1ULYA

Crystal structure analysis of the arsr homologue dna-binding protein from p. horikoshii ot3
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
190
structure length
190
Chain Sequence
AKKVKVITDPEVIKVMLEDTRRKILKLLRNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEMKGNLVEKYYGRTADVFYINLYLGDEELRYIARSRLKTKIDIFKRLGYQFEENELLNIMDRMSQKEFDATVRISKYIEEKEDALKDFSNEDIIHAIEWLSTAELARDEEYLELLKRLGSILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords hypothetical protein PH1932
publication title Crystal structure of the PH1932 protein, a unique archaeal ArsR type winged-HTH transcription factor from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 70
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2003-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ulyA01
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1ulyA02
5GXQC 1G6NA 3GZ5A 5G49A 1LEBA 2P5LC 3MNND 2MLKA 3X1VC 5B1LD 3DPTA 4YM6A 4QLCB 2EA2A 4O3MA 3REKA 1IN7A 3KEQA 5A2QZ 3R60A 5E18F 1I1SA 4E44A 5BNVA 4YS3A 3W98B 1OYYA 3V8KA 1O57A 2YX7A 5J8CA 1S32D 1P3AC 5DNMA 3K9TA 4G92C 1P4AA 3REKB 2A69F 1ZLAC 3WTTC 2Y48A 4YS3B 1P3FC 4G6QA 5AV9D 3QPHA 4H9RA 4Y15A 3F3XA 4ZBJC 3LELA 4ON0A 3BZ6A 2VT2A 3WG9A 3GVAA 5CPIC 2FMLA 2HS5A 1H3OA 2HEOA 1B6AA 3W96D 4A0XA 1J75A 4P9FA 4H9RB 4LD9C 1B67A 3KXBC 1H9TA 4AWLB 3U2RA 4R8HA 5CVVA 3LJAC 4IHSA 4CXFA 1R4VA 5B1MB 4H9PA 3AN2C 2R3SA 4WU9D 1S6LA 4GYIA 4HF2A 1P2FA 4M6BA 1FBUA 4RB2C 4N9HA 1XSDA 5HOOA 1SD6A 3AAFA 4O6JA 1LQ1A 1P3PC 3AFAC 3QU6A 2EA4A 4KIGA 2BEOA 4I0BA 1ZGJA 2V1DA 3B0CW 2CQKA 1ODDA 4ZUXC 4H0EA 1L3LA 4L9JA 4KN4X 3ROUA 4CO8A 1MD0A 1IRFA 5CPKA 1UCRA 3C1BC 3G73A 2V79A 1P3GC 1KGSA 5JRGB 3TOBA 1QO0D 1P3BA 2VE8A 5LEJA 3O62D 4HQMA 5L3FA 1MKMA 1QNTA 3BJOA 2WWYA 3WTPE 5E20A 1TTYA 4HLYA 3AZFC 3GFLA 3A6NC 1M18D 2IVMA 3KP4A 4CHUA 4KYWA 4HA8A 1YYVA 3CLOA 4BYYA 3DPLC 2DW4A 5J6XA 4UUZA 2QLZA 3JAMZ 5B0ZC 1KA8A 3TOAA 3B6FC 2L3DA 3WU1B 2PYOA 4Z5TC 3RELC 1SD5A 2V6CA 2FSWA 4IXAA 1KU7A 3B0BA 2H27A 5TJJA 5E5AC 2GWRA 1HQ3B 5HLHA 4J8VB 3GWZA 2E7WA 4U0YA 5IT9K 3AYWD 5AY8D 5J8FA 4ZYGA 1BBYA 2MH2A 1X3UA 1Y0UA 3AV2B 3VH5T 1S32C 1U3EM 4J8XA 4HGAB 2CO5A 1R00A 5AVBD 4HF1A 1TW2A 4RS8A 5E1WA 4FX4A 3EUHA 1FBSA 5CPJA 2ZFWA 3V9RB 5AV5A 4XBFA 1M19C 1P3KA 1E2XA 3AZNC 1K7AA 1EQZC 3HRMA 2GA1A 5AV6D 3GYHX 2DU9A 5AV5B 3AZHC 4LMYA 3UTAC 1P3KB 3HTUA 5DV5A 2H09A 2O03A 5AV8C 2LSOA 4KN7X 5B40B 2CV5D 1CF7A 3MGRD 4WK8F 1P3IC 3CTAA 5GT0D 1BI2A 5BPIA 4MQ9F 4GXOA 3WE2A 3MGPA 3HSFA 1S3JA 2WC2A 2RQPA 2RNJA 3PQKA 3KUYC 3CO7C 3WTPD 1FYKA 3AZGD 1U5TA 2CW0F 4L5JA 1KU9A 5LLQA 3MGPB 1YG2A 1PUEE 1T39A 2AROD 3O62C 5B2JC 3MNNB 2EV6A 4A6DA 5B1LB 2GQQA 3AZID 4Q5SF 1Z05A 2Z3YA 1XGSA 4XUJC 4WNNB 3TO7A 1R1TA 3ABTA 1A7WA 5DNNA 3UTBA 1TW3A 5BS7C 2DT5A 5C3IC 3FM3A 5JFRA 2F8NG 3HHGA 1PP8F 2HIOC 4KA4A 1IN4A 1ZREA 3B6GA 2LF8A 5DNNB 3ZMVA 1ZN2A 1J9IA 3UTBB 4AIKA 5AV9B 2Y75A 2WV0A 4CZZA 3LZ0D 1XCBA 4YFXF 4WXCA 3H3UA 4YIIA 4EM1A 1M1AA 5LRRA 2VE9A 1Z6RA 1K6OA 5H6RA 1UB9A 3X1SA 1MJ9A 3W96B 3TGNA 3ELKA 3P9CA 1J0RA 2LKPA 4QLCD 3ZPLA 3VH6A 5AVBC 3ABUA 4U7DA 5LGNA 3H3ZA 2M5WA 1M1AB 3LWFA 4L5IA 2AS5F 4WU9B 1P3LD 2W84A 5F99C 3W98D 2H94A 1H0MA 3CJNA 3U9GA 1HTAA 2XAFA 3BJAA 3Q9SA 3CO6C 5BT1C 4YM6D 4UUVA 2FOKA 3V8JA 5AVCC 3REKD 3RKWA 5BPDA 1SMYF 5AV6C 2HKXA 2RC4A 4ZYDA 4YS3D 1USSA 1R5GA 4HF0A 4EO5C 5DNMD 3COAC 3X1UD 3LFKA 2F5FA 1EH7A 3S2WA 3BWGA 3VODA 4LD5A 1S8NA 4ASNA 2CV5C 4MHGA 3O3KA 3R61A 3MGRC 2ZNZA 3N97A 5ED4A 3LELD 2ESHA 1FYMA 3I4PA 4U0WA 5GT0C 2P5VA 2XUBA 4KMUX 1M18B 2K86A 2VOOA 3LA2A 1ZLKA 2FE3A 4KGCC 4WXHA 1HW5A 5B32G 1G3SA 3WTPC 2IPQX 4NB5A 1E17A 1XCVA 3W97A 2QQBA 2HOEA 2VBXA 3REJA 3VOEA 3UT9C 1FC3A 4R8PA 3ML6A 4HAMA 1F66A 4XLPF 2VBYA 4IRIA 5B2IA 2P6SA 2K4BA 2KIFA 2JPBA 3JTHA 3REHC 3C1CA 1Z9CA 1ID3A 4MTEA 1KU5A 3R0AA 3AYWB 3TQNA 1P3MC 1J2XA 3X1TC 4G7HF 1IF1A 2Z99A 3O6BB 3F72A 4MEYF 3RKYA 4R8PB 5B2IB 1O7FA 2IO5C 5CPKD 3J81Z 3KE2A 1SD7A 3DV8A 3V8LA 2ISYA 3EYYA 5DUIA 2ZBKA 4H9SA 3SHFA 3DQVC 2UZKA 2STTA 5B24C 3RI4A 3AZLA 2LNBA 1P3BD 4OINF 2ESNA 4HW0A 4X23C 3REIA 4XZQA 5B31G 2Y0MA 5L3EA 5DEQA 2DTRA 2F8NA 5BO0A 3QP6A 1T6SA 4EGZA 3AZLB 2XKOA 5B33A 2M45A 2IA0A 4XZQB 1XSXA 1TZYC 2NQBA 1ZYRF 3F21A 4QLCC 2PYOD 4JBAA 2F8NB 4RGUA 4PGGA 5CLSA 3V4GA 3WTUC 4AWXB 3KFWX 3E6DA 4AD9A 4CSRA 3RTRA 1O3RA 3FMQA 1FLIA 3WKJA 3E5UA 4B8XA 2EWNA 2F5CA 2LDUA 3REKC 4NE5A 1U35D 1TNTA 1AOID 1QQIA 1XD7A 1D5VA 4MGRA 1OR7A 1T2KA 4YS3C 1BIBA 3KZYA 4GO1A 4BHBA 1H9GA 5CJ9A 3WKJB 4J8XD 3G3ZA 3I58A 3E6CC 4M74A 1N1JB 4EJTA 3AZGB 4EJWA 1R1VA 2IW5A 4NFTA 5BNXA 3V7CA 5ICFA 1ON1A 5CPJD 4RB3C 4JJNA 5AV5D 2M87A 3LZ1A 2D45A 3LSTA 2JZYA 2XRNA 4QLCU 3JSOA 2AROB 1P3KD 4AWLC 2EFPA 3SXYA 3SQNA 4H9OB 3QPTA 3MEXA 5B1MC 1KX5A 2O0YA 2P7CB 4LG0B 4JJNB 2G9WA 3LZ1B 3BOQA 3NQJB 4Z2YA 3ZMDA 3RYRA 4YFKF 4H9QB 2FMYA 2VXZA 3IC7A 1XN7A 1KX4A 2KJCA 1RUNA 1IAWA 2OD5A 3F8FA 3C7JA 5FUGA 2JSCA 3AV1A 3F6VA 2VODA 3B0DB 2D1VA 3AZJC 1WWXA 3LA7A 5B32A 1G3YA 3ZMSA 3L09A 2W25A 3HUGA 3E3VA 1R5HA 3LZ0B 2O61A 1YIOA 1T38A 5JRGC 1OYIA 3MAJA 1AWCA 5FUGB 5GT3A 2JTVA 2FEZA 5B32B 5LHHA 4I02A 5DDGA 4HDVA 3ISPA 5BOXA 5D5WB 2E1NA 2BV6A 4A12A 4ENKA 1K78B 1C0WA 1P3OA 3VFZA 1P3LB 4S05A 1F4KA 5GT3B 3BROA 2XHKA 5G49B 2O6GE 4NHJA 3QP5A 3BDDA 4XRFA 5ICCA 1IN8A 2FRHA 3WAAA 4I98B 4M72A 2LY8A 3X1UA 4YM6B 1DPRA 1Z7UA 3VH6T 2GZWA 2HTSA 4WWCA 1P3OB 5BNVB 4IHTA 1HQ3C 5HS7A 1T0FA 5DNND 3E6BA 4AIJA 4J8VC 3UTBD 3AZMA 2ELHA 4AVPA 3R45A 3SFZA 2EV5A 2K02A 5DNMB 3WAAB 5B31A 3X1UB 3EQLF 4YG2F 2CGPA 4Q47A 3B6GD 4BHPA 1RIOH 3GZ6A 3AV2C 1FP1D 2FBIA 1AOYA 4M71A 3AZMB 2HDCA 4LLNA 4EJVA 3R45B 3DKWA 4HGAC 2V1UA 1TAFA 3LELB 2IT0A 2JPCA 1M1AD 2M30A 2NZDC 3MGQA 1ZGAA 4A5MA 4L0ZB 3X1SD 2HZTA 1XDSA 1H3OB 5K5OA 1JE8A 1KX3A 5BQTA 1B6WA 4KDPA 1O3TA 4OMYA 2OZ6A 5CVJA 1ZG3A 4HYEA 1I1GA 5HS9A 3MGQB 4H9PB 5FGMA 1FNNA 5A2QK 3NRVA 3J80K 5JA4A 5AV5C 3MWMA 3L9FA 1BJAA 2MLGA 4LLGF 3KP2A 3V7RA 5GSUA 1P3KC 2DQLA 1ULYA 3WU0A 2UXXA 3EETA 5CP6C 2XAJA 5IT9Z 4WU8D 1P34A 5B40C 5JA4B 1KU3A 4M9XA 1R58A 4A2UA 3I0TA 4P5OA 4KIBA 5GSUB 2A07F 5GXQA 5CPKB 2CG4A 2DO7A 2OA4A 3X1VA 1HXDA 1P34B 4Z66C 2YU3A 1BC7C 1LB2A 1S7AA 3M9AA 1P3BB 2VC0A 1B4AA 3WTXC 2A61A 2F8NH 3L00A 3KZZA 3TKYA 2F8NK 4RAZA 3MGPC 5ERIA 1PDNC 5BS6A 1QZYA 1R23A 5LGUA 1ZLAA 4UUZB 3HSRA 3ZQ7A 3WTSC 4G91B 3GUDA 1P3FA 3W99A 3MNNC 1TQIA 5B1LC 3W97D 2EFWA 4MTDA 2PYOB 3HIFA 1U35A 4KUMA 1BI3A 3REJD 6PAXA 3F8NA 1AOIA 3TDZC 2M8EA 5FFZA 5DD4A 5CPIA 4R8PD 4RB0A 1F66D 5HLIA 5B2ID 1ZH5A 1ZLAB 2VC1A 4ZYEA 3IRQA 1MJAA 1P3FB 3W99B 1J59A 5FLXK 3C1CD 1ID3D 1HW2A 1GXPA 3HSEA 1FYLA 1U35B 1BC8C 3TO6A 2EFNA 1AOIB 3D0SA 1LVAA 1LDKB 3I53A 3KP6A 2ZJ2A 1NHAA 4LK1F 5DNNC 3MFKA 1OYWA 1FBQA 3UTBC 5AV9C 2JRTA 4J8XB 2OAZA 4I2OA 3FX3A 3RKXA 4DNCA 4ESJA 1P3PA 3AFAA 5CPJB 3AZLD 3W96C 3WTZA 2XVCA 2DBBA 3U1DA 3BPXA 2L54A 4ZUXA 4XZQD 3REID 1YTYA 1F1EA 2F8ND 1M1AC 4BXUA 3R6SA 2L4MA 4OMZA 2E1CA 4WU9C 1P3PB 5B33D 3C1BA 4OIQF 1P3GA 3GFIA 2MC3A 3BP8A 1STZA 3WTVC 3BPVA 2NQBD 3IKVA 1BH8A 4U88A 5FO5A 3AZFA 3A6NA 4ZH4F 1CF7B 3C1BB 1JFIA 1U8RA 1P3GB 4RB1A 3WKJD 2TDXA 2D2WA 4IRGA 4G6DA 2MBFA 1A04A 2Q8KA 1KQ8A 3MVDD 2OU2A 3KP7A 4HOBA 5B0ZA 1YW8A 1J5YA 3ZMUA 1U5TB 2HUEB 1P6RA 1QGPA 1YLFA 4HX8A 5LRSA 1M18C 3ECOA 4JJND 1DDNA 4B09A 3LZ1D 5TRDA 2ZO4A 3CDHA 5IT3A 2VONA 1BFMA 1XMAA 4CAYA 4BNCA 3MCZA 3KEOA 1KX5D 2ADUA 2BYKA 2OQGA 2DI3A 1P4XA 2QM3A 2YSRA 3TU4D 1OKRA 1JGSA 1KQ0A 3CUQA 1EH6A 4M9ZA 4CAYB 4DRBA 2HYFA 1M19A 2J5OA 3AYWC 4A0YA 1KX4D 5AY8C 2K4JA 2E7XA 3VEPA 3AZNA 2ZCWA 4CYDA 1ZARA 3I59A 1EQZA 3B6GB 3AV1D 5B2IC 2P7VB 3E5QA 5B32D 3CUQB 1YW7A 3AZHA 3UTAA 1OPCA 1IXSB 3KCCA 2Q2EA 2BGCA 1CGPA 2DPUA 3X1SB 4BH9A 5GT3D 5AV8A 3IWFA 3QAHA 1ZG5A 3MQ0A 2W24A 1P3IA 3UTAB 3Q5FA 3KSYA 2P8TA 5LEKA 1P3OD 2NNYA 4WU8A 3B0CT 2BYVE 1BIAA 3O2PE 5H20A 4UV9A 3NQUA 4WX9A 3HHHA 4LB5A 4D0PA 4XZQC 3WAAD 2RVQD 4PCQA 2EFOA 3AZEA 4UXNA 2FXAA 2PJPA 2XASA 5EEHA 3VB2A 3IHUA 4WU8B 5LBQA 3WODF 3QRFF 1P92A 1PP7U 1TNSA 2QQAA 1REPC 3AZMD 3ZP5A 1S29A 3NQUB 5B31D 3AZEB 3FM5A 4U0VA 2OZUA 4RAYA 5B2JA 1HBXG 4Z2MG 4G7OF 2KIUA 2XGXA 1EV7A 4M6YA 1B59A 3KLOA 2FU4A 3DFGA 4XUJA 4HX7A 4Q48A 5HDKA 4HLXA 3WKJC 1KU2A 3KETA 3AZGC 2RN7A 4EM2A 5BS7A 2FNPA 3ZMTA 2NAZA 5CVUA 5DYMA 4PZJA 3MGQD 2BYMA 3V7SA 3L2CA 2IA2A 1RI7A 2FJ7D 3WTWC 3D5LA 4OIOF 2HIOA 1BOAA 4J8WA 1KX3D 1O3QA 2AROC 4ZYHA 2W85A 3WA9A 5AIQA 1JHHA 2V1XA 2FNAA 4I0AA 3KWQA 3AZIC 3W97B 5HDGA 4EJUA 2KRFA 2BYMB 2XAHA 2X0LA 3REJB 4JJNC 3KP3A 4H9NA 3FZVA 1WKMA 3K1MA 4J8WB 2HIOB 1F66B 5GSUD 1SFEA 2F5DA 3WA9B 3SZPA 3KWQB 3C1CB 1ID3B 3M8FA 4RGSA 1P34D 3BJ6A 4ENMA 4H9NB 4LFUA 4AIHA 1B9MA 4Q4ZF 5D4RA 5GXQD 3GX4X 3LZ0C 2YX4A 1WWSA 3X1VD 3C1DA 3EYIA 2DK8A 2DAOA 5AVCA 3F6OA 1HKQA 3GXOA 2A68F 4EQQA 5JVTA 4LLLA 3P7NA 3REIB 3FWEA 2A6HF 2CYYA 2EK5A 2RV8A 2K7LA 5HDNA 5BO0B 2OQRA 1P3LC 3W98C 1ZLAD 5D6EA 5B33B 3VH5A 3MGSA 3W99D 1P3FD 1G4DA 3F23A 4YM6C 2NQBB 3MVDA 1B1BA 1P3OC 4CSRB 4P96A 5CPID 3HTSB 1QZZA 4KGCA 3MGSB 1ONVA 1XDUA 5K1YA 3VH5W 4ESBA 3WAAC 5DNMC 3F8BA 1ZAOA 3X1UC 4LD9D 3MVDB 4BAYA 2HYGD 2UXNA 5LGTA 1P4WA 3N4MA 5E1XA 1HSJA 1I5ZA 1FSHA 4KGCB 2MD5A 3LELC 3REHA 2ISZA 5BNXB 2G7UA 3AFAD 1P3PD 4GYGA 5HVQC 1P3MA 4KIFA 3TU4A 4ENNA 4ZUXD 4U7BA 4FT8A 4KUDA 4UHTA 3TDUC 1KYWA 1IXCA 4PDKA 3REHB 1KX5B 1HSTA 1FSEA 5ILUA 3M8EA 3C1BD 1P3GD 2IRFG 3TU4B 4MNUA 5B24A 4RGXA 1RZ4A 4KUDB 2VBZA 1MJBA 2F2EA 4IVNA 4EGYA 3RIRA 3HRTA 4X23A 1KX4B 1O3SA 1WSUA 5FD6A 4I01A 1U6GA 3K2ZA 3AZFD 3A6ND 1YQAA 2IJLA 2W57A 5D5UB 3QOPA 1Q9CA 1XB4A 3AV1B 5H6QA 2YPRA 3GLXA 2COMA 5GSUC 3NQOA 1FX7A 3AZKA 2M1BA 1UHMA 1DPUA 5B0ZD 5CPKC 3RPUA 4X23B 3B6FD 1TZYA 1P34C 4J8UA 4WF2A 3IL2A 3F8CA 1P3BC 3M1EA 3DP7A 3AZKB 3OV8A 3RJPA 5E8IA 2STWA 4OIPF 1TZYB 4J8UB 4R79A 5KDMA 1MZBA 4KNYA 3J80Z 4G91C 1IN5A 3ULQB 5LHIA 2L02A 2PYOC 2QQ9A 3JTGA 3P9KA 2EJRA 5KDMB 3FMSA 4K2EA 3KLNA 5B0YA 4RGRA 4LB6B 3W99C 3I54A 1RUOA 1B9NA 1M19D 5B31B 2IP2A 3AZND 3RPQA 1U35C 2PLYA 2FQ3A 4EJOA 1XGNA 3GEZA 1AOIC 1EQZD 3WTYC 1WRJA 1DP7P 4A6EA 5B1MA 2FJ7A 1MGTA 1IRGA 5B0YB 4YIFA 3AZHD 4PGHA 4J8XC 4XSZF 3UTAD 1TAFB 4OIRF 4NE3A 2QUFA 5DD8A 1KQ9A 5LHGA 3IKTA 2EFQA 5DUKA 5CPJC 5AV8D 1F9NA 2FJ7B 2RGVA 1KX3B 3FXRA 4P55A 1P3ID 3AZJA 4O5VA 2FBKA 1D3YA 1I6XA 4QWQA 2KKOA 2DQRA 4NQWA 4JK1X 5JRGA 1U78A 1SD4A 4HZFA 3BY6A 3K1NA 3KUYD 3AZED 3AZJB 2FBHA 2VOPA 1QBJA 5ILSA 1Q1HA 5D4SA 5FLXZ 4EMSA 4I09A 2Z5UA 5E1ZB 1G3TA 3CUOA 4L18B 1FPQA 2MA3A 2KIMA 3WGHA 2PQ8A 1W7PA 3ERED 5GXQB 3ECHA 3GW2A 5B2JD 1P3AA 2ZXJA 4FHTA 3X1VB 2D1HA 3H92A 5JR3A 2QVOA 3B73A 2XAQA 4IJAA 4HV6A 4XUJD 3DEUA 1ON2A 4DRAA 3JW4A 1HQ3A 4LJZF 2HTJA 4Y13A 1W7PB 4MQVA 5HS8A 1U5TC 2HUEC 4J8VA 3I64A 1LDDA 2YFWA 2JT1A 1P3AB 3T0YA 4G92B 3OOPA 5KK1A 3C3WA 5DCMA 4FX0A 2QYOA 2YR2A 2GIVA 2P4WA 2AXLA 2HIOD 4J8WD 3L7WA 2HWVA 3WA9D 3AV2A 3KWQD 5JHUA 4LD9A 2YFWB 3KXBA 2IA1A 2XAGA 5D5VB 2UWMA 4ZBJB 5DCMB 3LJAA 2P6TA 2NZDA 2H6BA 1MDMA 5CPIB 3AN2A 3IWZA 2P5KA 3FMRA 2XROA 3V9RA 3F8MA 4GCVA 4LD9B 3KXBB 2HQNA 1HW1A 2PMHA 5F1RA 4L9TA 5CYVA 1SFUA 2PBIA 3B6GC 3GO5A 3LJAB 4HBLA 2NZDB 5KVRA 1MDMB 3AN2B 1XMKA 5F99D 1GVJA 3CUQC 3JAMK 5DCFA 5D8KB 4GGGA 3FXQA 5HLGA 1V3FA 5BT1D 2QBYA 2VT3A 5AVCD 2DPDA 1BH9A 3X1SC 3AFAB 5CP6A 2CSOA 4LGWA 5B40A 1JXSA 1T98A 4M73A 4TV7A 1UFMA 3GFJA 4ZUXB 1IZ1A 4G8XA 4CGZA 4KFCA 2QBYB 4Z2MH 2A5YB 1OMIA 1BI0A 1BH9B 4JQFA 1D8JA 2NYXA 2XV4S 4IRHA 5CP6B 2L5AA 3M7GA 2ZNYA 4Z66A 5AIPA 3T8RA 1WQ2A 2Z33A 3MGSD 4MEXF 5K5QA 3RYPA 5L3DA 2ACJA 1TBXA 4IPAA 1D8KA 5EEGA 1BH8B 4E45A 5E17F 2NRAC 3B6FA 3PFIA 4WU8C 1W5SA 2BBYA 3AZFB 3A6NB 4Z5TA 3P9IA 2VN2A 3LQQA 4DQ2A 3RELA 1JFIB 4KGCD 4Z66B 4BQAA 5E5AA 3DXJF 4KMFA 2A3SA 3E97A 2PG4A 3AZEC 4KT5C 5B0ZB 1W4MA 3C18A 3MNNA 2B0LA 5L3CA 5D5XB 5B1LA 5F6FA 3B6FB 4S04A 4G7ZF 1FT9A 3HYIA 4Z5TB 2L4AA 3RELB 2QWWA 4WNNA 4Y17A 3UT9D 3RDIA 3MZYA 5E5AB 5L3GA 2PMUA 1LJ9A 1S32A 3REHD 1K79A 5FD5A 2FF4A 1P3MD 2KJBA 3X1TD 4KUDD 1BI1A 2X4HA 1U2WA 3TO9A 5AV9A 3W97C 5CVRA 1SFXA 1S32B 2BYKB 1S7OA 2K27A 3REJC 4YFNF 3FF5A 1R22A 1LDJA 3F22A 3J7AO 4R8PC 4J8WC 1F66C 5B24D 3MZHA 3PQJA 3WA9C 3W96A 3KWQC 3C1CC 1GHCA 1ID3C 1M19B 4X23D 3R0JA 1QPMA 3LA3A 3AZNB 2QZ8A 3HOSA 3I59B 1EQZB 4UVCA 2J5PA 4ETSA 1HKSA 3LAJA 4WU9A 2NNNA 4L9VA 4HQEA 3AZHB 5E8GA 3SZTA 3AZKD 4UVBA 1JHFA 3R4KA 3ZMZA 1R1UA 1ZRCA 1TZYD 2FA5A 4J8UD 4H9SC 5D6FA 2H6CA 3W6JB 3AZLC 5AV8B 1ZG1A 3K1PA 3NEUA 1XGMA 3REIC 2PI0A 1IN6A 5AONA 1FWZA 3KUYA 3FHZA 1P3IB 4A5NA 5ICEA 5CVIA 1ZRFA 3E5XA 5CHLB 1XGOA 4A0ZA 3VH6W 5BMZA 4ZZDA 4UVAA 3ZN1A 1F1ZA 5B33C 1TQMA 2BE5F 1YS6A 1HQCA 1G3WA 1R36A 3B02A 2PEXA 2R7FA 4BHCA 3KUYB 1TLHB 2NQBC 3O62A 2Z9OA 1EH8A 2ZKZA 3KP5A 2O3FA 4R1HA 1M18A 2YFVA 5ICGA 4M9SA 5B0YD 3MGSC 2A6EF 2F5EA 1TQPA 1ZHFA 4WV4B 3K0LA 2RVCA 3IRRA 1F5TA 4KHAA 3MVDC 3O62B 5B2JB 1YO5C 2CWEA 3I5UA 2RKHA 1KYZA 5B1MD 1SMTA 2YFVB 1SAXA 4XUJB 1FOKA 2DFIA 2GXGA 4ESFA 4ZZLA 4N9IA 3REOA 4KHAB 2HFHA 5C3IB 3AYWA 4LK0F 5AY8A 1VTNC 3W6KB 3LZ1C 4IF4A 2C6YA 3K69A 3T1BA 1V4RA 5ILVA 3AZJD 3T8TA 1DUXC 2GA2A 2O8XA 3GFMA 5L3BA 1IW7F 3T5XA 1KX5C 1GXQA 4CICA 4ENJA 5AY8B 5AVBA 4CDGA 2XIGA 3EDPA 5JRGD 1UHWA 5F64A 3B0DC 2HGCA 4P9UA 3TU4C 2GXBA 2PFBA 5F99A 2DK5A 3QU3A 5FFXA 2Q0OA 4KUDC 1ZLJA 4OOIA 2R7DA 4G9YA 1KX4C 2MH9A 1XSVA 5AVBB 5AV6A 1J7KA 3AV1C 1WI9A 3GF2A 4WXDA 5F99B 1W7PD 5B32C 1P3AD 4WCGA 5AVCB 2ETHA 5AV6B 5GT3C 4WZSB 1BM9A 4UNOA 1HQ3D 2CV5A 1IUYA 5D8LB 1O7LA 2ZMEA 3AZKC 4J8VD 3MGRA 2QENA 4EO5B 1LNWA 2DLLA 5JI6A 4J8UC 5GT0A 4EVIA 1FP2A 1Z1DA 4N0BA 3DF8A 1YS7A 2V9VA 4XSXF 4XLNF 2EB7A 2CV5B 1HKTA 3AV2D 2PN6A 2ZMEB 1I27A 2G7HA 2HR3A 2OBPA 2HQRA 4E70A 2RVQC 3MGRB 3WE3A 3J81K 3KXBD 3WTPA 1N1JA 3AZGA 1IXRC 5GT0B 3LJAD 2NZDD 4HV5A 1WWIA 3AN2D 1ZRDA 4UV8A 1R7JA 4L0YB 4EM0B 3JSPA 4KICA 3AZMC 3UT9A 4I7HA 5B31C 4HX4A 1USTA 2AROA 3WGIA 3WTPB 4OU0A 4H9OA 3AZIA 4M6XA 3ZN0A 3WGGA 1YFHA 3X1TA 1Z91A 4LG0A 5B0YC 3E6MA 3FXUA 4NE6A 2VBWA 3UT9B 2JSSA 3NQJA 4H9QA 2NS0A 5FB2A 3MGQC 2GAUA 2WTEA 3AZIB 3Q9VA 1RNLA 5CP6D 1P3MB 1Z6TA 2FJ7C 5B40D 3X1TB 1BN5A 1KX3C 2LF7A 2L01A 2IO5B 1LEAA 3LZ0A 3HOTA 3I71A 4F7ZA 5K5RA 4Z66D 1L0OC 3HRUA 5B24B 1YW9A 2RDPA 1FY7A 2CFXA 2XKPA 3LQRA 3HRSA 4L9NA 3LAPA 4HDUA 2HKOA 4EV0A 1W5TA 4QLCA 4G94A 4Z5TD 1K78A 3RELD 3MGPD 1FZPB 5E5AD 1P3LA 2EV0A 3W98A
chains in the Genus database with same CATH superfamily
1Y39A 2B63J 1G6NA 5GXQC 3FXMA 4A3BJ 3GZ5A 5G49A 1LEBA 3BR0A 2P5LC 3MNND 3CJQB 4XM3A 2MLKA 3X1VC 4BUPA 5B1LD 3DPTA 4B3AA 4YM6A 2FX0A 3UNGC 4QLCB 2EA2A 4O3MA 3REKA 1IN7A 3CCSI 4Y52J 3KEQA 5A2QZ 3K4KA 3R60A 4UB6C 5E18F 1I1SA 4E44A 5BNVA 4YS3A 4PFOA 3IUOA 3W98B 1OYYA 3V8KA 1O57A 2YX7A 4BJ5C 5J8CA 1S32D 1P3AC 4HSRA 5J4VA 5K7FA 5DNMA 3K9TA 4G92C 1FIPA 2MW8A 1P4AA 4RA2A 3REKB 3BT9A 1E0EA 4IOCF 1UJ8A 3CF5F 2A69F 3JRGA 1ZLAC 2KT0A 3WTTC 2Y48A 4YS3B 3GTPJ 1P3FC 4G6QA 1JI8A 5DM7F 4XOTA 5AV9D 3QPHA 4H9RA 4Y15A 3GTKJ 3F3XA 3HGGA 1SC7A 4ZBJC 3FXKA 2KISA 1ETQA 2RNGA 3HXLA 3LSMA 3LELA 1BR4A 4ON0A 3BZ6A 2VT2A 1B8IB 3WG9A 3GVAA 5CPIC 2HU9A 4JX5A 2M7AA 2FMLA 2HS5A 3OYMA 1H3OA 2HEOA 1B6AA 3W96D 2DJNA 3FXJA 4A0XA 1VQ4I 1JUSA 2NVYJ 3TP0A 1J75A 4P9FA 4H9RB 4XN0A 4LD9C 1B67A 2EBIA 3KXBC 1H9TA 3BR6A 2XF5A 4AWLB 4IL6C 2XF7A 3U2RA 4R8HA 1VQMI 5CVVA 1HF0A 1V55H 3LJAC 1Z67A 4CXFA 2TCTA 4IHSA 1R4VA 4H9PA 5B1MB 1FOXA 3AN2C 2R3SA 4WU9D 5F27A 2VIXA 2ELKA 1YIJI 1S6LA 4GYIA 4HF2A 1H89C 2HXIA 1P2FA 4M6BA 1FBUA 4RB2C 4N9HA 1XSDA 5HOOA 1V5FA 1SD6A 1Y6IA 2V1NA 3BCBA 2OCCH 3AAFA 4O6JA 1LQ1A 1K61A 1P3PC 3AFAC 3QU6A 4D5FA 2EA4A 4KIGA 1MBJA 2BEOA 4I0BA 2OTLI 1ZGJA 2EQRA 2V1DA 3B0CW 2CQKA 1ODDA 4ZUXC 5KAIC 4H0EA 1L3LA 4L9JA 4KN4X 1Y8RB 5HNFA 5J47A 2IS1A 3BC8A 3ROUA 5KNLA 4CO8A 1MD0A 1IRFA 1LFUP 4DQYB 5CPKA 3SYTA 4JX4A 3MMYB 1UCRA 2EINH 3C1BC 3G73A 2E36A 1SFKA 2V79A 1KGSA 4NQWB 5JRGB 1P3GC 2K9SA 3TOBA 1QO0D 1P3BA 2VE8A 5LEJA 3O62D 4HQMA 5L3FA 4BBSJ 1MKMA 1QNTA 3BJOA 4CH7A 2WWYA 3WTPE 1UELB 5E20A 2BW3A 5KAFC 1TTYA 4HLYA 3AZFC 3GFLA 2XD5A 3A6NC 2CU7A 1M18D 2F4MB 3KZIC 2IVMA 3KP4A 4CHUA 4KYWA 3MKZA 4HA8A 1FOYA 1YYVA 3CLOA 4BYYA 3DPLC 2DW4A 1X2NA 5J6XA 4UUZA 5DTDA 2QLZA 3JAMZ 4PJNA 5B0ZC 1KA8A 3TOAA 2BHZA 3FIWA 2LY2A 3B6FC 2L3DA 3WU1B 2PYOA 2BOLA 2HOSA 2V9KA 4Z5TC 1Z0XA 3RELC 1SD5A 2V6CA 2FSWA 4IXAA 1KU7A 3B0BA 2H27A 5TJJA 2BHYA 5E5AC 1YX3A 2GWRA 1HQ3B 1N25A 3E1SA 3CZ6A 2BY1A 4XLFA 5HLHA 4J8VB 3GWZA 2E7WA 3DTIA 2M7BA 2JWTA 4U0YA 3H1CA 5IT9K 3AYWD 4E4HA 5AY8D 4A3KJ 5J8FA 4A3IJ 3DU5A 4ZYGA 5IY5H 2CW8A 5FKMA 1BBYA 2MH2A 1X3UA 1Y0UA 1TL8A 3AV2B 3VH5T 4AYBA 2LC2A 3G1OA 5GPCA 1S32C 1U3EM 4J8XA 3I56I 4HGAB 2CO5A 1R00A 3K4MA 1S5LC 2ICWG 4HF1A 1TW2A 3MKLA 5AVBD 4RS8A 2QKLB 3KPHA 3PNVA 5E1WA 4FX4A 1VQ5I 4HNUA 3EUHA 3RZOJ 1FBSA 1ZQ3P 1LVKA 4D7MA 2LYCA 5CPJA 2ZFWA 3V9RB 5AV5A 4XBFA 1M19C 2ZSHB 1P3KA 4BY1J 1E2XA 2KDZA 4A3EJ 3AZNC 3RQIA 1K7AA 1EQZC 3HRMA 2GA1A 3L2WA 5AV6D 3GYHX 2Y2NA 1FTZA 2DU9A 4NBQA 2R5ZA 5AV5B 3OYKA 1VQLI 4ZJZA 5J40A 3AZHC 4LMYA 2DMNA 1XG1A 3UTAC 5IYBJ 1P3KB 3HTUA 1BW5A 5DV5A 2H09A 4BE0A 3GZNB 2O03A 4A3FJ 4ZTFA 5AV8C 2LSOA 4KN7X 4BE2A 5B40B 2CV5D 2R5ZB 1CF7A 3FK6A 2Y69H 1YHQI 3ZRGA 3W2VA 1PUFA 3MGRD 1WH7A 4WK8F 5FKKA 1P3IC 4ZYAA 1EJ9A 4DYQA 1VI0A 2N8GA 3CTAA 5GT0D 1BI2A 5BPIA 4XKVA 4MQ9F 4GXOA 3WE2A 2FJ1A 3S8PA 3PSFA 3MGPA 3ABLH 1S3JA 2WC2A 3HSFA 2RQPA 2RNJA 3MKWB 2ZJRF 1FJLA 3PQKA 3KUYC 2DDAA 2FQ4A 3CO7C 5IYCJ 3WTPD 3Q0UA 1FYKA 3AZGD 1U5TA 2CW0F 3BR5A 4L5JA 1KU9A 1HDDC 1OFCX 5LLQA 3MGPB 2CQXA 4AC0A 4A93J 1DGRM 1YG2A 2ECCA 1VF9A 1PUEE 4A3DJ 1U9OA 1ENHA 1T39A 2R93J 2AROD 3O62C 3VYRB 5B2JC 3L2QA 1ZR2A 1RKTA 5F0FA 1H8AC 3MNNB 2EV6A 4A6DA 5B1LB 2GQQA 3AZID 4B43A 2ZM5A 4Q5SF 1Z05A 2Z3YA 1XGSA 3ZCOA 4XUJC 3BR3A 2K40A 4WNNB 1P9QC 4QTRA 1W0UA 3TO7A 1R1TA 3ABTA 1A7WA 5DNNA 3HKZN 3UTBA 1TW3A 5BS7C 3A0BC 4II2A 1WHUA 2DT5A 1T8IA 1UG0A 2NOJB 2W1OA 3D5RC 3FM3A 5C3IC 5JFRA 2F8NG 4NDLA 3HHGA 1PP8F 1WJDA 1W0TA 2HPIA 3G2BA 2HIOC 4KA4A 1IN4A 2L7ZA 1ZREA 4X6AJ 3B6GA 3WU2C 2R7UA 2LVSA 4NC8A 2LF8A 3X2QH 5DNNB 3ZMVA 2JUGA 1ZN2A 1J9IA 3UTBB 4AIKA 5AV9B 2DA7A 4GFBA 1X1AA 2Y75A 2WV0A 4IZZA 4CZZA 3LZ0D 1XCBA 3AG3H 4YFXF 1VQOI 4WXCA 3H3UA 1X1PA 4YIIA 4EM1A 4D9JA 3A03A 1M1AA 5LRRA 2VE9A 4W1UA 1Z6RA 1K6OA 5H6RA 1UB9A 3X1SA 4DIQA 3X1TC 1MJ9A 2MC4A 1VFCA 3W96B 3TGNA 3ELKA 3P9CA 1J0RA 2R4GA 3SDBA 2ZXIA 2LKPA 4QLCD 1R4MB 3ZPLA 3OIQA 3VH6A 5AVBC 3ABUA 4NC7A 4U7DA 5LGNA 2EIJH 1MBGA 2M5WA 3H3ZA 1LE8B 3FBIB 1D5YA 1M1AB 3LWFA 4L5IA 2AS5F 4BBRJ 4WU9B 1P3LD 1SVOA 2W84A 3F0CA 3HKZA 5F99C 3W98D 2H94A 3MN2A 3H0GJ 3MGQA 3B6AA 1H0MA 3DPUA 1S9HA 3CJNA 3U9GA 1HTAA 1MBKA 2XAFA 3BJAA 3Q9SA 3CO6C 5BT1C 3F9KA 4UUVA 2FOKA 3BR2A 3V8JA 4YM6D 5AVCC 3S14J 3REKD 3RKWA 2JRMA 1SMYF 5FROA 5BPDA 2Z1DA 5F04A 3G71I 5AV6C 2HKXA 3Q0WA 2RC4A 4ZYDA 4YS3D 1USSA 2CMPA 4PJMA 1R5GA 3MD2A 5E3LA 4HF0A 4EO5C 5DNMD 3COAC 3X1UD 3G1LA 3RZDJ 3LFKA 2ZSIB 1JGGA 2VQRA 2K9MA 2F5FA 4BDYA 1EH7A 3S2WA 3BWGA 3PUBA 4RDUA 2RQQA 3VODA 4LD5A 1S8NA 4ASNA 4KISA 2ZJQF 4MHGA 2CV5C 3O3KA 3R61A 5FRMA 2Y2OA 2VJ4A 2X85A 3MGRC 2ZNZA 2ZXWH 3S3NA 3S2HJ 3N97A 2E5ZA 2EPFA 2OPTA 5ED4A 2HVSA 2ESHA 3LELD 1FYMA 2CV1A 3I4PA 3E7LA 4U0WA 5GT0C 2P5VA 2XUBA 4KMUX 1M18B 2K86A 4U87A 2VOOA 3LA2A 1ZLKA 3JRBA 4I6ZA 2FE3A 2VJIA 4KGCC 4WXHA 3PNYA 1T33A 1U8BA 1HW5A 5B32G 1G3SA 2WB1N 3WTPC 2IPQX 4NB5A 4DZPA 1E17A 3QPLA 3KFUG 1XCVA 3FKJA 3W97A 2QQBA 4DW6A 4HNVA 2HOEA 4FASD 2VBXA 3REJA 2XPVA 3VOEA 3NWSA 1FC3A 2ZC2A 3UT9C 4OAZA 2V7FA 4R8PA 3ML6A 2KHMA 4HAMA 4XLPF 2VBYA 4IRIA 5B2IA 5KHDA 1F66A 2P6SA 2K4BA 2JA2A 2KIFA 2JPBA 3JTHA 2JE5A 3REHC 3C1CA 1Z9CA 2WY8Q 4MTEA 1ID3A 1KU5A 1T3UA 3R0AA 4C9YA 3TQNA 1E3OC 4A3CJ 3AYWB 1P3MC 1J2XA 3PFYA 4G7HF 1IF1A 2Z99A 1BW6A 3O6BB 3PUFA 4F55A 2HVRA 2IS2A 3F72A 4MEYF 3RKYA 4DBQA 2LH9A 2YS9A 2GIZA 4R8PB 3OS1A 5B2IB 1O7FA 2IO5C 4DJAA 5CPKD 3K4JA 2JN6A 2X9DA 3J81Z 4F93B 3KE2A 4ZDLA 1SD7A 1IG7A 3DV8A 3V8LA 2ISYA 3EYYA 4HSTA 4BQQA 5DUIA 1HDPA 2ZBKA 2R7WA 3UKGA 3SHFA 3DQVC 2UZKA 2STTA 4H9SA 5B24C 3RI4A 4D1QA 3AZLA 2LREA 2WB1A 2LNBA 1P3BD 4OINF 4X1EA 2ESNA 4HW0A 3VPRA 4X23C 3REIA 3SZGA 4XZQA 5B31G 2Y0MA 3M1CA 5L3EA 5DEQA 2LR8A 2DTRA 2F8NA 2M34A 3L1PA 5BO0A 4B1RA 2XDVA 5E3OA 3QP6A 1IDYA 1T6SA 1U0JA 4EGZA 3AZLB 3S1QJ 2XKOA 5B33A 2L7MP 2JSPA 2M45A 4CCKA 2IA0A 2QGUA 4XZQB 1XSXA 2Y2IA 1YRNA 1ITYA 1TZYC 1PZRA 1T08B 1ZYRF 3A1YA 3F21A 4QLCC 2NQBA 2BY3A 2UV1A 2PYOD 4JBAA 2CH0A 2F8NB 4UUSA 3ABMH 3IH2A 4PGGA 4RGUA 5CLSA 3V4GA 3WTUC 2ELJA 4AWXB 3KFWX 3E6DA 3TEDA 3S1NJ 4AD9A 4CSRA 3LSHA 3C2HA 3RTRA 3HB9A 1O3RA 1UMQA 3FMQA 2EIMH 1FLIA 3WKJA 1SAUA 3E5UA 1IV8A 4B8XA 2EWNA 2F5CA 1TT0A 2LDUA 1YRNB 4QPQA 4G12A 3REKC 4NE5A 4HEA2 1JKQC 2LY9A 1U35D 4UUSB 1VQ7I 1TNTA 1IRZA 1AOID 1QQIA 1OCPA 1XD7A 1D5VA 2ZY3A 4MGRA 2DMQA 1OR7A 5CKTA 1T2KA 4YS3C 1BIBA 3KZYA 4GO1A 3OL3A 4E7JA 4BHBA 1H9GA 5LFAA 1TT5B 5CJ9A 3WKJB 4J8XD 3G3ZA 2X51A 3I58A 5EF6A 3E6CC 4M74A 1N1JB 4EJTA 3AZGB 1K6YA 1R1VA 3DBHB 4EJWA 2LG4A 1AU7A 1X58A 2IW5A 4NFTA 5BNXA 2XSJC 3V7CA 5ICFA 1ON1A 2CJJA 4M3GA 4RB3C 5CPJD 5TISC 5AV5D 4LIVA 4JJNA 2M87A 4Y3OA 3K70D 3LZ1A 2HVQA 4S0HB 4G6TB 2D45A 3LSTA 2MSYA 2VKHA 2JZYA 2XRNA 4QLCU 3JSOA 2AROB 1P3KD 4AWLC 2EFPA 3SXYA 2CQNA 3RQ4A 3SQNA 4H9OB 1OCRH 1QHHD 3MEXA 3QPTA 5B1MC 1KX5A 1ZTRA 2O0YA 2P7CB 5GP9A 4LG0B 4JJNB 3KYDB 2Y2HA 2G9WA 3LZ1B 2VPLA 2R7SA 2EH3A 3BOQA 3NQJB 2XRLA 3NARA 4Z2YA 3ZMDA 3RYRA 2Y0SN 5EDNA 3PIOF 4YFKF 4H9QB 2FMYA 2MFZA 2VXZA 3IC7A 4HRIA 1XN7A 5IP7J 2IAIA 2KDOA 5J1YA 1R4NB 1X4PA 1KX4A 2IGOA 2KJCA 1RUNA 1IAWA 2OD5A 3F8FA 3C7JA 3BG7A 4HNTA 1NH3A 1ETYA 5FUGA 3PNTA 2JSCA 2HZDA 3AV1A 2DN0A 3F6VA 3GTJJ 2VODA 3B0DB 2D1VA 4LG3A 3AZJC 1WWXA 1MBEA 3HG9A 2VL8A 3LA7A 4Y4RA 3RKQA 2Y2QA 1G3YA 5B32A 3ZMSA 3J7YJ 3F6TA 5C4JJ 3L09A 2W25A 3HUGA 3E3VA 1R5HA 2QSHX 3LZ0B 2O61A 5F08A 3CC2I 1TWGJ 3JREA 3KIOA 1YIOA 1T38A 5EYRA 3A01B 5JRGC 1OYIA 3MAJA 5FLMJ 2R7XA 3SEQA 1AWCA 2QCOA 2L9VA 3NAUA 1R71A 1I3AA 4PSXA 1ACIA 5FUGB 5GT3A 1VQ8I 2JTVA 1ORKA 2FEZA 5B32B 5LHHA 4I02A 2DTZA 1O4XA 1W36D 3HUGB 5DDGA 2K9NA 4HDVA 3ISPA 5BOXA 5D5WB 2E1NA 2BV6A 4AVZA 4A12A 4ENKA 1K78B 1C0WA 1P3OA 2WA0A 3LNQA 3OY9A 3VFZA 1P3LB 4S05A 3HOXJ 1F4KA 5GT3B 3BROA 3M3YJ 2XHKA 5G49B 2O6GE 4NHJA 3QP5A 3BDDA 3Q0VA 4V2GA 4XRFA 5ICCA 3HZJA 3PIPF 1IN8A 2FRHA 1Z21A 1YE9A 4I98B 4M72A 3ZQQA 1RR8C 2Y9YA 1DPRA 2LY8A 4YM6B 3X1UA 1Z7UA 3VH6T 2GZWA 4MLOA 2HTSA 2NS8A 3P5JA 2XGCA 5GPAA 4WWCA 1P3OB 1QVTA 3CF2A 5BNVB 4CA0A 4IHTA 2LFBA 1HQ3C 2E1OA 2X1DA 5HS7A 1T0FA 5DNND 4E6KG 2WBMA 3CLQA 3E6BA 4AIJA 2YU9J 4J8VC 3UTBD 2QKMB 3AZMA 2ELHA 4AVPA 3R45A 3SFZA 2EV5A 2K02A 2HNHA 5DNMB 3TW7A 3WAAB 2WADA 5B31A 3X1UB 1Z3XA 3EQLF 4YG2F 3P5JB 2CGPA 2KZGA 4Q47A 3B6GD 4BHPA 4EATA 1RIOH 3IH4A 1WPKA 3GZ6A 2EILH 3AV2C 1FP1D 2FBIA 1AOYA 3C2BA 4M71A 3AZMB 2HDCA 4LLNA 4EJVA 3R45B 1BOBA 3CC7I 1OCTC 1I39A 3DKWA 4HGAC 4QIWN 2V1UA 4LOCA 1TAFA 3LELB 2IT0A 2Q1ZB 2JPCA 1M1AD 2M30A 2NZDC 2DJIA 5FJ8J 1ZGAA 3FXLA 3W6VA 4A5MA 3FKIJ 3BTJA 1GUUA 4L0ZB 2HZTA 3X1SD 1XDSA 1H3OB 5K5OA 1JE8A 2BVMA 2M4GA 2K85A 1KX3A 5BQTA 1B6WA 5HLTA 4DYRA 4KDPA 1O3TA 2EIKH 1XPXA 4OMYA 2OZ6A 1DQUA 5CVJA 4DZJA 2X6OA 1ZG3A 2KFDA 3CMYA 4HYEA 1D0XA 1I1GA 5HS9A 3MGQB 4H9PB 5FGMA 3EUHC 1FNNA 5CQGA 5A2QK 3NRVA 3J80K 5JA4A 4GRIA 1Z3YA 5AV5C 2J8PA 3MWMA 2CUFA 3L9FA 1BJAA 2MLGA 4LLGF 3KP2A 2RREA 3V7RA 3DLAA 3A1KA 5GSUA 1P3KC 2DQLA 1ULYA 4ABZA 3WU0A 3BG5A 2JA8J 2UXXA 3EETA 1F36A 1JUMA 3M8JA 4XICA 3OMYA 1IJWC 5CP6C 2XAJA 5IT9Z 1X1CA 4WU8D 1XMXA 2BXYA 3KEYA 5B40C 5JA4B 1MH3A 1KU3A 4M9XA 1P34A 1R58A 4A2UA 3I0TA 5E3MA 4P5OA 4KIBA 5GSUB 4XOPA 4FTHA 4QPOA 4E7KA 2A07F 4IQ4A 5GXQA 4EEFG 1B72A 5CPKB 2CG4A 4XMYA 3WG7H 2DO7A 2OA4A 3X1VA 2MGQA 1HXDA 2JQ7A 1VZ0A 3AG2H 3J7AY 1P34B 4Z66C 2K9LA 2YU3A 1BC7C 3IAM2 1LB2A 1RETA 5KCMA 3K2AA 4FCYA 1S7AA 3M9AA 5C3EJ 2VC0A 1B4AA 3WTXC 2A61A 1P3BB 4D5CA 2OJED 4E7ZA 2F8NH 1Y1WJ 2I8DA 1UG2A 3ABKH 2BW3B 3L00A 3BZCA 3N05A 1KZHA 3KZZA 5B3SH 3TKYA 3S3MA 1W2EA 2F8NK 1P7IA 4RAZA 3MGPC 4FISA 5ERIA 5BS6A 1QZYA 1PDNC 1R23A 4E7SA 4Y7NJ 4J00A 4B44A 3K10A 1ERDA 1EKEA 5LGUA 1ZLAA 4XL9A 5E3NA 1N75A 4RAGA 3OYCA 4UUZB 3HSRA 3ZQ7A 3WTSC 4G91B 3GUDA 5C4XJ 1P3FA 3W99A 1V54H 3MNNC 1TQIA 2O8KA 5FKLA 5B1LC 3GMEA 3W97D 2EFWA 4MTDA 2PYOB 1BA5A 3HIFA 1OCCH 1U35A 1R49A 2VQGA 1BI3A 4KUMA 5HODA 3REJD 6PAXA 3F8NA 1A6QA 1AOIA 3TDZC 2M8EA 5FFZA 2DDBA 5DD4A 1XC5A 5CPIA 4R8PD 4RB0A 1F66D 5HLIA 5B2ID 1ZH5A 1QHGA 2DA6A 2VC1A 1ZLAB 4ZYEA 3IRQA 1IUFA 1MJAA 1MNMC 1P3FB 3H5RA 1J59A 5FLXK 3C1CD 4IHYA 3W99B 1ID3D 4XKWA 4XONA 1HW2A 3D5SC 2OC6A 2LKSA 1GXPA 3HSEA 1FYLA 2OCEA 3QPSA 1BC8C 1U35B 3SFIA 2VASA 1V5GA 3TO6A 3H9GA 2EFNA 1AOIB 3D0SA 1LVAA 3LL7A 4E7HA 1LDKB 3I53A 3KP6A 2ZJ2A 2LRDA 1NHAA 3G1MA 4LK1F 4XN3A 4F52A 3MFKA 1OYWA 2HXOA 5DNNC 1FBQA 2KLOA 2BZTA 1ZR4A 3UTBC 5AV9C 2JRTA 1HA8A 4J8XB 2OAZA 4I2OA 1W5CC 4RBOA 3FX3A 3RKXA 2DA1A 4DNCA 4ESJA 4BQNA 1P3PA 3I4MJ 3AFAA 3HEFA 5CPJB 3AZLD 3W96C 3WTZA 2XVCA 2DBBA 3U1DA 4AUXA 3BPXA 2L54A 4ZUXA 1FOWA 1P7JA 4XZQD 3REID 1YTYA 5BNGA 1F1EA 2F8ND 2R7VA 2L9NA 1M1AC 4BXUA 1FTTA 3R6SA 2L4MA 2K3FA 4OMZA 3JRAA 2E1CA 3HC7A 4WU9C 1P3PB 5B33D 3C1BA 1I50J 4OIQF 1P3GA 2BXZA 3GFIA 2MC3A 3BP8A 3RSNA 3HOWJ 1STZA 3WTVC 3BPVA 2NQBD 1OLTA 3IKVA 4M3EA 2FD5A 2JJ7A 1BH8A 4U88A 4M6VA 5M5WJ 4RLQA 4WJ3C 2E60A 1I6HJ 5FO5A 3AZFA 3A6NA 3DTKA 3BLYA 4ZH4F 1CF7B 2LTPA 3C1BB 4PJ0C 1U8RA 1PUFB 1P3GB 1JFIA 4RB1A 2L9RA 2YUSA 3WKJD 2TDXA 3TMOA 2D2WA 4IRGA 2CUZA 3CESA 2CW7A 4G6DA 2MBFA 3S1RJ 1A04A 2Q8KA 3OYHA 1ETKA 1KQ8A 3MVDD 1LFPA 2OU2A 3KP7A 4HOBA 4CYCA 4BS9A 5B0ZA 2CQ7A 1YW8A 1MSFC 4BACA 1J5YA 2LBFA 1WCMJ 2H1KA 3ERMA 4C3JJ 4BXXJ 1ZK8A 1PYVA 1UHSA 1JT0A 3G6EI 1D0ZA 3ZMUA 4B3XA 4CCNA 3GLLA 2CUEA 2HI3A 4IHWA 1GVDA 1U5TB 2L7FP 2HUEB 1P6RA 1QGPA 4CYCB 1YLFA 3BG9A 4HX8A 5GTIC 5LRSA 1M18C 3ECOA 2H1LA 3GTGJ 4JJND 1MW7A 1DDNA 2GM4A 4B09A 3LZ1D 3EPKA 5TRDA 2ZO4A 3CDHA 5IT3A 1UZCA 2XAUA 2VONA 1BFMA 1XMAA 2DA2A 4CAYA 4MIMA 4BNCA 3ESWB 4D7NA 4F91B 3MCZA 3H9QA 3KEOA 2DA3A 2L2OA 1NK2P 4ZC3A 2QEXI 1X4OA 4FQGA 1M1EB 4RLFA 1KX5D 2ADUA 2BYKA 1IC8A 1JJ8C 4XRMA 2OQGA 2NS7A 3HJEA 2DI3A 1P4XA 2QM3A 3S93A 1MH4A 2O7OA 5EZGA 2YSRA 3TU4D 3JR9A 5EGOA 1SEUA 1OKRA 1JGSA 1KQ0A 2B7EA 3CUQA 1EH6A 4M9ZA 3GTQJ 4CAYB 4DRBA 2DT7B 2RIQA 4N4OB 4ITVA 2HYFA 2QA4I 3EPJA 1M19A 2J5OA 5C44J 3AYWC 4A0YA 1KX4D 3ZQHA 1XX5A 1GT0C 2K4JA 1FEXA 2E7XA 5AY8C 3VEPA 3AZNA 3OR1C 2ZCWA 4CYDA 1ZARA 1SVLA 3I59A 1EQZA 3CDIA 3M4OJ 3B6GB 3AV1D 3CMEI 1VQ9I 1GV5A 5B2IC 2P7VB 3E5QA 5B32D 3CUQB 1YW7A 3AZHA 4P1WA 3HOYJ 3UTAA 3ZQIA 3OYBA 2DF4C 2GOMA 2TRTA 1OPCA 1IXSB 3KCCA 4PJLA 3QODA 2Q2EA 2BGCA 2VQHA 1CGPA 2DPUA 3X1SB 4BH9A 5FKNA 1N77A 1OISA 5JHFA 5GT3D 5AV8A 3IWFA 1A36A 3AL0B 2XPWA 3QAHA 1ZG5A 3MQ0A 2W24A 1P3IA 3UTAB 3ZQLA 3Q5FA 3H9JA 3KSYA 4CCLA 2E2IJ 2P8TA 5LEKA 1P3OD 3S17J 2UWXA 3U1KA 2NNYA 4WU8A 1XTAA 3PL8A 2NVTJ 3B0CT 2GBYA 3DBRB 2BYVE 1BIAA 3O2PE 5H20A 2P0WA 3QOEA 4C30A 3WHBA 4UV9A 3NQUA 4WX9A 3HHHA 4LB5A 4UPKA 4D0PA 4XZQC 3WAAD 4M3FA 4RM3A 2RVQD 4PCQA 2EFOA 3AZEA 4II3A 3QWLA 4UXNA 2FXAA 4V2FA 2PJPA 1MMSA 2M4KA 2XASA 5EEHA 3VB2A 4A3JJ 1WVRA 2Y9ZA 3IHUA 4WU8B 3S1MJ 5LBQA 3WODF 4C2UA 3QRFF 1IRXA 1P92A 3QYEA 1PP7U 1TNSA 2ZMEC 2Y2JA 2DT6A 2QQAA 1REPC 3AZMD 3ZP5A 1S29A 3NQUB 1MMAA 5B31D 3EUKL 3AZEB 2XB5A 3FM5A 4U0VA 2OZUA 3OSGA 2VUMJ 1DU6A 2CS3A 4RAYA 2DXIA 5B2JA 3FDDA 2KL4A 4XLCA 4IEJA 1HBXG 4Z2MG 1AHDP 4G7OF 2XD1A 2KIUA 2XGXA 1D1AA 5IPAA 1EV7A 4M6YA 3S2DJ 1B59A 3KLOA 4XKBA 2W4SA 3VYSB 3OYIA 2FU4A 1IGNA 3DFGA 4XUJA 4HX7A 4Q48A 5FKOA 5HDKA 1X2MA 4M3BA 4HLXA 2WAFA 1KU2A 1ZKGA 3RCOA 3KETA 3WKJC 1R6RA 2L5QA 2WAQN 2ZXHA 3EG5B 1HC8A 3AZGC 2RN7A 4ZDPA 4EM2A 5BS7A 2CRGA 2AO9A 2FNPA 2NAZA 3DKYA 4JOMA 4PZJA 5CVUA 1WJBA 5DYMA 3MGQD 2BYMA 1RKWA 4KT6A 4PUSA 3V7SA 3L2CA 1OR7C 2IA2A 3DWLE 2XPUA 1RI7A 2FJ7D 3WTWC 4IOAF 3D5LA 4OIOF 2HIOA 1BOAA 4J8WA 1KX3D 1E3HA 1O3QA 2AROC 4ZYHA 3OIPA 2W85A 4XR6A 4BQOA 2V9PA 1IDZA 3WA9A 5AIQA 1JHHA 1RESA 3JRHA 2V6EA 2V1XA 2DFEA 2FNAA 1ETVA 4I0AA 1YI2I 1UAAA 3KWQA 3AZIC 3A1IA 3W97B 2HDWA 5HDGA 2I10A 2KRFA 4EJUA 5DS9A 3H0LC 4YEJA 2WAEA 2BYMB 2XAHA 3K4LA 1WJCA 2X0LA 3REJB 4JJNC 3KP3A 4H9NA 1JUPA 3FZVA 1WKMA 3K1MA 4J8WB 2HIOB 1F66B 5GSUD 1SFEA 4MFDA 4V19K 2F5DA 3WA9B 3MKYB 3SZPA 1WJAA 2COBA 3KX2A 3KWQB 3C1CB 1PVEA 1ID3B 3TBIA 3M8FA 4E7LA 3MGRB 4RGSA 1P34D 3BJ6A 3DEWA 4ENMA 4H9NB 2EZLA 5B1AH 3HDDA 1MNDA 4Y33A 4LFUA 4AIHA 2WAQA 5CQEA 3A02A 3S32A 1FMVA 3HPHA 2ZB9A 3GBGA 4IHXA 1B9MA 4Q4ZF 5D4RA 5GXQD 3GX4X 2UUZA 3LZ0C 5M3FJ 2YX4A 1WWSA 4XNFA 3X1VD 1GV2A 3C1DA 3EYIA 2DK8A 2DAOA 5AVCA 3F6OA 1HKQA 4OAYA 3GXOA 2A68F 2Z16A 4BEHA 4EQQA 2Y2KA 5JVTA 2Y2LA 4LLLA 2GOXB 4UB8C 4XK4A 3P7NA 3REIB 3FWEA 2A6HF 2CYYA 2EK5A 2RV8A 3PO2J 2E35A 2E1MB 2K7LA 2X1CA 5IOYA 5HDNA 1VQ6I 4LIUA 5BO0B 2OQRA 2VKEA 2R7QA 1P3LC 2VQLA 2M9HA 3W98C 1ZLAD 5D6EA 1VQNI 5B33B 5GAGJ 4BU2A 2JA6J 3VH5A 3MGSA 4BGDA 3W99D 1KONA 3PJRA 1P3FD 3FK7A 4B4CA 4M3DA 1G4DA 3F23A 2VPRA 4YM6C 2NQBB 1QVUA 3MVDA 3U21A 2EZIA 3SEZA 3OYLA 1B1BA 2D5VA 4CCOA 1P3OC 4YRVA 3TL4X 2VKVA 3IH3A 4CSRB 2O9LA 5M3MJ 1A6IA 2VKDA 1X19A 4P96A 5CPID 1TWFJ 3VSLA 3CCRI 3HTSB 1QZZA 2LY1A 4KGCA 3MGSB 1ONVA 1XDUA 5K1YA 3VH5W 1OCOH 2ECBA 3W3CA 4ESBA 3WAAC 5DNMC 3F8BA 1ZAOA 5JVGF 3X1UC 3TP3A 4LD9D 3DCFA 3MVDB 2IS6A 4BAYA 1JT6A 2HYGD 2UXNA 5LGTA 5EG0A 3MZ8A 1P4WA 3N4MA 5E1XA 1T0FC 5IP9J 3LMMA 1LUJB 5EEAA 1HSJA 1I5ZA 3CCEI 1R9TJ 1FSHA 4KGCB 2MD5A 2V4JC 1N78A 2RAEA 3HOVJ 5B5EC 3HBLA 3LSJA 1LPQA 1K4TA 3LELC 5B66C 2IEKA 3REHA 1OCZH 1Y56A 3ZQFA 2G7UA 2ISZA 5BNXB 5EZHA 3AFAD 4GYGA 1P3PD 2IXSA 5HVQC 1P3MA 4KIFA 3I55I 2MD0A 3TU4A 4ENNA 3HL2A 4ZUXD 4U7BA 4FT8A 4KUDA 2R7TA 1Z77A 4PFPA 3BCAA 4UHTA 2KZVA 3TDUC 1KYWA 1IXCA 4PDKA 2XSDC 3REHB 1KX5B 1HSTA 1FSEA 3H0MC 5ILUA 1WJFA 3BZKA 2G0EA 3M8EA 1NG7A 3C1BD 2Z2SB 1P3GD 2JK3A 2IRFG 3TU4B 4MNUA 5B24A 2X6YA 3IP4B 4RGXA 4LITA 1RZ4A 1ZELA 3K4CA 3D1NI 4KUDB 1JTXA 2VBZA 1WZ2A 1MJBA 2F2EA 4IVNA 4EGYA 2XF6A 4C3IJ 1QRYA 3HRTA 3RIRA 4X23A 1KX4B 1O3SA 1WSUA 5FD6A 4I01A 1U6GA 3K2ZA 3CC4I 1Y0NA 1YQAA 2IJLA 2W57A 4A69C 3A6ND 5D5UB 3AZFD 1TZLA 3QOPA 1Q9CA 1XB4A 3AV1B 5H6QA 2YPRA 3GLXA 2COMA 5GSUC 5GAHJ 3ZXSA 3NQOA 1FX7A 2QF7A 3AZKA 2M1BA 1UHMA 1DPUA 5B0ZD 5CPKC 2IGMA 2IS4A 3RPUA 4X23B 3QYBA 1K4SA 1HCRA 1NG6A 3B6FD 1TZYA 1P34C 4J8UA 4WF2A 3IL2A 3F8CA 1MSEC 2HPMA 2Y0SA 1P3BC 4L5EA 3M1EA 3HGYA 2XGDA 4BXFA 3DP7A 3AZKB 3OV8A 3H35A 2L0KA 3CCQI 2M0CA 3RJPA 5E8IA 2GLOA 2STWA 3W2AA 2Y2GA 4OIPF 1TZYB 2Y31A 3C2GA 4IO9F 4J8UB 1TWCJ 3OWTA 4R79A 3JRCA 2CV2A 5KDMA 1MZBA 4KNYA 4PK4A 1SANA 3J80Z 1XS9A 2EZKA 4G91C 1NTCA 1R5ID 1IN5A 3ULQB 5LHIA 4IQJA 1OQYA 2L02A 3O8HA 2PYOC 2DMUA 3ONQA 2QQ9A 3JTGA 3Q3SA 3P9KA 3B6CA 3JCUC 4XQFA 3CJRB 2EJRA 1QA6A 5KDMB 3FMSA 4OWRB 4K2EA 1B8IA 3OYFA 1VNDA 3KLNA 5B0YA 4RGRA 4LB6B 3W99C 3WAAA 3I54A 1RUOA 1B9NA 4BDZA 1M19D 5B31B 2IP2A 1RR7A 3AZND 3OSFA 3RPQA 1U35C 2PLYA 1G59A 2K5CA 2FQ3A 2KRHA 1XGNA 4EJOA 3GEZA 1AOIC 1EQZD 3WTYC 1WRJA 1DP7P 4A6EA 5B1MA 3CCJI 2FJ7A 1MGTA 3A0HC 1IRGA 1X1BA 5B0YB 4YIFA 3AZHD 3GTMJ 4PGHA 2BVLA 4J8XC 5JLXA 4KJZA 3LFUA 4XSZF 3UTAD 3BTCA 1X1DA 1TAFB 4OIRF 4NE3A 2QUFA 5DD8A 2AHQA 1KQ9A 4I99C 2R5YA 5LHGA 3BG6A 4NC6A 3IKTA 2EFQA 5DUKA 3AG4H 1WJEA 3K4BA 4IHVA 5AV8D 5CPJC 1F9NA 5IP6A 2RGVA 3K70C 3LSKA 2FJ7B 3GTLJ 1KX3B 3FXRA 1U9NA 4P55A 3OYJA 1P3ID 2LMDA 3AZJA 4O5VA 2X1EA 2FBKA 1D3YA 2OF7A 1I6XA 2R5YB 4IX7A 4QWQA 2B9SA 2KKOA 1T95A 1PJRA 3OR2C 2HOTA 1DU0A 2DQRA 3L2UA 1X3ZB 3ASNH 3OYEA 4NQWA 4JK1X 5JRGA 3DBLB 1EA3A 1U78A 1SD4A 1LFBA 2DOEA 4HZFA 3OS2A 3BY6A 3K1NA 3KUYD 3AZED 3AZJB 2FBHA 4A3LJ 2VOPA 1QBJA 5ILSA 1Q1HA 5D4SA 4JP0A 5FLXZ 4EMSA 2ZJPF 1A5JA 3FISA 2ZY5A 4I09A 2Z5UA 5E1ZB 1G3TA 1WFXA 2W48A 3CUOA 4L18B 1G8XA 1FPQA 2MA3A 2KIMA 3WGHA 2PQ8A 4BKXA 1W7PA 2MG4A 3I3LA 3ERED 2DA4A 1D0YA 4NUBA 5GXQB 3ECHA 1B72B 3GW2A 5B2JD 4AYBN 1P3AA 2E34A 2ZXJA 4FHTA 3X1VB 1AKHA 2E2HJ 2HQAA 3E0JB 2D1HA 2AXTC 2M3AA 3H92A 5JR3A 3S15J 2QVOA 3A4CA 3B73A 2CUJA 2XAQA 4IJAA 3JRDA 4HV6A 4XUJD 1J09A 2XB0X 3DEUA 1ON2A 2LLKA 4F3QA 3JW4A 2W8SA 1HQ3A 4DRAA 4LJZF 5B1BH 1MMDA 2HTJA 4Y13A 2X6XA 1W7PB 1SVMA 4MQVA 5HS8A 1Z2CB 1U5TC 2DQNC 2HUEC 4J8VA 1JTYA 4XRSG 3I64A 2I5UA 1W36C 1LDDA 2YFWA 2JT1A 1P3AB 1BR2A 1AKHB 1JKRC 3OS0A 3T0YA 4G92B 3OOPA 5KK1A 3C3WA 5DCMA 1TC3C 4FX0A 1EF4A 2QYOA 2YR2A 2F4IA 2GIVA 2P4WA 2AXLA 2HIOD 4J8WD 2MYSA 3L7WA 3L2VA 2HWVA 3WA9D 3AV2A 3OL4A 1TP4A 3LSPA 3KWQD 3ZGKA 5JHUA 4LD9A 4J01A 2YFWB 2ID6A 1MBHA 2IA1A 2XAGA 3KXBA 5D5VB 2UWMA 4ZBJB 5DCMB 3LJAA 2P6TA 2NZDA 2H6BA 1MDMA 5CPIB 3AN2A 3IWZA 2P5KA 3FMRA 2XROA 1JKOC 1MIJA 3V9RA 3H5NA 2R7ZJ 3F8MA 3VYUB 3LSRA 2QSFX 4GCVA 1TWAJ 4LD9B 3KXBB 2HQNA 1HW1A 2PMHA 5F1RA 3CMAI 5HNHA 4L9TA 5CYVA 3OYNA 1SFUA 3QQAA 3OYGA 2PBIA 3B6GC 3GO5A 4PSWA 4HBLA 3BTIA 3PSIA 3LJAB 2NZDB 3CJTB 5KVRA 3DLLF 1MDMB 4BY7J 3AG1H 1XMKA 4AM3A 3AN2B 3FXOA 5F99D 1GVJA 3CUQC 3JAMK 5DCFA 4C3HJ 5D8KB 4GGGA 3FXQA 2OTJI 2X6WA 5HLGA 1V3FA 2X48A 5BT1D 2QBYA 2VT3A 2E71A 2JMWA 1DP3A 5AVCD 3IAS2 2DPDA 1BH9A 3X1SC 2IGNA 3AFAB 3H3VK 5CP6A 2CSOA 2WV1A 4B47A 4BJ6C 5J1RA 4LGWA 2DMTA 1JXSA 1T98A 4M73A 5B40A 3EPZA 2A05A 4TV7A 2LKXA 1UFMA 2K9QA 3GFJA 5J4YA 5M5YJ 3AL0C 1IZ1A 4ZUXB 2HYJA 2Y2ZA 4G8XA 4CSWA 4CGZA 4KFCA 2QBYB 4Z2MH 1YJNI 2A5YB 1A35A 1OMIA 4AU7A 1BI0A 1D1BA 1BH9B 4JQFA 1X3WB 1D8JA 1WGXA 2KQRA 5CPRB 2NYXA 2XV4S 4IRHA 5CP6B 2L5AA 3M7GA 2ZNYA 4JYKA 4Z66A 5AIPA 3T8RA 1WQ2A 1ETOA 2DYRH 4HPQA 2Z33A 3VYTB 3MGSD 4MEXF 5K5QA 3RYPA 5L3DA 2ACJA 2QSGX 1TBXA 4IPAA 1D8KA 5J3LA 5EEGA 1BH8B 4E45A 5E17F 4DOZA 2NRAC 1H88C 3B6FA 3PFIA 3HOZJ 4WU8C 1W5SA 2BBYA 2F5VA 3A6NB 1W1WE 3AZFB 3H36A 3P9IA 2VN2A 3LQQA 4DQ2A 4Z6YA 4Z5TA 3RELA 1JFIB 3VSKA 3HOUJ 4Z66B 3FBNB 4KGCD 4BQAA 5E5AA 3DXJF 4KMFA 2A3SA 3E97A 2PG4A 3S3OA 3AZEC 3CMMA 1WH5A 2M8GX 3JRIA 3GCMA 5J1UA 4KT5C 2VXDA 5B0ZB 1ETXA 1W4MA 3C18A 4CCMA 3MNNA 2B0LA 5L3CA 5D5XB 2LBFB 5F6FA 5B1LA 3B6FB 1Y8QB 4S04A 4G7ZF 2HQ5A 1FT9A 1V5EA 3HYIA 4Z5TB 2L4AA 2DFFA 3RELB 2QWWA 1Z7LA 5IYDJ 4WNNA 2F2AC 4Y17A 2HOAA 3RDIA 2ID3A 3MZYA 3UT9D 5E5AB 5K7HA 3V42A 5L3GA 2PMUA 2R7RA 5F1JA 4DGWB 1LJ9A 4JX6A 4NNJA 1S32A 3REHD 4A3GJ 2DMPA 1APLC 1K79A 3LOCA 5FD5A 2FF4A 1P3MD 2KJBA 3O8GA 3X1TD 4C2MJ 1DGWY 1I3QJ 2FUG2 2R0QC 2NVXJ 1BJZA 3H0DA 4KUDD 4A3MJ 1BI1A 3ZMTA 2X4HA 1U2WA 3TO9A 4KITB 2JA7J 5AV9A 3W97C 5CVRA 1SFXA 1SFOJ 1S32B 3AKZA 2BYKB 4CZCA 1S7OA 2K27A 3REJC 2G5IC 4YFNF 3FF5A 1R22A 1HOMA 2Y2MA 3HM5A 2GXAA 3CP2A 1LDJA 3F22A 2A6TA 3J7AO 4R8PC 4J8WC 1F66C 5B24D 5EGOB 3MZHA 3PQJA 3WA9C 2BG1A 3W96A 2OV7A 2NVQJ 1QU3A 3KWQC 3C1CC 1GHCA 1ID3C 2DODA 1M19B 4X23D 3OYDA 2NXNB 3OIOA 3R0JA 4XRSA 1QPMA 3LA3A 4X0GA 3AZNB 1IV6A 2QZ8A 3HOSA 3L2RA 2MABA 2FOWA 2HDDA 1QZEA 2DOAA 3I59B 3BTLA 2CV0A 1LE8A 1EQZB 4B48A 1WI3A 2QQ8A 4UVCA 2J5PA 4ETSA 1HKSA 1MBFA 3LAJA 2NNNA 4L9VA 4WU9A 4HQEA 2G5HC 1RPWA 3AZHB 5E8GA 3SZTA 3AZKD 3UR3C 2E19A 4UVBA 1JHFA 2O5RA 3R4KA 3RPUD 3ZMZA 1R1UA 2DA5A 3K6GA 1ZRCA 4HG2A 2FA5A 2Q2EB 5GTHC 1TZYD 2E2JJ 1JJ6C 4J8UD 2WY7Q 4H9SC 4MO7A 5D6FA 2H6CA 2PX9A 3W6JB 3AZLC 2ME0A 5AV8B 1ZG1A 2LD5A 3K1PA 3NEUA 3LSGA 1Q1VA 1XGMA 3REIC 2PI0A 1IN6A 5AONA 1FWZA 3KUYA 3FHZA 1P3IB 2NOGA 4A5NA 5ICEA 1BR1A 2ZY4A 2F4OB 2E1MC 5CVIA 1T56A 1ZRFA 3DEEA 3E5XA 5CHLB 2W00A 2JVGA 1XGOA 4BE1A 2VB6A 2ZFUA 4A0ZA 5JLWA 2R92J 3VH6W 5BMZA 4ZZDA 4UVAA 4RMNA 3ZN1A 2PMZN 3J7ZI 3SJMA 3DKXA 3WHCA 3ZQGA 1F1ZA 5B33C 3CCMI 1TQMA 4ZDOA 5TGTA 2AQEA 1YS6A 1HQCA 2BE5F 1G3WA 1R36A 3B02A 2A5WA 2PEXA 2R7FA 3BG3A 4BHCA 3IV5A 1TLHB 1YOVB 3KUYB 2NQBC 3O62A 4XLAA 2KPMA 2Z9OA 1EH8A 2ZKZA 3KP5A 5K7ZA 2O3FA 2P81A 3K7AJ 4R1HA 1M18A 1QPIA 2YFVA 5ICGA 4M9SA 5B0YD 3MVPA 2VJ5A 3MGSC 2A6EF 2F5EA 1TQPA 4H4KC 1ZHFA 4WV4B 3K0LA 2RVCA 3IRRA 1F5TA 4KHAA 3MVDC 4YIRX 1D1CA 3FDYA 3O62B 2EZHA 5B2JB 1YO5C 1E3PA 2CWEA 3I5UA 2RKHA 1S72I 1KYZA 5B1MD 1SMTA 3OYAA 2H8RA 1MMGA 3KYLA 1SAXA 2YFVB 4XUJB 1VQKI 2M0MA 3CCUI 3HPGA 1FOKA 2DFIA 4F92B 4BJTA 4E7IA 2GXGA 3LSIA 4ESFA 4ZZLA 4N9IA 4QSHA 3REOA 4KHAB 2HFHA 3EUAA 2VJJA 4BL0B 5C3IB 1MMNA 2PMZA 1ETWA 3AYWA 4LK0F 5AY8A 3H5AA 1VTNC 2Y2PA 3W6KB 3LZ1C 2KMUA 4IF4A 2C6YA 1YX5A 3K69A 3T1BA 1V4RA 5ILVA 1VQPI 3AZJD 3T8TA 1DUXC 2GA2A 2O8XA 4AIDA 3GFMA 5L3BA 1IW7F 2BY0A 3T5XA 1KX5C 3A2KA 2JCHA 1GXQA 4CICA 2W7NA 2L7KA 4ENJA 3NWTA 3S16J 5AY8B 5AVBA 4CDGA 2ME6A 1WJ5A 2XIGA 2F6CA 2R7OA 3EDPA 3CCVI 5JRGD 1UHWA 1YJ9I 5F64A 2DCEA 2HGCA 4P9UA 3B0DC 3TU4C 2DFHA 2GXBA 2PFBA 3IP4C 4J19A 2DK5A 5F99A 3VDXA 3QU3A 5FFXA 2Q0OA 4KUDC 1ZLJA 4OOIA 2R7DA 2LK2A 4G9YA 2V26A 1HLVA 2CFOA 3ZQCA 5FLVA 1KX4C 2MH9A 4XLEA 5EJCA 1XSVA 3OOUA 3GTOJ 5AVBB 2H8WA 5AV6A 1J7KA 3AV1C 1WI9A 3GF2A 4WXDA 5F0HA 5F99B 1W7PD 5B32C 2BY2A 2AQFA 3K4NA 5DM6F 5GADJ 5GAEJ 4MFEA 4XORA 1P3AD 1LKXA 3CD6I 1AA7A 4CCJA 4WCGA 3CCLI 5M5XJ 3VWBA 4I76A 5AVCB 3EPHA 2ETHA 1MNEA 1FIAA 5AV6B 3BQZA 5GT3C 1BM9A 4BEHB 4WZSB 5E79C 4UNOA 2KP6A 1HQ3D 2CV5A 1IUYA 1CQTA 5D8LB 1O7LA 2DYSH 2IBDA 2ZMEA 4J8VD 3AZKC 3MGRA 2QENA 1ZGWA 1A31A 1POGA 3CP8A 4IKFA 1F43A 4EO5B 3KYCB 1LNWA 2DLLA 2M2EA 2XGEA 2KIQA 5JI6A 4J8UC 5GT0A 3M07A 1FP2A 1Z1DA 4EVIA 4N0BA 5IOZA 3DF8A 1YS7A 2V9VA 4XSXF 4XLNF 2EB7A 2CV5B 1HKTA 3AV2D 2PN6A 3I4NJ 2JVHA 2ZMEB 2CQQA 1G2HA 1I27A 2G7HA 2HR3A 2OBPA 2HQRA 4E70A 1BL0A 3W2WA 4RAFA 3WE3A 3J81K 2FFFB 2RVQC 3KXBD 1GLNA 1YJWI 3WTPA 3DTEA 1N1JA 3AZGA 4UY8I 1IXRC 4ZTJA 5GT0B 2JUCA 4HV5A 1WWIA 3LJAD 2NZDD 3AN2D 4FETA 2KRCA 1ZRDA 4UV8A 1R7JA 1JKPC 4W97A 4EM0B 3JRFA 4L0YB 1GDTA 3JSPA 1K83J 4FE4A 4KICA 4PJJA 3UT9A 3AZMC 4I7HA 2VLAA 5B31C 4HX4A 1USTA 2AROA 5F0CA 2ZY2A 3WGIA 2Y30A 3WTPB 2L9SA 4OU0A 4H9OA 4RM2A 3AZIA 4M6XA 5EG0B 2OUMA 3ZN0A 3WGGA 1YFHA 3X1TA 1Z91A 4LG0A 3FHNA 2VQCA 1YITI 5B0YC 3E6MA 3FXUA 4NE6A 2VBWA 3CDLA 3UT9B 3EPLA 2K3PA 2JSSA 2IGKA 3BQYA 4CUGA 2NVUB 3NQJA 1FMWA 1TWHJ 5LD2C 4H9QA 2NS0A 5FB2A 4N4NB 3SDGA 3MGQC 2GAUA 1Y1VJ 2WTEA 3PM1A 3AZIB 3Q9VA 1RNLA 3CCYA 4ANJA 2XC7A 5H2FC 3I9V2 5CP6D 1P3MB 2PJRA 9ANTA 1Z6TA 2FJ7C 4UUTA 3PO3J 5B40D 3X1TB 1BN5A 2LOOA 1KX3C 2LF7A 1OJLA 2DOFA 2L01A 3QYFA 4DBRA 3H0RC 3ASOH 2IO5B 1LEAA 1RC9A 3LZ0A 3I71A 3HOTA 4F7ZA 2VI6A 1NK3P 2PJRB 5K5RA 4XIDA 3A01A 4GDFA 5FRNA 4Z66D 1L0OC 3G4SI 3DU6A 3HRUA 5B24B 4C2TA 1YW9A 2RDPA 1S7EA 1IO2A 1FY7A 4XLHA 1RRJA 2CFXA 2E5NA 2XKPA 3LQRA 2JA5J 2F48A 3HRSA 4L9NA 4YELA 3LAPA 4HDUA 2HKOA 4EV0A 1W5TA 4QLCA 4XKCA 4G94A 4Z5TD 3TW6A 1K78A 3CQZJ 4FE7A 4DYCA 2LP0A 3RELD 3MGPD 3AFHA 3ZOBA 1FZPB 3BR1A 5E5AD 1P3LA 3ZR8X 2EV0A 3W98A 2W82A
chains in the Genus database with same CATH topology
5GXQC 1G6NA 3GZ5A 5G49A 1LEBA 2P5LC 3MNND 2MLKA 3X1VC 5B1LD 3DPTA 4YM6A 4QLCB 2EA2A 4O3MA 3REKA 1IN7A 3KEQA 5A2QZ 3R60A 5E18F 1I1SA 4E44A 5BNVA 4YS3A 3W98B 1OYYA 3V8KA 1O57A 2YX7A 5J8CA 1S32D 1P3AC 5DNMA 3K9TA 4G92C 1P4AA 3REKB 2A69F 1ZLAC 3WTTC 2Y48A 4YS3B 1P3FC 4G6QA 5AV9D 3QPHA 4H9RA 4Y15A 3F3XA 4ZBJC 3LELA 4ON0A 3BZ6A 2VT2A 3WG9A 3GVAA 5CPIC 2FMLA 2HS5A 1H3OA 2HEOA 1B6AA 3W96D 4A0XA 1J75A 4P9FA 4H9RB 4LD9C 1B67A 3KXBC 1H9TA 4AWLB 3U2RA 4R8HA 5CVVA 3LJAC 4IHSA 4CXFA 1R4VA 5B1MB 4H9PA 3AN2C 2R3SA 4WU9D 1S6LA 4GYIA 4HF2A 1P2FA 4M6BA 1FBUA 4RB2C 4N9HA 1XSDA 5HOOA 1SD6A 3AAFA 4O6JA 1LQ1A 1P3PC 3AFAC 3QU6A 2EA4A 4KIGA 2BEOA 4I0BA 1ZGJA 2V1DA 3B0CW 2CQKA 1ODDA 4ZUXC 4H0EA 1L3LA 4L9JA 4KN4X 3ROUA 4CO8A 1MD0A 1IRFA 4DQYB 5CPKA 1UCRA 3C1BC 3G73A 2V79A 1P3GC 1KGSA 5JRGB 3TOBA 1QO0D 1P3BA 2VE8A 5LEJA 3O62D 4HQMA 5L3FA 1MKMA 1QNTA 3BJOA 2WWYA 3WTPE 5E20A 1TTYA 4HLYA 3AZFC 3GFLA 2XD5A 3A6NC 1M18D 2IVMA 3KP4A 4CHUA 4KYWA 4HA8A 1YYVA 3CLOA 4BYYA 3DPLC 2DW4A 5J6XA 4UUZA 2QLZA 3JAMZ 5B0ZC 1KA8A 3TOAA 3B6FC 2L3DA 3WU1B 2PYOA 4Z5TC 3RELC 1SD5A 2V6CA 2FSWA 4IXAA 1KU7A 3B0BA 2H27A 5TJJA 5E5AC 2GWRA 1HQ3B 5HLHA 4J8VB 3GWZA 2E7WA 4U0YA 5IT9K 3AYWD 5AY8D 5J8FA 4ZYGA 1BBYA 2MH2A 1X3UA 1Y0UA 3AV2B 3VH5T 1S32C 1U3EM 4J8XA 4HGAB 2CO5A 1R00A 5AVBD 4HF1A 1TW2A 4RS8A 5E1WA 4FX4A 3EUHA 1FBSA 5CPJA 2ZFWA 3V9RB 5AV5A 4XBFA 1M19C 1P3KA 1E2XA 3AZNC 1K7AA 1EQZC 3HRMA 2GA1A 5AV6D 3GYHX 2Y2NA 2DU9A 5AV5B 3AZHC 4LMYA 3UTAC 1P3KB 3HTUA 5DV5A 2H09A 2O03A 5AV8C 2LSOA 4KN7X 5B40B 2CV5D 1CF7A 3MGRD 4WK8F 1P3IC 3CTAA 5GT0D 1BI2A 5BPIA 4MQ9F 4GXOA 3WE2A 3MGPA 3HSFA 1S3JA 2WC2A 2RQPA 2RNJA 3PQKA 3KUYC 3CO7C 3WTPD 1FYKA 3AZGD 1U5TA 2CW0F 4L5JA 1KU9A 5LLQA 3MGPB 1YG2A 1PUEE 1T39A 2AROD 3O62C 5B2JC 3MNNB 2EV6A 4A6DA 5B1LB 2GQQA 3AZID 2ZM5A 4Q5SF 1Z05A 2Z3YA 1XGSA 4XUJC 4WNNB 3TO7A 1R1TA 3ABTA 1A7WA 5DNNA 3UTBA 1TW3A 5BS7C 2DT5A 5C3IC 3FM3A 5JFRA 2F8NG 3HHGA 1PP8F 2HIOC 4KA4A 1IN4A 1ZREA 3B6GA 2LF8A 5DNNB 3ZMVA 1ZN2A 1J9IA 3UTBB 4AIKA 5AV9B 2Y75A 2WV0A 4CZZA 3LZ0D 1XCBA 4YFXF 4WXCA 3H3UA 4YIIA 4EM1A 1M1AA 5LRRA 2VE9A 1Z6RA 1K6OA 5H6RA 1UB9A 3X1SA 1MJ9A 3W96B 3TGNA 3ELKA 3P9CA 1J0RA 2LKPA 4QLCD 3ZPLA 3VH6A 5AVBC 3ABUA 4U7DA 5LGNA 3H3ZA 2M5WA 1M1AB 3LWFA 4L5IA 2AS5F 4WU9B 1P3LD 2W84A 5F99C 3W98D 2H94A 1H0MA 3CJNA 3U9GA 1HTAA 2XAFA 3BJAA 3Q9SA 3CO6C 5BT1C 4YM6D 4UUVA 2FOKA 3V8JA 5AVCC 3REKD 3RKWA 5BPDA 1SMYF 5AV6C 2HKXA 2RC4A 4ZYDA 4YS3D 1USSA 1R5GA 4HF0A 4EO5C 5DNMD 3COAC 3X1UD 3LFKA 2VQRA 2F5FA 1EH7A 3S2WA 3BWGA 3VODA 4LD5A 1S8NA 4ASNA 2CV5C 4MHGA 3O3KA 3R61A 2Y2OA 3MGRC 2ZNZA 3N97A 5ED4A 3LELD 2ESHA 1FYMA 3I4PA 4U0WA 5GT0C 2P5VA 2XUBA 4KMUX 1M18B 2K86A 2VOOA 3LA2A 1ZLKA 2FE3A 4KGCC 4WXHA 1HW5A 5B32G 1G3SA 3WTPC 2IPQX 4NB5A 1E17A 3KFUG 1XCVA 3W97A 2QQBA 2HOEA 2VBXA 3REJA 3VOEA 3UT9C 1FC3A 4R8PA 3ML6A 4HAMA 1F66A 4XLPF 2VBYA 4IRIA 5B2IA 2P6SA 2K4BA 2KIFA 2JPBA 3JTHA 2JE5A 3REHC 3C1CA 1Z9CA 1ID3A 4MTEA 1KU5A 1T3UA 3R0AA 3AYWB 3TQNA 1P3MC 1J2X