1ULYA

Crystal structure analysis of the arsr homologue dna-binding protein from p. horikoshii ot3
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
190
structure length
190
Chain Sequence
AKKVKVITDPEVIKVMLEDTRRKILKLLRNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEMKGNLVEKYYGRTADVFYINLYLGDEELRYIARSRLKTKIDIFKRLGYQFEENELLNIMDRMSQKEFDATVRISKYIEEKEDALKDFSNEDIIHAIEWLSTAELARDEEYLELLKRLGSILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the PH1932 protein, a unique archaeal ArsR type winged-HTH transcription factor from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Dna binding protein
molecule keywords hypothetical protein PH1932
total genus 70
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2003-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ulyA01
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1ulyA02
4E70A 1T2KA 5B31B 1B6WA 2LDUA 2VBXA 3TQNA 3B6FA 3AYWD 2QM3A 5B0YC 1LVAA 5CP6A 3T8RA 3MAJA 2VXZA 3EYIA 3R0JA 1BI0A 4XRFA 3W98B 1R7JA 3MNND 3V7CA 2HQNA 5BT1D 2XAQA 5B24D 2P7VB 3MGPD 2ZKZA 1I1GA 4IRHA 3FMSA 4O6JA 5AV5B 4R8PB 3B6GD 4I7HA 5FFZA 1YO5C 4A2UA 1KX3B 2JSCA 4F7ZA 1AOYA 3HRUA 2WWYA 1P3AD 5EEHA 5AVBA 3WTUC 1G4DA 3W96A 3L7WA 1E2XA 2MBFA 3AZEA 2R7FA 3REJC 4DNCA 2NZDD 1E17A 1P3FA 4KMFA 3HOTA 5DNNA 4X23B 2CYYA 3WGGA 3CUQC 1IXRC 3I64A 1REPC 2CGPA 2DAOA 2O61A 4WU8A 4YS3B 4UVAA 1TZYD 4M6XA 3F8FA 1J59A 2ZMEB 4LFUA 4WU9A 5CPJA 3REIB 1P34B 3AZMB 4L0ZB 4QWQA 3UTAB 3DKWA 4G92B 5HOOA 5B33B 4A5MA 1YLFA 3W96B 1WQ2A 3RELA 3REJD 5D4SA 3WU0A 3Q9SA 3HSEA 2PN6A 3ZPLA 3W96D 2GAUA 3NQUA 4IRIA 1P2FA 3AZMD 1P3AC 4KN7X 3REID 2NZDA 4J8UB 2F5DA 2ZFWA 3R4KA 5BNXA 3AFAA 3LA3A 3A6NA 3P9KA 3W98C 1WWIA 1Q1HA 2OZ6A 2BBYA 5JA4A 4EO5C 3AAFA 3BOQA 3C1CA 1U8RA 3R0AA 5HS7A 3MGQA 4OU0A 3ISPA 3O2PE 3MNNC 1MJBA 5G49A 2AROD 4XUJA 3WE3A 3AFAC 3RIRA 1BI2A 2YFVB 1P3ID 3B6FC 1P3OC 3WG9A 4IXAA 4UUZB 2CQKA 2IA0A 2H27A 1QZYA 5GT0A 3BP8A 2B0LA 2QBYB 4X23C 2HZTA 3HSFA 2ZJ2A 1I5ZA 3L2CA 1WKMA 2K27A 1HKQA 3I0TA 4HZFA 2V1XA 3REKB 4H9QA 4EJWA 5CPKD 3O3KA 3TU4B 2IA1A 3AZID 2IO5C 4IJAA 5DD4A 4HYEA 3REIC 1FSHA 3UTBC 1P34C 3O62C 3W97C 5HLIA 4JJNA 3B6GA 4UNOA 3IRQA 1ZREA 3GFJA 5EEGA 3KFWX 4YM6A 4R1HA 4GYGA 1TQMA 3F8NA 2FJ7B 4ESJA 3AZHC 2JPCA 2A5YB 4A5NA 1AWCA 2HOEA 3C3WA 2X4HA 4UUVA 5B2IB 3E6MA 1YS6A 3AZED 1USTA 1MZBA 1HKSA 2GXGA 3LFKA 2DO7A 1UCRA 3REKA 1R22A 1F4KA 5DCFA 2O3FA 3U1DA 4GYIA 3M8FA 4NE6A 1EQZD 2ISYA 1YTYA 3LZ0B 1VTNC 2PJPA 5LGTA 3AV1B 1H3OB 5J6XA 5ERIA 5B0YA 3GFLA 2R3SA 3ABTA 4G91C 5F1RA 3W6KB 4AVPA 3JAMK 4BHCA 3SZTA 2F8NK 4BH9A 1K78A 3Q9VA 3TU4D 5AV5A 3C18A 4H9SA 4CYDA 4RGSA 4UV9A 5HS8A 1P3OA 3ZN1A 4AIJA 5BPIA 2RVQC 2L02A 2H09A 3AN2A 3E6CC 5CJ9A 4ZZDA 2BV6A 5ICGA 4N9HA 1M18D 5GXQB 5GT3B 5AV6A 1F66B 2ZNYA 3BROA 1D8JA 2VOOA 1P3IB 4U0WA 3V4GA 1HQCA 1Z05A 1IRGA 1J75A 3EETA 3CDHA 3AZIC 2KIFA 2AROB 5DNNB 4L5IA 3V8KA 2P4WA 3WA9A 3SQNA 5AV6C 5AV9D 5D5XB 1LDJA 3TU4A 1Q9CA 4R8HA 1R1UA 2PMUA 3C7JA 3F8MA 1O57A 2BYKB 2ZO4A 1BH8A 4G6DA 2F8NH 1WI9A 1P3GC 5CP6C 5FLXZ 2DBBA 2IA2A 1JFIA 1XCBA 4WXHA 3REHD 2WC2A 3VH6T 1KYWA 3AZGC 3REJB 4RGUA 2NNYA 5B33D 5LHGA 2FU4A 4RGXA 3N4MA 3KWQC 3CUQB 2FE3A 1ZRDA 1V4RA 4CO8A 5FLXK 1MDMA 3HYIA 1DUXC 4AD9A 3MEXA 3LA2A 3I59A 4LLGF 3HRSA 1ZAOA 4LD9B 3KZZA 5CVRA 2W57A 2DT5A 1L0OC 3LZ0A 5BQTA 1HXDA 1KQ0A 4ZH4F 3WTPB 1KQ8A 3KP4A 5HLGA 1F9NA 4Z66A 1AOIA 3SZPA 1SMTA 1P3MD 4XSZF 1SD6A 5AY8C 1P3GA 3G73A 4LMYA 5D6FA 4BAYA 1HW1A 1ZARA 1ZLAB 1TZYA 3MZYA 3AZGA 3SHFA 5KK1A 3TDZC 3C1BD 1T6SA 3LELB 4A6EA 2CV5B 1S6LA 1ZLKA 5F6FA 1KX3D 4CDGA 2A6HF 2QQBA 2EV5A 3AZNA 4UVBA 5ICCA 1TZYC 1W5SA 1H9TA 3MGPB 1KX5B 3QAHA 2P7CB 3T5XA 2V1DA 3K69A 4UVCA 3BY6A 5LHIA 4BHBA 2KJCA 3KXBC 5IT9Z 3T8TA 2NRAC 4EM0B 3LZ1A 3ABUA 2NZDC 1IN8A 3NRVA 3AZNC 2FQ3A 1EV7A 3V7SA 4CAYA 5HVQC 2P8TA 4RGRA 4ZUXA 3W98A 3F3XA 5B31D 1HTAA 1P3FC 3GF2A 4KMUX 3AN2B 3X1TC 3DFGA 3E6BA 2IW5A 5B40B 2HIOD 1G3WA 2XGXA 2OQRA 1ULYA 5GT3A 5GXQA 2XUBA 2CG4A 3V8LA 4KHAB 3T1BA 1W7PB 2E7WA 1M1AD 2QLZA 5B24C 3IKTA 3DF8A 4Y15A 5B32G 5ICFA 2HUEB 3KUYB 3LWFA 5B0ZB 5F64A 4NHJA 1XN7A 4I0AA 5GT0B 1U5TA 4N0BA 3K0LA 4H9PB 4OIRF 5AV9A 1S32D 3WTPC 2MH2A 3I71A 1HQ3C 3AZJC 2F5CA 1J2XA 5D8KB 3HOSA 1WRJA 1F5TA 3MGSC 4MNUA 3KP2A 2DTRA 4CSRB 3EYYA 2DU9A 3X1SB 3VEPA 1T39A 3AV2D 1BI3A 2FRHA 1ZLAC 4A6DA 3MZHA 4QLCD 4XZQD 4CGZA 4EM2A 1S8NA 1K78B 4RB3C 3AZJA 2FNAA 3HUGA 5CYVA 3RELB 3K9TA 2O0YA 3QU6A 4JJNC 1QQIA 2XAJA 4Z5TB 5CPJD 4WU9D 4JJND 2Z3YA 4A0YA 1SFXA 1CF7A 5CPIA 1D5VA 1JE8A 1IAWA 4KDPA 5B32D 1R36A 1T38A 4XZQC 3AZFA 1IUYA 4I98B 5LGUA 2F5FA 1FYKA 4PGHA 3AV2C 5F99B 2QUFA 1XGOA 2P5VA 4Z2MG 1KU5A 2QENA 3TDUC 1P3FB 5E20A 1B9MA 2EK5A 4X23A 3ZMSA 3A6ND 5B40C 2YU3A 4MEYF 4EJTA 4GGGA 2NS0A 3V9RB 4ZYHA 5F99A 1U35B 1YFHA 3F23A 4HLYA 3KSYA 3KXBA 1FPQA 3C1CC 3HHGA 1K7AA 2MD5A 1L3LA 1IF1A 4AWLC 1EH8A 4LK0F 5GXQC 5GT3C 5AONA 5GT0C 3GWZA 5IT9K 4LK1F 4OIOF 2HS5A 2EA4A 3WGIA 1HQ3B 5DDGA 4EJOA 5AV8B 3X1UB 3B0CW 1FT9A 1IXCA 2D1HA 4JK1X 5BO0A 5E5AB 3AZHA 1U5TC 5ILVA 4HGAC 5AV6B 1F66A 1JHFA 5HDKA 1OYIA 1FLIA 4HDUA 4ETSA 1OYWA 1DDNA 5BMZA 1ID3D 5H6RA 1MGTA 5JA4B 1P3GB 2VC1A 2MLGA 2Y0MA 1XGNA 3LA7A 1IN5A 1FBSA 2D1VA 4Z5TC 2NQBC 3X1VB 1ZRCA 3VH6A 3WKJD 3X1SA 4A12A 2RV8A 4M6BA 2EV0A 1A04A 4ENKA 4RAYA 2XAFA 5KDMB 1P34A 3ZMZA 1IXSB 1MJ9A 2EFPA 4AWXB 3J80Z 4M9SA 3GZ5A 2PYOC 5FD6A 4J8XC 1KU9A 2LF7A 4M72A 4HA8A 4HLXA 3L00A 1P3MC 3REHA 1TBXA 4EJVA 4J8VB 4M9ZA 3DEUA 1U35C 1KU3A 3WE2A 1EH6A 1GVJA 2P6TA 4WZSB 3OV8A 1R5HA 5B1LB 3MGQD 1G3SA 3CUOA 4GO1A 4J8WA 3WTXC 2ZMEA 1MD0A 2GQQA 4CAYB 5BS6A 2IVMA 1UHMA 2A68F 4S05A 2XHKA 5B32C 3LELC 1RUOA 4G7ZF 3J81K 5CHLB 3KP6A 3BZ6A 2L5AA 3IWZA 3X1UC 1M19C 1FSEA 1PP7U 1KX4C 1NHAA 2XIGA 4N9IA 2DFIA 3X1VD 3AZFD 2XAGA 3MFKA 1ZG3A 3GFMA 3GFIA 1YS7A 1P3GD 5DUKA 2QBYA 1I1SA 5JRGB 1O7FA 1GXQA 1JXSA 2L01A 4RB0A 2F5EA 2PFBA 2L4MA 2DI3A 4MHGA 4U7BA 2EWNA 3ERED 2MC3A 5AV9C 2RNJA 2OBPA 5AV6D 5F99D 3WTPA 4J8XD 5LRRA 4G94A 1PUEE 2FEZA 1R1TA 3E6DA 5AV8D 2KRFA 3HRMA 3X1TB 4XUJB 3ZQ7A 1FOKA 2CFXA 3U9GA 4WNNB 3WA9D 2TDXA 2ZBKA 3P9CA 3B0BA 4MTEA 4KICA 5K5RA 2KJBA 3RELD 1M19A 5A2QZ 2K4BA 1U2WA 1FC3A 1TQIA 2RKHA 3R60A 3EDPA 3K1NA 4ASNA 2W84A 5JRGA 3VFZA 2ELHA 2HQRA 2NAZA 4Z66C 1AOIC 2OQGA 2XKOA 5CPIC 4HF2A 2H6BA 4LB6B 1FWZA 1YW9A 5K5OA 1HW2A 1S7OA 2HFHA 4NQWA 2XVCA 3TO7A 4YFKF 4H9NA 1S32B 4NB5A 3VH5A 5D6EA 1R5GA 4KGCC 1FP2A 3I54A 3WKJA 4UXNA 3V7RA 5B0ZD 5B1LA 4KIGA 4J8WC 3RELC 4H9NB 1S32A 3IKVA 1M1AB 1KA8A 4JJNB 2E7XA 1JHHA 3MQ0A 3MGSA 2OD5A 2RN7A 1DP7P 4KIFA 4PZJA 2RDPA 1ON1A 1W7PA 3F8CA 4XLPF 1ZGAA 4YFNF 5L3BA 5TRDA 2DLLA 1FY7A 1P3PB 1S3JA 3WA9C 3HRTA 5B40D 1ZLAA 2LNBA 2AXLA 1KX4A 2GA2A 2DQRA 3AN2D 2DK5A 4XZQB 3AZLA 4Y13A 5JR3A 5AVBB 3HTUA 2J5OA 1XSDA 1UFMA 1XMAA 1GHCA 3LELA 2O6GE 2E1NA 5AY8D 4I0BA 5HDNA 5L3DA 2LY8A 3RTRA 4U7DA 2HYGD 4M74A 2O8XA 1I6XA 2STTA 3F6OA 4H9OA 1KX5D 3PQKA 2RC4A 1P3LB 3WAAB 5ILUA 3AZFC 2BYMA 3C1CB 5AVCA 2IJLA 3RKWA 1IN4A 2JPBA 1W7PD 2P5KA 5BS7A 3C1BB 1P3LA 4OMZA 2G7UA 3LZ1C 2VE8A 3D0SA 1Z91A 4Z66B 1AOIB 1ZLAD 1UB9A 3W99B 4I01A 3I4PA 1JFIB 1O7LA 3EUHA 3UTBA 3AZLD 4YG2F 1U3EM 4G9YA 2YPRA 2YX4A 4U88A 3RDIA 2HWVA 3WTPD 5J8FA 2XROA 1FX7A 4LD9D 5AV8A 1B1BA 4H9PA 4XBFA 3FMRA 4EMSA 5FD5A 1OKRA 3LQQA 2JRTA 5FGMA 1HSTA 5DUIA 3J7AO 3HIFA 5GSUB 1XD7A 1M1AC 2A61A 4P9UA 5TJJA 2NQBB 5D8LB 2XKPA 3H3UA 1TW3A 3ECHA 1P3PC 4EJUA 2M8EA 2CV5D 2IP2A 3AV2A 5B31C 2BYKA 1FYMA 1IZ1A 3L09A 4QLCA 4KUDB 4WK8F 1PP8F 4ZYDA 2MLKA 4CHUA 2KKOA 2CW0F 3MNNA 5FUGA 5AIQA 4FT8A 3MGPA 1KX3A 4KFCA 5AIPA 3RPQA 1O3SA 2UXXA 4DQ2A 3WAAC 1SD7A 4RAZA 1FNNA 1IW7F 3I59B 1SAXA 1EH7A 1XB4A 2QZ8A 3DPTA 4HW0A 4LB5A 2UXNA 1FP1D 4OIPF 1KX3C 5E1WA 4I2OA 3IL2A 4NE3A 3AFAB 2DPUA 2LSOA 1WSUA 3WAAA 3COAC 2C6YA 1OYYA 1M18B 4ZUXD 3B6FB 1P3OB 3BPVA 4GXOA 5LEKA 1M19B 5B31A 4R79A 5L3GA 2FXAA 3QPHA 2F8NG 4DRAA 5DNMA 5B2IA 2PMHA 1YW8A 3WTVC 1H0MA 4YS3C 1HW5A 3AZEC 3L9FA 4CXFA 3KUYA 3A6NC 2VBZA 3LAJA 3B6GC 3FZVA 4LG0B 2K02A 4U0VA 5CVIA 5AV9B 5E5AA 4HX8A 4MGRA 2A69F 5ILSA 3ZMDA 3K2ZA 1KX5A 4YM6D 3X1UA 5B1MB 2Y48A 3CO7C 3BJ6A 3J80K 3LZ0D 1YQAA 1WWXA 1EQZB 3PQJA 2V1UA 2NNNA 4L9NA 3ZP5A 1D8KA 2JT1A 3O62B 1R1VA 1F66D 3W97B 1J5YA 4YIFA 4WU9C 5CPJC 3LJAB 1B9NA 4ON0A 4CICA 1R23A 2BEOA 5B2JD 2Y75A 5FB2A 1P4AA 5D5WB 5CP6D 2W25A 3QP6A 3O6BB 2CWEA 2LKPA 2FJ7C 2NQBA 2H6CA 2G7HA 2XASA 4ESBA 5DNMD 5B2ID 5H6QA 3AZKB 5B2IC 4LGWA 1BM9A 5CPIB 4H9RA 4OOIA 3JSPA 2ADUA 4D0PA 1X3UA 4IVNA 4NE5A 4JBAA 5B32A 5K5QA 5GSUA 4MQ9F 4L18B 3LZ0C 1B67A 3AV1C 1O3RA 4KNYA 1KU2A 4ENMA 2JSSA 5CPKB 3GO5A 3SFZA 4YM6C 2CV5A 1F1ZA 1T98A 2HYFA 2VE9A 4ENNA 4LLNA 2OU2A 4M9XA 5B2JA 2RVQD 4RB1A 1BI1A 4CSRA 3AZKD 5AVCC 4WXCA 2HIOA 1MKMA 1ZHFA 3M9AA 5HLHA 3AZEB 1QBJA 3ZMUA 3W99A 3REKC 3AZMC 5B2JB 3LJAD 5LEJA 4UUZA 2PG4A 2IO5B 3W96C 3JW4A 2EFWA 1CF7B 1S29A 4ZUXC 5JFRA 5B1MC 5KDMA 4R8PA 3ECOA 4WCGA 5B1MD 2VODA 3REOA 2GXBA 3E5QA 4A0ZA 3RKXA 1Z9CA 2COMA 3AZIB 1LEAA 3REIA 4P9FA 2JTVA 3B73A 4HDVA 5AV5C 4R8PC 2D2WA 3REKD 1BFMA 5ED4A 3BWGA 1TTYA 1BC8C 4M73A 4EVIA 3C1BC 1J9IA 4YIIA 4HAMA 5IT3A 5FFXA 4B8XA 1Y0UA 3W99C 3JAMZ 5B24A 4L9VA 2Z33A 2ESHA 3LJAA 5KVRA 1V3FA 3WGHA 4RS8A 2MA3A 1RUNA 3NEUA 1P34D 2GIVA 3JTGA 3WTPE 3VOEA 1YIOA 4NFTA 1KU7A 4HX4A 3KWQB 2RQPA 3VODA 3HTSB 1QPMA 4WWCA 5E18F 5CPKC 4FX0A 4KYWA 4BXUA 3B02A 1XDUA 5GSUC 3KLNA 3T0YA 4KN4X 1LJ9A 4X23D 3KWQD 1G3YA 4G92C 5B33C 2YR2A 2VBWA 4J8UD 5CPKA 4H9SC 3AYWC 3H3ZA 5B2JC 4LD5A 2EFQA 4FHTA 1P3AB 1G6NA 4LLLA 3WTYC 1P3IC 3IC7A 5LLQA 3UTAD 1R4VA 4EGZA 2AROC 1ON2A 1ZGJA 5DNMC 4LG0A 2FBHA 5D5UB 4KHAA 3R45B 5GSUD 1S7AA 2YX7A 2PLYA 2ACJA 3E97A 3CJNA 3MNNB 4S04A 4G7HF 5E8IA 3W98D 3AZMA 2P6SA 5BS7C 3KETA 1TZYB 2HDCA 4JQFA 4BHPA 2M30A 4YS3D 4G8XA 3EQLF 1XGMA 4Q47A 2VONA 2KIMA 5B33A 5AY8A 1QGPA 2NZDB 2PI0A 5DD8A 4G91B 2QQAA 4LJZF 3F72A 2L54A 3IHUA 3W99D 1ZLJA 2VT2A 2Z9OA 3ROUA 2BE5F 3QU3A 3TOBA 1BH9A 2OZUA 3AN2C 1P3IA 2FJ7A 4DRBA 2FMLA 1OPCA 4R8PD 3B6GB 2CO5A 5AV5D 2EFOA 3WAAD 5B24B 1P3LD 3IRRA 2XAHA 5L3EA 3GYHX 4EV0A 2DW4A 5CVJA 4BYYA 2FOKA 3UTBB 5B0ZC 2IPQX 4Z5TA 3VH5W 4ENJA 3WTZA 5LHHA 5HS9A 1YW7A 4KGCD 4Y17A 5HDGA 5AY8B 4WU8C 4EGYA 1EQZC 3B0CT 3AYWB 2QWWA 2YFWB 2XRNA 5BO0B 3AZHB 5DNNC 5DCMA 3I58A 1B6AA 3NQJA 1LDKB 3X1SC 2PQ8A 1BIBA 4LD9A 2CV5C 3VB2A 5CPID 1P4XA 5K1YA 2GA1A 1P3PD 2ZCWA 3RI4A 4HQEA 3N97A 3FF5A 2NYXA 5DNMB 3NQOA 4WF2A 5CP6B 1RNLA 4HF1A 3W6JB 3X1VA 5BNXB 3U2RA 2BYVE 2A6EF 3E3VA 3KXBB 1HSJA 3O62D 5G49B 5B40A 3AZGB 3W97D 1U78A 1KYZA 1XDSA 3QPTA 3MGRC 4A0XA 3MVDA 1N1JA 3DP7A 4Z2MH 4KGCA 2YFWA 3QRFF 3DXJF 1OR7A 4YM6B 2HTJA 2EA2A 5E1XA 2QQ9A 3RJPA 4LD9C 2A3SA 5AVCB 3ZMVA 4UHTA 1WWSA 1TAFA 3P7NA 4G6QA 2H94A 1P3KD 1H3OA 3KCCA 4CZZA 3GUDA 3LSTA 1F66C 1M19D 3AZLC 1P3OD 3UT9B 2F8NA 4ZUXB 3B6FD 3CTAA 1BH9B 1K79A 3AZJB 3AFAD 3FMQA 4BNCA 5B31G 1XGSA 4U0YA 1FYLA 4WU8B 4YS3A 3WU1B 5E5AC 4E44A 1KX5C 3DQVC 2GZWA 5DEQA 3ZN0A 3GZ6A 2HTSA 2ISZA 3GVAA 4L5JA 2AS5F 5B0ZA 5E8GA 1DPUA 2EJRA 3AZNB 2Q8KA 4TV7A 4KUDD 4Q48A 3S2WA 2RVCA 5BPDA 2K86A 1RI7A 3K1PA 2W85A 3G3ZA 2YSRA 3VH6W 3R45A 3FX3A 3IWFA 4Q4ZF 3F6VA 3MGQB 3H92A 3WKJC 1FBQA 2NQBD 4HV6A 2V9VA 1ONVA 1YG2A 4MEXF 4J8WD 4IPAA 1ID3C 4BQAA 4P5OA 4ZBJB 3ZMTA 1M1AA 1P3BC 2STWA 1P3BD 1I27A 3NQJB 2DPDA 2A07F 3FXUA 4AIHA 1LNWA 3RYPA 1FZPB 1P3PA 1LDDA 4EM1A 5E17F 3DPLC 5LBQA 2Q2EA 3AZLB 4QLCU 2VN2A 2HR3A 4Z66D 3KEQA 1AOID 1SFUA 3JSOA 2Q0OA 5E1ZB 2L3DA 3MGPC 2OAZA 2XV4S 4J8UA 3MVDD 5BT1C 1KX4B 3C1CD 3V9RA 3KP5A 1O3TA 3C1BA 4P96A 2E1CA 2X0LA 3V8JA 5B0YD 3M8EA 1P3BA 3M7GA 3E5UA 2Z5UA 3KP7A 3UTAA 4L9TA 4O3MA 5E5AD 3WTTC 1C0WA 4FX4A 3BJOA 4WV4B 1LEBA 1Z7UA 4H0EA 3X1UD 3K1MA 3TO6A 5F99C 5C3IC 3VH5T 5B1MA 5AVBD 3FWEA 2V6CA 1PDNC 4J8VA 2D45A 3LZ1D 2DQLA 5L3FA 2PYOB 1Z6RA 2F8ND 3D5LA 3TGNA 2BGCA 2HUEC 3KUYC 3QOPA 3AV1A 3GXOA 3FM3A 3KP3A 4J8VC 1IRFA 4G7OF 2PYOA 2FF4A 1U35D 2Z99A 4HV5A 4AWLB 4ZYGA 5JI6A 3I5UA 2FBIA 3WTSC 2M5WA 3E5XA 4OMYA 2VOPA 3MGSB 2J5PA 1BN5A 2HEOA 5B1LC 3CLOA 4KA4A 2QVOA 4YFXF 1G3TA 3ULQB 1KQ9A 5ICEA 1TW2A 3DV8A 3MGSD 1BOAA 3P9IA 3REJA 1HBXG 5B32B 1HKTA 4I02A 2HKXA 3MGRD 4KUDA 1W4MA 4XLNF 5CVVA 2L4AA 4Z5TD 1J0RA 2ESNA 1JGSA 5DCMB 3QP5A 3AYWA 3F22A 4Z2YA 1D3YA 2K4JA 3UT9A 5JRGC 2F8NB 1XMKA 2PYOD 3GW2A 1TAFB 4J8XA 4QLCB 6PAXA 2FMYA 2PEXA 3WA9B 5FO5A 5BNVA 3MGRB 3LQRA 3AV2B 3R61A 2AROA 4XUJD 3X1TD 2R7DA 2W24A 3GX4X 3X1SD 3ML6A 2HGCA 4J8XB 4XUJC 1ZYRF 5C3IB 2FNPA 2WV0A 5B0YB 5BOXA 4M6YA 5GT0D 1N1JB 1OMIA 4PGGA 1RIOH 5JRGD 4IF4A 5J8CA 4KIBA 3MVDB 3KZYA 4B09A 2P5LC 2M45A 2LF8A 1P6RA 3AZFB 1ZN2A 4OINF 1P92A 3FHZA 1R58A 3Q5FA 1XSVA 1M18A 1XCVA 3FXRA 4HBLA 1K6OA 3UT9C 4RB2C 2FSWA 4O5VA 3B0DB 2HIOB 2VBYA 2ZNZA 4HX7A 3J81Z 3KEOA 5D4RA 5AV8C 3LZ1B 3NQUB 4P55A 3FM5A 1U5TB 3X1TA 4HGAB 1XSXA 4WXDA 4L0YB 1SMYF 4H9OB 5B1LD 2GWRA 1GXPA 5DYMA 3WTWC 3TOAA 4WNNA 1R00A 1DPRA 2FBKA 4J8WB 1STZA 2F2EA 4J8VD 1TLHB 3X1VC 1J7KA 1KX4D 3F21A 1RZ4A 5D5VB 2JZYA 1BBYA 1HQ3A 3LELD 1QNTA 1FBUA 1MJAA 3OOPA 1Z1DA 2QYOA 1LB2A 3GLXA 1EQZA 5CLSA 1B59A 3KE2A 4IHTA 3PFIA 4WX9A 1QO0D 3MGQC 1TNSA 3WKJB 1P3MB 2UWMA 2RGVA 3TKYA 1B4AA 4J8UC 4I09A 1MDMB 2YFVA 1ID3B 1P4WA 4ZBJC 1P3BB 4IRGA 4ZZLA 2UZKA 3MGRA 1H9GA 4EO5B 3MVDC 4OIQF 4ZYEA 3HHHA 4M71A 5LGNA 4XZQA 1BJAA 3AZJD 5DV5A 1HQ3D 1TNTA 4HOBA 1S32C 3B0DC 2HIOC 1ZG5A 3UT9D 1USSA 2G9WA 3AZIA 3GEZA 3REHB 2OA4A 1M18C 2FA5A 3MCZA 1P3KB 2BYMB 3F8BA 3AZND 1ZRFA 5L3CA 2WTEA 1TQPA 3HSRA 3BDDA 3RYRA 3BPXA 4PDKA 3WODF 3FXQA 3ELKA 3SXYA 1BC7C 2IRFG 2M87A 2PBIA 1SFEA 4H9RB 3A6NB 4HF0A 1Z6TA 1P3FD 3TU4C 5DNND 1SD5A 4L9JA 3KLOA 4K2EA 1O3QA 4EQQA 4WU8D 1IN7A 3RKYA 1U6GA 3M1EA 3LAPA 3KWQA 2EV6A 4ESFA 5GXQD 5GT3D 3KXBD 4KUDC 4MQVA 4E45A 2ZXJA 1ZH5A 1BIAA 1P3LC 1SD4A 4KUMA 1LQ1A 4WU9B 5CPJB 3LJAC 4HQMA 3CUQA 3CO6C 2EB7A 4Q5SF 5JHUA 3TO9A 5BNVB 2O03A 5AVCD 3AZKC 2HKOA 2M1BA 2K7LA 3AZHD 2IT0A 4XSXF 4AIKA 4H9QB 1YYVA 1P3MA 5H20A 4KGCB 3W97A 3O62A 5FUGB 1W5TA 5A2QK 3JTHA 2EFNA 3AV1D 3AZKA 4PCQA 3UTBD 1UHWA 1ZG1A 1ID3A 1U35A 2KIUA 4IHSA 3AZGD 1CGPA 3BJAA 1KGSA 3C1DA 1QZZA 2ETHA 3KUYD 3REHC 1P3KC 2MH9A 1BH8B 1F1EA 2V79A 2CSOA 1IN6A 1ODDA 4MTDA 1A7WA 3RPUA 2DK8A 5JVTA 4GCVA 3MWMA 4QLCC 2VT3A 1P3AA 3UTAC 5AVBC 2VC0A 3I53A 4KT5C 4UV8A 2FJ7D 5CVUA 5LRSA 1T0FA 1P3KA 3R6SA
chains in the Genus database with same CATH superfamily
4II3A 4E70A 1ZR4A 1T2KA 2JJ7A 5B31B 1B6WA 1MIJA 1LFPA 2LDUA 3LSJA 2VBXA 3TQNA 2QSGX 4BE0A 3B6FA 3M3YJ 1WPKA 3AYWD 2QM3A 5B0YC 1LVAA 4BU2A 5CP6A 3T8RA 3MAJA 2HI3A 2VXZA 3EYIA 3R0JA 1BI0A 4XRFA 3W98B 3SDBA 1R7JA 1AKHB 3MNND 3V7CA 1QZEA 2HQNA 3KYCB 5BT1D 2XAQA 3ZXSA 1VQNI 2NVYJ 5GPAA 5B24D 2P7VB 3BG7A 3ABMH 3MGPD 2ZKZA 1I1GA 3CDIA 2W48A 4BJTA 4IRHA 4C3JJ 2COBA 3FMSA 2JWTA 4O6JA 5AV5B 3FBIB 4R8PB 3B6GD 3NWTA 4I7HA 5FFZA 3S32A 1YO5C 4A2UA 3K10A 2JSCA 1KX3B 4F7ZA 1AOYA 4IHXA 3HRUA 2WWYA 2CV2A 1P3AD 2HXIA 2MABA 5EEHA 5AVBA 4NDLA 4XRSG 3WTUC 1G4DA 3BTCA 3W96A 2DDBA 1X1CA 3L7WA 1E2XA 2MBFA 2E5NA 3AZEA 2R7FA 2OCCH 3REJC 1MH3A 4DNCA 3OYBA 2NZDD 1E17A 1P3FA 4KMFA 3HOTA 4GRIA 5DNNA 3CC4I 5FKKA 3ZRGA 4X23B 3OIQA 2CYYA 3WGGA 3FKJA 5GPCA 3CUQC 1IXRC 3I64A 1REPC 2CGPA 2DAOA 2O61A 4WU8A 4YS3B 4UVAA 3H0LC 3FIWA 5GAHJ 1OCPA 1TZYD 4M6XA 4FQGA 3F8FA 1N78A 1J59A 3CCMI 2JA2A 3OWTA 1K4TA 5B66C 2ZMEB 4LFUA 2QSFX 4WU9A 5CPJA 5IYBJ 3REIB 2FQ4A 1P34B 3AZMB 2L7ZA 4L0ZB 4QWQA 3UTAB 3DKWA 1D0YA 2Q1ZB 1WJCA 4G92B 3Q0UA 3TW6A 5HOOA 3S16J 5B33B 4A5MA 1YLFA 3W96B 1WQ2A 4XKWA 3IUOA 3RELA 1K61A 3REJD 1RR8C 1S9HA 3WU0A 5D4SA 3Q9SA 3HSEA 2PN6A 3OR2C 5GAEJ 3ZPLA 1QU3A 3W96D 2GAUA 3NQUA 3EPJA 4UB8C 3H0MC 4RAFA 4XRSA 4IRIA 1P2FA 2IS4A 2Z16A 3OIOA 4XQFA 1XC5A 3AZMD 1P3AC 4KN7X 3REID 2NZDA 2WAEA 4J8UB 2F5DA 2ZFWA 3QYBA 2EZKA 2I8DA 3R4KA 5BNXA 2LC2A 3AFAA 3LA3A 3A6NA 3P9KA 5F08A 1WWIA 3W98C 1Q1HA 3OY9A 2OZ6A 2BBYA 5JA4A 3UNGC 5GTIC 4Y52J 3AAFA 4EO5C 3JRBA 4JX4A 3BOQA 3C1CA 2BZTA 1U8RA 3JRDA 2XF7A 1WJAA 3R0AA 3W2WA 5HS7A 3MGQA 4OU0A 3ISPA 3O2PE 3WHBA 3MNNC 1MJBA 2XGEA 3B6CA 5G49A 2KP6A 2AROD 1EKEA 1S7EA 3A1IA 3WE3A 4XUJA 3RIRA 3AFAC 1X1BA 1BI2A 2XC7A 2YFVB 1P3ID 3B6FC 1JJ6C 1P3OC 1BW5A 2FUG2 1SVLA 3WG9A 2KHMA 4IXAA 1JTYA 1JJ8C 4UUZB 1M1EB 2CQKA 2IA0A 2V26A 3IAS2 2H27A 4M3GA 4ZDPA 3H0DA 3DU5A 1QZYA 4A3EJ 1APLC 5GT0A 3BP8A 4DBRA 2B0LA 1GT0C 3CMYA 2CQ7A 2QBYB 2A5WA 2UUZA 4X23C 1MMGA 1MBEA 2HZTA 3HSFA 4E7KA 4IHYA 3AZFB 2ZJ2A 3K4NA 3RQIA 1I5ZA 3L2CA 4BQQA 4XICA 2MD0A 1WKMA 1X1AA 1V5EA 2K27A 1HKQA 1R5ID 3I0TA 4HZFA 3RCOA 2V1XA 3REKB 4H9QA 4EJWA 1W2EA 1VQLI 5CPKD 3O3KA 3TU4B 5KAFC 2IA1A 1IV6A 1IGNA 3AZID 2IO5C 4IJAA 3CCJI 5DD4A 1IV8A 4HYEA 5JVGF 1W1WE 3REIC 1FSHA 3UTBC 1P34C 3O62C 3W97C 5GTHC 5HLIA 4JJNA 3B6GA 4UNOA 2XPWA 3LSGA 3IRQA 4ZTJA 4PK4A 3CCRI 1ZREA 1BOBA 3GFJA 5EEGA 3KFWX 1X19A 4R1HA 1XX5A 4GYGA 4A3JJ 1TQMA 1VQ7I 2Y2KA 3F8NA 3L2VA 2FJ7B 1BR1A 4ESJA 1MSFC 2JPCA 3AG1H 3AZHC 2A5YB 4A5NA 1AWCA 4A3LJ 2JVHA 2HOEA 3G6EI 3CESA 3C3WA 2X4HA 4UUVA 1I3QJ 5LD2C 5B2IB 3E6MA 1YS6A 1YX5A 2UV1A 4D5FA 3AZED 1USTA 1MZBA 2HVQA 2OPTA 3PO3J 3TBIA 1FEXA 1HKSA 2GXGA 3LFKA 2DO7A 1LKXA 1UCRA 1FOXA 3REKA 1R22A 2Z1DA 5KAIC 1U9NA 1F4KA 1OISA 5DCFA 2O3FA 3U1DA 4C9YA 4GYIA 3M8FA 4NE6A 5JLWA 2R7XA 1PUFA 1EQZD 2ISYA 1YTYA 3LZ0B 1VTNC 1B8IA 2PJPA 3S15J 2DMUA 3PUBA 5LGTA 3AV1B 3A2KA 1HCRA 1N77A 1H3OB 1B72A 5J6XA 2DMNA 5ERIA 1GUUA 3TL4X 1OLTA 3GFLA 2R3SA 3ABTA 3M07A 4G91C 5B0YA 2K85A 1D0XA 5F1RA 3W6KB 4BS9A 2LBFA 4AVPA 3JAMK 4BHCA 4YM6A 3SZTA 4M3DA 2F8NK 3VSKA 4BH9A 1K78A 3Q9VA 3TU4D 4D7MA 3ABLH 2JRMA 3ONQA 5F27A 5AV5A 3C18A 4H9SA 4RGSA 4CYDA 4UV9A 3BCBA 5HS8A 5KNLA 3BQZA 1P3OA 1F36A 3ZN1A 4AIJA 2BXZA 3S2HJ 5BPIA 3MKWB 3AG2H 2VPRA 2OTJI 3Q0WA 1TT0A 2RVQC 3IP4C 2L02A 2H09A 3AN2A 1GLNA 2GBYA 2ZC2A 3E6CC 5CJ9A 4ZZDA 2BV6A 5ICGA 2ZXWH 3CF5F 4N9HA 4BY1J 1M18D 5IPAA 5GXQB 5GT3B 3OYCA 4BXXJ 3H9QA 1EF4A 5AV6A 2QEXI 1F66B 2ZNYA 4RM2A 3BROA 3OOUA 1D8JA 3F6TA 2VOOA 4B47A 1P3IB 3LFUA 2P81A 4U0WA 1HQCA 1Z05A 3OMYA 3FXLA 4XR6A 4RLQA 3O8HA 3V4GA 1IRGA 1J75A 3EETA 3CDHA 3AZIC 2KIFA 2AROB 4HNTA 3FXJA 3GTMJ 2DFEA 5DNNB 3KPHA 4L5IA 3VYSB 5H2FC 3V8KA 2P4WA 1Y39A 2XB0X 2O9LA 3SQNA 3AL0C 3WA9A 3A4CA 3CCUI 3JRIA 2ZSIB 5M3MJ 3LSRA 5AV6C 2KRCA 2NS7A 2H1KA 3GMEA 5D5XB 5AV9D 1LDJA 3TU4A 1Q9CA 4R8HA 2G5HC 3OYIA 1HC8A 1R1UA 2PMUA 3C7JA 3F8MA 1O57A 2BYKB 1ETXA 2ZO4A 1BH8A 2ZSHB 5EZGA 4NC7A 4G6DA 2F8NH 3PL8A 1WI9A 1Z77A 2QA4I 2R7VA 3FXOA 1JT0A 4DBQA 1P3GC 3BC8A 5CP6C 5FLXZ 2DBBA 2IA2A 1JFIA 1XCBA 4WXHA 3REHD 3JRFA 2WC2A 4GFBA 3LL7A 3QYEA 3VH6T 1WJEA 2LP0A 4PJMA 1KYWA 3AZGC 3REJB 4RGUA 2NNYA 4LG3A 4GDFA 5B33D 5LHGA 3HXLA 2FU4A 4RGXA 3N4MA 3KWQC 2DDAA 2X9DA 2LY2A 2FE3A 3CUQB 2MFZA 4N4NB 3CZ6A 1ZRDA 1V4RA 3FDYA 1K6YA 4CO8A 5FLXK 1MDMA 3HYIA 1DUXC 4AD9A 3MEXA 2R92J 3LA2A 3I59A 2EPFA 4LLGF 3P5JA 3HRSA 4E7JA 1ZAOA 1AKHA 3CCYA 4LD9B 3KZZA 4AVZA 5DS9A 2R7TA 5CVRA 2W57A 3H0GJ 2KL4A 2DT5A 3K2AA 3HJEA 1L0OC 3LZ0A 5BQTA 3BTJA 1HXDA 1KQ0A 1UZCA 2EIJH 4ZH4F 3ZQLA 1KQ8A 3KP4A 5HLGA 3W6VA 2QSHX 3WTPB 2X51A 1F9NA 2Y2PA 3HC7A 4Z66A 4YELA 1AOIA 1Z2CB 3SZPA 1Y8RB 4V19K 1SMTA 2M0CA 3G71I 1P3MD 4XSZF 4H4KC 1SD6A 3MZ8A 2E2IJ 5AY8C 1G8XA 2CU7A 1P3GA 1ETYA 2WAQA 3G73A 4LMYA 2VKHA 1R6RA 2VKVA 5D6FA 1HW1A 1ZARA 4BAYA 1NH3A 1TZYA 1ZLAB 3MZYA 3AZGA 1X4OA 3SHFA 4LIVA 5KK1A 4DYRA 3TDZC 2E1MB 3C1BD 1T6SA 1IO2A 3LELB 4A6EA 2CV5B 1S6LA 1ZLKA 5F6FA 1KX3D 4V2FA 4CDGA 2KZGA 2XGDA 3DEEA 3K70D 3DBLB 2A6HF 2QQBA 3S1QJ 2IAIA 2EV5A 1RR7A 3AZNA 3H3VK 4UVBA 5ICCA 3S14J 1W5SA 1H9TA 1TZYC 3MGPB 1KX5B 3QAHA 3DLLF 4Y7NJ 2P7CB 3T5XA 2V1DA 3K69A 4UVCA 3OSGA 3BY6A 5LHIA 1I39A 4BHBA 2KJCA 3KXBC 5IT9Z 3T8TA 2NRAC 2K9SA 1OCRH 4EM0B 2VXDA 4ZTFA 3LZ1A 3ABUA 2NZDC 1IN8A 3NRVA 3AZNC 2FQ3A 1YHQI 2DXIA 1EV7A 1MNDA 1ERDA 3V7SA 1D1CA 4CAYA 5HVQC 2P8TA 4RGRA 4ZUXA 2CH0A 1PVEA 4HG2A 1YRNB 3A1KA 3W98A 3F3XA 1Y1WJ 4CCLA 5B31D 1HTAA 1P3FC 3GF2A 4KMUX 3AN2B 5FKOA 3DFGA 3X1TC 3ZQQA 3E6BA 2IW5A 1RPWA 5B40B 3CMMA 2HIOD 1G3WA 3NWSA 2XGXA 2OQRA 1ULYA 5GT3A 5GXQA 1VQMI 2XUBA 2CG4A 2EZLA 3V8LA 4KHAB 3T1BA 1W7PB 2E7WA 2WB1N 1M1AD 2QLZA 5B24C 3IKTA 3DF8A 4Y15A 2RIQA 5B32G 1G59A 5ICFA 3LSHA 2HUEB 3KUYB 3LWFA 2ELKA 5B0ZB 5F64A 5J4VA 4NHJA 4JX5A 1XN7A 4I0AA 5GT0B 1U5TA 3DCFA 3VPRA 4N0BA 3K0LA 4H9PB 4OIRF 2M8GX 3KUYA 2LTPA 1A6IA 3PNTA 2X6WA 5E79C 5AV9A 1S32D 2XAUA 3WTPC 2MH2A 1NG6A 3I71A 1FOYA 1HQ3C 3AZJC 2F5CA 5IP9J 1J2XA 5D8KB 3HOSA 4DW6A 1WRJA 1F5TA 2HQAA 2VB6A 4A3CJ 3MGSC 4MNUA 3P5JB 3KP2A 2DTRA 4CSRB 1TP4A 3EYYA 2DU9A 3LMMA 3X1SB 3VEPA 1T39A 4A3GJ 3AV2D 1BI3A 2FD5A 3OL3A 2Y2OA 2CQQA 4PSXA 4IHWA 2FRHA 1ZLAC 3D5RC 4A6DA 1W0TA 2GXAA 3JR9A 1UAAA 3HGGA 3MZHA 4QLCD 4XZQD 4PUSA 4CGZA 4EM2A 2KDZA 1S8NA 1K78B 4RB3C 3AZJA 5K7HA 2FNAA 4XRMA 1W36C 2E36A 4BY7J 3CF2A 3M1CA 4M3EA 3HUGA 2WAFA 4HSTA 2KT0A 2DYSH 5CYVA 4XM3A 3RELB 3BZCA 4UPKA 3K9TA 3I4NJ 2O0YA 5TISC 3QU6A 4JJNC 1QQIA 2XAJA 4Z5TB 5DTDA 5CPJD 4WU9D 3C2GA 2Z3YA 4RLFA 4JJND 2IS2A 4KJZA 2Y9YA 4NC8A 4A0YA 1SFXA 1CF7A 5CPIA 1D5VA 1FOWA 1P9QC 4QIWN 4IHVA 1JE8A 1IAWA 4KDPA 5B32D 1R36A 1T38A 1VQ8I 1WH5A 4XZQC 2ZFUA 3AZFA 1IUYA 4I98B 5LGUA 2F5FA 3ABKH 1FYKA 3DKXA 4PGHA 4B48A 5F99B 3AV2C 1NTCA 2QUFA 1XGOA 2M4KA 2GM4A 2P5VA 3DLAA 3HOXJ 1KU5A 4Z2MG 2QENA 3TDUC 2MG4A 1P3FB 1R4MB 4FISA 3RZDJ 5KCMA 1HLVA 5E20A 1ETQA 1B9MA 2EK5A 4X23A 3ZMSA 3A6ND 5B40C 2YU3A 4MEYF 4EJTA 4GGGA 2R5YA 2NS0A 3V9RB 4ZYHA 5F99A 1U35B 3BQYA 1YFHA 2LY9A 3F23A 4HLYA 3KSYA 3KXBA 1FPQA 3J7ZI 2PX9A 3C1CC 3RQ4A 2FFFB 2B7EA 3PSFA 3HHGA 1K7AA 2MD5A 1L3LA 4ZDOA 4Y3OA 2XPUA 1IF1A 4AWLC 1EH8A 4LK0F 5GXQC 5GT3C 1FMVA 3HOVJ 2LG4A 2E1OA 2G5IC 5AONA 5GT0C 3GWZA 5DM6F 2VLAA 5IT9K 2OC6A 1NG7A 4LK1F 4OIOF 2CQNA 1LE8A 2HS5A 2EA4A 1MBKA 4ZYAA 5K7FA 3WGIA 1HQ3B 5J3LA 3V42A 4EJOA 5DDGA 1U0JA 1Q1VA 1UJ8A 5AV8B 3X1UB 5JLXA 3B0CW 1FT9A 1IXCA 3S3NA 1SVMA 2D1HA 4JK1X 3QODA 5C3EJ 4XLHA 5EGOA 5E5AB 5BO0A 3AZHA 1U5TC 1XG1A 3BG5A 4XOPA 4DIQA 5ILVA 4HGAC 2WADA 1WGXA 1VQ4I 5AV6B 1F66A 5CQEA 1LVKA 2E34A 1JHFA 5HDKA 2JVGA 1OYIA 4BBSJ 4UUTA 1FLIA 2KLOA 3HBLA 1XPXA 4UB6C 1VQPI 4HDUA 4ETSA 3DU6A 1OYWA 1DDNA 5EG0B 5BMZA 1QPIA 1ID3D 2QKLB 3A0HC 5H6RA 1MGTA 5JA4B 1P3GB 2VC1A 2MLGA 2Y0MA 4XOTA 4XN0A 1XGNA 2Y2NA 3LA7A 3ZQHA 1IN5A 1MH4A 1FBSA 2D1VA 3BG6A 4Z5TC 2ZJRF 2EZIA 9ANTA 3X1VB 1ZRCA 2NQBC 3VH6A 4E7IA 3X1SA 3WKJD 4A12A 2RV8A 4A3BJ 2EV0A 4M6BA 1A04A 2KRHA 4ENKA 4RAYA 2XAFA 1IRZA 3FDDA 3MN2A 1VQ5I 5KDMB 3A0BC 2QQ8A 1P34A 3ZMZA 1IXSB 1MJ9A 3BG3A 2EFPA 4AWXB 3J80Z 5CKTA 4M9SA 3GZ5A 1OCZH 1TZLA 4G6TB 2PYOC 5FD6A 1K4SA 4I76A 1KU9A 2LF7A 3OYEA 4J8XC 4M72A 4A3IJ 3ASOH 2BG1A 4HA8A 4HLXA 4KISA 3L00A 1GV5A 1SEUA 4U87A 1UG0A 1EJ9A 1P3MC 4LIUA 3REHA 1TBXA 4EJVA 4J8VB 4M9ZA 5HNFA 4I99C 1IDYA 2LR8A 3H1CA 3DEUA 2DA3A 3BR2A 1U35C 1KU3A 3WE2A 1EH6A 1GVJA 2CMPA 2P6TA 4WZSB 4A3DJ 2HU9A 3CJTB 3OV8A 4YRVA 4CZCA 3PM1A 1R5HA 2M7AA 4F93B 5B1LB 4C2UA 1G3SA 3CUOA 3MGQD 1ZKGA 4G12A 4GO1A 4JP0A 5FKNA 4J8WA 3SZGA 3WTXC 4DGWB 2ZMEA 1MD0A 2GQQA 2X1DA 4D1QA 4CAYB 5BS6A 2IVMA 3RKQA 1UHMA 3KZIC 2A68F 4DOZA 4S05A 2XHKA 5B32C 3GTOJ 3LELC 1RUOA 4PJJA 2V9KA 4G7ZF 3J81K 5CHLB 3CDLA 3KP6A 3K4KA 2WB1A 3BZ6A 2KFDA 2L5AA 3IWZA 3X1UC 1M19C 1FSEA 1PP7U 1KX4C 1NHAA 2XIGA 4N9IA 2DFIA 3GBGA 3X1VD 3AZFD 1W5CC 2XAGA 3MFKA 1ZG3A 4HPQA 3GFMA 2DFHA 3GFIA 2CJJA 1YS7A 3PIOF 1P3GD 5DUKA 1YI2I 2QBYA 2N8GA 1I1SA 5JRGB 1O7FA 1GXQA 3S3MA 1JXSA 2Y0SN 4BJ6C 2L01A 4F91B 1T8IA 4RB0A 2F5EA 2LKSA 2PFBA 1T08B 2L4MA 2DI3A 4MHGA 2HPIA 4U7BA 2EWNA 3ERED 2MC3A 3K4CA 5AV9C 2RNJA 2OBPA 3AG4H 5F99D 5AV6D 3CJQB 3WTPA 2W7NA 2AXTC 1KZHA 4J8XD 5LRRA 2KIQA 4G94A 1PUEE 2FEZA 3E0JB 1R1TA 3E6DA 5AV8D 2KRFA 3HRMA 3X1TB 4XUJB 3ZQ7A 3W3CA 2KPMA 3DWLE 3BR3A 1FOKA 2NXNB 2CFXA 3U9GA 4WNNB 3WA9D 3L2UA 2TDXA 3DEWA 2ZBKA 2BOLA 3P9CA 3GZNB 4AYBN 2ZJPF 3B0BA 5IP6A 1H8AC 4MTEA 1DGWY 1JI8A 3CQZJ 4KICA 3CP8A 5K5RA 2KJBA 3RELD 1M19A 2DJNA 5A2QZ 2RKHA 2K4BA 1FC3A 1TQIA 1U2WA 2BY2A 2DYRH 3R60A 2LK2A 3EDPA 3K1NA 2ZY4A 4ASNA 2W84A 5JRGA 3VFZA 2E71A 2ELHA 2HQRA 3BG9A 3ZQCA 2NAZA 4Z66C 1AOIC 2OQGA 3RZOJ 2CW8A 2K3PA 2XKOA 5CPIC 4HF2A 2X6XA 5B5EC 4LITA 2H6BA 4LB6B 1TC3C 1FWZA 1YW9A 5K5OA 1HW2A 1S7OA 2HFHA 3OL4A 4NQWA 2XVCA 3TO7A 3HKZN 4YFKF 4H9NA 1S32B 4FE4A 4NB5A 5D6EA 1R5GA 3VH5A 4KGCC 1FP2A 3I54A 2VPLA 3WKJA 4P1WA 4UXNA 2V1NA 4CCMA 4MFEA 3V7RA 5B0ZD 2WV1A 2O7OA 3DPUA 5B1LA 4W1UA 4KIGA 4J8WC 3RELC 4H9NB 3S1NJ 1S32A 3IKVA 1M1AB 1KA8A 4JJNB 2E7XA 1JHHA 3MQ0A 3MGSA 5F1JA 2OD5A 4XIDA 2RN7A 4KIFA 4PZJA 1DP7P 2RDPA 1ON1A 1D0ZA 1W7PA 3F8CA 4XLPF 2HVSA 1ZGAA 4X1EA 1JUSA 4YFNF 5L3BA 3K70C 2DLLA 5TRDA 1FY7A 1P3PB 1S3JA 3WA9C 2VJIA 2X1CA 2BHYA 3E1SA 3HRTA 5B1BH 1VFCA 3HDDA 5B40D 1ZLAA 2LNBA 2AXLA 3DBHB 2GA2A 3S3OA 1KX4A 2DQRA 2FOWA 3EUAA 2DK5A 3MVPA 4XZQB 3AN2D 2JA6J 2Q2EB 3AZLA 4F55A 2F4MB 4Y13A 5JR3A 5AVBB 3HTUA 4NQWB 2J5OA 4XKVA 4CSWA 1XSDA 1UFMA 1XMAA 1GHCA 3LELA 2B63J 1U9OA 2DJIA 2E1NA 2O6GE 3WU2C 5AY8D 4I0BA 5HDNA 1QHGA 3CLQA 2JK3A 5L3DA 2LY8A 3RTRA 4U7DA 2HYGD 4M74A 4A3MJ 2O8XA 3OSFA 1I6XA 2BVMA 2STTA 3PNYA 4MIMA 3F6OA 2CRGA 4H9OA 1QRYA 4B43A 5BNGA 3WG7H 1KX5D 3PQKA 2RC4A 2VIXA 1P3LB 3WAAB 2TRTA 3CCEI 3H5RA 1RETA 5ILUA 3AZFC 2BYMA 3C1CB 3S17J 2MSYA 5AVCA 2IJLA 1XMXA 5EG0A 1WI3A 3RKWA 1IN4A 2JPBA 1W7PD 2P5KA 5BS7A 2ID6A 1F43A 3C1BB 1P3LA 4OMZA 2K5CA 2DA6A 2G7UA 1YJNI 2VE8A 2ICWG 3C2HA 3LZ1C 1JUPA 1Z91A 2HDWA 3D0SA 4Z66B 4CYCB 1AOIB 1ZLAD 1UB9A 2R5YB 3C2BA 3JRHA 3FHNA 3U1KA 4OWRB 3W99B 4I01A 2PMZN 3I4PA 1JFIB 1O7LA 3EUHA 3UTBA 3AZLD 4E7ZA 4YG2F 2BHZA 1U3EM 4G9YA 2YPRA 2YX4A 3EUKL 4U88A 3RDIA 1IRXA 2HWVA 4CH7A 2DQNC 3WTPD 2HQ5A 5TGTA 5J8FA 2Y2HA 4IO9F 2XROA 5F04A 2R7UA 1POGA 1FX7A 4LD9D 5AV8A 3KEYA 1B1BA 3DKYA 4MO7A 4H9PA 4XBFA 3FMRA 3VDXA 1LUJB 4EMSA 4UUSA 5FD5A 1OKRA 1Y8QB 2JRTA 3LQQA 1HSTA 5FGMA 5DUIA 2LH9A 3HIFA 2CFOA 1XD7A 2VJ5A 5E3MA 3J7AO 5GSUB 1M1AC 2A61A 2L0KA 5TJJA 4P9UA 2NQBB 2NVUB 5D8LB 5IP7J 2XKPA 3S1MJ 3H3UA 1TW3A 3H5NA 3ECHA 3SEQA 1P3PC 2JMWA 1Z3YA 4EJUA 2IXSA 1Z3XA 2M8EA 4M3BA 4XLCA 4D9JA 2D5VA 2CV5D 3NARA 2CUFA 2IP2A 3UKGA 1I50J 2LOOA 4IOAF 3AV2A 5B31C 4BL0B 2BYKA 1FYMA 3BR5A 1IZ1A 3L09A 4QLCA 4KUDB 4WK8F 1PP8F 4ABZA 4ZYDA 2MLKA 4CHUA 2KKOA 2CW0F 3MNNA 4BE2A 2OTLI 4BACA 5FUGA 2E60A 4N4OB 1IJWC 5AIQA 4FT8A 2M3AA 1S5LC 1LFUP 1V5GA 3MGPA 1KX3A 3EPZA 2ME6A 1TWFJ 2Y31A 2J8PA 4KFCA 3QOEA 5AIPA 2GLOA 3RPQA 5LFAA 4BJ5C 1O3SA 2UXXA 4DQ2A 3WAAC 1SD7A 1RRJA 4RAZA 1FNNA 1IW7F 5FJ8J 5C4XJ 3I59B 4FTHA 1SAXA 4BXFA 4IOCF 1EH7A 1XB4A 2QZ8A 3DPTA 4HW0A 4LB5A 1YOVB 2UXNA 1FP1D 2LLKA 4OIPF 1KX3C 5E1WA 4I2OA 1MBFA 1N75A 1JTXA 3IL2A 4NE3A 3AFAB 2DPUA 2LSOA 1WSUA 3WAAA 3COAC 2C6YA 3HOZJ 4XONA 1OYYA 4BQOA 1M18B 4ZUXD 3B6FB 4PJNA 1UHSA 1P3OB 2OV7A 2JA8J 3BPVA 4GXOA 3HZJA 5LEKA 1M19B 2VQLA 5B31A 4R79A 1YITI 1WFXA 5L3GA 2FXAA 3QPHA 3SYTA 1ZELA 4B4CA 4DRAA 5DNMA 2F8NG 2YU9J 5B2IA 2VQHA 2PMHA 1YW8A 3WTVC 4RDUA 1H0MA 4YS3C 1HW5A 3G4SI 3I3LA 3L9FA 4CXFA 4NNJA 4A69C 2VBZA 4MFDA 5IY5H 1J09A 3ERMA 3LAJA 3A6NC 3B6GC 3FZVA 5EF6A 2AO9A 4LG0B 2K02A 1VQ9I 4XN3A 4U0VA 5CVIA 5EJCA 5AV9B 5EGOB 5E5AA 4E7SA 4HX8A 4MGRA 1ZGWA 2A69F 5ILSA 3ZMDA 3K2ZA 1KX5A 4YM6D 3X1UA 2LFBA 3HKZA 1MMAA 3OR1C 1XTAA 5B3SH 3UR3C 5B1MB 2Y48A 3CO7C 1E3HA 3BJ6A 3J80K 3LZ0D 1YQAA 1WWXA 1EQZB 3PQJA 2DODA 2DT7B 2V1UA 2NNNA 2QF7A 4L9NA 4IKFA 3ZP5A 1D8KA 2JT1A 1LPQA 1R1VA 2L9NA 3O62B 1J5YA 4YIFA 1F66D 2Y2QA 3SJMA 4WU9C 5CPJC 3LJAB 1B9NA 2LMDA 2VQCA 4ON0A 3PFYA 1R23A 1BR4A 1OCCH 2BEOA 4CICA 5B2JD 3BT9A 2Y75A 4XNFA 5FB2A 2ZXHA 1P4AA 2L7KA 5D5WB 2W25A 3QP6A 3O6BB 5CP6D 2CWEA 2LKPA 2FJ7C 3CP2A 2NQBA 2F2AC 2WAQN 5HODA 2G7HA 2H6CA 2XASA 4ESBA 5DNMD 2H8WA 5B2ID 5H6QA 3AZKB 5B2IC 2Y2LA 4LGWA 4B1RA 2DF4C 1BM9A 3ASNH 5CPIB 1Z0XA 4H9RA 3IAM2 4OOIA 3JSPA 2R7OA 1OJLA 2ADUA 2Y2IA 4D0PA 1X3UA 4XKCA 4IVNA 3IH4A 3L2WA 4NE5A 4JBAA 1JKRC 2JA7J 1WHUA 2TCTA 5B32A 2R5ZA 3FKIJ 5J47A 2EH3A 5K5QA 4MQ9F 4L18B 2JUCA 2R7ZJ 5GSUA 3LZ0C 1B67A 3PIPF 3AV1C 1O3RA 1P7JA 4KNYA 1KU2A 4ENMA 3ZOBA 2NOGA 3LSMA 1Z67A 3W2VA 2JSSA 4KITB 4C2MJ 5CPKB 2Z2SB 3GO5A 3SFZA 4YM6C 3PJRA 2CV5A 3NAUA 1F1ZA 1T98A 2HYFA 1AA7A 2VE9A 4ENNA 2K9QA 4M3FA 4LLNA 2OU2A 4M9XA 5B2JA 2RVQD 2DA1A 4RB1A 1BI1A 2XSDC 4CSRA 4IZZA 3AZKD 5AVCC 1UG2A 2OJED 1QVTA 4WXCA 2HIOA 2M0MA 2PJRA 4DZPA 1MKMA 1ZHFA 3KYDB 3M9AA 5HLHA 3AZEB 1QBJA 3ZMUA 3W99A 3REKC 3S8PA 3AZMC 2R0QC 5B2JB 3LJAD 5LEJA 4UUZA 1UMQA 2PG4A 2IO5B 3W96C 3JW4A 3K6GA 2EFWA 2Y9ZA 1CF7B 1S29A 5C44J 4ZUXC 2I5UA 4QPQA 5JFRA 1DU0A 5B1MC 3H35A 5KDMA 2LBFB 3QWLA 4R8PA 3ECOA 5HNHA 1YJWI 3QPSA 1X3WB 4WCGA 1LE8B 5B1MD 2VODA 3REOA 2L9RA 2GXBA 3E5QA 4A0ZA 3RKXA 1Z9CA 1B8IB 1BA5A 4BGDA 2COMA 2VASA 2BW3A 3AZIB 1LEAA 4X6AJ 4P9FA 1TT5B 2JTVA 3B73A 4HDVA 3REIA 5AV5C 4R8PC 2D2WA 3REKD 1BFMA 5ED4A 3BWGA 1TTYA 1BC8C 5FKMA 4M73A 4EVIA 3C1BC 1DQUA 1DU6A 3BLYA 4JX6A 2BW3B 4YIIA 1J9IA 2ZY3A 4HAMA 5IT3A 5B1AH 2XDVA 5FFXA 4B8XA 1Y0UA 3HM5A 4W97A 3JAMZ 1Y1VJ 3W99C 3HGYA 5B24A 2LD5A 4L9VA 3GTLJ 1BW6A 1HDPA 2Z33A 1O4XA 2ESHA 4CA0A 1YRNA 3LJAA 5KVRA 1CQTA 1V3FA 4XLFA 1OCOH 3WGHA 4RS8A 1AU7A 2MA3A 1RUNA 1TWAJ 3LSIA 1FTTA 3ZR8X 3NEUA 1A35A 3IV5A 1S72I 1P34D 2GIVA 3JTGA 1ETOA 3WTPE 3VOEA 1YIOA 4NFTA 1KU7A 1WJBA 2M2EA 4HX4A 3KWQB 2RQPA 4CCJA 3VODA 3HTSB 3ZGKA 1QPMA 4WWCA 5E18F 3HOYJ 5CPKC 4FX0A 2V6EA 4KYWA 2ZB9A 3S1RJ 3L2RA 4BXUA 3HOUJ 3ZQIA 3B02A 2E5ZA 1XDUA 2KDOA 4DZJA 3VYRB 1YJ9I 5GSUC 5CPRB 1SVOA 3KLNA 3CCVI 1FMWA 3T0YA 4KN4X 1LJ9A 4RBOA 4X23D 3DTKA 3KWQD 1OFCX 1G3YA 3X2QH 4G92C 2GIZA 1BJZA 2YR2A 5GP9A 5B33C 2VBWA 2VKEA 4J8UD 5CPKA 4H9SC 2L5QA 3AYWC 3H3ZA 3LNQA 1D5YA 5B2JC 2CUEA 1HDDC 4LD5A 2EFQA 2X6YA 2CV0A 4FHTA 1P3AB 1G6NA 2RREA 2DCEA 4LLLA 3WTYC 1P3IC 3IC7A 2NVTJ 2VKDA 3BR1A 5LLQA 3UTAD 1R4VA 4EGZA 1PYVA 4X0GA 2AROC 1ON2A 1ZGJA 1RKWA 1V5FA 1TWHJ 2E1MC 2JE5A 5DNMC 3SDGA 4LG0A 1T56A 2FBHA 5D5UB 4KHAA 1T0FC 3R45B 5GSUD 1S7AA 4RM3A 2YX7A 1ETVA 1XS9A 2PLYA 2WA0A 3WHCA 3E97A 2ACJA 3CJNA 4PJ0C 3MNNB 4S04A 4G7HF 1PZRA 2ZXIA 5E8IA 3W98D 3AZMA 2P6SA 5BS7C 3KETA 1TZYB 1ETKA 3H9JA 1AHDP 2HDCA 3EG5B 4JQFA 4BHPA 2M30A 2W1OA 4YS3D 1FIAA 4G8XA 4A3KJ 3EQLF 1XGMA 4Q47A 2VONA 2KIMA 2HOTA 5B33A 2YS9A 3LSKA 5AY8A 1QGPA 2NZDB 3OYDA 2PI0A 5DD8A 4G91B 2JQ7A 2QQAA 4LJZF 3F72A 2L54A 3IHUA 4BUPA 5M5YJ 3W99D 1R4NB 1ZLJA 1YX3A 3GCMA 5DM7F 2VT2A 4F92B 2Z9OA 3ROUA 3AKZA 2BE5F 3QU3A 3TOBA 3VYUB 3TP0A 1BH9A 2ID3A 2OZUA 3AN2C 4ITVA 4DYQA 1P3IA 3JCUC 4XKBA 3OS0A 2YUSA 2HPMA 2FJ7A 5C4JJ 2XSJC 2FMLA 4DRBA 1OPCA 3PO2J 4R8PD 3B6GB 2CO5A 5AV5D 2EFOA 4ZJZA 3WAAD 5B24B 1X2MA 1P3LD 3IRRA 4C2TA 4AC0A 2HXOA 2XAHA 5L3EA 3IH3A 2HVRA 3GYHX 4YEJA 4EV0A 2DW4A 5CVJA 2F4OB 2L7MP 4BYYA 2FOKA 3UTBB 5B0ZC 2IPQX 4Z5TA 3VH5W 4ENJA 1MMSA 3WTZA 5LHHA 5HS9A 3CCQI 1YW7A 4DQYB 4KGCD 3AG3H 1FIPA 3D5SC 4Y17A 5HDGA 4EGYA 5AY8B 4WU8C 3B0CT 1EQZC 3AYWB 1X3ZB 1MBGA 1GDTA 2QWWA 2YFWB 3BTIA 2M4GA 3HOWJ 2XRNA 3PNVA 5BO0B 3AZHB 1W0UA 4J00A 5DNNC 5DCMA 1JUMA 2QGUA 3OYAA 3I58A 2XD5A 1B6AA 3NQJA 1LDKB 1R9TJ 2LYCA 3X1SC 2PQ8A 1BIBA 4LD9A 2CV5C 4HRIA 2RNGA 2LY1A 3VB2A 5CPID 1P4XA 2V4JC 2ZY2A 5K1YA 2GA1A 1P3PD 4WJ3C 2ZCWA 4BQNA 3RI4A 4HQEA 3N97A 3QPLA 3FF5A 2NYXA 3SEZA 5DNMB 2VUMJ 2RAEA 3NQOA 3TW7A 2HOAA 4FETA 4WF2A 5CP6B 1RNLA 3LSPA 4HF1A 3W6JB 1T33A 2WY7Q 5M5XJ 5E3LA 3X1VA 5BNXB 1RKTA 2BYVE 3U2RA 2A6EF 2VI6A 3E3VA 3KXBB 4E7LA 1HSJA 4BKXA 3O62D 5G49B 5B40A 3AZGB 3W97D 2IGOA 1U78A 1KYZA 1XDSA 3QPTA 1P7IA 3MGRC 4A0XA 2HDDA 2VQRA 3MVDA 1N1JA 3DP7A 4Z2MH 1R49A 4KGCA 3FK6A 2YFWA 3QRFF 3DXJF 5J1RA 1OR7A 2IS6A 3CJRB 3G1OA 4YM6B 1VF9A 2HTJA 2LRDA 2M9HA 3KIOA 1DP3A 2CW7A 2EA2A 3K4MA 4JOMA 5E1XA 2R7RA 4XORA 2QQ9A 3RJPA 4LD9C 2A3SA 5AVCB 2Y30A 1JKOC 3ZMVA 2BY3A 4UHTA 2DA4A 3CMEI 2FJ1A 3CCLI 3I4MJ 1WWSA 3OYKA 1TAFA 3P7NA 4G6QA 2H94A 1P3KD 1H3OA 3KCCA 4CZZA 2IS1A 1D1BA 3K4BA 3GUDA 3LSTA 1F66C 1M19D 3AZLC 1TL8A 4UY8I 1P3OD 3HPHA 4IQ4A 3UT9B 2F8NA 2ECBA 4IEJA 4ZUXB 3B6FD 3CTAA 1BH9B 1K79A 3AZJB 3AFAD 3FMQA 2KMUA 4BNCA 2F5VA 3GTKJ 3VSLA 5FKLA 3J7YJ 1XGSA 5B31G 4EATA 4U0YA 1FYLA 3KFUG 3HPGA 4WU8B 3KYLA 3AL0B 4YS3A 1SFKA 3JRAA 1ACIA 2DMTA 2M34A 1G2HA 1HOMA 3WU1B 2EIMH 4I6ZA 3F0CA 5E5AC 2IBDA 2Y2ZA 4E44A 4QTRA 3DTIA 1KX5C 3DQVC 5EYRA 3A01A 2GZWA 5DEQA 1ENHA 3ZN0A 3OS1A 3GZ6A 1A36A 2V7FA 2HTSA 4E4HA 4AU7A 2BXYA 3OYGA 2ISZA 3GVAA 3VWBA 4L5JA 1Y56A 2AS5F 4Z6YA 5B0ZA 5E8GA 2X1EA 4IX7A 2K9MA 1DPUA 2EJRA 5CQGA 4UUSB 3PUFA 5KHDA 2CUZA 4KT6A 2XB5A 3AZNB 2Q8KA 2XD1A 3OYNA 2DA7A 4AM3A 3IH2A 4TV7A 4KUDD 2EIKH 3Q3SA 4NUBA 4Q48A 3S2WA 1ZR2A 2RVCA 5BPDA 2K86A 4XMYA 3OYFA 4BDZA 1E0EA 1RI7A 2WBMA 3A03A 3K1PA 2W85A 3G3ZA 1MNMC 1HA8A 4C3HJ 4IL6C 5F0FA 2YSRA 3VH6W 3R45A 3FX3A 3IWFA 4Q4ZF 1RESA 2GOMA 2Y69H 3F6VA 5M3FJ 3GTGJ 3MGQB 3H92A 3WKJC 2K9LA 1FBQA 2CQXA 2NQBD 4JYKA 2JA5J 2K3FA 4HV6A 2V9VA 1ONVA 3FBNB 4CYCA 1YG2A 4CCKA 4E6KG 5F0HA 4MEXF 5FRMA 4J8WD 1JKQC 3F9KA 2DFFA 4IPAA 2R5ZB 4BQAA 1ID3C 4P5OA 1VI0A 4ZBJB 3ZMTA 3JRCA 1M1AA 1P3BC 2STWA 1P3BD 1I27A 3NQJB 3B6AA 1ZTRA 2R7QA 2AHQA 2A07F 2DPDA 3CC2I 3GTPJ 3FXUA 4AIHA 1WJFA 2R4GA 3MMYB 1LNWA 1PUFB 1PJRA 3RYPA 2DA2A 1FZPB 1P3PA 1WJ5A 3QYFA 2E19A 1LDDA 2XF6A 3D1NI 4EM1A 5E17F 3FXMA 3DPLC 1X58A 5GADJ 5LBQA 2DA5A 3GLLA 1NK3P 1MNEA 2Q2EA 3AZLB 3AZEC 4YIRX 3O8GA 4QLCU 2RQQA 2VN2A 1OR7C 2HR3A 2IEKA 2PJRB 2ZM5A 3GTQJ 5J4YA 1WH7A 2MC4A 1BL0A 4Z66D 3KEQA 1AOID 3BTLA 1SFUA 1V55H 3JSOA 1N25A 2Q0OA 5E1ZB 1WCMJ 2L3DA 4QSHA 1MMDA 2Y0SA 2E35A 3MGPC 2ZY5A 3H5AA 2OAZA 4ZC3A 2EBIA 3CCSI 3JRGA 3KX2A 2EZHA 2XV4S 4J8UA 3MVDD 5BT1C 2V9PA 3MKLA 4C3IJ 1KX4B 3C1CD 1Z7LA 2LVSA 3V9RA 2W8SA 2F6CA 3LOCA 4FASD 1WJDA 3BZKA 3U21A 3KP5A 3ZCOA 1O3TA 3C1BA 4F52A 3G1LA 4S0HB 5FROA 3ZQFA 4P96A 2E1CA 2X0LA 3TMOA 3V8JA 3OYLA 5B0YD 2DOFA 3M8EA 1P3BA 4HSRA 3M7GA 1MSEC 3E5UA 2Z5UA 3MKYB 3KP7A 5IYCJ 3HL2A 3UTAA 4L9TA 4O3MA 5E5AD 3WTTC 3A1YA 1C0WA 4FX4A 4A3FJ 3BJOA 2XGCA 4BEHA 1LEBA 4WV4B 1Z7UA 3SFIA 4H0EA 3K1MA 3TO6A 3X1UD 4EEFG 5F99C 4PSWA 5C3IC 5K7ZA 3VH5T 5B1MA 2NVQJ 5AVBD 3FWEA 2V6CA 1PDNC 1ZQ3P 1A6QA 4J8VA 1IG7A 2D45A 3LZ1D 2DQLA 2AQEA 1JGGA 5L3FA 2PYOB 3S93A 1Z6RA 2F8ND 3D5LA 4NC6A 3TGNA 1NK2P 1I6HJ 4L5EA 4C30A 3M4OJ 2BGCA 2HUEC 3KUYC 1ETWA 3QOPA 3AV1A 3GXOA 3FM3A 3KP3A 4J8VC 1IRFA 1YE9A 4G7OF 2PYOA 2DN0A 2FF4A 2O5RA 1U35D 2IGKA 1IDZA 2Z99A 5IOZA 4HV5A 1OCTC 4AWLB 4ZYGA 3N05A 4B3AA 5JI6A 4FE7A 3I5UA 2FBIA 3WTSC 2M5WA 3E5XA 4OMYA 2VOPA 3MGSB 2J5PA 3PSIA 1BN5A 2HEOA 5B1LC 1R71A 4CUGA 4XLEA 3CLOA 4KA4A 2QVOA 2X48A 4YFXF 1G3TA 3ULQB 1KQ9A 5ICEA 4A93J 1TW2A 3DV8A 4E7HA 2W4SA 4OAYA 3MGSD 1BOAA 3P9IA 3G1MA 4NBQA 3REJA 2A6TA 2BVLA 1HBXG 5B32B 1HKTA 3OYJA 3OIPA 2HKXA 1E3PA 3M8JA 4I02A 3MGRD 4KUDA 2QCOA 1W4MA 4XLNF 1VQ6I 5CVVA 4Y4RA 1Y6IA 2L4AA 3J7AY 4Z5TD 1QVUA 1J0RA 2ESNA 5GAGJ 4BDYA 1JGSA 5DCMB 3QP5A 3AYWA 3Q0VA 3F22A 2P0WA 4Z2YA 2H8RA 1D3YA 2K4JA 4AUXA 4B3XA 3UT9A 5JRGC 3K7AJ 4AIDA 2F8NB 2JSPA 1XMKA 2PYOD 3GW2A 1TAFB 4J8XA 4QLCB 3I9V2 5FLMJ 2FMYA 2PEXA 6PAXA 1H89C 3WA9B 4RA2A 2VJJA 3I55I 4QPOA 5FO5A 5BNVA 3MGRB 3LQRA 3AV2B 3R61A 2AROA 4XUJD 3ZQGA 2R7DA 2W24A 3GX4X 3X1SD 3X1TD 3CD6I 2EINH 3ML6A 1SC7A 2HGCA 1IUFA 4J8XB 4XUJC 1ZYRF 3BCAA 2FNPA 1V54H 1RC9A 2OUMA 2WV0A 2R93J 2DTZA 5C3IB 5B0YB 3A01B 5BOXA 3A02A 4M6YA 5GT0D 1N1JB 2GOXB 2R7WA 1OMIA 4PGGA 1RIOH 5JRGD 2NS8A 4IF4A 5J8CA 4KIBA 3MVDB 3KZYA 2IGMA 3K4LA 4B09A 2P5LC 5FRNA 2M45A 2LF8A 1VNDA 4FCYA 1ITYA 2K40A 3FXKA 2L9VA 4OAZA 4BE1A 1P6RA 1VZ0A 3CMAI 1ZN2A 2DOAA 2DMPA 2XPVA 4OINF 1P92A 1T95A 1R58A 3FHZA 1ZK8A 3Q5FA 1XSVA 1M18A 4DJAA 1XCVA 2X6OA 3FXRA 4HBLA 2ECCA 1K6OA 2HNHA 3UT9C 4AYBA 3RSNA 4RB2C 2FSWA 4O5VA 3B0DB 2HIOB 3JREA 2VBYA 2ZNZA 2FX0A 4HX7A 1D1AA 3J81Z 3KEOA 5D4RA 1I3AA 5AV8C 3LZ1B 3NQUB 2BY1A 2WY8Q 4P55A 3FM5A 1U5TB 4MLOA 1WVRA 3X1TA 4M6VA 1XSXA 4HGAB 4WXDA 1SMYF 2B9SA 2LREA 3ESWB 4Y33A 4L0YB 2G0EA 2QKMB 3I56I 4H9OB 4D5CA 5B1LD 2GWRA 4XK4A 2X85A 1GXPA 5DYMA 4J19A 3WTWC 3TOAA 3TP3A 4WNNA 1U8BA 4ZDLA 1R00A 1DPRA 2DT6A 2FBKA 4J8WB 2VJ4A 4CCNA 2AQFA 1STZA 2F2EA 4J8VD 1BR2A 1QA6A 1ORKA 1TLHB 1H88C 1MW7A 4HEA2 1X4PA 3X1VC 1J7KA 2XF5A 1KX4D 4IQJA 3OYHA 3F21A 1RZ4A 5D5VB 2JZYA 1SFOJ 1BBYA 1HQ3A 1JT6A 3LELD 1QNTA 2IGNA 3H9GA 5EEAA 1FBUA 1MJAA 3OOPA 2E2HJ 4PFOA 5IOYA 1Z1DA 2EQRA 2QYOA 1LB2A 1DGRM 1EA3A 3GLXA 1EQZA 5CLSA 1B59A 1VQKI 1HF0A 3KE2A 4IHTA 3PFIA 4WX9A 2L7FP 1QO0D 3MGQC 1TNSA 3WKJB 2K9NA 1QHHD 1P3MB 2UWMA 2RGVA 3TKYA 3FISA 1B4AA 3HB9A 1A5JA 4J8UC 4I09A 4V2GA 1MDMB 2HOSA 2YFVA 1ID3B 1P4WA 3CC7I 1YIJI 1T3UA 4ZBJC 1P3BB 4IRGA 4ZZLA 3E7LA 2F48A 1FJLA 1OQYA 3HUGB 2UZKA 3MGRA 1H9GA 3OYMA 4EO5B 3MVDC 2H1LA 4OIQF 3K4JA 4ZYEA 4DYCA 3HHHA 3L1PA 2ZJQF 4M71A 5LGNA 3MKZA 2Y2JA 4XZQA 2A05A 1BJAA 3AZJD 5JHFA 5DV5A 1GVDA 3AFHA 1TNTA 1HQ3D 4HOBA 1S32C 5J1UA 3B0DC 2HIOC 1GV2A 2LKXA 1ZG5A 3UT9D 1WZ2A 1VQOI 1USSA 2G9WA 3AZIA 2DOEA 3L2QA 3GEZA 2ME0A 4XLAA 3REHB 2OA4A 3G2BA 1MBHA 2FA5A 3MCZA 2W82A 3VYTB 1P3KB 1M18C 2BYMB 3F8BA 3FK7A 3AZND 1ZRFA 2WTEA 5L3CA 2Y2GA 1TQPA 3HSRA 3H0RC 3BDDA 1SAUA 3RYRA 3BPXA 4HNVA 4BBRJ 4PDKA 1SANA 4II2A 3WODF 2UWXA 1TWGJ 3FXQA 3ELKA 3SXYA 1BC7C 1TWCJ 2IRFG 3EPKA 2M87A 3GTJJ 2PBIA 3HEFA 1SFEA 4PJLA 4H9RB 3A6NB 2CV1A 4XL9A 3DBRB 4HF0A 1Z6TA 2MYSA 1Y0NA 1P3FD 3TU4C 5DNND 1SD5A 5J1YA 5E3OA 2NVXJ 4RMNA 5E3NA 4L9JA 3KLOA 2L2OA 4K2EA 1O3QA 1X2NA 4EQQA 4WU8D 1IN7A 2BY0A 2MW8A 3RKYA 1U6GA 3M1EA 3LAPA 3KWQA 2EV6A 4ESFA 4RAGA 5GXQD 4F3QA 5GT3D 3KXBD 3W2AA 1Z21A 4BEHB 2EILH 4MQVA 4HNUA 5EDNA 4E45A 4KUDC 2ZXJA 2KISA 2W00A 1ZH5A 1BIAA 2NOJB 3QQAA 1P3LC 1SD4A 1UELB 4KUMA 2JN6A 2Y2MA 1LQ1A 4J01A 4WU9B 5CPJB 3LJAC 4HQMA 2KZVA 3CUQA 2CS3A 3CO6C 2EB7A 2R7SA 4Q5SF 1JKPC 4B44A 3RPUD 2DMQA 2L9SA 3DTEA 2E2JJ 5JHUA 3EUHC 4ANJA 3TO9A 1FTZA 5EZHA 5BNVB 1E3OC 2OF7A 2O03A 2VQGA 3TEDA 5AVCD 1B72B 3AZKC 2HKOA 3MD2A 2M1BA 2K7LA 1KONA 2IT0A 3AZHD 4PFPA 4XSXF 3BR6A 1X1DA 2I10A 4AIKA 1IC8A 4H9QB 3H36A 1LFBA 1YYVA 1P3MA 5H20A 4KGCB 5FLVA 3S2DJ 3W97A 3O62A 5FUGB 1MBJA 1W5TA 2CUJA 5A2QK 3EPHA 5M5WJ 3JTHA 2EFNA 3AV1D 3AZKA 4PCQA 3UTBD 3EPLA 1MMNA 1UHWA 1ZG1A 1ID3A 3W97B 1U35A 2M7BA 2KIUA 4IHSA 3AZGD 2F4IA 1CGPA 2OCEA 2O8KA 2JUGA 3OS2A 3BJAA 1KGSA 2HZDA 3BR0A 1QZZA 3C1DA 2ELJA 2XRLA 2ETHA 2KQRA 2MGQA 5IYDJ 3KUYD 3REHC 1X1PA 2MH9A 1P3KC 1BH8B 1F1EA 2V79A 2ZMEC 2CSOA 2PMZA 2HYJA 4CCOA 4D7NA 1IN6A 1ODDA 4MTDA 1A7WA 1W36D 3RPUA 2DK8A 5JVTA 1K83J 4GCVA 3MWMA 5J40A 2JCHA 4QLCC 3HG9A 2VT3A 1P3AA 3UTAC 2VL8A 3IP4B 5AVBC 2VC0A 3I53A 4KT5C 4UV8A 2FJ7D 5HLTA 5CVUA 5LRSA 1T0FA 1P3KA 1A31A 5F0CA 4LOCA 3R6SA
chains in the Genus database with same CATH topology
4E70A 1T2KA 5B31B 1B6WA 2LDUA 2VBXA 3TQNA 3B6FA 3AYWD 2QM3A 5B0YC 1LVAA 5CP6A 3T8RA 3MAJA 2VXZA 3EYIA 3R0JA 1BI0A 4XRFA 3W98B 1R7JA 3MNND 3V7CA 2HQNA 5BT1D 2XAQA 5B24D 2P7VB 3MGPD 2ZKZA 1I1GA 4IRHA 3FMSA 4O6JA 5AV5B 4R8PB 3B6GD 4I7HA 5FFZA 1YO5C 4A2UA 1KX3B 2JSCA 4F7ZA 1AOYA 3HRUA 2WWYA 1P3AD 5EEHA 5AVBA 3WTUC 1G4DA 3W96A 3L7WA 1E2XA 2MBFA 3AZEA 2R7FA 3REJC 4DNCA 2NZDD 1E17A 1P3FA 4KMFA 3HOTA 5DNNA 4X23B 2CYYA 3WGGA 3CUQC 1IXRC 3I64A 1REPC 2CGPA 2DAOA 2O61A 4WU8A 4YS3B 4UVAA 3H0LC 1TZYD 4M6XA 3F8FA 1J59A 2ZMEB 4LFUA 4WU9A 5CPJA 3REIB 1P34B 3AZMB 4L0ZB 4QWQA 3UTAB 3DKWA 4G92B 5HOOA 5B33B 4A5MA 1YLFA 3W96B 1WQ2A 3RELA 3REJD 5D4SA 3WU0A 3Q9SA 3HSEA 2PN6A 3ZPLA 3W96D 2GAUA 3NQUA 3EPJA 3H0MC 4IRIA 1P2FA 3AZMD 1P3AC 4KN7X 3REID 2NZDA 4J8UB 2F5DA 2ZFWA 3R4KA 5BNXA 3AFAA 3LA3A 3A6NA 3P9KA 3W98C 1WWIA 1Q1HA 2OZ6A 2BBYA 5JA4A 4EO5C 3AAFA 3BOQA 3C1CA 1U8RA 3R0AA 5HS7A 3MGQA 4OU0A 3ISPA 3O2PE 3MNNC 1MJBA 5G49A 3A1IA 2AROD 4XUJA 3WE3A 3AFAC 3RIRA 1BI2A 2YFVB 1P3ID 3B6FC 1P3OC 3WG9A 4IXAA 4UUZB 2CQKA 2IA0A 2H27A 1QZYA 5GT0A 3BP8A 2B0LA 2QBYB 4X23C 2HZTA 3HSFA 2ZJ2A 1I5ZA 3L2CA 1WKMA 2K27A 1HKQA 3I0TA 4HZFA 2V1XA 3REKB 4H9QA 4EJWA 1W2EA 5CPKD 3O3KA 3TU4B 2IA1A 3AZID 2IO5C 4IJAA 5DD4A 4HYEA 3REIC 1FSHA 3UTBC 1P34C 3O62C 3W97C 5HLIA 4JJNA 3B6GA 4UNOA 3IRQA 1ZREA 3GFJA 5EEGA 3KFWX 4YM6A 4R1HA 4GYGA 2Y2KA 1TQMA 3F8NA 2FJ7B 4ESJA 3AZHC 2JPCA 2A5YB 4A5NA 1AWCA 2HOEA 3C3WA 2X4HA 4UUVA 5B2IB 3E6MA 1YS6A 3AZED 1USTA 1MZBA 1HKSA 2GXGA 3LFKA 2DO7A 1UCRA 3REKA 1R22A 1F4KA 5DCFA 2O3FA 3U1DA 4GYIA 3M8FA 4NE6A 1EQZD 2ISYA 1YTYA 3LZ0B 1VTNC 2PJPA 5LGTA 3AV1B 1H3OB 5J6XA 5ERIA 5B0YA 3GFLA 2R3SA 3ABTA 4G91C 5F1RA 3W6KB 4AVPA 3JAMK 4BHCA 3SZTA 2F8NK 4BH9A 1K78A 3Q9VA 3TU4D 5AV5A 3C18A 4H9SA 4CYDA 4RGSA 4UV9A 5HS8A 1P3OA 3ZN1A 4AIJA 5BPIA 2RVQC 3IP4C 2L02A 2H09A 3AN2A 3E6CC 5CJ9A 4ZZDA 2BV6A 5ICGA 4N9HA 1M18D 5GXQB 5GT3B 5AV6A 1F66B 2ZNYA 3BROA 1D8JA 3F6TA 2VOOA 1P3IB 4U0WA 3V4GA 1HQCA 1Z05A 1IRGA 1J75A 3EETA 3CDHA 3AZIC 2KIFA 2AROB 5DNNB 4L5IA 3V8KA 2P4WA 3WA9A 3SQNA 3AL0C 5AV6C 5AV9D 5D5XB 1LDJA 3TU4A 1Q9CA 4R8HA 2G5HC 1R1UA 2PMUA 3C7JA 3F8MA 1O57A 2BYKB 2ZO4A 1BH8A 4G6DA 2F8NH 1WI9A 1P3GC 5CP6C 5FLXZ 2DBBA 2IA2A 1JFIA 1XCBA 4WXHA 3REHD 2WC2A 3VH6T 1KYWA 3AZGC 3REJB 4RGUA 2NNYA 5B33D 5LHGA 2FU4A 4RGXA 3N4MA 3KWQC 3CUQB 2FE3A 1ZRDA 1V4RA 4CO8A 5FLXK 1MDMA 3HYIA 1DUXC 4AD9A 3MEXA 3LA2A 3I59A 4LLGF 3HRSA 1ZAOA 4LD9B 3KZZA 5CVRA 2W57A 2DT5A 1L0OC 3LZ0A 5BQTA 1HXDA 1KQ0A 4ZH4F 3WTPB 1KQ8A 3KP4A 5HLGA 1F9NA 2Y2PA 4Z66A 1AOIA 1Z2CB 3SZPA 1SMTA 1P3MD 4XSZF 1SD6A 5AY8C 1P3GA 3G73A 4LMYA 5D6FA 4BAYA 1HW1A 1ZARA 1ZLAB 1TZYA 3MZYA 3AZGA 3SHFA 5KK1A 3TDZC 3C1BD 1T6SA 3LELB 4A6EA 2CV5B 1S6LA 1ZLKA 5F6FA 1KX3D 4CDGA 2A6HF 2QQBA 2EV5A 3AZNA 4UVBA 5ICCA 1TZYC 1W5SA 1H9TA 3MGPB 1KX5B 3QAHA 2P7CB 3T5XA 2V1DA 3K69A 4UVCA 3BY6A 5LHIA 4BHBA 2KJCA 3KXBC 5IT9Z 3T8TA 2NRAC 4EM0B 3LZ1A 3ABUA 2NZDC 1IN8A 3NRVA 3AZNC 2FQ3A 1EV7A 3V7SA 4CAYA 5HVQC 2P8TA