1ULYA

Crystal structure analysis of the arsr homologue dna-binding protein from p. horikoshii ot3
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
190
structure length
190
Chain Sequence
AKKVKVITDPEVIKVMLEDTRRKILKLLRNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEMKGNLVEKYYGRTADVFYINLYLGDEELRYIARSRLKTKIDIFKRLGYQFEENELLNIMDRMSQKEFDATVRISKYIEEKEDALKDFSNEDIIHAIEWLSTAELARDEEYLELLKRLGSILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PH1932
publication title Crystal structure of the PH1932 protein, a unique archaeal ArsR type winged-HTH transcription factor from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Dna binding protein
total genus 70
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2003-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ulyA01
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1ulyA02
3HTSB 3MGSB 3ECOA 3UT9B 2DAOA 1ID3B 1T39A 3R0AA 2ZNYA 2G9WA 2HIOD 1M1AD 5AV6A 2IA1A 1S7AA 1HW2A 4M6YA 5E5AB 3L9FA 1LQ1A 5GT3C 3HOTA 3HRTA 1JXSA 3OOPA 2FNAA 1RIOH 3GFLA 5B32A 2L5AA 2H27A 1YS7A 1OMIA 1B6WA 5AV8D 2KKOA 1P6RA 2ZBKA 3UTAA 1S29A 4CAYB 2NQBC 3HSFA 1SAXA 3C3WA 5AV9C 2RQPA 4M73A 2A68F 2YSRA 1D3YA 2OZ6A 1SMYF 5CPIB 3W97C 4NB5A 4P96A 1P3PC 3MCZA 5F99C 3AZLC 3KP2A 2FU4A 3B0CW 5DNND 3FMRA 4ENKA 5GT3B 1H3OA 3MEXA 4BXUA 1HW5A 1P3OD 4CSRA 5B2JD 3CUQA 2XHKA 1FYMA 2HIOA 1M1AA 5JRGC 3W6JB 3M9AA 1W7PD 3SZTA 4E44A 3X1TD 5CPKB 1C0WA 2XAQA 5GXQC 3AV1C 2NQBB 1SFXA 2V1DA 5JVTA 3C7JA 2P4WA 3IL2A 3V8LA 3W97B 1P3PB 1LEBA 3FWEA 5F99B 4X23C 2FBIA 3V8KA 1FT9A 2ESNA 1O3SA 1KYZA 4HA8A 2XV4S 3P9CA 4AVPA 1MDMB 3MGPC 3QU3A 3BZ6A 5JRGB 2HGCA 1O3QA 5BT1C 1KA8A 1O3RA 2JRTA 4FX4A 5GXQB 3AV1B 1M19A 5GT0C 2EV6A 2M30A 1P3GA 2GA1A 2PJPA 1P3OA 3DF8A 5B2JA 4KGCD 3BPXA 3LA3A 5GSUD 2AROA 2NS0A 1ID3D 4U0VA 3VOEA 1B9MA 4FX0A 1LDJA 5FUGA 4RB3C 3B73A 3RPUA 3MGPB 1P3KB 4CHUA 1KX5C 3QPTA 3TU4C 3AZEA 2IT0A 2GXGA 2K7LA 5B0ZD 3RELB 3KLOA 3GFMA 5GT0B 3AN2D 3FF5A 2Q2EA 3CLOA 5TJJA 5LHHA 4HLYA 3I58A 2HFHA 2D2WA 1RNLA 5L3BA 1XGOA 3H3ZA 1ZYRF 4AIJA 2GXBA 5ICGA 3AZFA 1FBSA 1FOKA 4HDVA 3MGRC 1KX5B 3TU4B 4XLNF 4KIGA 4Z2YA 1P3IC 1YTYA 1EH7A 3MFKA 3C1DA 4KGCA 2M87A 5B31D 2MH9A 5AVBC 2DBBA 5CPKD 4LLNA 1XB4A 4A5MA 3KWQB 4A2UA 1FBUA 2XKPA 4KICA 3AN2A 3MGRB 5CVUA 1P3IB 1AOYA 4IRGA 4A0ZA 3C1CC 3GYHX 4H9OA 5AVBB 1OKRA 3K9TA 5BO0A 3JTGA 2H6BA 1OYWA 4GYGA 1UFMA 5B0YA 1FBQA 1PDNC 2PEXA 1ZG5A 5B31A 3Q9SA 4E45A 2RV8A 5LLQA 2NNNA 1RI7A 2PLYA 4GGGA 2DT5A 3BY6A 5CLSA 1P3KD 3C1CB 3E6BA 3WAAC 1SD5A 3WA9B 5HLHA 4PDKA 1P3MA 4WV4B 2PFBA 1R7JA 2HEOA 4H9QB 5ED4A 3NEUA 1O7LA 4J8WC 4Z5TA 2PQ8A 3KZYA 4HX7A 1BH8A 5DUKA 4G7OF 3R61A 3KUYA 1Y0UA 2IW5A 2FBHA 4IRIA 1J2XA 5LEKA 4KFCA 2YFVA 1HKSA 3I59B 5DCMB 3CTAA 2HQRA 3WAAB 1AOIC 4YS3D 1I5ZA 2IPQX 1ZG1A 1TQPA 3OV8A 1SMTA 2VXZA 4ENNA 2F5CA 3UTBA 5BPIA 1O57A 4UV8A 2GWRA 1M18D 2IP2A 4J8VD 1KX3A 4WZSB 2LNBA 1XCBA 4GO1A 1PP8F 2ZXJA 3O62A 4J8WB 5JA4A 1QZYA 1JHHA 3K0LA 4LG0A 1JFIA 5DCFA 1FP2A 4IHSA 2NZDC 5B1MA 2V6CA 3KWQD 1ZLAB 1YW9A 5AV5D 3L2CA 2XAHA 2CG4A 2FQ3A 2HWVA 5CP6C 4I0BA 1ZRFA 4EM1A 4R79A 1AOIB 4QLCD 4AIKA 1P34D 3AZGD 1IN4A 1EH6A 5TRDA 3W99D 3VH5T 1P3LD 3WU0A 3R0JA 5B24C 3MNNB 3AZMC 1U8RA 3CO7C 2K27A 3F22A 4BH9A 1A7WA 4LB6B 2PG4A 1S32D 2NZDB 1R1UA 3I64A 2VBZA 1MJAA 4YIIA 5LBQA 1Z9CA 3REHC 3M7GA 4N9HA 5CP6B 2CWEA 2NRAC 4LD9C 2DK8A 3LQRA 4WU9A 4PCQA 2PYOC 4U7DA 1OYIA 1FC3A 4KHAB 1ZARA 1F66C 3EYIA 2W85A 5KDMA 5B24B 3AZMB 3KEOA 2M8EA 1P3FB 5AY8C 1P3AC 1K79A 5CVRA 4KT5C 3CJNA 5K5QA 3REIC 3FM5A 1P34A 5BNXA 5ERIA 3AZGA 4J8XD 3REHB 1P3LA 1TNSA 4Z66A 4G91B 2EJRA 1ZREA 4ESFA 4LD9B 5DNMC 2PYOB 2YX4A 4H9NB 4GCVA 4N0BA 1F66B 4WU8B 3E6CC 5AVCC 3ABTA 1KU5A 1XGSA 2QUFA 5AY8B 1BI1A 3KP5A 3REJD 1P3BA 3VODA 3NQJA 3W98C 4AIHA 3TDZC 1K7AA 3AZHD 4YFKF 1K78B 2BYKA 5AONA 3AZID 2FEZA 3WTPC 3GUDA 1ZLAD 2IO5C 1USSA 2Z99A 1YW7A 2FOKA 5AVCB 1HKTA 2VBXA 1P4XA 2M45A 5B1LD 3KXBC 3WU1B 1FLIA 2VC0A 1ZHFA 3DV8A 1USTA 3WTWC 4OIQF 3W98B 1HQ3D 2WWYA 4KDPA 3MNND 2G7HA 2KIUA 3KP3A 4XBFA 1LJ9A 5IT9K 2R7DA 3RYPA 5CPJD 5B33A 1T6SA 5DYMA 3B6FD 3AZKD 4R1HA 5B32C 3SZPA 3REJA 4IPAA 2IO5B 3B6GD 1K6OA 2QBYB 1TW3A 3UTAC 4I2OA 2RVQC 3DKWA 3S2WA 1XSVA 4XZQD 3LJAD 3KLNA 4NQWA 3V7CA 3AZHA 1B6AA 3WTYC 2RGVA 2ZNZA 3MGQC 3SQNA 1IAWA 3AZIA 4UUZA 4CGZA 1P3FD 1IRGA 3X1SC 5J6XA 2FRHA 4R8PD 1JGSA 2MLGA 4L18B 4WNNA 3L00A 5B1LA 2B0LA 4I01A 4OMYA 2A6EF 2ESHA 5B32B 3AZJA 1M1AC 1U35D 3E3VA 3UTAB 3GWZA 2Y48A 3FXRA 1U2WA 5CPJA 1W4MA 3MGQB 3B6FA 3K1MA 4WU8D 3X1VA 2FBKA 1Z6TA 3B6GA 5AV8C 3X1SB 1O3TA 4XZQA 4CSRB 4H9SC 3GFIA 2HIOB 1M1AB 4ZUXD 3ROUA 3KP4A 5DNNC 4KUDA 5BS7A 3X1UD 3B0CT 4H9PB 4XUJD 1S8NA 3FZVA 3BOQA 3IKTA 5ICCA 3REKA 2QLZA 3GXOA 3WGHA 3X1TC 2K4JA 3AYWD 4OIRF 5FFXA 1BC8C 2KIMA 3PFIA 2EFNA 4RGXA 3GZ6A 1XMKA 2BV6A 5L3EA 2V1UA 1LDDA 1OR7A 3LWFA 2HKOA 2PMHA 5D8LB 2O3FA 1HBXG 5G49A 3U9GA 5DNNB 1P3GB 4G6DA 1P3OB 2OQGA 5B2JB 4EJVA 4L9TA 4LLGF 5F1RA 1XGNA 1R58A 1RUOA 1W7PB 2FF4A 3QPHA 4M71A 4ZUXA 5AV6D 3X1TB 2HTJA 5FUGB 1YIOA 4MEYF 4DRAA 1F9NA 2OA4A 1BC7C 2YR2A 2CO5A 4NFTA 3I53A 4XUJA 2ADUA 2HYFA 4KGCC 5GSUC 3HRUA 4UV9A 1ID3C 3LELD 2KJBA 3WKJA 3AFAA 2F8ND 3A6ND 3KP7A 4ESJA 1LNWA 1FSHA 5D5UB 5B0ZC 1G3TA 4QWQA 4P9UA 3AN2C 5LGTA 2CGPA 3VB2A 4HF0A 1BOAA 1I6XA 4KGCB 1HSTA 5GSUB 2ZMEB 1R5HA 4WXDA 2GQQA 3GFJA 3WTZA 2IA2A 2NAZA 3EQLF 3NQUB 5CPIC 5LEJA 3C18A 3P9IA 4HF2A 4L9VA 5LHIA 2A3SA 5B0ZB 4BYYA 3N4MA 4ZBJC 1P4WA 4EO5B 3C1BA 2XAFA 3LELA 4LGWA 3AN2B 2J5PA 5B31C 1QO0D 3MAJA 2F8NA 3A6NA 5BNVA 5CPKC 3DXJF 4UVCA 3K69A 3RJPA 1FX7A 2F5DA 4E70A 1WQ2A 4JQFA 2K86A 2CFXA 2WTEA 3KZZA 2H94A 5KVRA 3ZQ7A 2HKXA 1TZYA 3D5LA 4G7HF 1MKMA 5BO0B 1M19D 4JJND 2QQBA 5CHLB 4BHCA 5JR3A 2FJ7A 3R4KA 4ZBJB 1P3GD 3IWZA 2W84A 2O8XA 2AROD 1V4RA 4LJZF 5B31B 1J5YA 3MVDA 3PQJA 3KFWX 3AZED 4Q5SF 2BYMB 3T8RA 4CO8A 3J81K 3G3ZA 3SXYA 1H9TA 4Z5TB 3KCCA 1P3KC 3KE2A 2A07F 1YO5C 2JTVA 1BH8B 1SD4A 4KIBA 1CF7B 2A61A 1SFEA 3VEPA 4MNUA 3RELC 5K5RA 5DEQA 4A6DA 3KEQA 4JJNA 3AZFD 3F8MA 2BEOA 3NRVA 4OIOF 2Y0MA 2VC1A 1R5GA 3LZ0A 2P7VB 1G4DA 5E1WA 4M6BA 3WE3A 5EEHA 4RAZA 2VOPA 1U5TA 4MQVA 5LGUA 2OU2A 1KX3B 3SHFA 3O62B 5JA4B 2VE8A 4A0YA 4LG0B 1X3UA 3D0SA 3ABUA 1JFIB 3TO9A 4YS3C 2VT3A 5B1MB 3H3UA 5E8IA 4BAYA 3QU6A 3BDDA 3B02A 5L3DA 1M18C 1LEAA 2O03A 4J8VC 5FO5A 3WGGA 1IXRC 3V9RA 2WV0A 1IN5A 3T5XA 3KWQC 5AV5C 4TV7A 3QOPA 2DO7A 4QLCC 4YS3B 3BJ6A 5B0YD 1P34C 4YM6D 2LY8A 3W99C 1P3LC 2BBYA 3LZ1D 1M18B 4NE5A 4J8VB 2CW0F 3ZMDA 2XASA 3I4PA 1S32C 4ZH4F 3RKWA 2JPCA 1KYWA 5D8KB 4ZZDA 2EV0A 5AV5B 1KGSA 2EFPA 1P3MD 1D8JA 3UT9A 4QLCB 1P34B 3EYYA 5D5XB 5HS8A 2W25A 5BNXB 3AZGB 3HHGA 3BJAA 4Z5TD 3W99B 1P3LB 3J81Z 1Z05A 1AWCA 2V79A 3WA9C 3KUYD 1EQZD 2STWA 5AV9D 2KRFA 1GXPA 4I02A 5E8GA 4HW0A 4EJWA 1S32B 4G9YA 4NE6A 2XAJA 4YM6A 3AZLD 2Y75A 5JHUA 4KN7X 2EFOA 3HTUA 3U1DA 5LRSA 1FPQA 4J8XC 3LZ1A 3UTBD 3B0BA 2V1XA 1KX3D 2UZKA 3O62D 3WG9A 2OAZA 1NHAA 2BYKB 3RYRA 5B1MD 3MWMA 2P5KA 3REJC 1B9NA 5FGMA 1XSXA 3R45B 1FY7A 3AZND 4ZYEA 1L3LA 2WC2A 4X23D 2ISZA 4RAYA 5HVQC 4J8XB 1SFUA 2Q8KA 2DQRA 2NQBA 1EQZA 3HSRA 5AV9A 3SFZA 1ZLAC 1P4AA 2KJCA 3W96D 4L0YB 5F99A 5B33B 1JHFA 3AZLA 5BS6A 5B1LC 2W24A 3WTTC 4AWLC 1HXDA 3REJB 3WGIA 3BROA 3TGNA 1MDMA 4EGYA 1HQ3C 3MNNC 4WU9D 5ILVA 3WTSC 3IKVA 1JE8A 3AZHB 4I09A 5CPJC 3AV1A 3DP7A 2VT2A 2A6HF 3AZKC 4ON0A 2RN7A 3AZIB 4Z2MG 4UUZB 4G8XA 5D6FA 4MGRA 3B6GC 5E1XA 3AZNA 1ZH5A 4B8XA 3I71A 3CO6C 3E6MA 4X23A 3LJAC 3K1PA 4WNNB 3F8NA 5B1LB 1ZG3A 4AWLB 3AZJB 3K2ZA 1U3EM 2O6GE 3MGPA 4AD9A 4DNCA 1HQ3B 1G3YA 4Z66D 4G6QA 1IXCA 3ECHA 2EB7A 3RI4A 2P6TA 1P3FC 3HRMA 1UB9A 4HDUA 2JT1A 3WE2A 3W96A 2ZKZA 3N97A 4BQAA 4R8PC 1SD7A 5CPJB 3B6FB 1ON2A 3Q9VA 3AZKB 5B2ID 4MTEA 3B6GB 1U35C 2VE9A 1P3BD 3ZN1A 4NHJA 5FFZA 5DD8A 5E17F 4G91C 1F1ZA 3LJAB 4XZQB 3T1BA 2FE3A 4WU8C 2DI3A 2DFIA 2F8NK 1KX5A 4A12A 3TU4A 3BWGA 3ZMUA 1DPRA 4HOBA 2EFWA 4R8PB 5ILSA 3P9KA 3WTVC 2L54A 2P8TA 1U35B 4ENJA 4ZUXC 1BJAA 3EUHA 2HOEA 2ELHA 2YX7A 2RDPA 3WTXC 4YIFA 3J7AO 3X1UC 1I1GA 4R8HA 1S7OA 2MLKA 4D0PA 4XUJC 5B2IA 5B33D 4M72A 3ZMSA 5G49B 2MD5A 1P3IA 3E5XA 2BYVE 2GA2A 4WXCA 3HYIA 3LFKA 3AYWC 5B32G 1QPMA 4JK1X 1Z6RA 2G7UA 4KYWA 3LA2A 4FHTA 1UHWA 1UHMA 5AVBA 4ZUXB 1B59A 3BJOA 1EH8A 1GXQA 4ESBA 4I7HA 5L3CA 2HS5A 3X1UB 4XUJB 3M8EA 4HQEA 2MH2A 3ZMVA 5D5WB 3HUGA 1DPUA 3AZJD 5E20A 5AV6C 3AYWB 4S05A 3C1CA 3V7SA 4ZYHA 4ETSA 1ONVA 1L0OC 1HW1A 1CGPA 1FYKA 3LQQA 2RVCA 3LELC 3X1VD 4Y13A 3KETA 3F21A 4ZYGA 1IW7F 2JSCA 1Z7UA 1O7FA 5KK1A 3B0DC 4HZFA 5AV6B 2HZTA 5DCMA 4LK0F 3WAAA 2XGXA 4HLXA 1STZA 4CICA 1BN5A 2F5FA 4YFXF 4KUDD 4MEXF 3J80K 2V9VA 4YFNF 1ZRCA 3LELB 2DPDA 3CUQC 3REKD 2HIOC 4J8WA 1FWZA 2F8NB 3A6NB 2FSWA 5BNVB 1BH9A 2IVMA 5C3IB 2L4MA 3B0DB 2OBPA 3ELKA 3K1NA 1ULYA 2RNJA 1I1SA 4U0YA 3MZYA 1MD0A 3AV2D 1AOIA 1IRFA 1WKMA 1H3OB 2XKOA 2PMUA 3QP5A 3CUQB 5EEGA 2C6YA 3O3KA 1D8KA 3IRRA 5HLIA 2HUEC 1M19C 1P92A 5IT3A 1REPC 4JJNC 1P3AD 1R00A 1P3GC 1LB2A 1P3OC 2L3DA 2NNYA 5CP6A 2RC4A 3T0YA 2Z33A 5B2JC 5D6EA 3GEZA 2AROC 2W57A 2R3SA 5BMZA 1H9GA 1U78A 2QZ8A 3AFAD 1MJ9A 3WKJD 2GAUA 3O6BB 3AZMA 1Z1DA 3MZHA 1Q9CA 3AZEC 4Q4ZF 4H9RA 3PQKA 3ZP5A 1KU7A 1D5VA 5A2QK 1ZRDA 2HUEB 1KU3A 5JFRA 3AV2A 4Q48A 5BOXA 1M19B 4M9SA 4JJNB 4S04A 1XMAA 5CJ9A 5IT9Z 5JI6A 3LZ0B 1QBJA 2EV5A 3REHA 3Q5FA 1TAFA 1TNTA 1IN7A 2AROB 5CVIA 1F5TA 4H9NA 1P2FA 1QGPA 1U5TB 5BQTA 5CVJA 2ZCWA 2JSSA 3AZFC 4DRBA 1EV7A 5AY8A 1P3AA 1BI3A 3AZEB 3FHZA 3F23A 3WTPD 4RGRA 2VOOA 3C1BD 2CV5D 3REIA 4Y15A 2H09A 3WTPE 3KXBD 4OINF 2HQNA 4BHPA 5B31G 4GXOA 3J80Z 2EWNA 5DNMA 3IWFA 3V9RB 1KQ0A 1B67A 4EO5C 1TZYD 3AZFB 1KQ9A 2GIVA 1W5SA 5L3GA 3HRSA 4XRFA 5F64A 1OYYA 2FJ7D 3W98A 1T98A 3EETA 3MQ0A 4OMZA 4G94A 3FMSA 1E17A 5D4RA 1YYVA 2BGCA 3GW2A 3DFGA 3FM3A 3MVDD 5B0YC 3WTPA 2L01A 1IUYA 3F8CA 3L7WA 2CV5A 1H0MA 3HSEA 4BHBA 5BPDA 3LZ1C 4I98B 2QYOA 3KXBA 1KU9A 2K4BA 2QVOA 2L02A 4A6EA 5HLGA 2F8NH 4FT8A 3QAHA 4H9OB 1P3MC 2X0LA 4EM0B 2VONA 4J8UD 4XSZF 1YQAA 1I27A 4UVBA 5B0YB 4YM6B 2LF8A 4UXNA 3LZ0D 2FXAA 4B09A 1XSDA 4Z5TC 3I5UA 4U7BA 3LZ1B 5A2QZ 3E6DA 3F6OA 1ZN2A 3KUYC 5B40D 1EQZC 1HTAA 5FB2A 1WWSA 3MGQA 2E1CA 2M5WA 4LD5A 1QQIA 2DK5A 4ASNA 2RKHA 3X1SA 1R1VA 5HDGA 1P3MB 1XD7A 2PI0A 3UTBC 1KX4D 4CDGA 4WWCA 3TKYA 4F7ZA 3LAJA 1KX3C 2L4AA 1R1TA 5CYVA 3O62C 3GO5A 3T8TA 1ZGJA 2F2EA 3M1EA 4XSXF 1RUNA 3KUYB 2X4HA 1EQZB 5AV9B 4P9FA 3RKYA 4EGZA 5B1MC 4J8UA 2YFVB 3AZNC 4H9PA 1R22A 1N1JA 1Q1HA 3AZLB 1YG2A 5AV8A 4M9ZA 1UCRA 1QNTA 3UTBB 1IN6A 4H9SA 1FP1D 5B40A 2YFWA 1G3WA 2ZFWA 2DW4A 3W96C 2HYGD 2AXLA 3R6SA 2ACJA 5DNNA 4RS8A 2HR3A 2UWMA 5D4SA 1KX4A 4NE3A 3IRQA 3AZNB 1J0RA 3MGSD 3UT9D 4P5OA 4X23B 1GVJA 1GHCA 4WU9C 1W7PA 2QQAA 2VBYA 1MGTA 4L9JA 3X1TA 3ERED 1B1BA 1TTYA 3ZMZA 4WCGA 4QLCU 5DV5A 4I0AA 5HS7A 3LAPA 1J9IA 3R60A 4WK8F 5E5AD 2DU9A 5D5VB 3W96B 2NYXA 3O2PE 2EK5A 4LB5A 3AZGC 1J7KA 3IHUA 4O6JA 2JPBA 1XGMA 4Z66C 3LA7A 1T0FA 4WU9B 2EA4A 3E5QA 2OZUA 1FNNA 2KIFA 3GVAA 5CPID 4WX9A 5KDMB 5B2IC 4UVAA 6PAXA 3F8BA 4OIPF 2Z3YA 1R23A 3QRFF 4CYDA 3MGSA 1KU2A 5GT3D 1P3BC 4PGGA 5GSUA 2ISYA 2D1HA 2ZMEA 3QP6A 4UUVA 2Z5UA 4L0ZB 1ID3A 3TOAA 3F72A 1TBXA 3NQUA 2M1BA 4Z66B 1TLHB 1HQCA 2NQBD 2H6CA 5E5AA 2E1NA 1J75A 5B0ZA 5E1ZB 1BFMA 4RGSA 3W97D 5B2IB 1P3PD 2BE5F 5F99D 4HF1A 2COMA 5HOOA 4RB1A 2XIGA 5L3FA 1G3SA 2GZWA 2XROA 2D1VA 1P3BB 3CDHA 4CAYA 3NQJB 4XLPF 4K2EA 5K5OA 5JRGD 2QM3A 1TQMA 5CPIA 1XDSA 2IA0A 2DLLA 2P6SA 3V4GA 5GXQD 5B33C 3AV1D 3NQOA 3F6VA 4KIFA 1R4VA 5GT3A 2K02A 4ZZLA 3GX4X 2A69F 4CXFA 2LDUA 1DDNA 5CPKA 3AZHC 1HKQA 4O3MA 3ZMTA 3MGPD 1V3FA 2IRFG 3AZIC 2LKPA 5AIPA 5BT1D 2PN6A 2BYMA 1ZAOA 3W97A 3RELD 1P3PA 5DDGA 4O5VA 2CYYA 3FXQA 2ETHA 5GT0D 1FZPB 1MJBA 1S3JA 4HV5A 4P55A 4EM2A 3AZJC 1Z91A 2AS5F 2XAGA 2QENA 2VODA 1BIAA 5JRGA 1CF7A 3HHHA 3CUOA 4BNCA 4EMSA 5GXQA 3B6FC 2MC3A 4OOIA 3X1VC 1KX5D 3TU4D 1BI2A 2HTSA 2HDCA 4HX4A 5HS9A 1HSJA 4IRHA 3GZ5A 3IC7A 3RKXA 4XZQC 3JSPA 1BM9A 3F3XA 1S6LA 5H6QA 1B4AA 4LK1F 1P3KA 4IJAA 3I54A 1E2XA 3E97A 4IHTA 1BH9B 4PGHA 5DUIA 1OPCA 3RELA 4KUDC 1W5TA 2EFQA 5BS7C 3M8FA 4HGAC 3H92A 5GT0A 3MGRD 3ML6A 3X1VB 1FSEA 3REKC 2A5YB 1P3ID 2TDXA 4Y17A 2XUBA 1SD6A 4EQQA 3WODF 2OQRA 1WWXA 2R7FA 4ZYDA 3TO6A 2F5EA 4HX8A 3V7RA 5FD5A 4EV0A 3AAFA 4MQ9F 3VH6T 4KUMA 1ZGAA 5H6RA 5AVBD 3HOSA 2FA5A 4KNYA 4G92C 1DUXC 3AV2C 3DPTA 1KQ8A 4YS3A 4RGUA 2ZO4A 4YG2F 2J5OA 2DQLA 4KUDB 1DP7P 3BPVA 3REOA 1WSUA 4HGAB 3ULQB 2D45A 1M18A 3REKB 4J8VA 2VBWA 2FMYA 4WXHA 5ICFA 5DD4A 3FX3A 1T2KA 3JW4A 4DQ2A 3C1CD 3KWQA 2E7XA 4EJTA 3VH5A 3WA9D 5AV5A 1IZ1A 2IJLA 3DEUA 1QZZA 4H9RB 2P5VA 3VH6A 3MGRA 4LLLA 4G92B 3AV2B 4QLCA 4KA4A 3WKJC 3AFAC 3W99A 4M6XA 4AWXB 1TAFB 4L5IA 5LRRA 4KN4X 1VTNC 5ILUA 4A5NA 2ZJ2A 2F8NG 4UHTA 4HBLA 2FNPA 1YS6A 1ZLJA 1S32A 1IXSB 2LF7A 3WAAD 3KP6A 5J8CA 2YPRA 4M74A 1P3AB 4CZZA 1T38A 4MHGA 2P7CB 5LHGA 3LSTA 4IVNA 3REIB 3HIFA 2LSOA 5FD6A 3BP8A 3WKJB 3AFAB 4J8WD 1XN7A 3GF2A 4JBAA 1PP7U 3WA9A 2E7WA 1IF1A 5DNMB 5HDNA 4L5JA 3R45A 1BI0A 3C1BC 3F8FA 2CV5C 4H9QA 1LDKB 5HDKA 1AOID 4HQMA 3JAMK 4J8XA 2STTA 3A6NC 3ZPLA 5C3IC 1TW2A 1PUEE 5K1YA 3DPLC 1LVAA 3I59A 1TZYC 4RB2C 2NZDD 1U6GA 3WTPB 2FJ7C 5F6FA 2EA2A 3RIRA 2OD5A 3C1BB 2CV5B 4M9XA 5CP6D 1R36A 5AIQA 4ENMA 3KXBB 3JSOA 3G73A 4HAMA 3VH5W 1ON1A 3TDUC 2DTRA 4L9NA 5FLXK 3VH6W 5B24D 3AZMD 1WRJA 2JZYA 4EVIA 3MVDC 5ICEA 1YLFA 1ZLAA 4H0EA 2UXNA 4UNOA 1TZYB 1YFHA 4RB0A 3V8JA 3E5UA 2FJ7B 4N9IA 4KMFA 1HQ3A 3REHD 3MNNA 3P7NA 4LFUA 3ISPA 4LD9D 2PYOD 2FMLA 3L09A 3TQNA 1F66D 1F1EA 4J8UC 2NZDA 3AZKA 4WF2A 3MVDB 2O61A 3FMQA 5AY8D 1MZBA 3LZ0C 1XCVA 5E18F 3LJAA 3RDIA 5B40C 3REID 4IF4A 4PZJA 1U5TC 4KHAA 1WI9A 1BBYA 4EJUA 5CVVA 5B24A 4MTDA 2QWWA 1P3FA 5DNMD 2CQKA 4R8PA 4HYEA 4U0WA 1KX4C 4J8UB 3COAC 3KSYA 2YU3A 3VFZA 1N1JB 4G7ZF 5AVCD 2Q0OA 2QQ9A 1U35A 5AV8B 2DPUA 4HV6A 3DQVC 2P5LC 4KMUX 3RPQA 4LD9A 3RTRA 3W98D 2PYOA 5B40B 2YFWB 4U88A 5H20A 2UXXA 3JAMZ 1F66A 4WU8A 1ZLKA 1YW8A 4EJOA 1RZ4A 4Z2MH 4Q47A 5LGNA 1IN8A 1KX4B 4OU0A 2Z9OA 3TOBA 3JTHA 2MBFA 3WTUC 3GLXA 3W6KB 1K78A 1ODDA 3U2RA 2MA3A 3X1UA 1J59A 1WWIA 1FYLA 3MGSC 3UT9C 4IXAA 5AVCA 2O0YA 5FLXZ 3TO7A 3ZN0A 2CSOA 1TQIA 5J8FA 3EDPA 5B32D 1A04A 4LMYA 2PBIA 1XDUA 3AYWA 2XVCA 3UTAD 2RVQD 3I0TA 3FXUA 2VN2A 5E5AC 1G6NA 2XRNA 1F4KA 3MGQD 4A0XA 4YM6C 1BIBA 4GYIA 3X1SD 2QBYA
chains in the Genus database with same CATH superfamily
3HTSB 3MGSB 3ECOA 4XIDA 3UT9B 1Y56A 2DAOA 1OCTC 3CMAI 4X6AJ 1XX5A 1ID3B 4HNUA 1T39A 3R0AA 4FETA 2ZNYA 2G9WA 3OYIA 2HIOD 4BDYA 3FXKA 3MVPA 5AV6A 1M1AD 3FK7A 4BGDA 2IA1A 2EZIA 1S7AA 5M5XJ 1HW2A 3GTPJ 2ZXHA 2P0WA 2VKVA 3S14J 4M6YA 5E5AB 3L9FA 2YU9J 1LQ1A 3OOUA 5GT3C 3HOTA 3HRTA 1JXSA 2R5ZB 1A5JA 5K7ZA 3NARA 3OOPA 3W6VA 1V54H 2FNAA 1RIOH 3GFLA 3F0CA 5B32A 4KJZA 2XSJC 2L5AA 1K4TA 2NXNB 1M1EB 1OMIA 1MBJA 1YS7A 2H27A 2KKOA 2BXYA 2OJED 3ERMA 2HU9A 1B6WA 1P6RA 3X2QH 2ZBKA 3UTAA 1S29A 4CAYB 4N4NB 4BJ5C 4MO7A 3HSFA 2HQAA 1VQ4I 1SAXA 5F0HA 3C3WA 2NQBC 5AV9C 2RQPA 4M73A 2A68F 2HNHA 2K3PA 1P7IA 2YSRA 4A3DJ 1D3YA 2NVTJ 4BQQA 2OZ6A 5H2FC 1SMYF 3A1IA 2V6EA 5CPIB 3W97C 1VQ5I 4NB5A 4P96A 1XPXA 2M3AA 3MCZA 3AL0B 5F99C 1P3PC 2L9NA 2Z16A 3KP2A 2FU4A 3AZLC 2Q1ZB 3B0CW 5DNND 5IYCJ 3FMRA 4ENKA 2KDZA 1WFXA 5M3FJ 1H3OA 5GT3B 3MEXA 4BXUA 1HW5A 3B6CA 1P3OD 4CSRA 2VJ4A 2JWTA 3HC7A 5CQEA 5B2JD 3CUQA 2XHKA 1FYMA 3O8HA 2HIOA 1M1AA 5JRGC 2ZXWH 3W6JB 3M9AA 2XSDC 1W7PD 3SZTA 4E44A 3X1TD 5CPKB 3OS0A 1C0WA 2XAQA 5GXQC 3AV1C 2NQBB 1SFXA 2XRLA 3RPUD 2V1DA 5JVTA 1OQYA 1MBEA 3C7JA 3CCEI 2P4WA 4II3A 3V8LA 3IL2A 3W97B 1P3PB 1LEBA 3FWEA 4UPKA 5F99B 2FBIA 4X23C 3V8KA 2DJIA 1FT9A 2ESNA 1O3SA 1KYZA 4HA8A 2XV4S 3P9CA 2JMWA 2WA0A 2BY1A 4AVPA 3DKXA 1W2EA 1MDMB 3MGPC 3QU3A 3BZ6A 5JRGB 2HGCA 1O3QA 5BT1C 1KA8A 1MMGA 1O3RA 3ZQGA 5AV8D 2JRTA 5FROA 1ITYA 4FX4A 3ZR8X 1RETA 2V9PA 3S32A 5GXQB 3AV1B 1M19A 1V5FA 5GT0C 2EV6A 3H9JA 2M30A 2WAFA 4LIUA 4XRSG 2GA1A 2PJPA 1P3GA 2BXZA 1P3OA 3DF8A 5B2JA 4KGCD 1XMXA 3OSFA 3BPXA 3LA3A 5GP9A 3PIPF 2AROA 5GSUD 2NS0A 2KT0A 3NWSA 1ID3D 4U0VA 4N4OB 3VOEA 1B9MA 4FX0A 1LDJA 3HZJA 5FUGA 2X85A 5B3SH 4RB3C 3B73A 1DQUA 3RPUA 3MGPB 1P3KB 4CHUA 2Z2SB 1KX5C 3QPTA 2X1EA 3TU4C 3ZQQA 3G4SI 3AZEA 4NBQA 5F27A 2GXGA 2IT0A 4M3EA 2K7LA 2EPFA 5B0ZD 1WCMJ 4BUPA 3RELB 1P7JA 3KLOA 4H4KC 2EILH 2WY8Q 3GFMA 1GV5A 2Y69H 5GT0B 3AN2D 2KZVA 4ZDLA 3FF5A 3G2BA 4IZZA 2JVGA 2Y0SA 2Q2EA 1ETYA 3LSKA 2DA4A 5M3MJ 3CLOA 3BR2A 5TJJA 5LHHA 3I58A 2HFHA 3QPSA 2D2WA 1RNLA 4HLYA 3EUHC 3PSIA 1ETXA 5L3BA 1XGOA 3H3ZA 1LE8A 3K4LA 5IP7J 1ZYRF 2FUG2 3DKYA 4AIJA 2R4GA 2GXBA 5ICGA 3AZFA 1FBSA 2KZGA 1FOKA 4HDVA 3MGRC 1KX5B 2PMZA 3TU4B 4XLNF 4KIGA 4Z2YA 1P3IC 1YTYA 1EH7A 3MFKA 4A3MJ 1WJEA 3C1DA 5TISC 5B1AH 4KGCA 2M87A 4J00A 1U9NA 5B31D 2EINH 2MH9A 3OL4A 1VQKI 5AVBC 2DBBA 4CCMA 5CPKD 4II2A 4LLNA 2O9LA 1XB4A 4ZDOA 3H1CA 2VXDA 4A5MA 1GLNA 3KWQB 2CUJA 4F93B 4A2UA 5F1JA 3MMYB 3H5AA 4MFEA 1QVTA 1FBUA 2XKPA 4KICA 3AN2A 3MGRB 3A01A 5CVUA 1YX3A 1P3IB 5EYRA 1AOYA 4IRGA 1T8IA 4A0ZA 4C2MJ 1OCOH 1B8IB 4AYBA 3PL8A 1FTZA 3C1CC 2JRMA 4DYQA 2VIXA 3GYHX 3CJRB 4H9OA 2W48A 3DTIA 2DFFA 2M2EA 2BY3A 5AVBB 1OKRA 3OYJA 3K9TA 5BO0A 3C2HA 3JTGA 2H6BA 1OYWA 4GYGA 1UFMA 5IPAA 2LD5A 3K70C 5B0YA 2UWXA 3KYDB 1FBQA 1Y39A 4NNJA 1PDNC 2PEXA 1ZG5A 2E2JJ 1G8XA 5B31A 4FTHA 3Q9SA 4HSRA 5J4YA 1X1PA 2KL4A 2M9HA 4E45A 3KEYA 2RV8A 1WJ5A 5LLQA 2NNNA 2ZY4A 1RI7A 2PLYA 4GGGA 4ZTFA 2DT5A 3BY6A 5CLSA 1P3KD 4YEJA 1IJWC 3E6BA 1PVEA 4RDUA 2R7XA 3C1CB 4GFBA 3WAAC 1SD5A 5EGOB 3WA9B 3L2RA 5HLHA 4PDKA 1P3MA 4WV4B 2PFBA 1R7JA 2HEOA 4H9QB 5J1RA 3LOCA 5ED4A 3DWLE 1X19A 2L7ZA 4ITVA 3NEUA 1O7LA 4PFPA 1H8AC 4J8WC 4Z5TA 2LR8A 2GOXB 1HC8A 2PQ8A 3KZYA 4HX7A 5TGTA 1BH8A 5DUKA 4G7OF 3R61A 2WAEA 3KUYA 3PNYA 1Y0UA 5CKTA 2IW5A 2FBHA 4BEHA 2VASA 1J2XA 5LEKA 4IRIA 4KFCA 2YFVA 4MIMA 1HKSA 3I59B 2E5NA 3IH4A 5DCMB 1O4XA 3KX2A 4C2UA 1Z21A 3CTAA 2HQRA 3WAAB 3OYGA 1AOIC 2JK3A 1TZLA 2CQ7A 4YS3D 3MKWB 1I5ZA 3I4NJ 2IPQX 1ZG1A 2HXIA 1TQPA 3OV8A 1SMTA 2VXZA 4XONA 2F5CA 4ENNA 3QOEA 5BPIA 3EPJA 3UTBA 1O57A 4UV8A 2GWRA 3FXMA 3BTJA 1M18D 4JX5A 2IP2A 4J8VD 1KX3A 4WZSB 2LNBA 1XCBA 4GO1A 4B1RA 2ZXJA 1PP8F 2QBYA 2YS9A 4GDFA 3IP4C 3DBHB 5JA4A 3O62A 4J8WB 1QZYA 1JHHA 1Z3YA 5EZGA 3K0LA 4LG0A 1HDPA 4RM3A 1JFIA 5DCFA 1FP2A 4IHSA 2NZDC 5B1MA 2V6CA 3KWQD 1ZLAB 4DZJA 1YW9A 5AV5D 3L2CA 5FKLA 2XAHA 2CG4A 2FQ3A 2HWVA 5CP6C 4I0BA 1ZRFA 4EM1A 4R79A 1AOIB 4QLCD 4AIKA 1P34D 3H5NA 5E79C 3DCFA 3GCMA 3WG7H 3AZGD 1IN4A 1EH6A 1D0ZA 5TRDA 3W99D 1Y1WJ 3VH5T 5FRNA 1P3LD 3WU0A 3R0JA 5B24C 3MNNB 3AZMC 1U8RA 4CYCB 3CO7C 2CH0A 5K7FA 2K27A 2LOOA 2KDOA 3F22A 3IP4B 3CCSI 4A93J 5J3LA 2XD1A 4BH9A 3BZCA 4LB6B 1A7WA 3H0GJ 2PG4A 5K7HA 1R4NB 1K6YA 1U8BA 5KHDA 1S32D 2NZDB 3ZQFA 1R1UA 3I64A 2VBZA 1MJAA 4YIIA 1WJAA 5LBQA 5FKOA 1Z9CA 3REHC 3M7GA 4N9HA 4A69C 2MGQA 4M3DA 2CWEA 3A0BC 4BBRJ 1OFCX 2QEXI 2NRAC 5CP6B 4LD9C 2DK8A 1GVDA 2R92J 3LQRA 2IGKA 4PJNA 4PCQA 3ZCOA 4WU9A 5LD2C 2PYOC 4U7DA 1OYIA 1FC3A 2VQHA 4XL9A 5FKNA 4KHAB 1ZARA 1F66C 3FDDA 3EYIA 2W85A 5KDMA 5B24B 1SVMA 1V5EA 3AZMB 3OMYA 3KEOA 2M8EA 3DEWA 3G71I 1P3FB 5AY8C 3M8JA 1P3AC 1K79A 5CVRA 4PJ0C 5J1YA 3GZNB 3Q0VA 2O5RA 1JKQC 4KT5C 2NOGA 3QPLA 3CJNA 3QYBA 5K5QA 2DA7A 3REIC 3FM5A 4NC7A 1P34A 2E71A 3DPUA 3LMMA 2GOMA 2XF5A 2LY1A 5ERIA 5BNXA 3AZGA 4J8XD 3REHB 1P3LA 4CA0A 1TNSA 3RQIA 4Z66A 4G91B 2EJRA 1ZREA 4ESFA 4LD9B 2DODA 1JKPC 5DNMC 3HOWJ 2PYOB 2YX4A 4H9NB 4GCVA 3H36A 4N0BA 4C3HJ 1F66B 2XF7A 3ASNH 4WU8B 3E6CC 2WB1A 3OYFA 5AVCC 3ABTA 1KU5A 1XGSA 2QUFA 5J4VA 5AY8B 1BI1A 3KP5A 3REJD 1P3BA 3VODA 3NQJA 3W98C 3EPKA 2HXOA 4AIHA 5HLTA 1R9TJ 1AHDP 4I99C 2K9QA 3TDZC 4HSTA 2ECBA 2JUGA 1K7AA 3AZHD 2KP6A 2E5ZA 2GIZA 2XGEA 4YFKF 1K78B 2CV1A 2BYKA 4G12A 2M8GX 5AONA 4CCKA 2X6XA 4A3GJ 2FEZA 3BR1A 3AZID 3WTPC 3GUDA 1ZLAD 4UUSA 4E7JA 2IO5C 2E1MC 3OIQA 1USSA 2Z99A 1YW7A 2EZHA 2FOKA 5CQGA 3HOVJ 2VBXA 1HKTA 5AVCB 1P4XA 2M45A 5B1LD 3KXBC 3WU1B 1FLIA 1SVLA 2VC0A 2QSHX 1QVUA 1ZHFA 3DV8A 1N78A 1USTA 4AC0A 3WTWC 4OIQF 3W98B 4IOCF 1NK2P 1HQ3D 2WWYA 3PSFA 4KDPA 3MNND 2G7HA 3FXOA 1X1CA 2W4SA 2KIUA 3KP3A 4XBFA 1LJ9A 5IT9K 1Z77A 2R7DA 3RYPA 2H8RA 2AQFA 5CPJD 5B33A 1T6SA 1TWGJ 5DYMA 2R7WA 3B6FD 3ABKH 3AZKD 1MMSA 4R1HA 5B32C 3SZPA 3REJA 1WPKA 4IPAA 5M5WJ 2IO5B 3B6GD 2K3FA 2E1MB 1ZKGA 1K6OA 2QBYB 1TW3A 3BR5A 3UTAC 4GRIA 4A3JJ 4I2OA 2RVQC 3DKWA 3S2WA 1XSVA 4XZQD 3LJAD 3KLNA 4NQWA 3V7CA 4B43A 1Q1VA 1DU6A 3AZHA 1B6AA 3WTYC 2RGVA 2ZNZA 4ABZA 2VPLA 3MGQC 3GTGJ 3SQNA 3ZGKA 1IAWA 3AZIA 2K9NA 3TP3A 4UUZA 4CGZA 2WBMA 1P3FD 4QPQA 1IRGA 3X1SC 2N8GA 5J6XA 2GXAA 2FRHA 3VSLA 4R8PD 2OF7A 1JGSA 2MLGA 4L18B 4WNNA 3L00A 1TC3C 2B0LA 2DQNC 4I01A 4OMYA 2A6EF 5B1LA 2ESHA 2NVYJ 5B32B 3AZJA 3AG1H 1M1AC 4PUSA 1U35D 3I9V2 3E3VA 1Y8QB 4M6VA 3TBIA 3UTAB 4BY1J 2Y2PA 3ZQCA 3GWZA 2Y48A 3FXRA 2E36A 4X0GA 1U2WA 5CPJA 1R71A 1W4MA 3MGQB 3B6FA 3K1MA 4PJJA 4WU8D 3X1VA 3PJRA 4BQOA 4JX6A 2FBKA 1Z6TA 4IL6C 3PUFA 3B6GA 5AV8C 3X1SB 4F91B 3ZQLA 2OV7A 1O3TA 5DM7F 3IAM2 5DM6F 2WV1A 4XZQA 3BTIA 4CSRB 4BY7J 3GFIA 2DA2A 4H9SC 3HJEA 5DTDA 2TRTA 2HIOB 1M1AB 2E35A 1I39A 4UB6C 4ZUXD 1V5GA 3ROUA 1RKWA 1W0UA 2MABA 3OR2C 1MBKA 3KP4A 5DNNC 3IH3A 2X6OA 4MLOA 4KUDA 3JCUC 5BS7A 3X1UD 3B0CT 4H9PB 4XUJD 3RCOA 3LSJA 1S8NA 3FZVA 3BOQA 3IKTA 5ICCA 1QA6A 1G2HA 3P5JB 4E4HA 3REKA 2QLZA 2CW7A 3GXOA 3WGHA 3X1TC 2K4JA 2L9RA 3CJTB 3AYWD 4OIRF 1JUMA 5FFXA 1BC8C 2LY9A 2KIMA 3PFIA 2EFNA 4RGXA 3RZDJ 3GZ6A 1XMKA 1N25A 2BV6A 5L3EA 2V1UA 2VQCA 1LDDA 1OR7A 3LWFA 2HKOA 2PMHA 4D5CA 5D8LB 2HVRA 2O3FA 1HBXG 5G49A 3OS2A 3BG7A 1EKEA 3U9GA 5DNNB 2HDWA 1MMNA 1P3GB 4G6DA 5E3LA 1P3OB 4PSWA 4NUBA 2OQGA 5IY5H 2LKSA 5B2JB 2GBYA 1T0FC 2BY0A 5GPCA 3I4MJ 4EJVA 4L9TA 4LLGF 5F1RA 1XGNA 1R58A 4A3FJ 1RUOA 1W7PB 2FF4A 3QPHA 4M71A 4ZUXA 5AV6D 3X1TB 2HTJA 5FUGB 5F0FA 1YIOA 5EDNA 4MEYF 3CJQB 1F9NA 4DRAA 2OA4A 1BC7C 2YR2A 2CO5A 4NFTA 3I53A 4XUJA 2ADUA 2HYFA 3OYCA 4KGCC 2DDBA 3CCLI 3HRUA 4ZJZA 2ZMEC 4UV9A 4XNFA 4OAZA 1B72A 5GSUC 1ID3C 1E3HA 3LELD 3IUOA 1YJ9I 2KJBA 3WKJA 3AFAA 3VPRA 3AG2H 3IAS2 1WVRA 4PSXA 2F8ND 2XPWA 3A6ND 3KP7A 2HZDA 1LNWA 4ESJA 2ZSHB 3CD6I 3EUKL 2HPIA 2EBIA 2KISA 2M7BA 1FSHA 5D5UB 5E3NA 1LE8B 1G3TA 5B0ZC 1HDDC 3DTEA 4OWRB 4A3CJ 4QWQA 4P9UA 1Z67A 3DLAA 3AN2C 3ZQIA 3BR6A 1YI2I 4IO9F 3H35A 1WJDA 5LGTA 2CGPA 3VB2A 3DBLB 4HF0A 4L5EA 1BOAA 1I6XA 4KGCB 1HSTA 5GSUB 3L2QA 2ZMEB 1R5HA 2LG4A 1LFUP 1A31A 4WXDA 5KNLA 2NVXJ 2L9SA 2GQQA 3GFJA 3LSGA 3WTZA 4YIRX 3RKQA 2IA2A 2NAZA 2NS8A 3EQLF 3OYAA 2FFFB 3NQUB 5CPIC 3C18A 5LEJA 3AL0C 3P9IA 4HF2A 4L9VA 5B5EC 4I6ZA 5LHIA 2A3SA 3UNGC 5B0ZB 1R5ID 4M3GA 4BYYA 3J7YJ 3N4MA 4ZBJC 1BR1A 1P4WA 2KQRA 4EO5B 3C1BA 2Y2MA 2XAFA 3LELA 4LGWA 3ZRGA 3AN2B 3A01B 2J5PA 4V2GA 5B31C 3ABLH 2XGCA 1QO0D 3MAJA 4XK4A 2F8NA 3A6NA 5BNVA 5CPKC 3DXJF 4UVCA 3K69A 3GMEA 2CU7A 3RJPA 1FX7A 2F5DA 4E70A 1WQ2A 4JQFA 4CSWA 5EF6A 2K86A 2CFXA 2WTEA 3KZZA 5BNGA 2H94A 5KVRA 3ZQ7A 2HKXA 4FCYA 3D5LA 4G7HF 1TZYA 2FJ1A 1MKMA 1ZELA 2W82A 2ZB9A 4V19K 5BO0B 2HVSA 1M19D 4PJMA 1MNEA 3JRDA 2QQBA 4JJND 5CHLB 4BHCA 5JR3A 2M0MA 2QSGX 3R4KA 4ZBJB 1P3GD 2FJ7A 3I56I 3IWZA 2W84A 2E1OA 4Y7NJ 2O8XA 2AROD 1V4RA 4LJZF 5B31B 5IOZA 4AU7A 2DMQA 1J5YA 3MVDA 3PQJA 3KFWX 2L9VA 5EG0A 3EPLA 4BE2A 2E2IJ 3AZED 1IG7A 4Q5SF 1XC5A 2BYMB 3T8RA 4CO8A 1ETWA 3J81K 1UAAA 3G3ZA 3G1MA 3CCMI 2PJRA 1JTXA 2Y9ZA 3G1LA 2OCCH 1AA7A 3EG5B 3SXYA 2LYCA 2ZJQF 1H9TA 4Z5TB 3KCCA 1P3KC 3KE2A 2A07F 4UUTA 1YO5C 2JTVA 1BH8B 1SD4A 4KIBA 3BTLA 2LREA 1CF7B 2IGMA 2A61A 1ZTRA 1SFEA 4XLCA 4XORA 2IAIA 3VEPA 3UR3C 4MNUA 3RELC 5K5RA 1PUFA 4HRIA 1X4PA 5DEQA 4A6DA 2QKMB 3KEQA 3S1NJ 3LSIA 4JJNA 3AZFD 3F8MA 2BEOA 3NRVA 4OIOF 2Y0MA 4X1EA 2VC1A 1R5GA 3LZ0A 2P7VB 1BW6A 2QF7A 1G4DA 5E1WA 4M6BA 3WE3A 2RNGA 2X1DA 3MKYB 5EEHA 4RAZA 2VOPA 2R0QC 1U5TA 4MQVA 5LGUA 3DBRB 2OU2A 2VI6A 2QA4I 1KX3B 3SHFA 3O62B 2K85A 5JA4B 1XS9A 2VE8A 1MBHA 1E0EA 3PNTA 4A0YA 4LG0B 1X3UA 4XOPA 3D0SA 3ABUA 1JFIB 2BY2A 3TO9A 4YS3C 2VT3A 3PM1A 3HOZJ 4Y33A 1V55H 5B1MB 4A3BJ 3H3UA 4DW6A 5E8IA 4BAYA 3QU6A 3BDDA 3B02A 3LL7A 4HNTA 5L3DA 1M18C 3VYRB 1LEAA 2LFBA 2O03A 4J8VC 5FO5A 3DU5A 4V2FA 3S3OA 3WGGA 1IXRC 4XR6A 3V9RA 2WV0A 1DGWY 1IN5A 3T5XA 3KWQC 3BTCA 5AV5C 4TV7A 3QOPA 1EA3A 2KFDA 2L7MP 3CESA 1LKXA 5IOYA 3MKZA 2DO7A 4QLCC 4YS3B 3BJ6A 5B0YD 1P34C 4YM6D 1W5CC 2LY8A 3K4MA 2KRCA 5LFAA 2JSPA 5FLVA 3W99C 1P3LC 1Z2CB 2BBYA 3LZ1D 1M18B 4XM3A 4NE5A 4J8VB 4RM2A 2CW0F 2CFOA 2F6CA 3ZMDA 3I3LA 1N77A 2WADA 3BR3A 2XASA 3I4PA 1ETKA 1S32C 3SZGA 4ZH4F 3RKWA 2JPCA 1KYWA 5D8KB 5FRMA 3B6AA 5EJCA 4ZZDA 2DCEA 2EV0A 5AV5B 3S2HJ 1KGSA 2EFPA 4QPOA 1P3MD 1D8JA 3UT9A 3M1CA 4QLCB 1OCCH 1P34B 3EYYA 5D5XB 5HS8A 2MFZA 2AQEA 2MG4A 2W25A 5BNXB 3AZGB 3HHGA 1WHUA 1QHGA 3BJAA 4Z5TD 3W99B 3HKZN 1P3LB 3VYTB 1J09A 1ZK8A 9ANTA 3J81Z 1Z05A 1AWCA 2V79A 3WA9C 1FJLA 3KUYD 2STWA 4FE7A 1EQZD 5AV9D 2KRFA 3TW6A 3BG5A 1GXPA 4I02A 3OYEA 5E8GA 3LNQA 4HW0A 4EJWA 1VQLI 1S32B 2G0EA 4G9YA 3AKZA 4NE6A 2XAJA 4YM6A 3AZLD 2Y75A 5JHUA 4KN7X 2EFOA 3HTUA 3U1DA 5LRSA 1FPQA 2ICWG 1SANA 3BR0A 4J8XC 3U1KA 3LZ1A 3UTBD 2GM4A 3B0BA 4BU2A 2BW3A 2V1XA 1KX3D 1GUUA 3DEEA 2UZKA 3O62D 3WG9A 5HNFA 2JCHA 2OAZA 1NHAA 1RR7A 2BYKB 3L2UA 3RYRA 2KPMA 3MWMA 5B1MD 2P5KA 1CQTA 3REJC 1B9NA 3E0JB 4UUSB 3CCJI 5FGMA 1XSXA 2VJJA 3R45B 1FY7A 3AZND 4ZYEA 1L3LA 2WC2A 3CCQI 4IHVA 2WAQN 4X23D 2ISZA 4RAYA 5JLWA 5HVQC 4J8XB 2HYJA 3CQZJ 1SFUA 1N75A 3A0HC 2Q8KA 2VQRA 2DQRA 3JRHA 2NQBA 1EQZA 4QIWN 3HDDA 1UJ8A 2Y2ZA 3HSRA 5AV9A 4D7MA 3SFZA 1IRXA 1ZLAC 1P4AA 2KJCA 3OYMA 4KISA 3W96D 4L0YB 5F99A 5B33B 1JHFA 3AZLA 5BS6A 5EEAA 5B1LC 2W24A 3WTTC 4AWLC 1HXDA 3REJB 3WGIA 3BROA 4AM3A 4G6TB 5J47A 3TGNA 2CUZA 2ZJRF 1MDMA 1ETQA 4EGYA 3S1RJ 1HQ3C 1NTCA 1HF0A 3MNNC 2VQLA 2EZKA 2HPMA 4NQWB 4WU9D 5ILVA 3WTSC 3IKVA 1JE8A 3AZHB 4I09A 5CPJC 2DA6A 3AV1A 3DP7A 2VT2A 2A6HF 3AZKC 4ON0A 2RN7A 3AZIB 2Z1DA 1F36A 4QSHA 1VQ9I 4Z2MG 4UUZB 4G8XA 5D6FA 4MGRA 3B6GC 5E1XA 4JP0A 2RIQA 3AZNA 1VQMI 3CLQA 3MZ8A 1ZH5A 4B8XA 3I71A 3CO6C 3E6MA 4X23A 3LJAC 1IO2A 3K1PA 4WNNB 3F8NA 4BKXA 5B1LB 1ZG3A 1ZGWA 4KT6A 4AWLB 3AZJB 1MH3A 5JLXA 3K2ZA 1U3EM 2AXTC 2O6GE 3MGPA 4AD9A 4DNCA 1HQ3B 4Y52J 1G3YA 4Z66D 4G6QA 1IXCA 2EB7A 3ECHA 4XKVA 3RI4A 1D1AA 2P6TA 1P3FC 3HRMA 1UB9A 2F48A 4HDUA 2JT1A 3WE2A 3W96A 2ZKZA 3N97A 4BQAA 4R8PC 1SD7A 2CQXA 2MC4A 5CPJB 3B6FB 2E34A 3FXLA 1ON2A 3HOUJ 3Q9VA 3A1KA 3AZKB 5B2ID 4MTEA 4PJLA 4RLFA 1VQ7I 3B6GB 1U35C 3E7LA 4RBOA 2VE9A 1GT0C 1WI3A 2HOSA 1P3BD 3ZN1A 4NHJA 5FFZA 5DD8A 5E17F 4G91C 1F1ZA 3LJAB 4XZQB 3T1BA 4ZYAA 2DA3A 2X1CA 4FASD 3J7AY 4BL0B 3HPHA 2FE3A 4P1WA 2LK2A 4WU8C 2DI3A 2DFIA 2F8NK 3TP0A 4A12A 1KX5A 3TU4A 3FK6A 3BWGA 3VWBA 3ZMUA 1AKHA 1IUFA 1DPRA 1P9QC 4HOBA 2I8DA 2EFWA 3Q0WA 2IGOA 5ILSA 4R8PB 5EZHA 3P9KA 1RPWA 2L54A 3WTVC 3GTOJ 2DFEA 2P8TA 1U35B 4ENJA 1MMDA 4ZUXC 3W2WA 1BJAA 4CH7A 3OYLA 3D5RC 3EUHA 2HOEA 2JJ7A 3BG3A 2ELHA 1MW7A 2YX7A 1FIAA 2RDPA 4XLEA 2ZJPF 3WTXC 4YIFA 3J7AO 1EJ9A 2M0CA 3PNVA 3X1UC 1I1GA 4R8HA 1S7OA 2MLKA 4D0PA 2VKEA 4IEJA 5B66C 4XRSA 2O8KA 2IS1A 5B2IA 5B33D 4XUJC 1ACIA 4M72A 3ZMSA 5G49B 3K4NA 2MD5A 1P3IA 2QSFX 3E5XA 3OR1C 2BYVE 2GA2A 2Y2GA 4WXCA 3HYIA 3LFKA 4BE1A 3TEDA 1YRNB 5B32G 3AYWC 4XOTA 1QPMA 4JK1X 1Z6RA 2G7UA 4IHYA 4KYWA 3LA2A 3M07A 1R4MB 4FHTA 1UHWA 1UHMA 4RA2A 2JA2A 5AVBA 4ZUXB 1B59A 2HI3A 3BJOA 1EH8A 2XB0X 5KCMA 1GXQA 4ESBA 4LITA 4E7IA 4I7HA 1TWCJ 5L3CA 2HS5A 3X1UB 3QYEA 2PMZN 3TMOA 4PK4A 2Y2QA 4XUJB 1JJ6C 2XAUA 3M8EA 4CUGA 5GAHJ 4FISA 2ZY5A 4HQEA 2ECCA 1B72B 4AUXA 2MH2A 3ZMVA 5D5WB 2RREA 3HUGA 1FOXA 1DPUA 3AZJD 1WJFA 5E20A 5AV6C 3AYWB 1ZR2A 4S05A 4XRMA 3C1CA 2EIKH 3V7SA 4ZYHA 4ETSA 5EGOA 4DYCA 1MMAA 1X2MA 1ONVA 3MKLA 1L0OC 1HW1A 1CGPA 1FYKA 3LQQA 2RVCA 1EF4A 1DP3A 3BCBA 5C44J 2FX0A 2LBFA 3LELC 3X1VD 4Y13A 5E3OA 3KETA 1FMVA 3K4CA 3F21A 4ZYGA 1YX5A 5HNHA 1IW7F 1Y6IA 2DT6A 2JSCA 2VQGA 1Z7UA 1O7FA 5KK1A 3H5RA 4FQGA 3B0DC 4AYBN 4HZFA 3A1YA 1FEXA 5AV6B 3Q0UA 1RKTA 2HZTA 2V4JC 1UG2A 3TL4X 5DCMA 4LK0F 2MSYA 3WAAA 2XGXA 3ASOH 3FXJA 1SFOJ 2FOWA 1BR4A 4HLXA 3PIOF 1STZA 2HVQA 4CICA 3F9KA 3ZXSA 1BN5A 1I3AA 3S3MA 2F5FA 4YFXF 4KUDD 2DA1A 4MEXF 2EIJH 1QRYA 3J80K 1JTYA 2V9VA 4XLAA 2DFHA 4YFNF 1ZRCA 3LELB 2DPDA 3CUQC 3BG6A 3REKD 4W1UA 2R7RA 1JT0A 2HIOC 4J8WA 1FWZA 1LFPA 5DS9A 3GTMJ 2F8NB 3A6NB 2FSWA 2CS3A 5BNVB 3K10A 2IVMA 1BH9A 4F55A 2R93J 1NG6A 5C3IB 2L4MA 2DJNA 2MW8A 4HPQA 3A2KA 3B0DB 1VNDA 2IS2A 4S0HB 1PYVA 3D1NI 2OBPA 3ELKA 3K1NA 3OIOA 3OSGA 1ULYA 2RNJA 1I1SA 4C30A 4U0YA 2IXSA 3MZYA 1MD0A 4CCNA 3AV2D 1IRFA 1AOIA 3OY9A 2DYRH 3LSMA 1WKMA 1F43A 1KZHA 1TT5B 1Y8RB 3OL3A 1H3OB 5FJ8J 2XKOA 2PMUA 1SVOA 3FDYA 2ME6A 3S1QJ 3QP5A 2DA5A 2CV0A 2DMTA 3CUQB 1I6HJ 3JR9A 2JE5A 5EEGA 5C4XJ 2C6YA 1R6RA 3VYUB 3O3KA 1D8KA 1E3OC 1S9HA 3IRRA 3CCYA 5HLIA 3CC7I 3RQ4A 2HUEC 1M19C 1P92A 5IT3A 1REPC 4JJNC 5GAEJ 1P3AD 1R00A 4XN3A 4D5FA 1P3GC 2IBDA 1LB2A 1X1AA 5C4JJ 1P3OC 2L3DA 3FHNA 2NNYA 5CP6A 2RC4A 3T0YA 2Z33A 2JA7J 5B2JC 1D1CA 5D6EA 3GEZA 2AROC 2PJRB 2W57A 2R3SA 5BMZA 1H9GA 1VQ8I 1U78A 2ZC2A 2QZ8A 3GTLJ 1MJ9A 3AFAD 3WKJD 2GAUA 5GAGJ 1TP4A 2AHQA 3O6BB 3AZMA 2ID6A 2K40A 1Z1DA 3MZHA 1Q9CA 3AZEC 2LC2A 5JVGF 4Q4ZF 4H9RA 3PQKA 3ZP5A 2LMDA 1KU7A 1D1BA 4J19A 4LOCA 5A2QK 1ZRDA 1D5VA 1PUFB 1KU3A 2HUEB 5JFRA 3AV2A 4Q48A 5BOXA 1M19B 4M9SA 4JJNB 2P81A 3OYKA 2K9SA 4S04A 1XMAA 1S7EA 5CJ9A 1X4OA 5JI6A 5IT9Z 3LZ0B 3VSKA 1QBJA 2EV5A 3REHA 3H9GA 3Q5FA 1TAFA 1TNTA 3KPHA 1IN7A 1VQNI 2AROB 5CVIA 1F5TA 4RAFA 4H9NA 1P2FA 1QGPA 1U5TB 3CP8A 3OYBA 4E7LA 4AIDA 5BQTA 2X9DA 5CVJA 2ZCWA 3S2DJ 3SJMA 4RMNA 2JSSA 2ZSIB 1UZCA 4DRBA 1QU3A 3AZFC 1EV7A 5AY8A 1P3AA 1BI3A 3AZEB 4AVZA 3FHZA 2IEKA 3F23A 3WTPD 4RGRA 2CMPA 2OCEA 3I55I 2VOOA 3C1BD 2CV5D 3LFUA 3REIA 2KMUA 4Y15A 2H09A 3CDIA 3CCVI 3WTPE 3KXBD 2K9MA 4OINF 2H1KA 2DXIA 2Q2EB 2I5UA 2HQNA 4BHPA 3CMEI 4BBSJ 5B31G 4GXOA 3J80Z 2Y31A 1WGXA 2EWNA 5DNMA 3PUBA 3IWFA 3HEFA 1TL8A 3V9RB 2OTJI 3CCUI 5HODA 4ZDPA 1KQ0A 1B67A 3MD2A 2W7NA 2CRGA 4EO5C 1TZYD 1D5YA 3AZFB 1LFBA 1KQ9A 1G59A 4YELA 1A6QA 2GIVA 1W5SA 5L3GA 3HRSA 4RLQA 4XRFA 1W36D 5F64A 3OYDA 1T33A 1OYYA 3L2WA 1ETOA 1IDYA 2FJ7D 3W98A 1T98A 3CDLA 2ELKA 3FIWA 1NH3A 3EETA 3MQ0A 4OMZA 2VJ5A 4G94A 4ANJA 1A6IA 3FMSA 4A3LJ 2L7FP 2W1OA 2HQ5A 4XN0A 3N05A 1E17A 1HA8A 2M4GA 5D4RA 2Y2IA 1YYVA 3VDXA 2BGCA 3GW2A 2KIQA 3DFGA 3S1MJ 2BZTA 3FM3A 3CC2I 2W8SA 3MVDD 5B0YC 3WTPA 3HBLA 2L01A 2ZY3A 1IUYA 1W0TA 4DZPA 3F8CA 3L7WA 2WB1N 2CUFA 4IHXA 2B9SA 2CV5A 1H0MA 3HSEA 4BHBA 5BPDA 3LZ1C 1OJLA 4I98B 4XLFA 4IHWA 3BC8A 2QYOA 2UV1A 1KU9A 3KXBA 2K4BA 3A02A 2M4KA 2QVOA 2RAEA 3W2VA 1UMQA 3CF5F 2EH3A 2L02A 5F04A 3HM5A 3S15J 4C3JJ 3F6TA 4A6EA 5HLGA 2F8NH 2B63J 3HXLA 4FT8A 3QAHA 1T95A 3IV5A 4H9OB 4M3FA 1P3MC 2ZFUA 2XC7A 2X0LA 4EM0B 2VONA 4J8UD 5IP9J 1DU0A 5GTHC 4XSZF 3UKGA 1YQAA 1I27A 4UVBA 2R7ZJ 5B0YB 4YM6B 1RR8C 1JJ8C 3BT9A 2LF8A 4UXNA 2QKLB 3LZ0D 3GTKJ 2FXAA 4B09A 1XSDA 4Z5TC 3I5UA 4U7BA 4FE4A 2VLAA 5A2QZ 2OUMA 4A3EJ 3LZ1B 3E6DA 3F6OA 3L2VA 1ZN2A 4CCOA 3KUYC 5B40D 1EQZC 2BW3B 4IQJA 1MSEC 4J01A 5FB2A 1HTAA 3WHBA 1WWSA 2LTPA 3MGQA 2E1CA 2M5WA 2L7KA 2BG1A 1JUSA 4LD5A 3HOYJ 2GLOA 3A03A 1QQIA 2DK5A 3KZIC 4ASNA 3FBIB 1D0XA 2RKHA 2XGDA 1R1VA 1E3PA 5HDGA 3X1SA 3FKIJ 1P3MB 1XD7A 4BJ6C 2PI0A 3UTBC 1KX4D 4CDGA 4WWCA 1VQOI 3TKYA 4F7ZA 1WJBA 2VKDA 3LAJA 1KX3C 2L4AA 1R1TA 3JRGA 5CYVA 1UELB 3GO5A 3O62C 3JRCA 3T8TA 2R7UA 1ZGJA 2F2EA 4D1QA 3PO3J 3M1EA 4XSXF 1RUNA 3KUYB 2X4HA 1EQZB 5AV9B 4P9FA 3RKYA 4EGZA 5B1MC 3C2BA 5B1BH 4BEHB 4J8UA 2YFVB 3AZNC 4H9PA 1R22A 1N1JA 2L5QA 1QHHD 3P5JA 1Q1HA 3AZLB 1YG2A 3M4OJ 5AV8A 4M9ZA 1UCRA 1QNTA 5FKMA 2V1NA 5E3MA 3UTBB 1IN6A 4E6KG 4H9SA 1FP1D 5B40A 4BXXJ 1BR2A 1YHQI 3BZKA 2YFWA 1G3WA 3ONQA 5GTIC 2XDVA 1ENHA 2ZFWA 3WHCA 2DW4A 3W96C 2HYGD 2AXLA 3R6SA 4F3QA 2ACJA 2R5YA 3HL2A 3FKJA 5DNNA 4RS8A 2HR3A 2UWMA 5CPRB 2NS7A 2IGNA 5D4SA 2HDDA 4NE3A 1KX4A 3IRQA 3AZNB 1J0RA 3MGSD 3UT9D 3L1PA 4P5OA 4X23B 5KAFC 1GVJA 2BVMA 1I3QJ 1RC9A 1A36A 1GHCA 3CP2A 4WU9C 1W7PA 5J40A 2QQAA 2VBYA 1MGTA 2XPVA 4L9JA 1B1BA 1TTYA 3ERED 2BHZA 3X1TA 3ZMZA 4WCGA 4C9YA 4QLCU 5DV5A 4I0AA 5HS7A 1YITI 3LAPA 1J9IA 1NK3P 3R60A 2HOTA 2UUZA 4WK8F 5E5AD 2DU9A 3BCAA 5D5VB 2VL8A 4MFDA 1K61A 3WU2C 3H3VK 1GDTA 4JYKA 3W96B 1OCZH 2NYXA 3OIPA 3K4BA 3O2PE 5M5YJ 3KYCB 2EK5A 2EIMH 4LB5A 2IS4A 2DDAA 1U9OA 3AZGC 4LG3A 1J7KA 3IHUA 3EPHA 4O6JA 3HB9A 3QYFA 2JPBA 1XGMA 4E7ZA 3PO2J 4Z66C 3LA7A 1T0FA 2L2OA 4WU9B 2EA4A 3E5QA 4UB8C 2AO9A 2OZUA 2TCTA 1FNNA 3G6EI 2KIFA 3GVAA 2X51A 3TW7A 2ME0A 5CPID 4HG2A 4WX9A 5KDMB 5B2IC 2NOJB 4UVAA 6PAXA 3F8BA 4OIPF 2Z3YA 1R23A 1TWAJ 2A5WA 1AKHB 1Z7LA 3GTQJ 3QRFF 4CYDA 2CUEA 1KU2A 2R7VA 5GT3D 3MGSA 1P3BC 1SAUA 4PGGA 3S16J 5GSUA 2ISYA 2D1HA 2K5CA 2ZMEA 3QP6A 4UUVA 2Z5UA 4L0ZB 1ID3A 3TOAA 4DOZA 1X3ZB 2COBA 4DGWB 1YJWI 3F72A 1TBXA 5J1UA 3NQUA 2M1BA 2JQ7A 1BOBA 4Z66B 1FIPA 1UHSA 1TLHB 1HQCA 3IH2A 2NQBD 2H6CA 5E5AA 2E1NA 1J75A 5B0ZA 5E1ZB 2ZM5A 1BFMA 4RGSA 2R5ZA 1OLTA 3AG4H 3W97D 5B2IB 2VPRA 1P3PD 2BE5F 5F99D 2KLOA 4HF1A 2COMA 1PJRA 1Y1VJ 5HOOA 4RB1A 2XIGA 5L3FA 1G3SA 2GZWA 2XROA 2D1VA 5GPAA 2BVLA 3CDHA 1LPQA 1P3BB 2R7SA 2LH9A 3S93A 3NQJB 4CAYA 2VKHA 4XLPF 4K2EA 2XF6A 2QQ8A 4XKBA 2MD0A 4F52A 1W1WE 3Q3SA 5K5OA 3W2AA 5JRGD 1MIJA 2QM3A 2W00A 1A35A 3J7ZI 1TQMA 4Z6YA 5CPIA 3GLLA 4NC8A 3S3NA 1XDSA 3HGYA 2IA0A 3OYNA 2DLLA 2P6SA 3V4GA 5GXQD 5B33C 3AV1D 1X1BA 4IOAF 3NQOA 4XICA 3F6VA 4KIFA 3ZQHA 1R4VA 5GT3A 2K02A 1QZEA 4ZZLA 1ORKA 3GX4X 4QTRA 1HCRA 2A69F 3SFIA 4DBRA 2V9KA 3D5SC 4CXFA 2LDUA 4BE0A 1VFCA 1MBGA 1DDNA 3HUGB 4IKFA 2R7QA 5CPKA 3AZHC 1HKQA 3W3CA 4O3MA 3BQZA 3ZMTA 5F08A 3M3YJ 3MGPD 1V3FA 2IRFG 3AZIC 2LKPA 3GTJJ 5AIPA 5BT1D 2PN6A 2BYMA 1ZAOA 3W97A 2CJJA 1BJZA 1JKOC 3RELD 1P3PA 2CQNA 3SYTA 2M7AA 5DDGA 1GV2A 3EUAA 3HG9A 4O5VA 4YRVA 2CYYA 2R7OA 2ETHA 3FXQA 2LBFB 1R49A 2CV2A 5GT0D 1FZPB 1MJBA 1S3JA 1S5LC 3CZ6A 4HV5A 4P55A 3CMMA 2H1LA 4EM2A 3AZJC 1Z0XA 1Z91A 2Y9YA 2AS5F 3X1SD 2XAGA 2QENA 2VODA 1BIAA 1VI0A 5JRGA 2FQ4A 1CF7A 4BJTA 2E60A 3DU6A 3HHHA 5FKKA 3CUOA 3OYHA 1AU7A 2E19A 4BNCA 4EMSA 5GXQA 1RESA 3EPZA 3B6FC 2MC3A 4OOIA 5KAIC 3FBNB 3X1VC 1KX5D 1WJCA 3TU4D 1BI2A 3BLYA 1YIJI 2HTSA 1TWHJ 2HDCA 4IX7A 5JHFA 2L0KA 1VF9A 4HX4A 3BQYA 3O8GA 5HS9A 1HSJA 4IRHA 3GZ5A 3IC7A 3RKXA 4XZQC 1VQPI 4ZTJA 3JSPA 1BM9A 4OAYA 3K4JA 3F3XA 2LLKA 1S6LA 3OS1A 5H6QA 1B4AA 4LK1F 1P3KA 4IJAA 2JVHA 3I54A 1E2XA 3E97A 4IHTA 1BH9B 4A3IJ 1MSFC 4PGHA 5DUIA 1OPCA 4B47A 2I10A 3NAUA 3RELA 4KUDC 1W5TA 2EFQA 2DF4C 5BS7C 3M8FA 4HGAC 3H92A 5IYDJ 1MH4A 2E2HJ 5GT0A 1K83J 1MNDA 3MGRD 3ML6A 3X1VB 1FSEA 3REKC 1SFKA 2A5YB 1P3ID 2TDXA 4Y17A 2XUBA 1SD6A 4B48A 1ETVA 3WODF 2OQRA 1WWXA 2DMUA 2R7FA 4EQQA 3LSHA 4IQ4A 2Y2HA 4ZYDA 3TO6A 3ABMH 1WZ2A 2DMPA 2F5EA 4HX8A 3V7RA 5FD5A 1KONA 4EV0A 3AAFA 4MQ9F 4HEA2 3VH6T 2JA8J 4KUMA 1ZGAA 4M3BA 3G1OA 5H6RA 1JT6A 1OR7C 5AVBD 2VB6A 3HOSA 2DOEA 1T56A 2FA5A 4KNYA 4G92C 1D0YA 1DUXC 1JKRC 3AV2C 3DPTA 1KQ8A 4YS3A 4RGUA 2ZO4A 4YG2F 2J5OA 2RQQA 2Y2LA 2ID3A 2DQLA 1Y0NA 1DP7P 3BPVA 3REOA 2VUMJ 4KUDB 1WSUA 4HGAB 3ULQB 2PX9A 4XMYA 2D45A 4Y4RA 1M18A 2H8WA 3REKB 4J8VA 4U87A 2VBWA 2FMYA 4WXHA 5ICFA 5C3EJ 5DD4A 3FX3A 3JRIA 1T2KA 4CZCA 4HNVA 3JW4A 1QPIA 2OC6A 4DQ2A 3C1CD 2LKXA 1ZQ3P 3KWQA 2E7XA 4EJTA 2D5VA 3VH5A 3WA9D 1U0JA 5AV5A 3DEUA 1IZ1A 2IJLA 3HOXJ 1T08B 1QZZA 4H9RB 2P5VA 1SC7A 2JN6A 2LVSA 3VH6A 3A4CA 3KIOA 3MGRA 4LLLA 1JI8A 4G92B 3AV2B 4QLCA 2LP0A 4UY8I 1JGGA 4KA4A 3K70D 3JREA 2F2AC 1OISA 2B7EA 1MNMC 2A05A 4DIQA 1B8IA 1HLVA 3AFAC 3WKJC 2BHYA 4F92B 3W99A 4M6XA 4AWXB 1TAFB 2Y0SN 4L5IA 5LRRA 4KN4X 1VTNC 5ILUA 4A5NA 2ZJ2A 2F8NG 4UHTA 4HBLA 2FNPA 1YS6A 1ZLJA 1S32A 3KFUG 2JA6J 4C2TA 1IXSB 2LF7A 5F0CA 3WAAD 3KP6A 5J8CA 2YPRA 4M74A 4W97A 3H0LC 1P3AB 2X6WA 4B44A 4CZZA 1T38A 1YE9A 4MHGA 2P7CB 3K4KA 4E7SA 2Y2OA 5LHGA 3LSTA 2XD5A 2EQRA 4IVNA 3REIB 4DJAA 3HIFA 2LSOA 5FD6A 2F5VA 3BP8A 1X58A 3WKJB 3AFAB 1DGRM 4J8WD 2Y30A 1FOYA 3DTKA 1XN7A 3GF2A 3QQAA 4JBAA 3LSRA 1PP7U 3PFYA 3WA9A 1WH5A 2E7WA 4CCJA 3HGGA 5HDNA 1IF1A 1FTTA 5DNMB 4L5JA 4ZC3A 2YUSA 4CCLA 4D7NA 3R45A 1BI0A 2LRDA 4JX4A 3C1BC 3F8FA 2CV5C 4H9QA 1LDKB 3SEQA 3OWTA 5HDKA 4NDLA 2K9LA 4D9JA 1AOID 4HQMA 1Z3XA 4I76A 3JAMK 2IS6A 4J8XA 3K6GA 2STTA 2Y2JA 3A6NC 3BG9A 1APLC 3ZPLA 4Y3OA 4E7HA 5C3IC 1TW2A 3CC4I 1PUEE 4BQNA 2Y2NA 5K1YA 3DPLC 3ESWB 5GADJ 1LVAA 3I59A 1NG7A 4RB2C 1IGNA 1VQ6I 2NVQJ 1TZYC 3SEZA 2EZLA 4WJ3C 2NZDD 3HPGA 4BS9A 1LVKA 4B3XA 3CCRI 1W36C 1U6GA 2NVUB 4XKWA 3WTPB 2J8PA 2R7TA 4RAGA 2FJ7C 2OPTA 5F6FA 1HOMA 3FISA 2EA2A 3RIRA 2OD5A 2Y2KA 3QODA 4M9XA 3C1BB 5CP6D 2CV5B 2QCOA 2V26A 1R36A 1VZ0A 2DOFA 5AIQA 4ENMA 1IV8A 2BOLA 1IDZA 3KXBB 2LY2A 3JSOA 3K2AA 3G73A 4HAMA 2JUCA 4XKCA 1MBFA 1ON1A 3TDUC 3VH5W 1T3UA 2DTRA 1H88C 1XG1A 4L9NA 1TT0A 5FLXK 3VH6W 5B24D 1H89C 3AZMD 1WRJA 2JZYA 4EVIA 3MVDC 5ICEA 1YLFA 2WY7Q 1ZLAA 4H0EA 2ZY2A 2UXNA 4UNOA 1TZYB 4LIVA 1YFHA 4RB0A 4XQFA 5FLMJ 1ERDA 3GBGA 3V8JA 3E5UA 2F4MB 2FJ7B 4N9IA 4KMFA 2O7OA 3V42A 3KYLA 1HQ3A 3REHD 3MNNA 3P7NA 4LFUA 3ISPA 4CYCA 4LD9D 2X6YA 2JA5J 4C3IJ 2PYOD 3JRFA 3H0MC 2FMLA 3L09A 3ZOBA 3TQNA 1UG0A 1OCRH 1F1EA 4J8UC 1F66D 2NZDA 3AZKA 4WF2A 3MVDB 2O61A 3FMQA 3U21A 2DN0A 5EG0B 5AY8D 2XPUA 1FOWA 1MZBA 3LZ0C 2MYSA 1XCVA 3QWLA 5E18F 4E7KA 3LJAA 3RDIA 1K4SA 4BDZA 5B40C 3REID 2DTZA 4IF4A 1ZR4A 4PZJA 1U5TC 4DBQA 4KHAA 1WI9A 3CMYA 1BBYA 2CW8A 4BACA 4EJUA 5CVVA 1PZRA 5B24A 3C2GA 4MTDA 4A3KJ 3H9QA 2QWWA 2ZXIA 1BA5A 1P3FA 5DNMD 2CQKA 2V7FA 2OTLI 4R8PA 4HYEA 4U0WA 4XLHA 1KX4C 3JRBA 4J8UB 3COAC 1BL0A 3KSYA 2YU3A 3VFZA 1N1JB 2X48A 4G7ZF 5AVCD 1X3WB 2Q0OA 1IRZA 2QQ9A 1U35A 5AV8B 2DPUA 4HV6A 3DQVC 2P5LC 1YOVB 4KMUX 3RPQA 4JOMA 4LD9A 3RTRA 3W98D 4NC6A 3LSPA 2PYOA 5B40B 1WH7A 3H0RC 2YFWB 4U88A 5H20A 3S17J 2UXXA 3JAMZ 1RRJA 1IC8A 4DQYB 1F66A 4DYRA 1POGA 4WU8A 2CQQA 2FD5A 5IYBJ 2R5YB 1ZLKA 2HOAA 1YW8A 3H0DA 4EJOA 1RZ4A 3NWTA 4Z2MH 3E1SA 1XTAA 4Q47A 3SDBA 2DMNA 1YRNA 5LGNA 1IN8A 1KX4B 1OCPA 4OU0A 2Z9OA 3HKZA 3TOBA 4EATA 3JTHA 1SEUA 2ELJA 2MBFA 3WTUC 1YJNI 3GLXA 2A6TA 2XB5A 3W6KB 1K78A 2DOAA 1ODDA 2DYSH 1FMWA 3AG3H 3U2RA 2MA3A 1S72I 4BXFA 3SDGA 3VYSB 1IV6A 2VJIA 3X1UA 1J59A 1WWIA 1BW5A 1FYLA 3MGSC 3UT9C 2F4OB 4IXAA 1X1DA 2G5HC 5AVCA 2O0YA 2QGUA 3TO7A 3ZN0A 5FLXZ 2G5IC 2CSOA 1TQIA 5J8FA 1JUPA 3EDPA 1A04A 5B32D 3CF2A 3AFHA 4LMYA 3JRAA 2PBIA 1XDUA 3AYWA 3K7AJ 5IP6A 2XVCA 4EEFG 3UTAD 2RVQD 3I0TA 1LUJB 2VN2A 3FXUA 4KITB 5E5AC 2M34A 1G6NA 2DT7B 4PFOA 2XRNA 3DLLF 3S8PA 3RZOJ 1X2NA 2KHMA 1F4KA 3MGQD 3MN2A 4A0XA 2F4IA 4B3AA 1TWFJ 3RSNA 2KRHA 4YM6C 1BIBA 4GYIA 1I50J 4B4CA 2WAQA
chains in the Genus database with same CATH topology
3HTSB 3MGSB 3ECOA 3UT9B 2DAOA 1ID3B 1T39A 3R0AA 2ZNYA 2G9WA 2HIOD 1M1AD 5AV6A 2IA1A 1S7AA 1HW2A 4M6YA 5E5AB 3L9FA 1LQ1A 5GT3C 3HOTA 3HRTA 1JXSA 3OOPA 2FNAA 1RIOH 3GFLA 5B32A 2L5AA 2H27A 1YS7A 1OMIA 1B6WA 5AV8D 2KKOA 1P6RA 2ZBKA 3UTAA 1S29A 4CAYB 2NQBC 3HSFA 1SAXA 3C3WA 5AV9C 2RQPA 4M73A 2A68F 2YSRA 1D3YA 3A1IA 2OZ6A 1SMYF 5CPIB 3W97C 4NB5A 4P96A 1P3PC 3MCZA 5F99C 3AZLC 3KP2A 2FU4A 3B0CW 5DNND 3FMRA 4ENKA 5GT3B 1H3OA 3MEXA 4BXUA 1HW5A 1P3OD 4CSRA 5B2JD 3CUQA 2XHKA 1FYMA 2HIOA 1M1AA 5JRGC 3W6JB 3M9AA 1W7PD 3SZTA 4E44A 3X1TD 5CPKB 1C0WA 2XAQA 5GXQC 3AV1C 2NQBB 1SFXA 2V1DA 5JVTA 3C7JA 2P4WA 3IL2A 3V8LA 3W97B 1P3PB 1LEBA 3FWEA 4UPKA 5F99B 2FBIA 4X23C 3V8KA 1FT9A 2ESNA 1O3SA 1KYZA 4HA8A 2XV4S 3P9CA 4AVPA 1W2EA 1MDMB 3MGPC 3QU3A 3BZ6A 5JRGB 2HGCA 1O3QA 5BT1C 1KA8A 1O3RA 2JRTA 4FX4A 5GXQB 3AV1B 1M19A 5GT0C 2EV6A 2M30A 1P3GA 2GA1A 2PJPA 1P3OA 3DF8A 5B2JA 4KGCD 3BPXA 3LA3A 5GSUD 2AROA 2NS0A 1ID3D 4U0VA 3VOEA 1B9MA 4FX0A 1LDJA 5FUGA 4RB3C 3B73A 3RPUA 3MGPB 1P3KB 4CHUA 1KX5C 3QPTA 3TU4C 3AZEA 2IT0A 2GXGA 2K7LA 5B0ZD 3RELB 3KLOA 3GFMA 5GT0B 3AN2D 3FF5A 2Q2EA 3CLOA 5TJJA 5LHHA 4HLYA 3I58A 2HFHA 2D2WA 1RNLA 5L3BA 1XGOA 3H3ZA 1ZYRF 4AIJA 2GXBA 5ICGA 3AZFA 1FBSA 1FOKA 4HDVA 3MGRC 1KX5B 3TU4B 4XLNF 4KIGA 4Z2YA 1P3IC 1YTYA 1EH7A 3MFKA 3C1DA 4KGCA 2M87A 5B31D 2MH9A 5AVBC 2DBBA 5CPKD 4LLNA 1XB4A 4A5MA 3KWQB 4A2UA 1FBUA 2XKPA 4KICA 3AN2A 3MGRB 5CVUA 1P3IB 1AOYA 4IRGA 4A0ZA 3C1CC 3GYHX 4H9OA 5AVBB 1OKRA 3K9TA 5BO0A 3JTGA 2H6BA 1OYWA 4GYGA 1UFMA 5B0YA 2UWXA 1FBQA 1PDNC 2PEXA 1ZG5A 5B31A 3Q9SA 4E45A 2RV8A 5LLQA 2NNNA 2ZY4A 1RI7A 2PLYA 4GGGA 2DT5A 3BY6A 5CLSA 1P3KD 3C1CB 3E6BA 3WAAC 1SD5A 3WA9B 5HLHA 4PDKA 1P3MA 4WV4B 2PFBA 1R7JA 2HEOA 4H9QB 5ED4A 3NEUA 1O7LA 4J8WC 4Z5TA 2PQ8A 3KZYA 4HX7A 1BH8A 5DUKA 4G7OF 3R61A 3KUYA 1Y0UA 2IW5A 2FBHA 4IRIA 1J2XA 5LEKA 4KFCA 2YFVA 1HKSA 3I59B 5DCMB 3CTAA 2HQRA 3WAAB 1AOIC 4YS3D 1I5ZA 2IPQX 1ZG1A 1TQPA 3OV8A 1SMTA 2VXZA 4ENNA 2F5CA 3EPJA 5BPIA 3UTBA 1O57A 4UV8A 2GWRA 1M18D 2IP2A 4J8VD 1KX3A 4WZSB 2LNBA 1XCBA 4GO1A 1PP8F 2ZXJA 3O62A 4J8WB 3IP4C 5JA4A 1QZYA 1JHHA 3K0LA 4LG0A 1JFIA 5DCFA 1FP2A 4IHSA 2NZDC 5B1MA 2V6CA 3KWQD 1ZLAB 1YW9A 5AV5D 3L2CA 2XAHA 2CG4A 2FQ3A 2HWVA 5CP6C 4I0BA 1ZRFA 4EM1A 4R79A 1AOIB 4QLCD 4AIKA 1P34D 3AZGD 1IN4A 1EH6A 5TRDA 3W99D 3VH5T 1P3LD 3WU0A 3R0JA 5B24C 3MNNB 3AZMC 1U8RA 3CO7C 2K27A 3F22A 2XD1A 4BH9A 1A7WA 4LB6B 2PG4A 1S32D 2NZDB 1R1UA 3I64A 2VBZA 1MJAA 4YIIA 5LBQA 1Z9CA 3REHC 3M7GA 4N9HA 5CP6B 2CWEA 2NRAC 4LD9C 2DK8A 3LQRA 4WU9A 4PCQA 2PYOC 4U7DA 1OYIA 1FC3A 4KHAB 1ZARA 1F66C 3FDDA 3EYIA 2W85A 5KDMA 5B24B 3AZMB 3KEOA 2M8EA 1P3FB 5AY8C 1P3AC 1K79A 5CVRA 4KT5C 3CJNA 5K5QA 3REIC 3FM5A 1P34A 5BNXA 5ERIA 3AZGA 4J8XD 3REHB 1P3LA 1TNSA 4Z66A 4G91B 2EJRA 1ZREA 4ESFA 4LD9B 5DNMC 2PYOB 2YX4A 4H9NB 4GCVA 4N0BA 1F66B 4WU8B 3E6CC 5AVCC 3ABTA 1KU5A 1XGSA 2QUFA 5AY8B 1BI1A 3KP5A 3REJD 1P3BA 3VODA 3NQJA 3W98C 3EPKA 4AIHA 3TDZC 1K7AA 3AZHD 4YFKF 1K78B 2BYKA 5AONA 3AZID 2FEZA</