1ULYA

Crystal structure analysis of the arsr homologue dna-binding protein from p. horikoshii ot3
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
190
structure length
190
Chain Sequence
AKKVKVITDPEVIKVMLEDTRRKILKLLRNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEMKGNLVEKYYGRTADVFYINLYLGDEELRYIARSRLKTKIDIFKRLGYQFEENELLNIMDRMSQKEFDATVRISKYIEEKEDALKDFSNEDIIHAIEWLSTAELARDEEYLELLKRLGSILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the PH1932 protein, a unique archaeal ArsR type winged-HTH transcription factor from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Dna binding protein
molecule keywords hypothetical protein PH1932
total genus 70
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2003-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ulyA01
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1ulyA02
2A6EF 2NQBC 5CYVA 1JE8A 1FZPB 3WKJB 3X1SC 4HGAB 2CSOA 3C3WA 1S7OA 4R8HA 1ODDA 3R0JA 5LGUA 3KLNA 2XIGA 1HQ3D 1BFMA 5ILUA 5KDMA 3UTAC 1U2WA 3HRTA 3LZ0B 5JI6A 5GSUA 4HA8A 1M1AB 3K69A 5DCFA 5LGNA 2A07F 4WU8D 4I0AA 4RAZA 3WTYC 3GEZA 3HHGA 1SD7A 3VFZA 3MGQB 3T8TA 1W7PD 4J8UA 3AZNC 4HX8A 3E5QA 1H3OA 5JRGC 3KUYD 2RVQC 1GXPA 4IHSA 4X23C 5KVRA 3A6NB 2DBBA 5CPKA 3VB2A 3LA3A 1SMTA 2DTRA 4M73A 1BBYA 2XKPA 3F8MA 3L9FA 3LELB 5CP6A 4OMZA 1P3FD 4Z2MG 2RVCA 3B6GD 3HSEA 4EGYA 4BNCA 3P9KA 4IF4A 3RIRA 3REIC 3CUQA 4RGSA 1L0OC 4EJTA 1MZBA 3AN2A 1D3YA 2JRTA 4ESBA 4CAYA 1ID3C 2D1HA 2XAFA 1P3AB 3E97A 4UVCA 3GWZA 4WXDA 3O62A 4HZFA 1ZLAA 2F5FA 5BOXA 3GYHX 1T39A 1IUYA 1R7JA 1BOAA 1Z7UA 1P3BB 4J8XB 2K02A 1XMAA 5B2JA 1GVJA 4A12A 3O6BB 5DYMA 5L3EA 2FOKA 4M74A 3MGSA 3PQJA 1ID3D 1G3TA 2HKOA 4KFCA 1TBXA 2A68F 4WU8B 4A6EA 4JQFA 2OU2A 5DUIA 4MNUA 4NFTA 4N9HA 1T98A 4XUJC 1M18B 1QZYA 3TU4A 3I4PA 2JPBA 4J8UD 2OAZA 1B4AA 2EFOA 3GFIA 3ECHA 3GUDA 2XAJA 3WKJD 1DPRA 3RDIA 5CPJD 2RKHA 1U5TB 1P3AA 3HRUA 1KA8A 1FC3A 5DD4A 4ENJA 2YX4A 2ZXJA 2KIMA 5LEJA 1L3LA 4AWLC 4J8XA 1IN7A 3V8JA 5AVCB 2O3FA 4BQAA 3V9RA 4HV6A 5CVIA 5BNVA 3LZ1D 3KXBB 5B1MA 3X1UA 4I2OA 1FWZA 1HKSA 3MGSB 2D2WA 3BPVA 1O3SA 3KWQB 1SFEA 1IRGA 1F66D 3R4KA 1HSTA 1BH9A 3A6ND 4KA4A 5AV5A 5B32G 3KP3A 3VH5T 4UV8A 4RS8A 3E6CC 3MGPD 5CPKC 3NQJB 3KFWX 1LNWA 4EJUA 2STTA 1G4DA 2EFNA 5GXQB 4A0XA 4WCGA 5BNXA 5B2IC 1BH8A 2W24A 5ILVA 5J8CA 1YS7A 2FMYA 1LEAA 1XD7A 1P34D 4UNOA 4LD9C 1SD4A 4ZUXD 1HQCA 3UTAA 4KUDB 2JZYA 4M9XA 3AFAD 2RQPA 3HUGA 2DFIA 2TDXA 2J5PA 1QNTA 4J8VD 4MEYF 4ZYGA 4YS3B 3ZMUA 3GFMA 4PGGA 2STWA 5GT0A 1M1AC 2PYOA 4L5IA 1KX3C 1FOKA 5GT0D 1R1TA 2P8TA 4HOBA 3EQLF 2M30A 5AV9C 3MGRD 3RKXA 2FA5A 3ABTA 2VE9A 4J8WB 4EM2A 4XZQD 1P34A 4UUZB 3NQJA 2K7LA 2QLZA 4M9SA 2W25A 1P3OA 1X3UA 4LK1F 1ZRCA 2KIUA 2O61A 5JRGB 4U88A 3J80K 3TKYA 3ML6A 5BNXB 1P3GC 3MNNA 1FP2A 2P5LC 5E5AB 4DNCA 3Q9VA 5AV8A 5B2ID 2Q8KA 1K78A 3CO7C 3AZKD 4I02A 1M19A 2YU3A 1TQIA 5E8IA 3TDZC 1KX4C 4ZUXC 2GXGA 1ON2A 5AVCD 1Z91A 3WTUC 3AZEA 5B0YD 2KKOA 5FD5A 3JTGA 1S3JA 2FBKA 1R5HA 3C1CC 4PCQA 4P9FA 1YO5C 4AIHA 3M9AA 1ZGAA 3QU3A 3SHFA 5DNND 5FLXZ 5AVBD 4QLCA 4IRGA 1HBXG 4J8XC 1KX5A 2RGVA 1UFMA 2H09A 4J8VB 1W4MA 2XV4S 3O3KA 1M19C 3D5LA 2O0YA 1P3LA 5D6FA 3RPQA 2M45A 3MEXA 1KQ9A 2XAHA 2OD5A 3JTHA 3TU4C 4WU9C 3MGRB 1P3PA 3TO9A 3C1BA 1HW2A 1XMKA 1M18C 1TZYA 2MLKA 4O5VA 3REKC 1HW1A 3FM5A 3DQVC 3X1TC 3QAHA 3MVDD 3B6FA 1P3KD 4HV5A 3V4GA 1YG2A 3WAAB 4QLCC 4I0BA 4KUMA 3AV1B 5D4RA 5JA4B 4S04A 3AV2B 1U5TC 3E6BA 1UHMA 2Q2EA 2R7DA 2F5DA 4H9PB 2K4BA 3IRRA 1KU9A 3AZHA 1M1AA 5TRDA 1DPUA 4JK1X 3I54A 2YFVB 4HAMA 5L3BA 3UT9B 2HIOB 2XAGA 2HWVA 4UVAA 1KYZA 3HRSA 1P3LB 4BYYA 3EUHA 3UTBC 1JFIB 2YX7A 1KX3A 3V7RA 2FE3A 3ZN1A 1BI1A 2VN2A 4LB6B 2RVQD 4GCVA 4HQMA 5C3IC 2FJ7D 4A5NA 2FJ7A 1PP8F 3REJA 3K1PA 1O57A 3HYIA 4RGUA 4CSRA 5CPKB 4G91C 1U78A 3DFGA 1IZ1A 2PEXA 1H9GA 2F2EA 1I1SA 2ISYA 3AV2A 3LA7A 5DNMD 4G8XA 3WGHA 5ERIA 1TAFB 1R23A 4CICA 4OMYA 1FYKA 4ZH4F 3WTPB 1REPC 5KK1A 1P3KB 1P3GD 2QBYA 2HYFA 3W97B 3B6GC 2YFVA 4PGHA 2GZWA 3WGIA 1XDUA 5ILSA 3DKWA 1JFIA 5AV6A 1S8NA 3FX3A 1KX3B 1K7AA 3C1CA 3I5UA 4FT8A 3NQUB 5B33B 3X1VB 4M71A 1KU7A 1JGSA 3AZLA 1F9NA 4Z5TB 1FT9A 5B31C 3REJB 4KMUX 2A69F 1R1UA 2D1VA 2O6GE 5HDKA 3K0LA 4L9NA 4A6DA 3JSPA 3V7SA 4BXUA 3DPLC 1NHAA 2E7XA 4ASNA 5L3GA 1KYWA 2F8NA 3AZHD 4R8PD 1P3IC 4ESFA 3GVAA 3Q5FA 4J8XD 3GZ5A 5CVJA 2XGXA 3SZTA 1ZAOA 4XZQC 1F1ZA 1IXCA 1XCVA 5LHGA 2FEZA 2ZMEB 3LAJA 4IPAA 2OQGA 3GO5A 5CPJA 4CDGA 3AZHC 5GT3B 2O8XA 3CTAA 4BHBA 4OINF 3LZ1B 3GW2A 4XBFA 4M9ZA 1D5VA 5BNVB 2VC0A 3LJAC 3D0SA 1W5TA 1P3IA 4KN7X 4WNNB 1A04A 5F1RA 2H6CA 2GQQA 2ZJ2A 4EM0B 5F99A 3EETA 5EEGA 2UWMA 5B1LA 1M18A 3TU4B 4U0VA 2C6YA 1HW5A 1BN5A 2L54A 5LRSA 2Y0MA 2YPRA 4LLNA 1P3PC 2Z33A 3BROA 1TW2A 1U35C 3G3ZA 4AVPA 3AZGA 3VH6T 3X1TB 2A5YB 1FX7A 3ROUA 4RB1A 1U5TA 5B1MC 3X1UC 4YM6D 4HX7A 3REHD 3AFAB 1BI3A 2EA4A 1ZG3A 3TOBA 5B31D 2WC2A 3ULQB 3ZMVA 4EQQA 3WTVC 3L7WA 2L4MA 2NQBA 4H9OA 2AROB 4G94A 3L2CA 5ICEA 2FBHA 2LKPA 5BPIA 5K1YA 5E1XA 3N4MA 3VH5A 2MLGA 4YFXF 4M6BA 1TTYA 3CUQC 4Z5TD 5BMZA 4HW0A 2ZO4A 1WKMA 5LEKA 3T1BA 3HHHA 3KSYA 4GO1A 2L02A 3H3ZA 3AZMA 1R58A 1S29A 4Q5SF 4P55A 5B2IA 1P34B 1HSJA 5E8GA 3DXJF 1RNLA 2HQNA 4HDVA 3B0DB 3WGGA 1MDMA 3KETA 4G7ZF 1F66A 2FU4A 5TJJA 4KIFA 4XSXF 4NB5A 2X0LA 4G91B 1P3OD 2HKXA 3I58A 4B8XA 5GSUD 3AFAA 2QQAA 1I5ZA 5B40B 1OPCA 3RKWA 3U2RA 5B0ZC 2VBYA 1HQ3A 1S32C 2E7WA 2NRAC 5LLQA 4ETSA 4EJVA 1GHCA 4M72A 5BO0B 1P3KC 2O03A 1P3AD 2V79A 4YM6B 4KGCC 1FBSA 1TZYC 3TO7A 1BIAA 1ZG5A 3BJ6A 4Q48A 1WSUA 1I6XA 1KU5A 5E5AD 3ABUA 1OYWA 4MHGA 1JXSA 3W6KB 3Q9SA 2FRHA 4RGRA 3W99D 4LG0A 5L3DA 2KRFA 1YQAA 2F8NG 3TU4D 5D5XB 4JJNA 5B2JC 2DPUA 5CP6B 3H92A 1O3QA 5LBQA 2VT3A 3AZED 4Y13A 1CF7B 3MVDA 3B6FD 3R61A 4J8UB 1AOIA 2WWYA 4CZZA 1TNTA 1U35A 1IN8A 4LFUA 5HOOA 1Q9CA 3WAAD 3X1SD 3AZGC 2V1XA 4HF1A 3A6NA 1FP1D 1P3PD 4CGZA 2ZBKA 4J8VC 1XCBA 5B0YC 2J5OA 1ZLJA 3RELD 3AZKC 4AIKA 3MVDC 2JSCA 5B40D 2XVCA 4WX9A 1FBQA 3REID 2Z99A 4G7HF 3LJAA 4WU9A 1EV7A 2V9VA 4EVIA 4CAYB 2Z9OA 3AZNA 3W96B 1UCRA 3O62B 1F5TA 1ZLAB 1QO0D 5CPIB 3F23A 1R4VA 1QZZA 4A0YA 1DP7P 2DW4A 1FYMA 2VONA 1XGMA 3IKTA 1J7KA 2P5KA 4EO5C 2JT1A 2MBFA 1U3EM 3LA2A 3C1BB 3AZKA 3P9CA 5K5QA 4Z2MH 1BJAA 3MGPB 4MQ9F 1IRFA 5B24A 4IRIA 3GF2A 5DNMB 5FGMA 3V8KA 3AZIC 3AN2D 3WTTC 2XUBA 1ID3A 2VC1A 3MGSD 3SQNA 3BWGA 5DV5A 3AZJA 4Z66B 3F3XA 5LHHA 1S32A 4G9YA 2NZDC 3KCCA 4LD9A 3W96A 2VXZA 3RELB 4CYDA 2CW0F 1R22A 4YFKF 1P6RA 2HZTA 5CPKD 1RZ4A 5LGTA 3WKJC 1KQ0A 1C0WA 3E6MA 3VH6W 4HDUA 3KWQA 2CV5D 3WA9D 2YR2A 4OIQF 4ZBJB 1J75A 1P3MD 3WTPC 5HDNA 4WU8A 4UXNA 4KUDD 4LD5A 2E1CA 3W97C 5AV5B 3JAMK 2BYMA 2XRNA 4KUDA 1Z1DA 4EJWA 3VEPA 4Y15A 3AN2C 3W6JB 3W99C 5AY8A 3J81Z 5GT0B 2L4AA 2UZKA 3GXOA 3HOSA 2XAQA 4DRBA 5B0ZB 3X1VC 5B33C 4X23B 2PMUA 3A6NC 1A7WA 2QBYB 5GT3D 3W97A 3B6FC 1SD6A 3RELA 5G49B 4LGWA 3COAC 4K2EA 4G6QA 1ZYRF 5CVUA 5A2QK 3LELC 3LZ1A 1HTAA 2W84A 3AYWA 1P3FC 2HYGD 3KUYB 1ULYA 1S32D 3U1DA 3X1SA 1BIBA 2GIVA 1XGNA 4LLLA 4JJNC 4DQ2A 2EV0A 3AZJD 3LWFA 1P2FA 1T6SA 1YW7A 3P9IA 2EB7A 4D0PA 4O6JA 4RB0A 2VBWA 2PQ8A 5AV8B 2OBPA 3AZFA 5BS7A 5FLXK 2FJ7C 3FXUA 3NEUA 4H9SA 3TGNA 4N0BA 1P4AA 2BE5F 5HVQC 3RJPA 2Z5UA 1P3FA 4O3MA 1EQZD 4PDKA 3L00A 2RC4A 3MNNB 1YLFA 4WXHA 1I27A 5FUGB 4GYIA 4P9UA 2V1UA 4LMYA 3HOTA 4MQVA 2CV5C 3N97A 3E6DA 5E1ZB 3KUYA 1ZRFA 2NQBB 2MD5A 5E17F 1EQZC 5D6EA 3LELD 1Z6TA 1SFUA 3IWZA 2ESNA 2DI3A 2VBXA 5HDGA 5DNNC 3MGQA 4FX0A 1P92A 3WODF 3O62C 1ZLAC 3X1TD 1MJBA 5FO5A 5CPIC 3CUOA 2MH2A 1YIOA 3RYPA 4ENMA 3VH6A 4H9QB 3SFZA 5AVCC 4J8WA 5LRRA 3F22A 3TDUC 4L18B 2LY8A 4UV9A 3MGSC 3LQQA 1P3OB 1KU2A 2AROC 1ZH5A 3I71A 4GGGA 2GA2A 4ZZDA 1P3MC 2DQLA 5FFZA 3KZYA 1E2XA 3CUQB 1ZGJA 5JHUA 1H3OB 5B32D 3MCZA 1P4XA 4R1HA 1K78B 2WTEA 3BY6A 3WAAA 4HX4A 4H9OB 2LSOA 2P6SA 3EYYA 3GLXA 2MH9A 3E5UA 4Z66C 5EEHA 4YM6A 2ACJA 5D4SA 1OYIA 2KJCA 3I64A 1PDNC 1ZHFA 1PUEE 5E18F 2FXAA 3KP4A 5B33D 3TQNA 4AD9A 3X1VD 4MTEA 2IP2A 3LZ0A 5GSUB 3LJAD 4CXFA 3ISPA 1IN6A 5B40C 1P3BC 2BYVE 1RUOA 5DD8A 1LQ1A 2HTSA 4LJZF 1RUNA 1KU3A 3AZFC 2IW5A 2CGPA 3IRQA 2YSRA 2QM3A 3EYIA 1OKRA 3TOAA 1AOIB 3R60A 5AY8C 4WXCA 3WTSC 2OA4A 4YM6C 5F99C 4BH9A 5JVTA 5HLHA 4NE6A 2VE8A 4L0YB 2NZDD 4CSRB 3BJOA 1U35D 4EV0A 3LZ0D 1HKQA 2ETHA 1QGPA 1AOYA 3IL2A 2EA2A 2Y48A 1P3BA 3LAPA 1Y0UA 4S05A 5GXQD 2BYKA 4Z5TA 3TO6A 3F6VA 5JR3A 4G7OF 1S6LA 3WG9A 3AZID 3J80Z 2XHKA 3WA9A 3W98A 3KE2A 5B24C 4H9PA 5B24D 2RDPA 1HKTA 2M87A 4ZUXB 3LQRA 4JJNB 2F8NB 2HEOA 5CVVA 5CHLB 3C1CB 4KHAA 5IT9K 3UTBD 3AZMC 2PYOC 1F4KA 2CYYA 4EGZA 3AZLB 3AZGD 2XKOA 3AZKB 1CF7A 4Y17A 2GA1A 1XGOA 5BS7C 3VOEA 4J8WD 2NAZA 3C18A 1FLIA 2OZ6A 3MAJA 3E5XA 4E44A 2QZ8A 4CO8A 3UTAB 2DK8A 4FX4A 3W96C 3KP6A 3GFLA 2VT2A 3MNNC 2KJBA 1QPMA 1TLHB 3B0CW 1P3GA 2FQ3A 4GYGA 3REKB 1R5GA 1FPQA 2EWNA 3WTPA 2FNAA 5IT3A 1YFHA 4KICA 2NNYA 1AWCA 3KXBC 1KGSA 4KMFA 2PN6A 1FSHA 1BH8B 2F8NK 3WAAC 3MGQC 4G6DA 3IWFA 3F8CA 1TQMA 4I7HA 3B02A 2EV5A 4ENKA 2M1BA 2EV6A 4EM1A 4XLPF 3AZEC 3AZIB 4KGCA 1K79A 2LF8A 4XUJA 3KXBA 1IN4A 3W99A 3ELKA 2K4JA 2F5EA 1XB4A 3FF5A 4R8PA 2EJRA 5E5AA 3REHC 2WV0A 4YIFA 4J8WC 2F8ND 4L9VA 1YW9A 5ICFA 2NZDB 1P3LC 3CJNA 2YFWB 3UTBB 2AROD 5F6FA 2EFQA 4OOIA 5AIPA 3QP6A 3RELC 2AROA 4A5MA 3M8EA 1ID3B 1P3AC 1B9MA 3ZN0A 3WTZA 5E5AC 3F8BA 4XSZF 3UT9D 4Z66A 3KXBD 3P7NA 1M18D 2VBZA 2Q0OA 3AYWD 1WI9A 1BI2A 3M8FA 3AAFA 2BEOA 4RGXA 2IPQX 4WF2A 5B0YA 5GT3A 5BPDA 4WU8C 4JJND 1CGPA 3B0CT 4OIRF 5B1LC 1M19D 3PQKA 4XUJB 2AS5F 4A2UA 3W99B 1ZN2A 3AZLD 3RI4A 5AV8D 3ECOA 5GSUC 1STZA 2LNBA 4X23D 4ENNA 2P7CB 1B6AA 4OIOF 4H9NA 4I98B 3AZFB 1ON1A 3B6FB 2K27A 2DT5A 4U7BA 2ISZA 3RPUA 2R7FA 3WU0A 5HS8A 4I01A 3KWQD 2CV5A 5BO0A 4QLCD 2DQRA 4NE5A 5AY8B 4ZYDA 5DNNA 1TQPA 1T2KA 3H3UA 1USTA 1MDMB 4HLXA 4KIBA 3REJC 5AV9D 1KX4B 3FHZA 5B31G 3MGRA 2HTJA 2PG4A 3REKD 4YS3D 3B73A 3KEOA 1KX3D 3I0TA 4EMSA 5KDMB 1ZREA 5G49A 5DUKA 4AIJA 2NS0A 3BP8A 2EFPA 3W98C 4J8VA 1Z9CA 2JPCA 4HQEA 3AV2C 3RKYA 3REJD 4CHUA 5AV9A 4XZQB 1XDSA 2ZCWA 3IKVA 3AZMD 5CLSA 3QRFF 2ESHA 3KZZA 5AV6D 1K6OA 2JSSA 2CQKA 3M7GA 2VOPA 4H9NB 5F99D 3MGRC 3AZHB 3HRMA 1F66C 2H27A 2IO5C 5CVRA 4IJAA 2L3DA 3KEQA 5ICGA 5B2IB 4LK0F 3AZLC 1M1AD 1G3SA 1O3TA 2PLYA 3MQ0A 4IHTA 4H9RA 1MKMA 1KX4A 1Q1HA 3MZYA 3ZMZA 3REHA 3BDDA 4L5JA 4KUDC 2QQ9A 5B32B 4G92B 3FXQA 5ICCA 3AV1C 1USSA 1LDDA 4HYEA 4KN4X 4ZYHA 4YS3C 5CPID 5J8FA 2GAUA 1XSVA 4Z66D 1R36A 5AV9B 3GZ6A 3V8LA 3BJAA 3K1MA 4U7DA 2F8NH 4JBAA 1ZARA 5BQTA 1D8KA 5B1LD 5BT1C 3C1BD 4KIGA 5B33A 3X1VA 2HIOC 1BC8C 4Q47A 3S2WA 5B1MB 3X1UB 1J5YA 2FNPA 5D8LB 1H9TA 2Z3YA 4HF2A 1EH6A 5FB2A 3ZPLA 3WTXC 1J59A 4KT5C 1WWSA 2R3SA 2DU9A 1B59A 3AYWC 1KX5D 4OIPF 2CWEA 3WE2A 3REHB 1LB2A 3J7AO 5B32A 2W85A 4ON0A 4Q4ZF 5AIQA 4ESJA 3L09A 1U8RA 1BI0A 1O7LA 1P3KA 1I1GA 5D5UB 3R45A 2QYOA 4FHTA 5E1WA 3OV8A 1QBJA 4H9SC 3K9TA 2H94A 2RNJA 3B0DC 3B6GB 2NNNA 1SMYF 3LFKA 1P3LD 4MEXF 4E45A 2RN7A 4NE3A 2RV8A 3DPTA 3T8RA 2MA3A 2Y75A 2X4HA 1FSEA 1H0MA 4E70A 4QLCU 5AVBC 1S32B 2FSWA 2QQBA 3RTRA 5F99B 4WU9B 5GT3C 1TW3A 2VOOA 2UXNA 3B0BA 1PP7U 5B31B 3F72A 4ZUXA 3LZ1C 2HS5A 5H6RA 5B1LB 5CPJB 3C1CD 2XASA 3C1DA 2HR3A 5CPIA 1BM9A 4KGCD 3T5XA 1LDJA 1YW8A 1G3YA 2DPDA 5HS9A 5AVCA 5DCMA 2CG4A 1R00A 4X23A 1EH7A 1P3IB 1MD0A 3R45B 4IRHA 3MGPA 3VODA 1BC7C 4L9TA 3WTPD 3UTAD 5B24B 2IA0A 3WA9C 4RB2C 5DNMA 2BYMB 3MNND 2GWRA 3CDHA 1N1JB 5BT1D 5L3FA 1V3FA 3I53A 2HDCA 4YS3A 4I09A 3REKA 4TV7A 5B1MD 3X1UD 2ELHA 2PYOB 3FMRA 3AZGB 3BOQA 3W98B 1P4WA 4YIIA 3KLOA 5CP6D 1W5SA 1ZG1A 5B31A 1J0RA 4UHTA 1TZYD 5C3IB 3QP5A 1G3WA 1J9IA 4YG2F 2HOEA 1KX5B 4R79A 2L01A 1J2XA 2F5CA 2M5WA 4M6XA 4UUZA 4XLNF 3VH5W 3FMQA 3X1SB 4HGAC 3W97D 5DCMB 1F66B 2IO5B 5FD6A 1P3PB 2P4WA 3LZ0C 3BZ6A 4BHCA 4LB5A 1LEBA 3AZJC 2ADUA 6PAXA 2AXLA 4AWXB 3J81K 2ZFWA 3FZVA 4KDPA 4RAYA 3AV1A 1P3ID 3GFJA 3C1BC 3KP2A 3AZEB 1P3MA 3DV8A 4H0EA 3ZQ7A 3WKJA 1W7PB 3PFIA 4NQWA 5HLGA 2HUEC 1LJ9A 3I59A 5K5OA 5FUGA 1WWXA 3OOPA 4Z5TC 1KQ8A 2MC3A 4H9QA 1LDKB 4R8PC 1IW7F 4LG0B 1HQ3B 4U0YA 2HIOA 4KGCB 1P34C 1O7FA 3WTWC 1WQ2A 3REIB 3O62D 1ZLAD 3HTSB 3UTBA 3GX4X 2UXXA 3NRVA 2P5VA 2XROA 1KX4D 4B09A 4J8UC 1W7PA 1JHHA 3LELA 2H6BA 4XUJD 3I59B 2PFBA 4L9JA 3JW4A 3DP7A 3W98D 3LJAB 3SXYA 3WE3A 1XSDA 3U9GA 2W57A 1TZYB 1XN7A 1IN5A 3C7JA 2G7UA 3F21A 5B0YB 3AN2B 1FYLA 3EDPA 3MWMA 1OR7A 4XZQA 5AV6B 4KYWA 5FFXA 5DEQA 2PI0A 2EFWA 3V9RB 2A3SA 5JA4A 3R0AA 3REIA 3IC7A 2DAOA 5B2JB 5AV5D 3SZPA 5CP6C 3AV2D 5CPJC 1MGTA 1XSXA 1T0FA 3QOPA 1E17A 1U35B 5HS7A 1ONVA 2LF7A 3ZMTA 3JSOA 2G7HA 2K86A 4AWLB 1BH9B 4KNYA 1ZLKA 4EO5B 2P6TA 3AFAC 3UT9A 1DDNA 1HXDA 2BGCA 3ZMSA 4H9RB 5H6QA 1RI7A 5DDGA 4U0WA 2IA1A 3KWQC 3WA9B 1IAWA 3ZMDA 3K2ZA 3MVDB 5GXQA 3F8FA 4ZYEA 4WZSB 5D5WB 2FJ7B 5L3CA 4WWCA 3WTPE 4M6YA 2DLLA 3E3VA 2OZUA 5D8KB 5CJ9A 5J6XA 3T0YA 2QENA 2ZKZA 3FM3A 1GXQA 4P96A 3HSRA 4KHAB 1D8JA 3O2PE 5B0ZD 2BYKB 1FNNA 1TAFA 1IXRC 2GXBA 3F6OA 2VODA 4HF0A 1B9NA 1KX5C 5B32C 4G92C 1YS6A 5K5RA 2IT0A 1U6GA 2E1NA 4MGRA 2QUFA 4LD9B 2IA2A 2A6HF 1EQZB 4UUVA 3FMSA 2QWWA 4BAYA 3AZNB 4RB3C 4L0ZB 5B2JD 1RIOH 3CO6C 3F8NA 1MJAA 1XGSA 3V7CA 4N9IA 3MFKA 1G6NA 2ZNZA 3G73A 3QPTA 5JRGA 1YYVA 3AZJB 3NQUA 4ZBJC 2P7VB 3KP7A 2COMA 2G9WA 2IJLA 3X1TA 5A2QZ 5IT9Z 3NQOA 3FXRA 5AV5C 3KP5A 2IVMA 2OQRA 5AVBA 2FMLA 1FY7A 1VTNC 2L5AA 1WRJA 3B6GA 1P3OC 1SD5A 3AYWB 2HUEB 4MTDA 4A0ZA 1WWIA 1P3GB 1SFXA 1EH8A 2NYXA 1JHFA 4R8PB 4WNNA 1B1BA 1HQ3C 1Z6RA 1UB9A 2KIFA 4EJOA 4QWQA 1IF1A 4XRFA 4BHPA 2ZMEA 1O3RA 1EQZA 1YTYA 4P5OA 2YFWA 3RYRA 1QQIA 1TNSA 3KUYC 2NQBD 1V4RA 2HQRA 2DO7A 3CLOA 3WU1B 3HIFA 5AONA 3AZIA 4NHJA 3AZFD 3DF8A 5LHIA 1ZRDA 3M1EA 1S7AA 3IHUA 1Z05A 3R6SA 2CO5A 5JFRA 2BBYA 3MGQD 3W96D 2FF4A 4LD9D 3DEUA 5BS6A 5F64A 5JRGD 5ED4A 5GT0C 3AZND 4UVBA 1LVAA 5AVBB 2PMHA 4WU9D 1MJ9A 2NZDA 2LDUA 2EK5A 5D5VB 2HFHA 4Z2YA 1IXSB 3QPHA 4HLYA 1M19B 1T38A 1N1JA 1B67A 5E20A 1R1VA 2IRFG 2PYOD 1AOIC 5H20A 4HBLA 3MZHA 4IXAA 2JTVA 4ZZLA 1P3FB 4WV4B 3LSTA 3ZP5A 2HGCA 1SAXA 5B0ZA 2D45A 4IVNA 1F1EA 3QU6A 5AV6C 1UHWA 1FBUA 3JAMZ 2ZNYA 2M8EA 3MGPC 4QLCB 5AY8D 1AOID 5AV8C 4YFNF 3BPXA 1OMIA 3ERED 3AV1D 5DNNB 3REOA 5HLIA 2V1DA 1P3BD 5DNMC 4GXOA 2CFXA 3FWEA 2BV6A 3K1NA 2QVOA 2A61A 4WK8F 3HSFA 2PBIA 2FBIA 4PZJA 5B40A 1OYYA 5GXQC 3UT9C 2DK5A 4F7ZA 2B0LA 2HIOD 2V6CA 3AZMB 3HTUA 4DRAA 2PJPA 1B6WA 2CV5B 1DUXC 4LLGF 4OU0A 1P3MB
chains in the Genus database with same CATH superfamily
1MIJA 2A6EF 2NQBC 3FISA 3OIOA 5CYVA 1JE8A 1Y0NA 1FZPB 3WKJB 1OCPA 3X1SC 4HGAB 2CSOA 1Y1VJ 3C3WA 5EG0A 1S7OA 4R8HA 1ODDA 2JQ7A 3R0JA 5LGUA 3KLNA 2XIGA 1HQ3D 1BFMA 4BXFA 5ILUA 3A02A 5KDMA 3UTAC 1U2WA 3HRTA 3H0DA 5JI6A 1YITI 2GXAA 5GSUA 3LZ0B 4HA8A 1M1AB 2K9NA 3HOUJ 3K69A 1FOWA 2WAQN 3LSHA 5DCFA 3H36A 3PIOF 2NOGA 5LGNA 5M5XJ 2A07F 4WU8D 4I0AA 4RAZA 4A3KJ 1ZQ3P 1NK3P 3WTYC 1H8AC 3GEZA 3RSNA 4D1QA 3KX2A 3HHGA 4IOCF 4BE1A 3JREA 1SD7A 3VFZA 3MGQB 1TT5B 3T8TA 4H4KC 2NVQJ 1W7PD 2JRMA 4J8UA 2QSHX 3C2HA 3AZNC 4HX8A 3E5QA 1H3OA 5JRGC 3KUYD 2XPWA 2RVQC 3ZQQA 2ZY4A 1VQOI 4XLCA 1GXPA 4IHSA 2W8SA 2X51A 4X23C 5KVRA 4E7LA 3A6NB 4IQJA 3DTEA 2DBBA 5CPKA 3EPLA 3VB2A 1X2MA 3LA3A 1PYVA 4PFPA 4HNUA 3JRBA 1SMTA 2Y2NA 2DTRA 2HYJA 1IDZA 4M73A 2ECCA 1LFBA 2XKPA 1BBYA 1Y8QB 2GBYA 3F8MA 3L9FA 2ZXHA 3LELB 2CS3A 5CP6A 2Y2MA 4OMZA 1P3FD 4Z2MG 2RVCA 3B6GD 3CF5F 4C2MJ 3AL0B 4M6VA 3HSEA 4IHVA 4EGYA 4BNCA 3LNQA 3P9KA 5F0FA 4IF4A 3RIRA 2BXYA 3REIC 2F4OB 3CUQA 4RGSA 1L0OC 3HKZA 1IG7A 4EJTA 1MZBA 3AN2A 3LOCA 1D3YA 1YOVB 2JRTA 4W97A 4ESBA 3I55I 2D1HA 4CAYA 2XAFA 3ERMA 1T8IA 1P3AB 3PL8A 3E97A 4UVCA 3GWZA 4WXDA 3O62A 4HZFA 1ZLAA 2F5FA 3QQAA 5BOXA 4I6ZA 3GYHX 1T39A 1Y39A 3HG9A 1R7JA 1IUYA 1BOAA 1Z7UA 3LMMA 4M3BA 1ZR2A 3SEZA 4J8XB 1P3BB 2KZVA 2K02A 1XMAA 5B2JA 4X1EA 1GVJA 1RR7A 4A12A 3O6BB 3DTKA 5DYMA 2E2JJ 5L3EA 2FOKA 3MD2A 1UELB 3GLLA 3HOYJ 3AG2H 4M74A 3MGSA 4MFEA 4DOZA 3PQJA 1ID3D 5J1RA 1G3TA 2DA4A 2HKOA 4KFCA 5FRMA 1TBXA 2A68F 2E19A 4WU8B 4XRSA 4A6EA 4JQFA 2OU2A 2RAEA 5DUIA 4MNUA 4NFTA 4N9HA 1T98A 3HOVJ 4XUJC 2IEKA 1QZYA 1M18B 3TU4A 4AC0A 3I4PA 2JPBA 4J8UD 1VQLI 2OAZA 1B4AA 2BG1A 2LKXA 2EFOA 3K4LA 3GFIA 3ECHA 3C2GA 3GUDA 2XAJA 3QPSA 5F1JA 3L1PA 3AZGB 5FKOA 3GTPJ 3WKJD 2H1KA 1XTAA 1DPRA 5F0CA 3D5RC 3ABKH 3RDIA 5CPJD 2RKHA 4QSHA 1ZTRA 1U5TB 2DDAA 3QPLA 2DA2A 5H2FC 1P3AA 3HRUA 3DU5A 1KA8A 1FC3A 5DD4A 4ENJA 2YX4A 2ZXJA 1PZRA 4D5CA 2KIMA 5LEJA 1L3LA 4AWLC 2CQNA 1WCMJ 1IN7A 5C4JJ 4J8XA 3V8JA 1MMGA 5AVCB 2O3FA 3BTJA 4BQAA 4HV6A 3KIOA 3RZDJ 3V9RA 5CVIA 1BOBA 2QF7A 3DBHB 5BNVA 3LZ1D 3KXBB 5B1MA 3X1UA 3EUHC 4HNTA 3CCMI 4I2OA 1FWZA 1HKSA 3MGSB 2D2WA 2OCEA 5IYBJ 3BPVA 2E1OA 2KL4A 4A3JJ 1O3SA 3KWQB 1N75A 1ETYA 1JTXA 1RRJA 1SFEA 3D1NI 1IRGA 2VIXA 1F66D 3R4KA 5GAHJ 2R7UA 2ZJQF 1HSTA 5M3MJ 4UB8C 1BH9A 3A6ND 4XL9A 2CRGA 3BC8A 4KA4A 5AV5A 5B32G 3KP3A 3VH5T 4UV8A 4N4OB 5BNGA 3HDDA 4RS8A 4BQOA 3E6CC 2VI6A 3MGPD 5CPKC 3NQJB 2UUZA 2W7NA 2IXSA 3KFWX 2DA6A 3A1YA 1LNWA 4EJUA 2STTA 1G4DA 2EFNA 5GXQB 4FETA 4A0XA 4WCGA 3I56I 5BNXA 5HNHA 2LREA 2WB1A 1Z7LA 5B2IC 1BH8A 1BW6A 2W24A 5B5EC 4V2GA 5ILVA 5J8CA 1YS7A 2FMYA 1LEAA 1XD7A 2QKMB 1P34D 4QPQA 2MC4A 4UNOA 2OF7A 1SFOJ 4LD9C 1SD4A 1ACIA 4ZUXD 1HQCA 3UTAA 4KUDB 3S3MA 2AQEA 2JZYA 2MSYA 4M9XA 3AFAD 2DYRH 2RQPA 3HUGA 4JX6A 4XONA 2DFIA 2TDXA 2J5PA 2L9VA 1QNTA 4J8VD 1J09A 4MEYF 1UJ8A 4ZYGA 4YS3B 3ZMUA 4P1WA 3J7ZI 3LSJA 3GFMA 4PGGA 4S0HB 2STWA 5GT0A 1M1AC 2PYOA 4L5IA 1KX3C 2HDDA 1WH5A 2DMTA 1FOKA 5GT0D 2LK2A 1LFUP 1R1TA 5J47A 2P8TA 1RKWA 1YI2I 4HOBA 2VL8A 3EQLF 2M30A 4DYQA 5AV9C 3MGRD 2ME6A 3RKXA 2FA5A 3ABTA 4II3A 2VE9A 4J8WB 1JUPA 3CC2I 2M7BA 4EM2A 2L9RA 4Z6YA 4XZQD 1P34A 4UUZB 2GOXB 2K7LA 3NQJA 2QLZA 4M9SA 2W25A 1ZR4A 2LY1A 1P3OA 1X3UA 4LK1F 1ZRCA 2KIUA 2O61A 1YE9A 5JRGB 4U88A 3J80K 2E2HJ 1T0FC 3FBIB 3TKYA 3OMYA 1H89C 1OJLA 3ML6A 3CCQI 5BNXB 1P3GC 3TP3A 3MNNA 1FP2A 4XLEA 2P5LC 5E5AB 4Y4RA 4DNCA 4FCYA 3Q9VA 2EPFA 2KT0A 3OSGA 4BY1J 5AV8A 3K7AJ 5B2ID 2Q8KA 1K78A 3CO7C 3AZKD 4I02A 4ZDOA 1M19A 4CYCB 2YU3A 1TQIA 5E8IA 1Z77A 3TDZC 1KX4C 4ZUXC 2GXGA 1ON2A 5AVCD 1Z91A 3WTUC 3AZEA 5B0YD 2XPUA 3Q0UA 2KKOA 1GT0C 2E35A 2Y2KA 1F43A 1QRYA 4NQWB 5FD5A 3JTGA 1S3JA 2FBKA 1R5HA 3C1CC 4PCQA 2XGEA 4P9FA 1YO5C 4AIHA 3M9AA 1ZGAA 5J1YA 4E7IA 3QU3A 3K70D 2EZHA 4FQGA 4G6TB 3SHFA 5DNND 5FLXZ 5AVBD 2X85A 4QLCA 4IRGA 1BA5A 1HBXG 4J8XC 1KX5A 2RGVA 3HOXJ 1UFMA 2H09A 4J8VB 2VQHA 4HRIA 2NVYJ 1W4MA 2XV4S 2P0WA 3HEFA 3O3KA 4KT6A 1M19C 3D5LA 2O0YA 3K4JA 1P3LA 5D6FA 4DZJA 3RPQA 2M45A 1B72B 3MEXA 1KQ9A 2XAHA 2OD5A 3JTHA 3TU4C 4PUSA 1RESA 2K9LA 3MZ8A 4M3GA 4BACA 4IQ4A 1EF4A 3MGRB 5J4VA 4WU9C 1P3PA 3OY9A 3TO9A 3C1BA 3H0GJ 1HW2A 1XMKA 4DIQA 1M18C 2ME0A 1TZYA 4BU2A 2MLKA 4O5VA 3REKC 1HW1A 2ICWG 2HVSA 3FM5A 3K4MA 3DQVC 3X1TC 3JRFA 3QAHA 3MVDD 1UG2A 2WV1A 3FK6A 3RCOA 4E6KG 1P3KD 4HV5A 3V4GA 3B6FA 2L7FP 1YG2A 2DCEA 3WAAB 4A3CJ 3MN2A 5GTHC 1XS9A 4QLCC 4I0BA 1A5JA 4KUMA 3AV1B 5D4RA 3JRHA 5JA4B 4S04A 3AV2B 1WJAA 3LSKA 1U5TC 3E6BA 1XG1A 3H5RA 2QGUA 1UHMA 2EZIA 4D9JA 1YIJI 4BQQA 1CQTA 2E1MC 2Q2EA 2R7DA 3NWTA 1IV8A 2F5DA 2R7WA 4IOAF 1W1WE 4H9PB 2F48A 2K4BA 4HPQA 1KU9A 3IRRA 3AZHA 1VI0A 2WA0A 1M1AA 5TRDA 1DPUA 4JK1X 3I54A 3HL2A 2YFVB 2YU9J 4BE2A 4HAMA 5L3BA 3UT9B 2HIOB 2XAGA 2HWVA 4UVAA 1KYZA 2Y2PA 3HRSA 1P3LB 4BYYA 3EUHA 1P7JA 3TBIA 3UTBC 1JFIB 3PSIA 2YX7A 1KX3A 3V7RA 2FE3A 3ZN1A 1BI1A 2VN2A 4LB6B 2NVUB 2RVQD 4GCVA 4HQMA 1FIPA 5C3IC 3MKYB 5F27A 2FJ7D 4HG2A 3RKQA 1NK2P 4A5NA 2FJ7A 1PP8F 1RR8C 3REJA 3K1PA 1O57A 3HYIA 4RGUA 3BG9A 1WH7A 4CSRA 5CPKB 4G91C 3RPUD 4FE7A 2OPTA 1U78A 4QTRA 1JI8A 3DFGA 1IZ1A 2PEXA 1H9GA 2F2EA 2QQ8A 2ISYA 4CH7A 1I1SA 3LA7A 3AV2A 5DNMD 3IP4B 4G8XA 3WGHA 5HODA 1Z21A 5ERIA 1TAFB 1JUMA 3I9V2 1Y8RB 1ORKA 1R23A 4CICA 4OMYA 1FYKA 3K4KA 4V19K 4ZH4F 1X19A 3WTPB 1HOMA 2IS1A 1REPC 5KK1A 1P3KB 4W1UA 1P3GD 2QBYA 2HYFA 1I50J 3W97B 4BBRJ 3B6GC 3BCAA 2YFVA 4PGHA 2Y9YA 2GZWA 3WHCA 3WGIA 2CV0A 2XPVA 2RNGA 2EINH 3HOWJ 1XDUA 5ILSA 3LFUA 1NG6A 3DKWA 3HZJA 1JFIA 1YRNB 5AV6A 1S8NA 3FX3A 2G5HC 1KX3B 2K9SA 1K7AA 1UG0A 5EEAA 3C1CA 2V7FA 3I5UA 1GLNA 2NOJB 4FT8A 3HKZN 4KJZA 2D5VA 3NQUB 5B33B 4M71A 3X1VB 1K61A 1OCTC 1KU7A 1JGSA 3AZLA 2KIQA 1V5EA 2M0CA 1F9NA 1LE8A 3H0RC 4Z5TB 1FT9A 3BTCA 5B31C 3REJB 4KMUX 2A69F 2LKSA 2MFZA 3GCMA 1R1UA 2D1VA 4E7ZA 2O6GE 2LLKA 5HDKA 3K0LA 1MBJA 4DGWB 4L9NA 4A6DA 3JSPA 3V7SA 2N8GA 3CMMA 3DPLC 4BXUA 1NHAA 2ELKA 2E7XA 4ASNA 4JOMA 1S72I 5L3GA 1KYWA 3CCJI 2F8NA 3AZHD 4R8PD 2CQXA 1P3IC 4ESFA 1RC9A 3GVAA 3Q5FA 1MNEA 4J8XD 3GZ5A 2BY1A 5CVJA 2XGXA 3SZTA 1ZAOA 4XZQC 1F1ZA 1IXCA 3SDGA 1XCVA 3GTOJ 5LHGA 2FEZA 3O8GA 2TRTA 2ZMEB 2CQ7A 3LAJA 4BS9A 1U0JA 4IPAA 1T3UA 2FUG2 2OQGA 3GO5A 5HNFA 5CPJA 2DFHA 4XNFA 4CDGA 1A6IA 5GT3B 3AZHC 2O8XA 3CTAA 4RAFA 4BHBA 2OV7A 4NC8A 4OINF 3LZ1B 3GW2A 4Y3OA 4XBFA 1IRZA 4M9ZA 1D5VA 4PJMA 4XN3A 5BNVB 2VC0A 5EGOA 3LJAC 3D0SA 1W5TA 1P3IA 3CLQA 4KN7X 4WNNB 1A04A 1B8IA 5F1RA 3K4CA 2H6CA 2GQQA 3S15J 2KPMA 2AHQA 2ZJ2A 4EM0B 5F99A 4I76A 3EETA 3BQZA 5EEGA 2ELJA 2UWMA 1W5CC 1E3OC 5B1LA 4CA0A 1M18A 5KAIC 3TU4B 4U0VA 2C6YA 1HW5A 1G2HA 1BN5A 2L54A 5LRSA 2Y0MA 1IGNA 2YPRA 4LLNA 2LOOA 3TP0A 5K7FA 2Z33A 1P3PC 1ENHA 3BROA 1TW2A 4XKBA 1U35C 4QIWN 2HQ5A 3G3ZA 4DJAA 4AVPA 3AZGA 3VH6T 3X1TB 2A5YB 3E1SA 1FX7A 1YJ9I 3ROUA 4J01A 2V6EA 4RB1A 1U5TA 5B1MC 3X1UC 4YM6D 2Z16A 4HX7A 1JJ6C 1SVMA 2CW7A 2PMZA 3REHD 3JCUC 3AFAB 1BI3A 3WG7H 2EA4A 4MIMA 2DQNC 1ZG3A 3TOBA 5B31D 2WC2A 3ULQB 4UUSB 1VF9A 2V1NA 3ZMVA 4EQQA 3WTVC 1W0TA 3L7WA 2L4MA 3HUGB 2XD1A 2NQBA 4H9OA 3VWBA 3CCVI 2AROB 4G94A 1WPKA 2JWTA 3L2CA 1K6YA 1W0UA 5ICEA 3S3OA 4ANJA 2FBHA 3HBLA 2WBMA 2IGNA 2LKPA 5BPIA 5K1YA 2X9DA 5E1XA 3N4MA 3VH5A 3B6CA 1VNDA 2MLGA 4BEHA 4YFXF 4M6BA 1TTYA 3CUQC 4Z5TD 5BMZA 4IL6C 4HW0A 2ZO4A 1WKMA 5LEKA 1NTCA 2NVXJ 3T1BA 3HHHA 2ID3A 3KSYA 5M5YJ 4E7HA 4GFBA 3UR3C 3CCEI 4BQNA 4GO1A 2L02A 1U8BA 4XMYA 3H3ZA 3A0HC 2IBDA 4E4HA 3AZMA 1R58A 1FMWA 1S29A 4DW6A 4Q5SF 4P55A 5B2IA 4ITVA 2O8KA 1P34B 1HSJA 5E8GA 3DXJF 3SZGA 1RNLA 4CCKA 2XF5A 2UV1A 3OYEA 2HQNA 3P5JA 4HDVA 2LR8A 4IX7A 2LVSA 3B0DB 4N4NB 2Z2SB 3TMOA 3WGGA 1MDMA 3KETA 4G7ZF 2F5VA 5E3LA 2ZB9A 1D5YA 1F66A 1R4MB 2CW8A 3PUFA 2ECBA 2FU4A 5TJJA 3OYHA 4KIFA 4MFDA 4XSXF 1LVKA 4NB5A 2X0LA 3KYCB 4G91B 1P3OD 2Y0SA 5GADJ 2FQ4A 2HKXA 5FKKA 4AYBA 3I58A 2E71A 4B8XA 5GSUD 3AFAA 2QQAA 3G4SI 1I5ZA 5B40B 1OPCA 3PNYA 3RKWA 3U2RA 5B0ZC 2BY0A 2VBYA 1HQ3A 1S32C 3CMYA 2O7OA 2E7WA 4LIVA 2WADA 2NRAC 5LLQA 4ETSA 4EJVA 2X1CA 1MNDA 1GHCA 1JTYA 4M72A 3MKWB 4UB6C 5BO0B 1P3KC 2VQGA 2O03A 2KLOA 1P3AD 2V79A 2Y0SN 2JJ7A 4YM6B 4KGCC 5IP6A 1FBSA 2RIQA 1T95A 1TZYC 5EZHA 3TO7A 3OL3A 1BIAA 1ZG5A 2R7ZJ 2CUJA 3BJ6A 4Q48A 4C30A 1R49A 3CCUI 4RBOA 1WSUA 1I6XA 1KU5A 5E5AD 3ABUA 3OYGA 1OYWA 4MHGA 1JXSA 3W6KB 3Q9SA 2FRHA 4RGRA 3W99D 4LG0A 5L3DA 2KRFA 1YQAA 4XKWA 3TU4D 2F8NG 5D5XB 4JJNA 3KYLA 4CSWA 3P5JB 5B2JC 4D5FA 3BR1A 2DPUA 5CP6B 4KISA 3H92A 1O3QA 5LBQA 2VPLA 3H1CA 2DFFA 2VT3A 1XC5A 1FOXA 3AZED 2XRLA 4Y13A 1CF7B 3MVDA 3B6FD 2HNHA 2RQQA 3R61A 4J8UB 2XF6A 1AOIA 2WWYA 2EBIA 2HI3A 4CZZA 3ZQHA 1TNTA 2BHYA 4AUXA 2Y2HA 1U35A 1IN8A 1WVRA 2MYSA 4LFUA 5HOOA 1K83J 1Q9CA 3WAAD 3X1SD 3AZGC 2V1XA 4BJTA 4HF1A 3PO3J 3A6NA 1FP1D 3GTGJ 1P3PD 3K6GA 2PMZN 4Y33A 4CGZA 2ZBKA 4J8VC 1XCBA 4B3AA 3CD6I 5B0YC 2R5YA 2J5OA 1ZLJA 2Y2ZA 3CDIA 3RELD 3ESWB 3AZKC 4AIKA 3BT9A 3MVDC 1OFCX 4AYBN 2JSCA 5B40D 2XVCA 4GDFA 3L2WA 4WX9A 3QODA 1MMNA 1FBQA 3REID 2Z99A 1TC3C 4G7HF 4XRSG 3LJAA 4KITB 2ZY2A 1EV7A 4WU9A 4M3FA 2V9VA 3PFYA 4EVIA 2DN0A 2CUFA 4CAYB 4C2TA 2FX0A 2VJJA 3BQYA 2Z9OA 3AZNA 3W96B 1UCRA 3O62B 1F5TA 1ZLAB 2LYCA 1QO0D 5CPIB 2XB0X 4XLAA 1HC8A 3F23A 4JYKA 1R4VA 1X2NA 1QZZA 1D0XA 2VQLA 4A0YA 1DP7P 2DW4A 1FYMA 2VONA 3A01A 1XGMA 2OUMA 3IKTA 1ZELA 1J7KA 2P5KA 4XIDA 4EO5C 2JT1A 4QPOA 2MBFA 4LITA 1U3EM 2X1EA 3LA2A 3C1BB 3AZKA 1I3AA 3P9CA 4B44A 5K5QA 1BJAA 4Z2MH 1MBKA 3MGPB 4MQ9F 2ZM5A 1V5GA 3VPRA 1IRFA 1N25A 5B24A 3DWLE 3AG4H 4IRIA 3GF2A 1ZGWA 1A36A 4GRIA 3A1KA 1TWFJ 5DNMB 5FGMA 2H1LA 4II2A 3V8KA 3AZIC 3AN2D 3WTTC 2XUBA 2IS6A 2VC1A 3HPHA 1ID3A 2JCHA 3MGSD 1YX3A 3EPZA 3SQNA 4D7NA 3BWGA 5DV5A 3EG5B 5JHFA 3AZJA 2X6XA 2QCOA 2BVMA 4XICA 4CCOA 3CCSI 4Z66B 5B3SH 3F3XA 5LHHA 1WZ2A 2VKEA 4B47A 1S32A 4G9YA 5LFAA 2NZDC 1OCZH 2DOEA 3KCCA 4LD9A 3HXLA 3W96A 2W00A 2JA2A 2VXZA 3HM5A 2ZXIA 4CYDA 1E0EA 2BVLA 3RELB 2CW0F 1R22A 4YFKF 4BXXJ 1P6RA 2HZTA 4DQYB 5CPKD 1RZ4A 4OAZA 5LGTA 3WKJC 1KQ0A 3C2BA 1Z3XA 1S7EA 3DKYA 4XLFA 1BL0A 3X2QH 3S2HJ 2JE5A 1C0WA 4BGDA 2R4GA 3E6MA 3VH6W 3PSFA 3GTJJ 3HGGA 1IUFA 2XSJC 4HDUA 2R0QC 3KWQA 2CV5D 2YR2A 3WA9D 2DYSH 2M0MA 4OIQF 4ZBJB 1J75A 1P3MD 3WTPC 5HDNA 4WU8A 4UXNA 2K85A 5E3NA 3OYFA 4OWRB 3BR2A 4KUDD 4LD5A 2E1CA 3W97C 2HDWA 5JLXA 5AV5B 5GAEJ 3JAMK 2BYMA 2XRNA 4KUDA 1Z1DA 4EJWA 3VEPA 4Y15A 3ZRGA 1WJDA 2ZJPF 1G8XA 3AN2C 3W6JB 3W99C 1DP3A 3J81Z 1SVLA 5AY8A 4F93B 4F52A 2HVQA 5GT0B 4BJ5C 5J1UA 2VLAA 2L4AA 2CUZA 3GXOA 3K2AA 2UZKA 3HOSA 2XAQA 4DRBA 5B0ZB 3X1VC 5B33C 1YJWI 4X23B 2PMUA 3GZNB 3CP2A 1MSFC 3A6NC 1A7WA 2QBYB 5GT3D 3W97A 1TT0A 2W82A 3B6FC 1SD6A 2FOWA 3RELA 1O4XA 2JA7J 5G49B 3TW6A 4LGWA 3COAC 4K2EA 4G6QA 1MNMC 1ZYRF 3DEEA 2GOMA 5CVUA 5A2QK 1IJWC 3LELC 3LZ1A 1HTAA 2W84A 3AYWA 1P3FC 2HYGD 3KUYB 1ULYA 4PJ0C 4D7MA 1S32D 3U1DA 3X1SA 1BIBA 2GIVA 1G59A 3F6TA 1XGNA 1N78A 2KFDA 4LLLA 5EDNA 1F36A 3A03A 4JJNC 4DQ2A 4EATA 2EV0A 3AZJD 1TWHJ 3LWFA 1P2FA 1T6SA 1YW7A 2RREA 3P9IA 3OYDA 2EB7A 4O6JA 4D0PA 4RB0A 4B3XA 2VBWA 2VKHA 3AFHA 2PQ8A 1X58A 2VPRA 3JRIA 5AV8B 2IS2A 2HXOA 4MLOA 5IOZA 2OBPA 3ZQGA 3SJMA 1MSEC 5FRNA 3AZFA 3H0MC 5BS7A 5FLXK 2E2IJ 2FJ7C 1SAUA 3FXUA 3NEUA 4H9SA 2H8RA 3U21A 2VXDA 5IPAA 3TGNA 1EA3A 4CZCA 4N0BA 1P4AA 2BE5F 5HVQC 3RJPA 2E34A 2M2EA 2Z5UA 2P81A 1P3FA 2OCCH 4XLHA 4O3MA 2LBFA 1EQZD 3MVPA 2ZXWH 1HDDC 1D1BA 3L00A 4PDKA 2RC4A 1JKRC 4NC6A 2FFFB 3MNNB 1YLFA 4WXHA 1I27A 5FUGB 4GYIA 2ZSIB 4P9UA 2V1UA 1MH3A 1D1AA 4LMYA 3HOTA 4MQVA 2CV5C 4J19A 3N97A 3E6DA 4B48A 5E1ZB 3KUYA 1ZRFA 2NQBB 2MD5A 4MO7A 4C3IJ 4C3JJ 5E17F 3M3YJ 5D6EA 1EQZC 3LELD 2KDZA 1Z6TA 5IY5H 1SFUA 3IWZA 4XOPA 4AM3A 3AG1H 1N77A 2ESNA 2DI3A 2E5NA 2M34A 2VBXA 2L7ZA 5HDGA 5EGOB 5DNNC 1FOYA 4ZYAA 3MGQA 4FX0A 2G5IC 1P92A 3WODF 5C4XJ 3ZGKA 4IHXA 3O62C 1ZLAC 2M9HA 3X1TD 3DKXA 1MJBA 5FO5A 2ZY3A 5CPIC 3CUOA 5J40A 2MH2A 1YIOA 3G6EI 3QYEA 1LFPA 3RYPA 4ENMA 4A3GJ 5DM7F 3M8JA 3VH6A 4BDZA 3L2UA 4H9QB 3SFZA 5AVCC 4J8WA 1OCCH 5LRRA 3F22A 2HPMA 2K5CA 3TDUC 4L18B 2LY8A 4UV9A 3MGSC 3LQQA 3Q0VA 2V26A 1P3OB 1KU2A 3FXLA 3GTLJ 3PUBA 2AROC 1ZH5A 2L5QA 1UZCA 4A3LJ 3I71A 2EILH 4GGGA 4BY7J 3A4CA 3DTIA 2GA2A 5EG0B 2KRHA 4ZZDA 3CC7I 1P3MC 2DQLA 4JX5A 3S93A 5FFZA 1PVEA 3KZYA 1E2XA 3CUQB 3BZKA 1ZGJA 5JHUA 1H3OB 3S1MJ 5B32D 4F92B 3MCZA 4E7SA 2DMUA 1P4XA 4RLQA 3ZXSA 3CMEI 2WAQA 3PJRA 2K3FA 4R1HA 5M3FJ 1K78B 2WTEA 1WHUA 1VFCA 3BY6A 1ZKGA 2VJ4A 1PJRA 3FIWA 3WAAA 4HX4A 4H9OB 2LSOA 2P6SA 3S1NJ 4A3DJ 3EYYA 3GLXA 4M3EA 1MMSA 2MH9A 1PUFA 2AO9A 3E5UA 4Z66C 2CV1A 5EEHA 4YM6A 2ACJA 2DMNA 4RMNA 3HPGA 5D4SA 1OYIA 2OC6A 4U87A 1T33A 2KJCA 3I64A 3K10A 3QWLA 2ZSHB 1ZHFA 3DU6A 3OWTA 1PDNC 1PUEE 5E18F 2FXAA 3L2QA 1AU7A 3KP4A 5B33D 2X1DA 3TQNA 4AD9A 2Y2LA 3X1VD 4MTEA 2IP2A 3LZ0A 2BY3A 1NG7A 5GSUB 3LJAD 1POGA 4NNJA 4CCNA 4CXFA 3ISPA 1IN6A 5B40C 1P3BC 2Y2GA 2BYVE 3KPHA 1RUOA 5DD8A 1LQ1A 1V5FA 2HTSA 3CZ6A 4LJZF 1YHQI 3H9JA 1RUNA 1OCOH 1KU3A 3AZFC 2IW5A 2GM4A 1X1PA 2L9NA 3QYFA 2X48A 2CGPA 2R7VA 3IRQA 2YSRA 3WU2C 2QM3A 3OYNA 3EYIA 1OKRA 3TOAA 1AOIB 3R60A 5AY8C 4WXCA 3WTSC 2OA4A 2XGCA 4PK4A 3L2VA 4YM6C 4XN0A 5F99C 1Y1WJ 4BH9A 2JA8J 5J4YA 3S3NA 2X6YA 3VYTB 3AL0C 5JVTA 2FJ1A 2Y9ZA 1D0ZA 3BR5A 5HLHA 4NE6A 2VE8A 4L0YB 2NZDD 4CSRB 3BJOA 4Y7NJ 1U35D 3OIQA 4EV0A 4PSWA 2DF4C 4L5EA 3IH4A 4IO9F 5DM6F 3LZ0D 1VQ5I 1HKQA 2ETHA 2MW8A 4JX4A 1QA6A 1QGPA 3F9KA 3VYRB 3FBNB 1AOYA 3IL2A 2BHZA 3NARA 2EA2A 2Y48A 2Y2IA 3LAPA 1P3BA 1A6QA 1Y0UA 4S05A 1Z3YA 3IAS2 2TCTA 5GXQD 2BYKA 4Z5TA 5DTDA 3TO6A 3F6VA 3FDDA 3A0BC 5JR3A 3G71I 4G7OF 1S6LA 3WG9A 3AZID 3J80Z 2XHKA 3KFUG 3WA9A 3W98A 3KE2A 3CJTB 5B24C 4H9PA 1Q1VA 3PIPF 1VQ4I 5B24D 2QKLB 2RDPA 1TWAJ 1HKTA 5FKMA 2K9QA 2M87A 1ITYA 4ZUXB 2VUMJ 3TL4X 1APLC 2K40A 3LQRA 1QZEA 4JJNB 2F8NB 1FEXA 2HEOA 5CVVA 5CHLB 2EZKA 3EUKL 5EJCA 1ETKA 3C1CB 4KHAA 5IT9K 1JT0A 3UTBD 3AZMC 2PYOC 1F4KA 2CYYA 3ZQFA 4EGZA 3AZLB 4LOCA 3BZCA 3AZGD 2XKOA 3AZKB 1CF7A 4E7KA 4Y17A 4V2FA 3ABMH 2GA1A 5JVGF 3NWSA 1XGOA 5BS7C 3VOEA 4BDYA 4AVZA 4J8WD 1HA8A 2NAZA 3C18A 4CCMA 1FLIA 2OZ6A 3MAJA 3HOZJ 3E5XA 4X0GA 2QZ8A 4E44A 4CO8A 4DYRA 3BR0A 3UTAB 2L7KA 3JRCA 3HJEA 2DK8A 4XOTA 4FX4A 3CCLI 3KP6A 3W96C 3GBGA 3GFLA 4AU7A 2UWXA 2VT2A 3A2KA 3MNNC 3PNVA 2KJBA 1JT6A 1QPMA 1TLHB 3B0CW 3OYIA 1P3GA 2FQ3A 4GYGA 3QOEA 3REKB 1R5GA 1FPQA 1X1CA 2EWNA 2OTJI 3WTPA 2FNAA 5IT3A 2EQRA 1OR7C 4KICA 2NNYA 1YFHA 1AWCA 1KGSA 3KXBC 4KMFA 2PN6A 1FSHA 1TP4A 1BH8B 2F8NK 3OSFA 3WAAC 4G6DA 2LY2A 3V42A 3IWFA 3MGQC 1MH4A 3F8CA 4FISA 1FTZA 5TGTA 1TQMA 1H88C 1MMAA 4I7HA 3B02A 2EV5A 4ENKA 3CJRB 2M1BA 2EV6A 3RZOJ 4EM1A 3JRGA 4XLPF 3AZEC 5IP9J 3AZIB 2E1MB 2V9PA 3OYBA 1JJ8C 1A31A 4KGCA 3D5SC 3S2DJ 1K79A 3OYCA 2PJRB 5KAFC 2LF8A 2XAUA 4XUJA 3KXBA 1IN4A 3W99A 3ELKA 2K4JA 2HOTA 2F4MB 2F5EA 1XB4A 3FF5A 4R8PA 2EJRA 5E5AA 3REHC 5EZGA 1OISA 2WV0A 4YIFA 3OYLA 4J8WC 2F8ND 4XR6A 4L9VA 2QSGX 2R5ZB 2F6CA 1YW9A 4PJJA 5ICFA 2NZDB 5CPRB 1P3LC 3CJNA 2Y69H 2YFWB 2JUCA 3OYJA 3UTBB 2AROD 2G0EA 5F6FA 2EFQA 4CYCA 1VQPI 4OOIA 5AIPA 3FXMA 3QP6A 3RELC 2AROA 3HC7A 3M8EA 4A5MA 1ID3B 2QA4I 1P3AC 3GTKJ 5IP7J 4FASD 4A3MJ 1B9MA 3ZN0A 1K4SA 1AHDP 3W6VA 3WTZA 5E5AC 3Q0WA 3F8BA 1A35A 5FKNA 4XSZF 1Z2CB 5FKLA 3UT9D 4Z66A 3KXBD 3P7NA 1M18D 1SVOA 2VBZA 2Q0OA 3AYWD 1JUSA 1SFKA 1WI9A 4RDUA 5KHDA 1BI2A 3M8FA 2E5ZA 3ASOH 3AAFA 2BEOA 1U9NA 1HCRA 4RGXA 3IP4C 2IPQX 4WF2A 5E3MA 5B0YA 5GT3A 5BPDA 2IGOA 4WU8C 2JVHA 4JJND 1CGPA 2COBA 3BR6A 4A3FJ 3B0CT 4OIRF 5B1LC 1M19D 3PQKA 2M7AA 4XUJB 2AS5F 4A2UA 1DU0A 2R7TA 3W99B 4IHYA 1EJ9A 1ZN2A 3LSGA 4ZDLA 4BEHB 2HU9A 3RI4A 1HF0A 1GDTA 5AV8D 3AZLD 3ECOA 5GSUC 3OYAA 2NS8A 3B6AA 1X4OA 1STZA 3G2BA 2LNBA 3OL4A 2DODA 3S32A 4X23D 1VQ9I 4ENNA 2P7CB 1B6AA 5GPAA 5FJ8J 4OIOF 2WY7Q 4H9NA 4I98B 3AZFB 1ON1A 2R7QA 3B6FB 2K27A 2DT5A 4U7BA 3IUOA 2ISZA 3RPUA 3W2WA 2R7FA 1IC8A 4M3DA 3WU0A 2DTZA 2V9KA 5HS8A 4I01A 3KWQD 2CV5A 5BO0A 4ZTJA 2DQRA 4NE5A 4QLCD 1TL8A 5AY8B 4ZYDA 1GVDA 1TQPA 2DDBA 2JA5J 5DNNA 3W2VA 1T2KA 3S14J 3LSIA 3H3UA 1USTA 4HLXA 4KIBA 1MDMB 4UPKA 3REJC 3ZQLA 5AV9D 1KX4B 2EZLA 3FHZA 5B31G 3MGRA 2HTJA 2HXIA 2PG4A 3REKD 4YS3D 3B73A 3RQIA 3KEOA 3KYDB 2M8GX 1KX3D 1UHSA 2BW3A 2X6WA 2KQRA 3BR3A 1E3HA 3I0TA 4EMSA 5KDMB 3I3LA 1ZREA 1DQUA 5G49A 5DUKA 2GLOA 4AIJA 2NS0A 3BP8A 1JKQC 2EFPA 1GUUA 3W98C 4J8VA 4FE4A 2BXZA 1Z9CA 2JPCA 3I4MJ 2VKVA 4HQEA 3AV2C 3RKYA 3REJD 1BW5A 2LRDA 4CHUA 5M5WJ 5AV9A 2OJED 4XZQB 1XDSA 2ZCWA 3IKVA 5IYCJ 1FMVA 3TEDA 3AZMD 5CLSA 1YX5A 3QRFF 2ESHA 2I8DA 2EIMH 3KZZA 5AV6D 3BTIA 1P9QC 3S1RJ 1K6OA 2JSSA 4XK4A 2CQKA 3M7GA 2VOPA 4H9NB 5F99D 3MGRC 5CKTA 3AZHB 3HRMA 1F66C 2DA5A 2H27A 5B66C 2IO5C 4ABZA 1I3QJ 5CVRA 4IJAA 2L3DA 3KEQA 3S16J 5ICGA 1FIAA 5B2IB 2VASA 4LK0F 5IOYA 3AZLC 1M1AD 1G3SA 3GMEA 2ID6A 1O3TA 2NXNB 3M07A 3SDBA 2PLYA 1R4NB 1WJBA 3MQ0A 4IHTA 4H9RA 1MKMA 1M1EB 1KX4A 1Q1HA 2Y31A 3MZYA 3ZMZA 1B72A 3REHA 3BDDA 4L5JA 4KUDC 2QQ9A 5B32B 4G92B 3FXQA 4BUPA 5ICCA 3AV1C 4XQFA 2XF7A 1USSA 1LDDA 4HYEA 4XKVA 3O8HA 4KN4X 1WJEA 4ZYHA 5LD2C 4YS3C 2I10A 2M4KA 3LSPA 5C3EJ 5CPID 3HGYA 2CJJA 5J8FA 2GAUA 1WFXA 1XSVA 4Z66D 1R36A 3JR9A 1FTTA 5J3LA 5AV9B 3GZ6A 3V8LA 3OYMA 3BJAA 3K1MA 1MBGA 4U7DA 1PUFB 3G1LA 2F8NH 4JBAA 1ZARA 1QVUA 1WJ5A 2CMPA 1D8KA 5BQTA 3I4NJ 5B1LD 4A3EJ 4KIGA 5BT1C 5B33A 3C1BD 3X1VA 2XGDA 2HIOC 2JSPA 1BC8C 4Q47A 3S2WA 5B1MB 3H0LC 2ZJRF 1J5YA 2FNPA 5D8LB 1H9TA 2Z3YA 4FTHA 3X1UB 4HF2A 4E7JA 2Q2EB 4DBQA 3J7AY 4LLGF 2LFBA 1EH6A 1HLVA 1MBHA 1AKHB 3DCFA 5FB2A 5GTIC 3ZPLA 3WTXC 4J00A 1J59A 4IKFA 4KT5C 1WWSA 2R3SA 4DYCA 2DU9A 1B59A 2LG4A 3AYWC 1KX5D 3FHNA 1MW7A 4AIDA 5HLTA 2GIZA 4OIPF 3HB9A 3VSLA 2CWEA 1YRNA 3ZQIA 3WE2A 3REHB 1LB2A 3J7AO 1W36D 5B32A 3OR2C 2L0KA 2W85A 4ON0A 3W3CA 1BR4A 4ZJZA 2QEXI 4Q4ZF 5AIQA 1R9TJ 4Y52J 4ESJA 3L09A 3W2AA 1U8RA 1LE8B 1ETQA 1BI0A 5CQEA 3DEWA 4HSTA 1O7LA 1P3KA 1I1GA 4YELA 2JN6A 5D5UB 3R45A 4CCLA 1ERDA 4BE0A 2QYOA 4FHTA 5E1WA 2CH0A 3OV8A 1QBJA 4H9SC 3MKZA 3K9TA 2H94A 1Y56A 1P7IA 2RNJA 1V54H 3B0DC 3B6GB 2NNNA 1D0YA 1SMYF 3LFKA 4B1RA 1K4TA 1P3LD 4MEXF 3M4OJ 4E45A 2RN7A 3BG6A 2RV8A 3DPTA 3T8RA 5IYDJ 1TZLA 4NE3A 2MA3A 2Y75A 2X4HA 1FSEA 1H0MA 1RPWA 2L7MP 4RLFA 4E70A 2LD5A 5DS9A 4QLCU 1JKPC 5AVBC 2Q1ZB 1S32B 4HNVA 2FSWA 2QQBA 3RTRA 5F99B 3K70C 4WU9B 5GT3C 1TW3A 2VOOA 1QPIA 2UXNA 3B0BA 2VQCA 1PP7U 5B31B 3F72A 1DGRM 4ZUXA 2HS5A 3LZ1C 5H6RA 5B1LB 5CPJB 3C1CD 2XASA 3C1DA 3LSRA 2HR3A 5CPIA 3EPHA 1BM9A 2EIKH 2MGQA 4KGCD 3CCYA 3T5XA 1VQMI 1LDJA 1YW8A 1G3YA 2DPDA 5HS9A 3K4BA 5AVCA 2CV2A 4CUGA 1QHGA 2EIJH 5DCMA 1HDPA 5KNLA 2CG4A 3A1IA 1R00A 4X23A 1DU6A 1EH7A 1P3IB 3EPJA 1MD0A 3R45B 1B8IB 4IRHA 3MGPA 3VODA 1ETWA 4L9TA 1BC7C 3CP8A 2JUGA 3WTPD 3UTAD 5B24B 1LUJB 2IA0A 3WA9C 5CQGA 2ZMEC 3AKZA 2B9SA 4RB2C 2OTLI 5FROA 5DNMA 2BYMB 3MNND 2GWRA 2IS4A 3CDHA 3BLYA 3S1QJ 2Y2JA 5EYRA 1R5ID 1N1JB 3MKLA 2KRCA 5BT1D 3JRAA 2VJIA 5L3FA 1QHHD 1V3FA 3I53A 2HDCA 3LSMA 4YS3A 4I09A 1T56A 3REKA 3N05A 4TV7A 5B1MD 4X6AJ 3X1UD 2ELHA 2PYOB 2DA3A 3FMRA 4XKCA 3SFIA 3BOQA 1GV5A 1P4WA 3PNTA 3JRDA 3PO2J 3MMYB 3W98B 1BR2A 2WY8Q 4YIIA 3KLOA 1MBEA 3LL7A 1X4PA 1ETOA 1ID3C 4NC7A 2CU7A 1W5SA 1ZG1A 5B31A 1J0RA 4UHTA 1TZYD 5CP6D 5C3IB 3QP5A 1S5LC 1G3WA 1J9IA 3G1OA 4YG2F 2HOEA 1OQYA 4PJLA 1KX5B 4R79A 2L01A 1J2XA 2F5CA 2M5WA 4M6XA 5K7HA 4UUZA 4XLNF 3VH5W 1LKXA 3FMQA 3X1SB 3IH3A 4HGAC 3W97D 5DCMB 2VB6A 1F66B 2HPIA 2DMQA 2CQQA 5FD6A 3OS2A 4BJ6C 2IO5B 1P3PB 1XMXA 4B43A 2A5WA 1U9OA 2P4WA 3OYKA 2XC7A 2WAFA 2YS9A 2KISA 3KZIC 1YJNI 3BZ6A 1JGGA 3LZ0C 4BHCA 4LB5A 9ANTA 2CFOA 1LEBA 2R7SA 3AZJC 2ADUA 6PAXA 2AXLA 1NH3A 4AWXB 4BL0B 3J81K 2ZFWA 4UUSA 3FZVA 1GV2A 4KDPA 3ONQA 3RQ4A 4RAYA 1XX5A 2IAIA 4EEFG 3AV1A 1P3ID 3GFJA 1W2EA 3C1BC 3KP2A 2LY9A 4UUTA 1X3WB 3AZEB 3SYTA 3FKJA 1P3MA 3DPUA 3DV8A 4PSXA 4H0EA 2XSDC 1DGWY 3ZQ7A 1LPQA 3WKJA 1W7PB 2MG4A 3PFIA 4NQWA 2DMPA 5HLGA 2HUEC 1UAAA 2XD5A 1LJ9A 3I59A 2QSFX 2E60A 5K5OA 5C44J 4LIUA 5FUGA 1VQ8I 1WWXA 1T08B 1SC7A 3OOPA 1VQ7I 2R7OA 4Z5TC 1Y6IA 2FD5A 1KZHA 1KQ8A 2MC3A 4H9QA 1LDKB 4R8PC 1IW7F 4LG0B 1HQ3B 4U0YA 5FLMJ 3S17J 4F55A 2HIOA 5F04A 3EPKA 3SEQA 4KGCB 4C3HJ 3GTMJ 4I99C 2W1OA 1P34C 2H8WA 2PJRA 2M3AA 1O7FA 3E0JB 2LP0A 1IV6A 2ZFUA 3WTWC 1WQ2A 3REIB 3QYBA 1FJLA 4BBSJ 3NAUA 4HSRA 1Z67A 3H5AA 3IV5A 3O62D 1ZLAD 3HTSB 3UTBA 3GX4X 2UXXA 5B1AH 3NRVA 2P5VA 3PM1A 2ZY5A 1KONA 2XROA 3BG3A 1WJFA 2JVGA 1KX4D 2X6OA 3H3VK 1MMDA 3ZR8X 4B09A 2L2OA 4J8UC 1W7PA 1JHHA 1JKOC 3OIPA 1E3PA 2LBFB 4YIRX 3LELA 2H6BA 4PJNA 4XUJD 2LC2A 2PFBA 3I59B 4G12A 4CCJA 4L9JA 2K9MA 3JW4A 3DP7A 3W98D 2VJ5A 2K3PA 3LJAB 2Y30A 3SXYA 3WE3A 1XSDA 3U9GA 2W57A 3CESA 3OS1A 1TZYB 1XN7A 1IN5A 1R6RA 1WGXA 2HQAA 2AXTC 3C7JA 2G7UA 3F21A 5B0YB 3AN2B 1FYLA 2BY2A 3EDPA 3MWMA 1V55H 1OR7A 1X1DA 2KMUA 2B63J 4XZQA 5AV6B 1X1AA 4KYWA 2DJIA 5FFXA 3A01B 5DEQA 2PI0A 2EFWA 3V9RB 4RA2A 2A3SA 4NDLA 5JA4A 3R0AA 4IZZA 2Z1DA 3REIA 3IC7A 2DAOA 5B2JB 5AV5D 2KHMA 3SZPA 5KCMA 2XDVA 1X3ZB 5CP6C 3AV2D 5CPJC 1MGTA 2O5RA 1XSXA 4F3QA 3G1MA 1T0FA 3QOPA 1E17A 1BR1A 1U35B 3FXJA 5HS7A 1MBFA 4C9YA 1ONVA 2LF7A 3ZMTA 4YEJA 3J7YJ 3JSOA 2G7HA 2K86A 4PFOA 1VZ0A 4ZC3A 4AWLB 1BH9B 2DA1A 2LH9A 3CC4I 3CMAI 4KNYA 1ZLKA 4A93J 4EO5B 2P6TA 3AFAC 3UT9A 1DDNA 1HXDA 2BGCA 3ZMSA 4H9RB 5H6QA 4OAYA 1RI7A 5DDGA 4F91B 1R71A 4U0WA 2IA1A 5F0HA 2MD0A 3KWQC 5K7ZA 3WA9B 1IAWA 1I39A 3ZMDA 3K2ZA 3FXOA 1WJCA 5GXQA 2M4GA 3F8FA 3MVDB 4RAGA 1I6HJ 4ZYEA 4WZSB 3CJQB 5D5WB 3ASNH 2FJ7B 1QVTA 5L3CA 3UNGC 4B4CA 2DT7B 1XPXA 4HEA2 2JA6J 4WWCA 3WTPE 3BCBA 2LTPA 2DLLA 1OCRH 2KP6A 3Q3SA 3BG5A 3E3VA 4M6YA 4A3IJ 2OZUA 5D8KB 5CJ9A 5J6XA 3T0YA 3DLAA 2QENA 2ZKZA 1IRXA 3FM3A 1SANA 1GXQA 1ETVA 3EUAA 3HSRA 4P96A 4ZDPA 1D8JA 4KHAB 2LMDA 3L2RA 3O2PE 4DBRA 2R5YB 2Y2OA 1ZK8A 2XB5A 5B0ZD 4RM2A 2BYKB 1FNNA 1TAFA 2I5UA 1IXRC 2GXBA 5F08A 3F6OA 2VODA 3IH2A 4HF0A 1B9NA 1KX5C 1AKHA 1AA7A 5B32C 4G92C 1YS6A 5K5RA 4ZTFA 2IT0A 1U6GA 2HOSA 2E1NA 2R93J 3M1CA 2PX9A 4MGRA 3FDYA 3IAM2 2QUFA 4LD9B 2IA2A 2A6HF 1TWCJ 1VQNI 4UUVA 1EQZB 3FMSA 1S9HA 2QWWA 4BAYA 2DT6A 4DZPA 3AZNB 5E3OA 4RB3C 4L0ZB 5B2JD 1RIOH 3VSKA 3CO6C 3F8NA 1MJAA 2DFEA 4WJ3C 1XGSA 3CQZJ 3V7CA 2DOAA 2R92J 4N9IA 3K4NA 1D1CA 4A3BJ 3MFKA 1G6NA 2ZNZA 1BJZA 3G73A 3QPTA 5JRGA 3ZQCA 1YYVA 3AZJB 1SEUA 3TW7A 3H9QA 3DBRB 3NQUA 4ZBJC 2P7VB 2KZGA 3KP7A 2COMA 2G9WA 2IJLA 2J8PA 3X1TA 1EKEA 5A2QZ 2HOAA 1RKTA 3VDXA 5IT9Z 3NQOA 3FXRA 3GTQJ 5AV5C 3KP5A 4NBQA 3ZOBA 2IVMA 2OQRA 3AG3H 2L9SA 1ETXA 5AVBA 2FMLA 1FY7A 1VTNC 2VKDA 2HVRA 2L5AA 2HZDA 1WRJA 3VYUB 3B6GA 1P3OC 2Y2QA 1SD5A 3AYWB 3S8PA 2B7EA 3ABLH 2DJNA 2HUEB 5TISC 2VQRA 4MTDA 5EF6A 4A0ZA 1WWIA 5E79C 4A69C 1P3GB 1SFXA 5GP9A 5GPCA 2NYXA 1JHFA 4R8PB 4WNNA 1B1BA 1HQ3C 1Z6RA 5JLWA 1UB9A 2KIFA 4EJOA 2KDOA 2YUSA 4QWQA 5FLVA 1IF1A 1RETA 4XRFA 4BHPA 3UKGA 2ZMEA 1O3RA 4XM3A 1EQZA 1X1BA 1YTYA 3H5NA 4P5OA 2YFWA 1TWGJ 3RYRA 1QQIA 1TNSA 3KUYC 2NQBD 1V4RA 3FK7A 2HQRA 2DO7A 3CLOA 3WU1B 1UMQA 3HIFA 5AONA 3AZIA 4NHJA 3OOUA 3AZFD 3DF8A 5LHIA 4UY8I 1ZRDA 3M1EA 1S7AA 3IHUA 3H9GA 1Z05A 3R6SA 2CO5A 5JFRA 2BBYA 2ZC2A 4RM3A 3MGQD 2CUEA 2FF4A 1IDYA 3W96D 4LD9D 3DEUA 2R7XA 5BS6A 5F64A 5JRGD 5ED4A 1QU3A 5GT0C 2V4JC 3AZND 3OR1C 2NVTJ 4UVBA 1LVAA 3VYSB 2R5ZA 5AVBB 3BG7A 3OS0A 2BZTA 2PMHA 2NS7A 4WU9D 1MJ9A 2AQFA 2NZDA 2LDUA 2EK5A 2F2AC 4XORA 2HFHA 2MABA 5D5VB 1WI3A 4Z2YA 2DOFA 4C2UA 4BKXA 2O9LA 1IXSB 3QPHA 4HLYA 1M19B 1T38A 1N1JA 1B67A 2IGMA 5E20A 1R1VA 3BTLA 2EH3A 2W4SA 2IRFG 1AOIC 2PYOD 5H20A 4HBLA 3MZHA 4IXAA 2IGKA 2JTVA 4ZZLA 2DA7A 1P3FB 4WV4B 3LSTA 3DBLB 3ZP5A 2HGCA 2DXIA 2E36A 1SAXA 3CF2A 5B0ZA 2D45A 4IVNA 1F1EA 3QU6A 3F0CA 3E7LA 4JP0A 1Z0XA 5AV6C 1UHWA 1FBUA 2A05A 1VQ6I 3JAMZ 2ZNYA 2M8EA 4LG3A 3MGPC 3H35A 5AY8D 4QLCB 2JK3A 1AOID 5AV8C 2A6TA 1W36C 1OLTA 3ZCOA 4YFNF 3BPXA 1OMIA 3FKIJ 3ERED 3AV1D 5DNNB 3REOA 5GAGJ 5HLIA 2V1DA 1P3BD 5DNMC 4IEJA 2WB1N 4GXOA 3CDLA 3FXKA 2R7RA 5B1BH 3KEYA 2CFXA 3CCRI 3FWEA 2BV6A 3K1NA 2BW3B 2QVOA 4NUBA 2A61A 4WK8F 3HSFA 2PBIA 2FBIA 2F4IA 4PZJA 2BOLA 2WAEA 1IO2A 4YRVA 5B40A 1OYYA 5GXQC 3UT9C 2DK5A 3U1KA 2B0LA 4F7ZA 2HIOD 2V6CA 3DLLF 3AZMB 3HTUA 4DRAA 2JMWA 2PJPA 4IHWA 2W48A 1B6WA 3WHBA 2CV5B 1DUXC 1VQKI 4XRMA 1EH8A 4OU0A 1P3MB
chains in the Genus database with same CATH topology
2A6EF 2NQBC 5CYVA 1JE8A 1FZPB 3WKJB 3X1SC 4HGAB 2CSOA 3C3WA 1S7OA 4R8HA 1ODDA 3R0JA 5LGUA 3KLNA 2XIGA 1HQ3D 1BFMA 5ILUA 5KDMA 3UTAC 1U2WA 3HRTA 3LZ0B 5JI6A 5GSUA 4HA8A 1M1AB 3K69A 5DCFA 5LGNA 2A07F 4WU8D 4I0AA 4RAZA 3WTYC 3GEZA 3HHGA 1SD7A 3VFZA 3MGQB 3T8TA 1W7PD 4J8UA 3AZNC 4HX8A 3E5QA 1H3OA 5JRGC 3KUYD 2RVQC 2ZY4A 2W8SA 1GXPA 4IHSA 4X23C 5KVRA 3A6NB 2DBBA 5CPKA 3EPLA 3VB2A 3LA3A 1SMTA 2Y2NA 2DTRA 4M73A 1BBYA 2XKPA 3F8MA 3L9FA 3LELB 5CP6A 2Y2MA 4OMZA 1P3FD 4Z2MG 2RVCA 3B6GD 3HSEA 4EGYA 4BNCA 3P9KA 4IF4A 3RIRA 3REIC 3CUQA 4RGSA 1L0OC 4EJTA 1MZBA 3AN2A 1D3YA 2JRTA 4ESBA 4CAYA 1ID3C 2D1HA 2XAFA 1P3AB 3E97A 4UVCA 3GWZA 4WXDA 3O62A 4HZFA 1ZLAA 2F5FA 5BOXA 3GYHX 1T39A 1IUYA 1R7JA 1BOAA 1Z7UA 1P3BB 4J8XB 2K02A 1XMAA 5B2JA 1GVJA 4A12A 3O6BB 5DYMA 5L3EA 2FOKA 4M74A 3MGSA 3PQJA 1ID3D 1G3TA 2HKOA 4KFCA 1TBXA 2A68F 4WU8B 4A6EA 4JQFA 2OU2A 5DUIA 4MNUA 4NFTA 4N9HA 1T98A 4XUJC 1M18B 1QZYA 3TU4A 3I4PA 2JPBA 4J8UD 2OAZA 1B4AA 2BG1A 2EFOA 3GFIA 3ECHA 3GUDA 2XAJA 3WKJD 1DPRA 3RDIA 5CPJD 2RKHA 1U5TB 1P3AA 3HRUA 1KA8A 1FC3A 5DD4A 4ENJA 2YX4A 2ZXJA 1PZRA 2KIMA 5LEJA 1L3LA 4AWLC 4J8XA 1IN7A 3V8JA 5AVCB 2O3FA 4BQAA 3V9RA 4HV6A 5CVIA 5BNVA 3LZ1D 3KXBB 5B1MA 3X1UA 4I2OA 1FWZA 1HKSA 3MGSB 2D2WA 3BPVA 1O3SA 3KWQB 1SFEA 1IRGA 1F66D 3R4KA 1HSTA 1BH9A 3A6ND 4KA4A 5AV5A 5B32G 3KP3A 3VH5T 4UV8A 4RS8A 3E6CC 3MGPD 5CPKC 3NQJB 3KFWX 1LNWA 4EJUA 2STTA 1G4DA 2EFNA 5GXQB 4A0XA 4WCGA 5BNXA 5B2IC 1BH8A 2W24A 5ILVA 5J8CA 1YS7A 2FMYA 1LEAA 1XD7A 1P34D 4UNOA 4LD9C 1SD4A 4ZUXD 1HQCA 3UTAA 4KUDB 2JZYA 4M9XA 3AFAD 2RQPA 3HUGA 2DFIA 2TDXA 2J5PA 1QNTA 4J8VD 4MEYF 4ZYGA 4YS3B 3ZMUA 3GFMA 4PGGA 2STWA 5GT0A 1M1AC 2PYOA 4L5IA 1KX3C 1FOKA 5GT0D 1R1TA 2P8TA 4HOBA 3EQLF 2M30A 5AV9C 3MGRD 3RKXA 2FA5A 3ABTA 2VE9A 4J8WB 4EM2A 4XZQD 1P34A 4UUZB 3NQJA 2K7LA 2QLZA 4M9SA 2W25A 1P3OA 1X3UA 4LK1F 1ZRCA 2KIUA 2O61A 5JRGB 4U88A 3J80K 3TKYA 3ML6A 5BNXB 1P3GC 3MNNA 1FP2A 2P5LC 5E5AB 4DNCA 3Q9VA 5AV8A 5B2ID 2Q8KA 1K78A 3CO7C 3AZKD 4I02A 1M19A 2YU3A 1TQIA 5E8IA 3TDZC 1KX4C 4ZUXC 2GXGA 1ON2A 5AVCD 1Z91A 3WTUC 3AZEA 5B0YD 2KKOA 2Y2KA 5FD5A 3JTGA 1S3JA 2FBKA 1R5HA 3C1CC 4PCQA 4P9FA 1YO5C 4AIHA 3M9AA 1ZGAA 3QU3A 3SHFA 5DNND 5FLXZ 5AVBD 4QLCA 4IRGA 1HBXG 4J8XC 1KX5A 2RGVA 1UFMA 2H09A 4J8VB 1W4MA 2XV4S 3O3KA 1M19C 3D5LA 2O0YA 1P3LA 5D6FA 3RPQA 2M45A 3MEXA 1KQ9A 2XAHA 2OD5A 3JTHA 3TU4C 4WU9C 3MGRB 1P3PA 3TO9A 3C1BA 1HW2A 1XMKA 1M18C 1TZYA 2MLKA 4O5VA 3REKC 1HW1A 3FM5A 3DQVC 3X1TC 3QAHA 3MVDD 3B6FA 1P3KD 4HV5A 3V4GA 1YG2A 3WAAB 4QLCC 4I0BA 4KUMA 3AV1B 5D4RA 5JA4B 4S04A 3AV2B 1U5TC 3E6BA 1UHMA 2Q2EA 2R7DA 2F5DA 4H9PB 2K4BA 3IRRA 1KU9A 3AZHA 1M1AA 5TRDA 1DPUA 4JK1X 3I54A 2YFVB 4HAMA 5L3BA 3UT9B 2HIOB 2XAGA 2HWVA 4UVAA 1KYZA 2Y2PA 3HRSA 1P3LB 4BYYA 3EUHA 3UTBC 1JFIB 2YX7A 1KX3A 3V7RA 2FE3A 3ZN1A 1BI1A 2VN2A 4LB6B 2RVQD 4GCVA 4HQMA 5C3IC 2FJ7D 4A5NA 2FJ7A 1PP8F 3REJA 3K1PA 1O57A 3HYIA 4RGUA 4CSRA 5CPKB 4G91C 1U78A 3DFGA 1IZ1A 2PEXA 1H9GA 2F2EA 1I1SA 2ISYA 3AV2A 3LA7A 5DNMD