  3B6G A;  4H9R B;  5B2I A;  5AVB C;  1JFI B;  4YS3 A;  4H9Q B;  2FJ7 D;  1AOI C;  3KXB A;  2NZD B;  1B67 A;  4E44 A;  3MGQ A;  3AZF A;  4R8P D;  1F66 A;  5B1M D;  3VH5 T;  5BT1 D;  4DRB A;  3AZM A;  3X1S A;  3LJA D;  2FJ7 C;  5GXQ A;  1EQZ D;  4H9N B;  4R8P C;  4WU9 D;  5B1M C;  3AN2 D;  5GT3 D;  5BT1 C;  1P34 D;  4ZUX B;  3WA9 B;  1BH9 B;  3AZK A;  3AZN A;  4KGC B;  2BYK A;  4Z2M H;  3KWQ B;  3NQU A;  1EQZ C;  1P3P C;  4WU9 C;  3W97 B;  3WKJ D;  3AN2 C;  5CPJ A;  5GT3 C;  2JSS A;  5AVC D;  5BO0 B;  3LEL D;  1P34 C;  1KX3 D;  3W99 C;  3REI B;  3WAA D;  3TU4 B;  1ID3 A;  5AVC C;  3LEL C;  2YFV B;  3B6G D;  5CHL B;  5AV6 A;  1KX3 C;  5B2I D;  3W98 B;  5E5A B;  5B40 C;  1KX4 B;  5DNM A;  3NQJ B;  4YS3 D;  5B24 C;  4Z2M G;  3B6G C;  3KXB D;  3MGQ D;  4Z5T C;  3AZF D;  1F66 D;  5JRG A;  3AZM D;  3AZE C;  1M18 A;  4YS3 C;  3MNN A;  3X1S D;  1JFI A;  3MGS B;  3WTP E;  3KXB C;  5GXQ D;  3C1B A;  3MGQ C;  5CP6 A;  3A6N A;  5GSU B;  3AZM C;  3VH5 A;  5B1L B;  3X1S C;  3AZN D;  3AZK D;  5GXQ C;  5KDM A;  3WTP A;  4H9N A;  4G92 C;  5CPJ D;  3O62 A;  1P3K C;  1AOI B;  3WA9 A;  1BH9 A;  4KGC A;  4G91 B;  1ID3 D;  2FJ7 B;  3VH6 W;  5AV6 D;  1Q9C A;  5BNX B;  4R8P B;  5B1M B;  5DNM D;  1ID3 C;  3TU4 A;  5AV6 C;  5CPK C;  3B0D C;  1P3P B;  5JRG D;  1HTA A;  4WU9 B;  1M18 D;  3AN2 B;  1KX4 A;  3MNN D;  5GT3 B;  1P3M B;  4JJN B;  1P34 B;  2F8N H;  3C1B D;  3W99 B;  5B32 G;  5CP6 D;  5B0Y A;  3A6N D;  5JRG C;  1M18 C;  3MNN C;  5AVC B;  3LEL B;  3C1B C;  1BH8 A;  2YFW B;  3WTP D;  5B40 B;  5CP6 C;  3A6N C;  3O62 D;  1F1E A;  5B24 B;  4J8X B;  3B6F A;  3WA9 D;  4KGC D;  4Z5T B;  3WTP C;  4YM6 A;  3AZE B;  1ZLA B;  3O62 C;  2F8N G;  3WA9 C;  1H3O B;  3MGQ B;  3C1C A;  3KUY A;  3TU4 D;  3X1S B;  1HQ3 A;  5GXQ B;  5BNX A;  1KX4 D;  4QLC B;  1P3K B;  2BYK B;  3AZG B;  3NQU B;  5B0Y D;  1P3P A;  3AV1 A;  1WWI A;  1P3M A;  4JJN A;  2BYM A;  5B0Y C;  3W99 A;  1P3G C;  3REL A;  3UT9 A;  1ID3 B;  3B6F D;  4NE6 A;  5AV6 B;  2F8N K;  5CPK B;  3B0D B;  2YFW A;  4YM6 D;  2L5A A;  5B40 A;  1M19 B;  4J8V B;  3B6F C;  5B24 A;  4J8X A;  3C1C D;  3KUY D;  4Z5T A;  4YM6 C;  5JRG B;  1M18 B;  4J8W B;  3MNN B;  3AZE A;  1ZLA A;  1HQ3 D;  5AV8 A;  3C1B B;  5G49 A;  3C1C C;  3KUY C;  1H3O A;  4G91 C;  5CP6 B;  3A6N B;  4KUD A;  4M6B A;  1HQ3 C;  4ZBJ C;  5KDM B;  3WTP B;  1P3P D;  3AV1 D;  3O62 B;  1P3M D;  4JJN D;  4QLC A;  1P3K A;  3AZG A;  3W99 D;  5B31 G;  3REL D;  3UT9 D;  5BNV A;  3AV1 C;  1P3M C;  4JJN C;  3X1U B;  5B40 D;  3REL C;  3UT9 C;  5B24 D;  5B0Z A;  4J8X D;  3AV2 A;  1P3A B;  4Z5T D;  4XUJ C;  5C3I C;  5CPK A;  2F8N B;  4WZS B;  1ULY A;  3AZE D;  1ZLA D;  4NE5 A;  1M19 A;  4J8V A;  5AV8 D;  4J8X C;  5B2J B;  5B0Y B;  1B6W A;  3AZI B;  1P3G B;  3AYW B;  1ZLA C;  4J8W A;  5AV8 C;  5CPI A;  1BH8 B;  4J8U A;  4DRA A;  4KUD C;  3VH6 T;  5AV5 C;  4AWL C;  4QLC D;  4Z66 B;  1P3K D;  3R45 A;  3B6F B;  3LZ0 B;  3AZG D;  4YM6 B; 
#chains in the Genus database with same CATH topology
 4QLC C;  3B0C W;  5B32 A;  3C1C B;  3AZG C;  3KUY B;  3H0M C;  4WU8 A;  5B0Z D;  4ZBJ B;  1HQ3 B;  3AV2 D;  3UTB C;  5CPK D;  3X1U A;  3X1T C;  3MVD A;  1M19 D;  2HUE C;  4J8V D;  5B0Z C;  4E45 A;  3AV2 C;  1P3A A;  2F8N A;  3AV1 B;  4J8W D;  1M19 C;  4J8V C;  2BYM B;  5CPI D;  5F99 A;  4J8U D;  1P3O B;  5B2J A;  5AV9 A;  3REL B;  3UT9 B;  3AZI A;  1P3G A;  2Y2J A;  4J8W C;  3AYW A;  5CPI C;  3V9R B;  4J8U C;  4XUJ B;  5C3I B;  5FUG B;  3AZH A;  3VH6 A;  1N1J A;  2UWX A;  5B32 D;  4Z66 A;  5BS7 A;  3LZ0 A;  1S32 A;  4WU8 D;  2HIO C;  1WWS A;  3AZL B;  1P3L A;  5AV8 B;  5B32 C;  5G49 B;  3X1U D;  3MVD D;  2CV5 A;  4WU8 C;  4KUD B;  5AV5 B;  4AWL B;  3MGP A;  3REK B;  1P3A D;  3X1U C;  2F8N D;  4XZQ C;  3MVD C;  1P3F C;  5F99 D;  5B2J D;  5AV9 D;  1P3A C;  3AZI D;  5BNV B;  1P3G D;  3X1V A;  3AYW D;  3REJ B;  4WNN B;  1R4V A;  5F99 C;  3UTB B;  4H9S A;  2Y2H A;  5B2J C;  5AV9 C;  3X1T B;  3AZH D;  3AZI C;  1P3O A;  2HUE B;  3AYW C;  5B0Z B;  4Z66 D;  3AV2 B;  3LZ0 D;  3V9R A;  4CAY A;  1S32 D;  4XUJ A;  5GT0 A;  5FUG A;  3AZH C;  3W96 B;  1TAF B;  1P3L D;  2PYO C;  4Z66 C;  5BS7 C;  5B31 A;  3LZ0 C;  1S32 C;  2CV5 D;  3A1I A;  1P3L C;  3MGP D;  4H9O A;  5CPI B;  3AZL A;  4J8U B;  3A1K A;  3MGR A;  2CV5 C;  3LZ1 C;  3R45 B;  2IO5 C;  5AV5 A;  5DNN C;  3MGP C;  2ARO A;  1U35 A;  1KX5 A;  4CSR A;  3REK A;  4X23 B;  2NQB A;  2HIO B;  5JA4 B;  3REH A;  2J8P A;  2W8S A;  4EO5 C;  5B32 B;  4UPK A;  1P3O D;  3AZJ A;  3X1V C;  4WU8 B;  3REJ A;  4WNN A;  4H9S C;  3UTA A;  3UTB A;  4XUJ D;  5GT0 D;  1P3B A;  1P3O C;  4XZQ B;  3MVD B;  3X1T A;  1M1A B;  1P3F B;  2CWE A;  1P3I A;  5B31 D;  5GT0 C;  1KU5 A;  4KHA A;  3W96 A;  1TAF A;  3AZL D;  5F99 B;  5B31 C;  5AY8 A;  5AV9 B;  3LJA C;  3MGR D;  2ZM5 A;  3B0C T;  4KUD D;  5AV5 D;  3AZL C;  2ARO D;  1U35 D;  1KX5 D;  3IP4 C;  3REK D;  2NQB D;  3VH5 W;  3MGR C;  3AZH B;  4H9P B;  3REH D;  1N1J B;  2PYO B;  4LD9 A;  5B33 B;  2ARO C;  1U35 C;  1KX5 C;  3WKJ C;  3AZJ D;  3REK C;  1S32 B;  2NQB C;  1TZY B;  4X23 A;  2HIO A;  1P3L B;  4UUZ B;  3REJ D;  3REH C;  5JA4 A;  3WAA C;  3UTA D;  3UTB D;  2G5I C;  3AZJ C;  1P3B D;  4NFT A;  3X1T D;  3AFA A;  2CV5 B;  4H9R A;  5B2I C;  3LZ1 B;  1P3I D;  3MGP B;  2IO5 B;  5DNN B;  3REJ C;  3UTA C;  1P3B C;  2Y2M A;  4H9Q A;  4XZQ A;  3AZF C;  1M1A A;  3W96 D;  1F66 C;  1P3I C;  1P3F A;  2NZD A;  4EO5 B;  4NE3 A;  5AY8 D;  3EPK A;  3X1V B;  3W96 C;  5AVB B;  5AY8 C;  2XD1 A;  3AZN C;  3AZK C;  4ZUX A;  4LD9 D;  3KWQ A;  1PZR A;  5CPJ C;  3P5J B;  3W97 A;  4CAY B;  5GT0 B;  5BO0 A;  4HGA C;  4X23 D;  2HIO D;  4H9P A;  4LD9 C;  2PYO A;  3EPL A;  5B31 B;  5B33 A;  3REI A;  3AFA D;  3LJA B;  2YFV A;  4X23 C;  1TZY A;  1EQZ B;  4H9O B;  2LY8 A;  4UUZ A;  3W98 A;  5E5A A;  5DNM C;  3B0B A;  3NQJ A;  3AFA C;  3MGR B;  4XZQ D;  1M1A D;  2NZD D;  1P3F D;  3LZ1 A;  2ARO B;  5DNN A;  1U35 B;  1KX5 B;  3WKJ B;  4CSR B;  2NQB B;  1KX3 B;  3MGS A;  1M1A C;  2NZD C;  3REH B;  3WAA B;  5GSU A;  3AZJ B;  4ZUX D;  5B1L A;  3B6G B;  5B2I B;  3KWQ D;  5AVB A;  3W97 D;  3UTA B;  4YS3 B;  2Y2O A;  1P3B B;  4ZUX C;  3KXB B;  1AOI A;  4KGC C;  3AZF B;  1F66 B;  3KWQ C;  1P3I B;  2PYO D;  5B33 D;  3REI D;  3AZM B;  3W97 C;  4WV4 B;  4KHA B;  2FJ7 A;  1TZY D;  3AL0 C;  2DQN C;  3W98 D;  5E5A D;  4G92 B;  4R8P A;  3REI C;  5B33 C;  5B1M A;  3TU4 C;  5AY8 B;  2RVQ D;  3AZN B;  3AZK B;  3LJA A;  1TZY C;  3LZ1 D;  2Y2Q A;  1EQZ A;  3W98 C;  5E5A C;  5DNN D;  1KX4 C;  4WU9 A;  5CPJ B;  1A7W A;  3AN2 A;  2RVQ C;  5GT3 A;  1P34 A;  4HGA B;  3MGS D;  1BFM A;  4LD9 B;  3KSY A;  5GSU D;  3WKJ A;  2Y2N A;  5B1L D;  5AVC A;  3LEL A;  3MGS C;  3X1V D;  1KX3 A;  5AVB D;  1W2E A;  5DNM B;  5GSU C;  3WAA A;  2Y2K A;  5B1L C;  3AFA B;  1AOI D;  3B6G A;  4H9R B;  5B2I A;  5AVB C;  1JFI B;  4YS3 A;  4H9Q B;  2FJ7 D;  1AOI C;  3KXB A;  2NZD B;  1B67 A;  4E44 A;  3MGQ A;  3AZF A;  4R8P D;  1F66 A;  5B1M D;  3VH5 T;  5BT1 D;  4DRB A;  3AZM A;  3X1S A;  3LJA D;  2FJ7 C;  5GXQ A;  1EQZ D;  4H9N B;  4R8P C;  4WU9 D;  5B1M C;  3AN2 D;  5GT3 D;  5BT1 C;  1P34 D;  4ZUX B;  2ZY2 A;  3WA9 B;  1BH9 B;  3AZK A;  3AZN A;  4KGC B;  2BYK A;  4Z2M H;  3KWQ B;  3NQU A;  1EQZ C;  1P3P C;  4WU9 C;  3W97 B;  3WKJ D;  3AN2 C;  5CPJ A;  5GT3 C;  2JSS A;  5AVC D;  5BO0 B;  3LEL D;  1P34 C;  3EPH A;  1KX3 D;  3W99 C;  3REI B;  3WAA D;  3TU4 B;  1ID3 A;  5AVC C;  3LEL C;  2YFV B;  3B6G D;  5CHL B;  5AV6 A;  1KX3 C;  5B2I D;  3W98 B;  5E5A B;  5B40 C;  1KX4 B;  5DNM A;  3NQJ B;  4YS3 D;  5B24 C;  4Z2M G;  3B6G C;  3KXB D;  3MGQ D;  4Z5T C;  3AZF D;  1F66 D;  5JRG A;  3AZM D;  3AZE C;  1M18 A;  4YS3 C;  3MNN A;  3X1S D;  1JFI A;  3MGS B;  4WJ3 C;  3WTP E;  3KXB C;  5GXQ D;  3C1B A;  3MGQ C;  5CP6 A;  3A6N A;  5GSU B;  3AZM C;  3VH5 A;  5B1L B;  3X1S C;  3AZN D;  3AZK D;  2G5H C;  5GXQ C;  5KDM A;  3WTP A;  4H9N A;  4G92 C;  5CPJ D;  3O62 A;  1P3K C;  1AOI B;  3WA9 A;  1BH9 A;  4KGC A;  4G91 B;  1ID3 D;  2FJ7 B;  3VH6 W;  5AV6 D;  3H0R C;  1Q9C A;  5BNX B;  4R8P B;  5B1M B;  5DNM D;  1ID3 C;  2Y2I A;  3TU4 A;  5AV6 C;  3H0L C;  5CPK C;  3B0D C;  3EPJ A;  1P3P B;  5JRG D;  1HTA A;  4WU9 B;  1M18 D;  3FDD A;  3AN2 B;  3MNN D;  5GT3 B;  1KX4 A;  1P3M B;  4JJN B;  1P34 B;  2F8N H;  3C1B D;  2ZY4 A;  3W99 B;  5B32 G;  5CP6 D;  5B0Y A;  3A6N D;  5JRG C;  1T3U A;  1M18 C;  3MNN C;  5AVC B;  3LEL B;  3C1B C;  1BH8 A;  2YFW B;  3WTP D;  5B40 B;  5CP6 C;  3A6N C;  3O62 D;  1F1E A;  2Y2L A;  5B24 B;  4J8X B;  3B6F A;  3WA9 D;  4KGC D;  4Z5T B;  3WTP C;  4YM6 A;  3AZE B;  1ZLA B;  3O62 C;  2F8N G;  3WA9 C;  1H3O B;  2Y2G A;  3MGQ B;  3C1C A;  3KUY A;  3TU4 D;  4DQY B;  1Z2C B;  3X1S B;  1HQ3 A;  5GXQ B;  5BNX A;  1KX4 D;  4QLC B;  1P3K B;  2BYK B;  2RIQ A;  3AZG B;  3NQU B;  5B0Y D;  2Y2P A;  1P3P A;  3AV1 A;  1WWI A;  1P3M A;  4JJN A;  2BYM A;  5B0Y C;  3W99 A;  1P3G C;  3REL A;  3UT9 A;  1ID3 B;  3B6F D;  4NE6 A;  5AV6 B;  2F8N K;  5CPK B;  3B0D B;  2YFW A;  4YM6 D;  3KFU G;  2L5A A;  5B40 A;  1M19 B;  4J8V B;  3B6F C;  5B24 A;  4J8X A;  3C1C D;  3KUY D;  4Z5T A;  4YM6 C;  5JRG B;  1M18 B;  4J8W B;  3MNN B;  3AZE A;  1ZLA A;  1HQ3 D;  5AV8 A;  3C1B B;  5G49 A;  3C1C C;  3KUY C;  1H3O A;  4G91 C;  5CP6 B;  2F2A C;  2BG1 A;  3A6N B;  2ZY3 A;  4KUD A;  4M6B A;  1HQ3 C;  4ZBJ C;  5KDM B;  3WTP B;  1P3P D;  3AV1 D;  3O62 B;  1P3M D;  4JJN D;  4QLC A;  1P3K A;  3AZG A;  3W99 D;  5B31 G;  3REL D;  3UT9 D;  2JCH A;  5BNV A;  3AV1 C;  1P3M C;  4JJN C;  3X1U B;  5B40 D;  3REL C;  2FFF B;  3UT9 C;  5B24 D;  5B0Z A;  4J8X D;  3AV2 A;  1P3A B;  4Z5T D;  4XUJ C;  5C3I C;  5CPK A;  2F8N B;  4WZS B;  1ULY A;  2VQR A;  3AZE D;  1ZLA D;  4NE5 A;  1M19 A;  4J8V A;  5AV8 D;  4J8X C;  5B2J B;  5B0Y B;  1B6W A;  3AZI B;  1P3G B;  3AYW B;  1ZLA C;  4J8W A;  5AV8 C;  5CPI A;  1BH8 B;  4J8U A;  2JE5 A;  2ZY5 A;  4DRA A;  2DF4 C;  4KUD C;  3VH6 T;  5AV5 C;  4AWL C;  4QLC D;  4Z66 B;  1P3K D;  3R45 A;  3B6F B;  3LZ0 B;  3AZG D;  2XD5 A;  3F6T A;  4YM6 B;  3EG5 B; 
#chains in the Genus database with same CATH homology
 4QLC C;  3B0C W;  5B32 A;  3C1C B;  3AZG C;  3KUY B;  3H0M C;  4WU8 A;  5B0Z D;  4ZBJ B;  1HQ3 B;  3AV2 D;  3UTB C;  5CPK D;  3X1U A;  3X1T C;  3MVD A;  1M19 D;  2HUE C;  4J8V D;  5B0Z C;  4E45 A;  3AV2 C;  1P3A A;  2F8N A;  3AV1 B;  4J8W D;  1M19 C;  4J8V C;  2BYM B;  5CPI D;  5F99 A;  4J8U D;  1P3O B;  5B2J A;  5AV9 A;  3REL B;  3UT9 B;  3AZI A;  1P3G A;  2Y2J A;  4J8W C;  3AYW A;  5CPI C;  3V9R B;  4J8U C;  4XUJ B;  5C3I B;  5FUG B;  3AZH A;  3VH6 A;  1N1J A;  2UWX A;  5B32 D;  4Z66 A;  5BS7 A;  3LZ0 A;  1S32 A;  4WU8 D;  2HIO C;  1WWS A;  3AZL B;  1P3L A;  5AV8 B;  5B32 C;  5G49 B;  3X1U D;  3MVD D;  2CV5 A;  4WU8 C;  4KUD B;  5AV5 B;  4AWL B;  3MGP A;  3REK B;  1P3A D;  3X1U C;  2F8N D;  4XZQ C;  3MVD C;  1P3F C;  5F99 D;  5B2J D;  5AV9 D;  1P3A C;  3AZI D;  5BNV B;  1P3G D;  3X1V A;  3AYW D;  3REJ B;  4WNN B;  1R4V A;  5F99 C;  3UTB B;  4H9S A;  2Y2H A;  5B2J C;  5AV9 C;  3X1T B;  3AZH D;  3AZI C;  1P3O A;  2HUE B;  3AYW C;  5B0Z B;  4Z66 D;  3AV2 B;  3LZ0 D;  3V9R A;  4CAY A;  1S32 D;  4XUJ A;  5GT0 A;  5FUG A;  3AZH C;  3W96 B;  1TAF B;  1P3L D;  2PYO C;  4Z66 C;  5BS7 C;  5B31 A;  3LZ0 C;  1S32 C;  2CV5 D;  3A1I A;  1P3L C;  3MGP D;  4H9O A;  5CPI B;  3AZL A;  4J8U B;  3A1K A;  3MGR A;  2CV5 C;  3LZ1 C;  3R45 B;  2IO5 C;  5AV5 A;  5DNN C;  3MGP C;  2ARO A;  1U35 A;  1KX5 A;  4CSR A;  3REK A;  4X23 B;  2NQB A;  2HIO B;  5JA4 B;  3REH A;  2J8P A;  2W8S A;  4EO5 C;  5B32 B;  4UPK A;  1P3O D;  3AZJ A;  3X1V C;  4WU8 B;  3REJ A;  4WNN A;  4H9S C;  3UTA A;  3UTB A;  4XUJ D;  5GT0 D;  1P3B A;  1P3O C;  4XZQ B;  3MVD B;  3X1T A;  1M1A B;  1P3F B;  2CWE A;  1P3I A;  5B31 D;  5GT0 C;  1KU5 A;  4KHA A;  3W96 A;  1TAF A;  3AZL D;  5F99 B;  5B31 C;  5AY8 A;  5AV9 B;  3LJA C;  3MGR D;  2ZM5 A;  3B0C T;  4KUD D;  5AV5 D;  3AZL C;  2ARO D;  1U35 D;  1KX5 D;  3IP4 C;  3REK D;  2NQB D;  3VH5 W;  3MGR C;  3AZH B;  4H9P B;  3REH D;  1N1J B;  2PYO B;  4LD9 A;  5B33 B;  2ARO C;  1U35 C;  1KX5 C;  3WKJ C;  3AZJ D;  3REK C;  1S32 B;  2NQB C;  1TZY B;  4X23 A;  2HIO A;  1P3L B;  4UUZ B;  3REJ D;  3REH C;  5JA4 A;  3WAA C;  3UTA D;  3UTB D;  2G5I C;  3AZJ C;  1P3B D;  4NFT A;  3X1T D;  3AFA A;  2CV5 B;  4H9R A;  5B2I C;  3LZ1 B;  1P3I D;  3MGP B;  2IO5 B;  5DNN B;  3REJ C;  3UTA C;  1P3B C;  2Y2M A;  4H9Q A;  4XZQ A;  3AZF C;  1M1A A;  3W96 D;  1F66 C;  1P3I C;  1P3F A;  2NZD A;  4EO5 B;  4NE3 A;  5AY8 D;  3EPK A;  3X1V B;  3W96 C;  5AVB B;  5AY8 C;  2XD1 A;  3AZN C;  3AZK C;  4ZUX A;  4LD9 D;  3KWQ A;  1PZR A;  5CPJ C;  3P5J B;  3W97 A;  4CAY B;  5GT0 B;  5BO0 A;  4HGA C;  4X23 D;  2HIO D;  4H9P A;  4LD9 C;  2PYO A;  3EPL A;  5B31 B;  5B33 A;  3REI A;  3AFA D;  3LJA B;  2YFV A;  4X23 C;  1TZY A;  1EQZ B;  4H9O B;  2LY8 A;  4UUZ A;  3W98 A;  5E5A A;  5DNM C;  3B0B A;  3NQJ A;  3AFA C;  3MGR B;  4XZQ D;  1M1A D;  2NZD D;  1P3F D;  3LZ1 A;  2ARO B;  5DNN A;  1U35 B;  1KX5 B;  3WKJ B;  4CSR B;  2NQB B;  1KX3 B;  3MGS A;  1M1A C;  2NZD C;  3REH B;  3WAA B;  5GSU A;  3AZJ B;  4ZUX D;  5B1L A;  3B6G B;  5B2I B;  3KWQ D;  5AVB A;  3W97 D;  3UTA B;  4YS3 B;  2Y2O A;  1P3B B;  4ZUX C;  3KXB B;  1AOI A;  4KGC C;  3AZF B;  1F66 B;  3KWQ C;  1P3I B;  2PYO D;  5B33 D;  3REI D;  3AZM B;  3W97 C;  4WV4 B;  4KHA B;  2FJ7 A;  1TZY D;  3AL0 C;  2DQN C;  3W98 D;  5E5A D;  4G92 B;  4R8P A;  3REI C;  5B33 C;  5B1M A;  3TU4 C;  5AY8 B;  2RVQ D;  3AZN B;  3AZK B;  3LJA A;  1TZY C;  3LZ1 D;  2Y2Q A;  1EQZ A;  3W98 C;  5E5A C;  5DNN D;  1KX4 C;  4WU9 A;  5CPJ B;  1A7W A;  3AN2 A;  2RVQ C;  5GT3 A;  1P34 A;  4HGA B;  3MGS D;  1BFM A;  4LD9 B;  3KSY A;  5GSU D;  3WKJ A;  2Y2N A;  5B1L D;  5AVC A;  3LEL A;  3MGS C;  3X1V D;  1KX3 A;  5AVB D;  1W2E A;  5DNM B;  5GSU C;  3WAA A;  2Y2K A;  5B1L C;  3AFA B;  1AOI D;  3B6G A;  4H9R B;  5B2I A;  5AVB C;  1JFI B;  4YS3 A;  4H9Q B;  2FJ7 D;  1AOI C;  3KXB A;  2NZD B;  1B67 A;  4E44 A;  3MGQ A;  3AZF A;  4R8P D;  1F66 A;  5B1M D;  3VH5 T;  5BT1 D;  4DRB A;  3AZM A;  3X1S A;  3LJA D;  2FJ7 C;  5GXQ A;  1EQZ D;  4H9N B;  4R8P C;  4WU9 D;  5B1M C;  3AN2 D;  5GT3 D;  5BT1 C;  1P34 D;  4ZUX B;  2ZY2 A;  3WA9 B;  1BH9 B;  3AZK A;  3AZN A;  4KGC B;  2BYK A;  4Z2M H;  3KWQ B;  3NQU A;  1EQZ C;  1P3P C;  4WU9 C;  3W97 B;  3WKJ D;  3AN2 C;  5CPJ A;  5GT3 C;  2JSS A;  5AVC D;  5BO0 B;  3LEL D;  1P34 C;  3EPH A;  1KX3 D;  3W99 C;  3REI B;  3WAA D;  3TU4 B;  1ID3 A;  5AVC C;  3LEL C;  2YFV B;  3B6G D;  5CHL B;  5AV6 A;  1KX3 C;  5B2I D;  3W98 B;  5E5A B;  5B40 C;  1KX4 B;  5DNM A;  3NQJ B;  4YS3 D;  5B24 C;  4Z2M G;  3B6G C;  3KXB D;  3MGQ D;  4Z5T C;  3AZF D;  1F66 D;  5JRG A;  3AZM D;  3AZE C;  1M18 A;  4YS3 C;  3MNN A;  3X1S D;  1JFI A;  3MGS B;  4WJ3 C;  3WTP E;  3KXB C;  5GXQ D;  3C1B A;  3MGQ C;  5CP6 A;  3A6N A;  5GSU B;  3AZM C;  3VH5 A;  5B1L B;  3X1S C;  3AZN D;  3AZK D;  2G5H C;  5GXQ C;  5KDM A;  3WTP A;  4H9N A;  4G92 C;  5CPJ D;  3O62 A;  1P3K C;  1AOI B;  3WA9 A;  1BH9 A;  4KGC A;  4G91 B;  1ID3 D;  2FJ7 B;  3VH6 W;  5AV6 D;  3H0R C;  1Q9C A;  5BNX B;  4R8P B;  5B1M B;  5DNM D;  1ID3 C;  2Y2I A;  3TU4 A;  5AV6 C;  3H0L C;  5CPK C;  3B0D C;  3EPJ A;  1P3P B;  5JRG D;  1HTA A;  4WU9 B;  1M18 D;  3FDD A;  3AN2 B;  3MNN D;  5GT3 B;  1KX4 A;  1P3M B;  4JJN B;  1P34 B;  2F8N H;  3C1B D;  2ZY4 A;  3W99 B;  5B32 G;  5CP6 D;  5B0Y A;  3A6N D;  5JRG C;  1T3U A;  1M18 C;  3MNN C;  5AVC B;  3LEL B;  3C1B C;  1BH8 A;  2YFW B;  3WTP D;  5B40 B;  5CP6 C;  3A6N C;  3O62 D;  1F1E A;  2Y2L A;  5B24 B;  4J8X B;  3B6F A;  3WA9 D;  4KGC D;  4Z5T B;  3WTP C;  4YM6 A;  3AZE B;  1ZLA B;  3O62 C;  2F8N G;  3WA9 C;  1H3O B;  2Y2G A;  3MGQ B;  3C1C A;  3KUY A;  3TU4 D;  4DQY B;  1Z2C B;  3X1S B;  1HQ3 A;  5GXQ B;  5BNX A;  1KX4 D;  4QLC B;  1P3K B;  2BYK B;  2RIQ A;  3AZG B;  3NQU B;  5B0Y D;  2Y2P A;  1P3P A;  3AV1 A;  1WWI A;  1P3M A;  4JJN A;  2BYM A;  5B0Y C;  3W99 A;  1P3G C;  3REL A;  3UT9 A;  1ID3 B;  3B6F D;  4NE6 A;  5AV6 B;  2F8N K;  5CPK B;  3B0D B;  2YFW A;  4YM6 D;  3KFU G;  2L5A A;  5B40 A;  1M19 B;  4J8V B;  3B6F C;  5B24 A;  4J8X A;  3C1C D;  3KUY D;  4Z5T A;  4YM6 C;  5JRG B;  1M18 B;  4J8W B;  3MNN B;  3AZE A;  1ZLA A;  1HQ3 D;  5AV8 A;  3C1B B;  5G49 A;  3C1C C;  3KUY C;  1H3O A;  4G91 C;  5CP6 B;  2F2A C;  2BG1 A;  3A6N B;  2ZY3 A;  4KUD A;  4M6B A;  1HQ3 C;  4ZBJ C;  5KDM B;  3WTP B;  1P3P D;  3AV1 D;  3O62 B;  1P3M D;  4JJN D;  4QLC A;  1P3K A;  3AZG A;  3W99 D;  5B31 G;  3REL D;  3UT9 D;  2JCH A;  5BNV A;  3AV1 C;  1P3M C;  4JJN C;  3X1U B;  5B40 D;  3REL C;  2FFF B;  3UT9 C;  5B24 D;  5B0Z A;  4J8X D;  3AV2 A;  1P3A B;  4Z5T D;  4XUJ C;  5C3I C;  5CPK A;  2F8N B;  4WZS B;  1ULY A;  2VQR A;  3AZE D;  1ZLA D;  4NE5 A;  1M19 A;  4J8V A;  5AV8 D;  4J8X C;  5B2J B;  5B0Y B;  1B6W A;  3AZI B;  1P3G B;  3AYW B;  1ZLA C;  4J8W A;  5AV8 C;  5CPI A;  1BH8 B;  4J8U A;  2JE5 A;  2ZY5 A;  4DRA A;  2DF4 C;  4KUD C;  3VH6 T;  5AV5 C;  4AWL C;  4QLC D;  4Z66 B;  1P3K D;  3R45 A;  3B6F B;  3LZ0 B;  3AZG D;  2XD5 A;  3F6T A;  4YM6 B;  3EG5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...