1ULYA

Crystal structure analysis of the arsr homologue dna-binding protein from p. horikoshii ot3
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
190
structure length
190
Chain Sequence
AKKVKVITDPEVIKVMLEDTRRKILKLLRNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEMKGNLVEKYYGRTADVFYINLYLGDEELRYIARSRLKTKIDIFKRLGYQFEENELLNIMDRMSQKEFDATVRISKYIEEKEDALKDFSNEDIIHAIEWLSTAELARDEEYLELLKRLGSILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PH1932
publication title Crystal structure of the PH1932 protein, a unique archaeal ArsR type winged-HTH transcription factor from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Dna binding protein
total genus 70
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2003-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ulyA01
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1ulyA02
1UHWA 2IA0A 4J8WC 3BPXA 1G3YA 3REOA 3JAMZ 4WWCA 4Z2MH 4QWQA 3TU4A 3AZLA 3TU4B 4Z66C 2Z5UA 5B24D 1W7PD 2GWRA 1UCRA 5JVTA 3I64A 3DPLC 2LY8A 3CUOA 2XAGA 2YX7A 1EH6A 4PDKA 1H3OB 1R1UA 1P3FC 3W96C 2G7HA 4CXFA 5BS7A 2EJRA 1XGNA 2CYYA 3X1SA 4KIBA 3X1SB 5K5OA 5LGNA 4A0XA 2E1NA 3CUQC 3J80Z 1JHFA 4WNNA 3EETA 3I0TA 1YTYA 2B0LA 5E20A 4B8XA 3RDIA 5B31C 2HEOA 1DP7P 1P3AD 3I59B 4L9TA 5D5VB 5LGTA 2CV5D 1ZRCA 1FLIA 2E7XA 1IRGA 3MZHA 4G91B 4M6YA 4XUJD 2PYOD 1OYIA 3UTBC 4KNYA 1HW1A 1FBQA 4CGZA 1WQ2A 1J59A 1XCVA 2AROC 5CLSA 1BH8B 2OA4A 1P3PD 5JR3A 4XZQD 1P3KC 2K27A 5CVRA 1MGTA 4I0BA 3QRFF 1R4VA 5HLHA 4OMZA 5BOXA 3AZGC 3U9GA 4HZFA 1K6OA 3KETA 4IRHA 4YM6A 3NRVA 3WTPB 3T8RA 1SFUA 1BJAA 3MVDA 3MVDB 1V4RA 3AFAA 3AN2A 2HKXA 3KCCA 3KP7A 2BYVE 1DUXC 3IWZA 3L7WA 1HW5A 2EA4A 4EV0A 3U2RA 5B33C 3KXBB 2W84A 4HOBA 4J8WA 4J8WB 1AOIB 4Z66A 2LDUA 4GGGA 3REKD 4Z66B 2F8NK 2ZNZA 2A3SA 4G6DA 4KHAA 1KX4B 4KHAB 1GHCA 3AZHD 4AVPA 2A6HF 5DYMA 2KJCA 1A04A 3C1BB 1TQMA 3IHUA 1P3FA 1ONVA 4LG0A 4LG0B 3W96A 2QQAA 3DV8A 4UXNA 1XB4A 3VOEA 5HDGA 4EQQA 3CUQA 4P9UA 3CUQB 4GYGA 1A7WA 2DO7A 3WAAD 1LDJA 3R60A 4OMYA 1XDSA 4BHPA 3ZPLA 1O3QA 3GX4X 3TGNA 1GXPA 5B31A 3GF2A 1DDNA 3O62D 3LELD 4EJTA 3OV8A 2CW0F 5HLGA 1M19C 2MBFA 3MGPC 3AV1C 4CHUA 3M8EA 3RKWA 3QPHA 3V8KA 3LJAC 3MGRC 3HRMA 3UTBA 3UTBB 1I1GA 1SAXA 5BMZA 1ZGAA 2P7VB 2AROA 3RYRA 2QVOA 5CP6C 4L9JA 1P3KA 1B9NA 1BC7C 1P3KB 1P3IC 1ZLAD 5JRGC 3W97C 2EV0A 3PQKA 1P3AB 3QAHA 3AZGA 5BS6A 5AV8D 2CV5B 4MTEA 3QU3A 5LBQA 3EUHA 2WWYA 1J7KA 2PYOB 4YFNF 2HIOB 3F22A 4HF0A 2Q8KA 2Y0MA 4P96A 3EYIA 5AV6C 3B6FC 3FF5A 4CDGA 3G3ZA 1KX3D 2RV8A 4MEXF 2AXLA 2FMYA 4XZQB 1ULYA 2K7LA 5B33A 2ZKZA 2OD5A 5B33B 2DU9A 5BPDA 3GW2A 4RB0A 3WTUC 1RIOH 1EQZC 4KGCB 2KRFA 1YO5C 3REJC 4EMSA 5D4SA 4Q5SF 5H6QA 4G7OF 3VH6A 5FFXA 5HLIA 4WZSB 2BYMA 4ZYDA 4HLYA 2BYMB 3ZMVA 3AZJB 3KUYD 4L18B 5BNVA 3HRUA 3KP4A 5BNVB 5F99C 3J7AO 1W4MA 3C1CC 2KIFA 5D5WB 4HLXA 2W24A 4YIFA 3NQUA 1XD7A 5E5AC 3REHD 2HQRA 4J8UD 2STTA 3F8NA 3SZTA 3K1MA 2D2WA 2YFWA 1M19A 4GXOA 5AV9D 4WXDA 1M19B 3MGPA 2E7WA 3AV1A 5DD8A 1YFHA 3MGPB 3AV1B 5IT9K 1LDKB 3NQOA 1MD0A 3LJAA 1KA8A 2RGVA 3MGRA 2IA2A 3MGRB 3ZN0A 4RB1A 1R58A 3TDUC 1FOKA 1B9MA 3VEPA 4YFXF 4WU9B 2CWEA 4HAMA 1WWIA 4UUZA 2M1BA 2C6YA 1T38A 3LZ1C 3WAAB 5CP6A 1U6GA 5J6XA 1T39A 1P3IA 3BJOA 3W97A 1YS6A 5JRGA 2O3FA 1MZBA 3W97B 3LELB 5C3IB 2PFBA 3X1VC 3IRRA 3GEZA 2LNBA 2JSCA 1BI2A 1ID3C 4Z5TB 3KSYA 3W98C 5DDGA 1M18C 5AV6A 3B6FA 2ELHA 5E18F 3B6FB 3GFIA 3R61A 5JI6A 2OQGA 3IKTA 4P55A 1I27A 3A6NC 3RYPA 1P34C 1SD6A 1ZLAB 3V8LA 2NS0A 5CPJC 1EQZA 5B31G 5LHGA 5AV8B 2GA2A 4WU8C 3REJA 3WG9A 4BHBA 4ZZDA 3UTAC 5ILUA 4S04A 1P92A 4EJOA 1FP1D 4EJVA 2NRAC 3I54A 4P5OA 5F99A 1EH7A 3M8FA 2L4AA 5CJ9A 3C1CB 2PBIA 4KUMA 3W99D 3V7SA 3B0CT 5JHUA 4J8VD 5L3EA 5E5AA 1BH9B 1YS7A 5E5AB 1YW9A 2A07F 3ISPA 1NHAA 2PJPA 2DLLA 3I58A 5ILVA 1R36A 5GT3D 3KZZA 1QPMA 1P3OC 3AZFC 3X1TD 3ML6A 2FJ7C 4HF2A 4JK1X 5GXQD 1C0WA 2LF7A 4PZJA 4M9XA 3HTUA 2HFHA 1PP7U 3KUYB 2QQ9A 5B2JD 4L0ZB 1SFXA 2XV4S 3QP5A 5CPKC 3H3UA 4DRAA 2YR2A 3MNND 1F1EA 3LZ1A 4HV6A 2CO5A 3AZMC 2XRNA 1KQ8A 3AV2C 5H20A 5GSUC 1OKRA 4R1HA 3WE3A 3TU4D 3AZLD 1P6RA 5AV9B 2A6EF 4A5MA 3X1VA 3JSPA 3FMSA 4MEYF 3MWMA 4HYEA 1ID3A 1K78B 1D8KA 1J5YA 2FSWA 5K5RA 3W98A 4RB3C 4O5VA 1M18A 3W98B 3H3ZA 4Q4ZF 1M18B 3RI4A 4L5IA 1JHHA 2V1UA 3WGGA 3LA3A 3A6NA 2XUBA 3X1SD 2DK5A 1P34A 3WTYC 3VH5A 3UT9C 5CPJA 1PDNC 1HQ3C 2H6CA 2JSSA 2CGPA 4ENJA 4WU8A 4Y17A 2R7DA 3UTAA 4ETSA 5F1RA 1RNLA 1YIOA 2A5YB 3F23A 5AVBC 5B0ZC 3WGHA 4RAZA 5E1XA 1M1AC 1USTA 2KKOA 2Z99A 4DNCA 1F4KA 4MTDA 2Y48A 5HS8A 2NNNA 1J75A 3O6BB 2O6GE 1BIBA 1R23A 4YS3C 1JFIB 1P3OA 3R45B 3AZFA 4WF2A 2FJ7A 4ZUXC 1P3OB 2H09A 3AZFB 5D5UB 3SQNA 4RGUA 2RVQC 1ZARA 5HDNA 3Q5FA 4BHCA 3M1EA 5DUIA 2JZYA 4F7ZA 1T0FA 4YM6D 1TTYA 5EEGA 2VBXA 5DNMC 3DF8A 3F72A 5CPKA 4HQEA 3F8FA 3F8MA 3S2WA 4H0EA 3W99B 3MVDD 3HSRA 2M30A 3CTAA 5L3BA 3AN2D 2VE9A 1YW8A 4LB6B 2EV5A 4EM1A 4G94A 5GXQB 3AZMA 4J8WD 3AV2A 5GSUA 3GFLA 3C18A 1RZ4A 3JSOA 4Z66D 1D5VA 1ZG1A 2EFPA 4NQWA 5HS9A 1IN6A 4KIGA 2PQ8A 1TAFB 2O8XA 4LK0F 1MJAA 5CPIC 4N9IA 5KDMA 5ICGA 1P3FD 2VBWA 5BNXB 2V79A 3W96D 2L5AA 1HQCA 4HX8A 4KUDC 4EVIA 3IRQA 4LB5A 3PQJA 1B6AA 1IN7A 3TKYA 3AYWC 1ZRDA 3UT9A 3AZLB 3MQ0A 3UT9B 1HQ3A 2ETHA 1OR7A 2RKHA 1TNSA 2P6SA 3JAMK 3QU6A 2FOKA 3T0YA 3GVAA 4A6EA 1HKQA 2P5VA 2EFQA 4GCVA 1GVJA 3EYYA 3B6GC 5AVBA 5B0ZA 5B31D 5B0ZB 1UFMA 1M1AA 2TDXA 4KYWA 2RNJA 2BYKA 1T6SA 1S8NA 3AAFA 2H27A 3ZMZA 4XLPF 3UTBD 2OU2A 2EV6A 4H9RA 2Z33A 4YS3A 2V1DA 2AROD 4WNNB 4M72A 4CZZA 3IKVA 3IWFA 5DCMA 3J80K 2IW5A 1KU5A 4ZUXA 1JXSA 1P3KD 3E6BA 3L2CA 4U0YA 1HSJA 1FPQA 2NQBC 5A2QZ 4PCQA 1XN7A 3F21A 3HOTA 4G8XA 4ZBJC 5DNMA 2HIOD 5B32G 2YFVA 2DBBA 1QQIA 3LAPA 5ILSA 4S05A 3AZNC 3E6DA 1O7FA 5AY8C 4IVNA 5BT1C 3B0CW 3BJAA 1TLHB 2F8NG 1ZRFA 3WODF 1Q9CA 2XKPA 5B33D 1EH8A 5TJJA 5B2IC 1BI1A 4KGCD 2DQLA 3KWQC 2FBKA 5LRRA 1LNWA 3ZQ7A 4OIRF 3GFJA 3P9IA 2OZUA 4YM6B 1XSXA 2GIVA 5ICFA 1RUOA 2HKOA 1USSA 3DP7A 5CPIA 3AZJD 4MQ9F 3AFAB 3AN2B 4AD9A 2WV0A 5G49A 4LD9C 2F5FA 2A68F 2XKOA 2DPDA 5AVCC 2BV6A 1IUYA 5D8LB 4KUDA 3RTRA 3ULQB 4Q48A 1KU3A 3N4MA 3WTWC 3AYWA 4PGGA 1BC8C 4CAYA 2QBYA 1P4XA 2OAZA 4ON0A 3W6JB 3HUGA 4M6BA 4KN4X 4EM0B 3ZMSA 3MGSC 2FBHA 2E1CA 3M7GA 5CVIA 4R8PC 3B6GA 4HDUA 4EM2A 2GQQA 1M19D 1P3FB 1MJ9A 3MGPD 3AV1D 1TNTA 3W96B 3LZ0C 3LJAD 3MGRD 2IRFG 5JA4A 3B0BA 5JA4B 2HYGD 2R7FA 3IC7A 4ZYGA 4O6JA 5HVQC 3WTTC 4WU9D 4E70A 1LJ9A 1XGMA 3AZIC 1IN5A 3WTZA 1P3GC 3T1BA 5DCFA 1L3LA 2VBZA 5CP6D 5H6RA 1R1TA 3HRSA 5JRGD 3W97D 5B31B 4JJNC 2NQBA 1UB9A 2NQBB 1FBSA 3TO9A 1KQ0A 3K1NA 3E6CC 2K02A 4G92C 3WTPE 1ZLJA 4Z5TD 5DNNC 2P8TA 2Q2EA 4LLLA 3AZNA 1BN5A 3TOAA 5AV6D 3B6FD 2AROB 5ERIA 5AY8A 4IF4A 4UHTA 5BO0A 3QOPA 1TZYC 2W57A 5B0YC 4B09A 5LEKA 2YU3A 3GXOA 5B2IA 2D1VA 3KWQA 1ZYRF 1EQZD 1P4AA 2FXAA 3KWQB 3AZGB 4LK1F 3REJD 2FF4A 3ABTA 1FBUA 2KJBA 2O61A 1SD4A 4MGRA 1ODDA 3DFGA 5D6EA 5LLQA 3O62C 5F99D 2MLGA 4LD9A 1HKTA 5AVCA 1KX5C 1H9GA 4IHTA 1J2XA 3RELC 3QP6A 3C1CD 1U35C 1OMIA 3F6VA 4KMFA 5D6FA 5E5AD 3Q9VA 4R79A 2DT5A 1IN4A 1J0RA 2DFIA 4E44A 2PI0A 3WA9C 1S32C 3MGSA 2L3DA 5GT0C 3MGSB 2EFNA 3SHFA 4R8PA 2MD5A 1O7LA 3MFKA 2M45A 2L01A 2VBYA 3LZ0A 1YYVA 3B0DC 4LD5A 4BXUA 2QZ8A 1U5TC 1MJBA 4CICA 5ICEA 3NQUB 4HF1A 3AZIA 4DQ2A 1P3GA 1P3GB 2ZXJA 2NZDC 3LZ1D 1B67A 2ZNYA 2HUEC 2VE8A 1LEAA 3G73A 1Z6RA 2M5WA 2QUFA 1CF7A 2YFWB 4JJNA 3E97A 3HOSA 1S29A 3V4GA 1B6WA 4EGZA 2YX4A 3LJAB 3X1VD 2NYXA 4BQAA 3GFMA 2IA1A 5DNNA 3BPVA 4GYIA 1ID3D 3LA2A 3KP5A 3W98D 1M18D 3KEOA 4I2OA 4UUZB 1J9IA 1L0OC 1D8JA 4EO5C 5CP6B 1TZYA 3ZMTA 5B0YA 3A6ND 1P3IB 1P34D 5JRGB 1XCBA 4FX4A 5CPJD 1E17A 3CO6C 1BOAA 3REHC 4HW0A 1QBJA 4WU8D 2GXBA 5B40C 4KT5C 3UTAD 4IJAA 4XSXF 2BGCA 1F5TA 3ZP5A 3D5LA 1R1VA 3O62A 5AV6B 5B1MC 1FYKA 4M74A 5B32C 4JBAA 1I1SA 1KX5A 4QLCC 1H0MA 2HWVA 3RELA 2MH9A 4PGHA 3RELB 1U35A 3EQLF 2OQRA 1U35B 3FX3A 1EQZB 3GZ5A 1ON2A 2H94A 2CSOA 2DI3A 3REJB 2M87A 2AS5F 1P3OD 4RB2C 1S32A 3AZFD 2FJ7D 3WA9A 2ISZA 4ZH4F 2Y75A 3E5QA 5GT0A 3SFZA 1QNTA 1S32B 5GT0B 3FM5A 1Z05A 4X23C 1FZPB 5L3GA 5AIPA 5F99B 5L3DA 4A6DA 1Z91A 4LMYA 3J81Z 5AIQA 5CPKD 1U5TA 2ZBKA 2DW4A 1U5TB 4MQVA 4RGXA 4BNCA 1IXCA 3C7JA 2MA3A 3KZYA 3AZEC 3TDZC 4YIIA 2NZDA 2DTRA 4XBFA 5LEJA 1FSHA 1STZA 3BWGA 2HQNA 1O3SA 2HUEB 2MH2A 3AV2D 5GSUD 4LLGF 3REIC 3ZMUA 1OYWA 2HDCA 4UVCA 4H9PA 1S7OA 3NQJA 3GYHX 1ZH5A 4LFUA 4H9PB 4Z2MG 1G6NA 2Z9OA 1D3YA 1KU2A 2MC3A 5CVJA 1G3TA 3R0JA 3LZ1B 1KQ9A 5B1LC 4N0BA 4EO5B 3JTGA 2F5DA 5LHHA 4BYYA 1OYYA 2XROA 3UT9D 3RKYA 2UZKA 3REHA 1XGOA 1Y0UA 2DPUA 3X1VB 3AZKC 1F9NA 5B40A 4HGAC 3ELKA 5D8KB 5B40B 1ID3B 3X1TC 5B0ZD 1K79A 3GWZA 2L4MA 2QQBA 1M1AD 2RDPA 5B1MA 5B2JC 3K9TA 2ESNA 5B32A 3I4PA 4QLCA 5EEHA 4QLCB 2A69F 3A6NB 1P3BC 1W5TA 4CSRA 1P34B 3VODA 2WTEA 3JTHA 4HA8A 2PMHA 1ZREA 5CPJB 1B59A 2W25A 5AV5C 4QLCU 4WU8B 3TOBA 4YS3D 1DPRA 5DD4A 2F8NA 5HS7A 3GUDA 4NFTA 3UTAB 2XAHA 1E2XA 5L3FA 2FA5A 4X23A 2RVQD 3D0SA 3LAJA 4X23B 3WU0A 3WU1B 4ZZLA 2LSOA 1FYMA 2IVMA 2FU4A 3KP3A 4M73A 5DNMD 1HBXG 1UHMA 2FNAA 4M9SA 1KYWA 4Z2YA 2HZTA 2OBPA 3AZEA 3AZEB 3KP6A 3N97A 2FJ7B 3X1UC 3WTSC 4IRIA 1P3LC 1QO0D 2JRTA 3REIA 5J8CA 4I01A 2M8EA 1KU7A 3F3XA 4G9YA 5JFRA 2KIMA 2RVCA 3F8BA 5CPKB 3ZMDA 1F66C 4FHTA 3SZPA 4P9FA 5ICCA 3AFAD 5CPID 3WKJC 2FE3A 2F2EA 4H9NA 3VFZA 3C1DA 1R7JA 2YSRA 3FXRA 3W6KB 5B1LA 2IPQX 4U0VA 2STWA 4G91C 2D1HA 3AZMB 3AV2B 2XAJA 3AYWD 5GSUB 2JPBA 4UV8A 3BJ6A 3B02A 3AZKA 1U3EM 1U78A 3FZVA 2FNPA 3AZKB 2FEZA 4HGAB 2Q0OA 1BIAA 6PAXA 3X1TA 2VT3A 1FP2A 3B6GD 3OOPA 1SMYF 5KDMB 1QZYA 2VOOA 1TW2A 1YW7A 1Z1DA 2QWWA 1TQIA 5B2JA 5FLXZ 1FY7A 1B1BA 2JTVA 3DPTA 3RKXA 1LEBA 3WTPC 5AONA 1P3BA 2PLYA 3M9AA 2HTJA 2O0YA 5LGUA 4G6QA 2X0LA 3WGIA 1HQ3B 5AV5A 5AV5B 1WKMA 3I53A 3MGQC 1HKSA 3B73A 3KXBC 1FT9A 3HSFA 5D4RA 3WE2A 3P9CA 5AVBB 1TW3A 2A61A 4HQMA 1XSVA 1M1AB 2NQBD 1AOIC 3K1PA 4J8XC 1P2FA 3KP2A 2BYKB 1KX4C 1R00A 4WK8F 2EA2A 4ENMA 2P6TA 4LJZF 4U7DA 3C1BC 1H3OA 4K2EA 3FXQA 2WC2A 5KVRA 4H9RB 3AZND 1LB2A 4M71A 4YS3B 2J5OA 1SD5A 2HGCA 5AY8D 2ACJA 2XAFA 4G7ZF 5BT1D 5DCMB 4L0YB 2J5PA 1P3MC 4ZUXB 3X1UA 3X1UB 3VB2A 5B2ID 1P3LA 3KWQD 3AZGD 1P3LB 4BAYA 1BM9A 4RAYA 5FUGA 5B24C 5FUGB 1IXSB 1S3JA 2D45A 4ENNA 3ZN1A 3HHHA 5A2QK 2P4WA 1VTNC 5DNMB 2RQPA 1F66A 3GZ6A 2YFVB 1REPC 3LFKA 5BQTA 1F66B 4NE3A 3LWFA 3F6OA 4KN7X 5FO5A 4ESFA 3WKJA 1H9TA 3WKJB 5LHIA 5CYVA 3I59A 5K1YA 4LD9D 3VH6T 5AVCD 3GLXA 5IT3A 1FC3A 5E8GA 5LRSA 1B4AA 2W85A 1SMTA 3KEQA 1YG2A 4HX4A 3V7RA 1BH8A 4KIFA 4YG2F 3L09A 2GAUA 3BZ6A 1WWXA 3MGSD 4NB5A 3V9RA 1RI7A 4OOIA 3V9RB 4R8PD 1X3UA 5CPIB 2XASA 1N1JA 4OIQF 1N1JB 1P3AC 1KGSA 5G49B 4A5NA 2CV5C 1G4DA 3LZ0D 3NEUA 1S7AA 3WTVC 2FBIA 4KUDB 3WTPA 4XUJC 2PYOC 2HIOC 3AYWB 4CAYB 2QBYB 3AZID 1JGSA 2XHKA 1P3GD 1WRJA 1FWZA 5E17F 1P3PC 4ESBA 1ZG5A 3MGQA 3MGQB 4XZQC 3KXBA 2QLZA 3B6GB 4RGSA 3K0LA 4JJND 4KGCC 1AOIA 3R4KA 4J8XA 5FGMA 4J8XB 1KX4A 3RPQA 2CQKA 1U8RA 3F8CA 3HSEA 5DNND 1QGPA 2P5KA 5KK1A 3C1BA 1EV7A 2NNYA 3AZJC 4JQFA 1IRFA 4WXCA 3P9KA 4NHJA 3L00A 1BFMA 1G3WA 3RPUA 4AWLC 1I5ZA 1P3MA 1XMKA 1TZYD 1P3MB 5B0YD 1P3ID 2JPCA 3DKWA 4AWXB 4KFCA 2X4HA 3REKC 3HIFA 1W7PA 5B24A 5B24B 1W7PB 2XGXA 4RGRA 2EWNA 4ZBJB 4KMUX 3AZHC 4U88A 3R6SA 3V7CA 2HOEA 4M9ZA 4MHGA 1Z6TA 3AZNB 4YFKF 2LF8A 5AY8B 1O3RA 5BO0B 2VOPA 1KX5D 4AIJA 2YPRA 3RELD 3KE2A 1U35D 4L9NA 1KU9A 1YQAA 5B2IB 2VONA 4WU9C 1BI3A 1XGSA 2HTSA 1LVAA 3KFWX 2L54A 4H9SC 3WAAC 3WA9D 1S32D 5GT0D 3MCZA 2ZMEA 2ZMEB 4HBLA 3LELC 5C3IC 5CHLB 2R3SA 1P3AA 2ZFWA 3H92A 2QYOA 4LD9B 4D0PA 2IO5C 4I7HA 2CV5A 2QM3A 3GO5A 5AVCB 2V6CA 4AIKA 4I09A 4XUJA 2PYOA 4XUJB 2HIOA 4Z5TC 2ESHA 3ECHA 1HTAA 4ENKA 2K4JA 1LQ1A 1P3PA 2NZDD 1P3PB 1O57A 4XZQA 5CVVA 4I0AA 1ZN2A 1Z9CA 4BH9A 4R8PB 1ZLAC 5E1WA 5ED4A 1IF1A 1WWSA 4KGCA 3MZYA 2UXXA 1AWCA 5AV8C 1ZLKA 2VODA 3LZ0B 2CFXA 2VXZA 2FQ3A 5DUKA 4I02A 1LDDA 2UWMA 3AZIB 3AZJA 2F8NH 4IHSA 3QPTA 2GZWA 2OZ6A 4L5JA 5FB2A 2XVCA 2IJLA 3DEUA 3HYIA 4Y13A 2EFWA 1KX3C 4O3MA 2IT0A 4AWLB 2XIGA 3HHGA 3V8JA 4JJNB 1CF7B 3LQRA 3REKA 3PFIA 4U7BA 1IAWA 3REKB 3K2ZA 5B40D 4G92B 3AZHA 2F5CA 2PMUA 3AZHB 5DNNB 3VH5T 4NE6A 3FWEA 5IT9Z 4H9QA 3KUYC 4H9QB 5B1MD 1T2KA 5B32D 4ESJA 4QLCD 5F64A 1TZYB 5B0YB 4HV5A 3U1DA 2VC1A 3TQNA 2V1XA 2LKPA 5TRDA 4WU9A 4ZYHA 4Q47A 1OPCA 5FD5A 2F8ND 3I5UA 3P7NA 4FX0A 2PG4A 4H9SA 2K86A 3WAAA 2ADUA 4IPAA 4J8UC 4HDVA 2ZCWA 3BROA 4OIPF 2EK5A 2G9WA 3CLOA 4RS8A 3MEXA 4X23D 4UVBA 3LELA 5AV9C 3O62B 1MDMA 2ZJ2A 3CDHA 2BEOA 1MDMB 4XRFA 2HYFA 2IO5B 1KX5B 5K5QA 1XMAA 4FT8A 4Z5TA 1WI9A 4EJWA 3VH6W 3K69A 3E5UA 3BY6A 3AZED 3E5XA 1SFEA 3IL2A 3WA9B 1S6LA 4E45A 1ZLAA 1ZGJA 3TO7A 2P5LC 1IW7F 1RUNA 1ON1A 3REID 1K7AA 3E6MA 4R8HA 5AV8A 3B0DB 3JW4A 3T5XA 3BDDA 1R5HA 2GXGA 1XDUA 2V9VA 3J81K 1SD7A 3T8TA 4WV4B 1V3FA 4CO8A 3I71A 4OIOF 2FRHA 1KX3A 2NZDB 1KX3B 5B1LD 5L3CA 3AZMD 2COMA 3KLNA 3C1CA 2O03A 3HTSB 4XSZF 4H9OA 4ASNA 1BH9A 4ZYEA 4H9OB 2P7CB 4LGWA 1U2WA 4N9HA 2NAZA 3NQJB 4L9VA 2EFOA 4OU0A 3AZKD 1MKMA 2BE5F 3R0AA 3LSTA 2G7UA 2ISYA 5J8FA 2BBYA 5BPIA 2DQRA 3BP8A 2DAOA 2L02A 4U0WA 3KUYA 1T98A 4AIHA 5FFZA 4IXAA 3HRTA 3C3WA 4KDPA 1F1ZA 4A2UA 4UNOA 1P3BD 4EJUA 2ZO4A 2F5EA 4UV9A 3W99C 1PP8F 2FMLA 4J8VC 5DEQA 1HQ3D 2VC0A 5F6FA 5AV5D 3REHB 4IRGA 3RIRA 5GT3C 5CVUA 5HDKA 4J8UA 4J8UB 5GXQC 5AVBD 1IXRC 3BOQA 1GXQA 5AV9A 2XAQA 5B1MB 1W5SA 1HW2A 5B32B 3DXJF 1R5GA 1ZAOA 3CJNA 4TV7A 4UVAA 1Z7UA 2KIUA 4CSRB 1K78A 3LQQA 5E1ZB 1ZG3A 3ABUA 3FXUA 2MLKA 2F8NB 1IZ1A 4HX7A 3COAC 1FX7A 3MNNC 1HXDA 1KYZA 4ZUXD 4UUVA 3X1UD 5E8IA 1CGPA 2HR3A 2RN7A 3TU4C 1P3LD 2RC4A 4A12A 3AZLC 3O3KA 1BI0A 4GO1A 5HOOA 4WX9A 1O3TA 1JE8A 4A0ZA 1F66D 2JT1A 4KICA 3WKJD 3MAJA 4I98B 1Q1HA 3WTXC 3TO6A 4CYDA 5BS7C 1AOYA 1G3SA 4A0YA 3X1SC 3FHZA 4DRBA 3ERED 3LA7A 2EB7A 3REIB 1HSTA 2VN2A 1DPUA 1JFIA 2IP2A 4MNUA 2PN6A 3Q9SA 3R45A 1I6XA 2QENA 4OINF 2UXNA 3E3VA 1FYLA 1QZZA 4H9NB 2VT2A 5DV5A 3O2PE 3SXYA 4KUDD 4G7HF 2Z3YA 5B1LB 3CO7C 3WTPD 3L9FA 5D5XB 3W99A 1WSUA 4J8VA 1ZHFA 4J8VB 3EDPA 5FD6A 2H6BA 4Y15A 1BBYA 3KLOA 1FNNA 1P4WA 1R22A 4EGYA 1TBXA 3FM3A 5GT3A 3MGQD 2GA1A 5GT3B 3FMRA 4WCGA 3KXBD 3X1TB 5GXQA 4WXHA 1AOID 4NE5A 4J8XD 3ECOA 5B2JB 1KX4D 3VH5W 4YM6C 3ROUA 2HS5A 1XSDA 1P3BB 5FLXK 2K4BA 3FMQA 1TAFA 3C1BD 3MVDC 3DQVC 1PUEE 3RJPA 2CG4A 3AFAC 2DK8A 4M6XA 3AN2C 4XLNF 1FSEA 5BNXA 4LLNA 1TQPA 4KA4A 2PEXA 3MNNA 1P3MD 1YLFA 1IN8A 3MNNB
chains in the Genus database with same CATH superfamily
1UHWA 2IA0A 4J8WC 3HL2A 3KPHA 3BPXA 1G3YA 4HEA2 3REOA 3JAMZ 4WWCA 4QWQA 2BVMA 4Z2MH 3TU4A 3CMYA 2WAFA 3TU4B 3AZLA 4Z66C 2Z5UA 3AL0B 1W7PD 5B24D 2GWRA 1UCRA 5JVTA 3I64A 3DPLC 2LY8A 3CUOA 2XAGA 2YX7A 3DBHB 5FKNA 1UELB 3HZJA 2NVYJ 1EH6A 4E7IA 4PDKA 3CCYA 1H3OB 5M5YJ 1R1UA 3S93A 1AA7A 2DMPA 3LSPA 5F04A 1P3FC 2DMUA 1X1DA 3D5SC 3W96C 2G7HA 3SDGA 2DDAA 4CXFA 5BS7A 2EJRA 1XGNA 3OIPA 1TWFJ 2CYYA 3X1SA 4KIBA 3X1SB 5K5OA 1PZRA 2GOMA 5LGNA 4A0XA 2E1NA 3CUQC 4CCLA 3S2HJ 5FKLA 2NVTJ 3J80Z 1JHFA 4WNNA 3EETA 3I0TA 5K7ZA 1Z7LA 1TT0A 2O7OA 1PYVA 1ZELA 1YTYA 3UNGC 2B0LA 3ABLH 1A6QA 3CESA 5E20A 1U0JA 4B8XA 3IAS2 4EATA 3RDIA 5M5XJ 3G1MA 4IEJA 1W0TA 1FOYA 2HEOA 2O5RA 5B31C 1P9QC 2IS4A 4V2GA 1DP7P 3I59B 4L9TA 5D5VB 3I4NJ 1P3AD 3O8GA 5LGTA 2CV5D 2WY7Q 4MLOA 3GTJJ 1ZRCA 1FLIA 2E7XA 2PMZA 1IRGA 3MZHA 4G91B 4M6YA 4XUJD 2PYOD 1OYIA 3UTBC 4M3BA 4KNYA 1HW1A 2OUMA 1FBQA 3DBRB 1WFXA 3OYDA 1WQ2A 1J59A 4CGZA 1XCVA 2AROC 5CLSA 4PK4A 4B4CA 3PO3J 1E0EA 1BH8B 2OA4A 1P3PD 5DS9A 5JR3A 1B72B 4XZQD 1W36C 1N25A 3PIOF 1P3KC 4RM2A 3LOCA 4UB8C 2K27A 4XR6A 5CVRA 1MGTA 2LOOA 1S32B 4I0BA 3QRFF 5E3MA 1R4VA 2GM4A 5HLHA 2VJ5A 4OMZA 1UG2A 5BOXA 3AZGC 4QPQA 3U9GA 4HZFA 1K6OA 3KETA 4IRHA 3EUHC 4YM6A 3NRVA 1X58A 3WTPB 2DMTA 3Q0UA 3T8RA 1OCRH 1SFUA 2CV0A 1BJAA 2DA6A 3MVDA 4HPQA 1IO2A 3MVDB 4KISA 1V4RA 3AFAA 1FOXA 3AN2A 2HKXA 3KCCA 3H0MC 2Y2LA 3KP7A 2BYVE 4XORA 3RCOA 1DUXC 3IWZA 3L7WA 3C2HA 3DEEA 1HW5A 2EA4A 2L7FP 4EV0A 3U2RA 5B33C 3KXBB 3V42A 2W84A 3I56I 2OV7A 4HOBA 4A69C 4J8WA 1ENHA 4J8WB 3TBIA 5DM6F 4E7JA 1AOIB 2ZXIA 4OWRB 2LDUA 1F43A 4Z66A 4GGGA 3REKD 4Z66B 2F8NK 2ZNZA 2A3SA 4G6DA 4KHAA 1KX4B 3PM1A 4KHAB 1D0YA 1GHCA 3AZHD 4AVPA 3S1MJ 3HB9A 4V2FA 3BR6A 2A6HF 5DYMA 2KJCA 1A04A 3C1BB 1TQMA 1VQ7I 3IHUA 3WAAA 2JJ7A 2R7XA 3GTQJ 4RA2A 1P3FA 1ONVA 4LG0A 3FXOA 3HOVJ 4LG0B 3W96A 3HXLA 3ZXSA 3S1QJ 2LTPA 1LUJB 2QQAA 3LSMA 3DV8A 2QSFX 4UXNA 3S32A 2VB6A 2MFZA 1XB4A 3HOZJ 2BY2A 2UWXA 3VOEA 5HDGA 4EQQA 2E60A 3CUQA 4P9UA 1HDPA 2DJIA 4XLFA 2BOLA 5F27A 3CUQB 3HOWJ 1Y0NA 4GYGA 4HG2A 2DA7A 1A7WA 2DO7A 1Y39A 5FRNA 3K2AA 3WAAD 1LDJA 3R60A 4AYBA 2QGUA 4OMYA 2PX9A 1XDSA 2ZJRF 4BHPA 3ZPLA 2HYJA 1O3QA 2W00A 3GX4X 1FMWA 2WAQA 3TGNA 3GF2A 1GXPA 2CUZA 1DDNA 5B31A 3G4SI 3OV8A 2CW0F 3CP8A 5HLGA 2MBFA 1VQLI 4EJTA 2Y2PA 3MGPC 3AV1C 4CHUA 2LC2A 2M4GA 2OPTA 3BTLA 3M8EA 3RKWA 1AKHB 2FOWA 5EG0B 1R49A 1GVDA 2VQHA 3QPHA 3V8KA 3LJAC 1G2HA 3MGRC 3BG5A 4BQQA 3HRMA 3UTBA 4BXFA 3UTBB 1I1GA 1SAXA 2Y0SA 3BT9A 4Y52J 5BMZA 2CUJA 1JT6A 3S3NA 2QA4I 1ZGWA 3GCMA 1ZGAA 3GZNB 1NH3A 2P7VB 4GDFA 2AROA 4UPKA 3RYRA 3HG9A 2L2OA 2QVOA 5CP6C 3MKWB 3A02A 2DN0A 1YE9A 4L9JA 1P3KA 1B9NA 1BC7C 2FJ1A 1ZR2A 1P3KB 1P3IC 1ZKGA 1ZLAD 5JRGC 4LOCA 3W97C 2EV0A 5J3LA 3PQKA 3DKYA 1P3AB 3QAHA 3AZGA 1JJ6C 5BS6A 5AV8D 2CV5B 4MTEA 3QU3A 5LBQA 2LY9A 4XLCA 3SFIA 3EUHA 3JRDA 2ECCA 3OL4A 2WWYA 1J7KA 4PSXA 2PYOB 4YFNF 4B47A 2HIOB 4CYCA 3F22A 5BNGA 4HF0A 4BKXA 3PJRA 4CYCB 2Q8KA 2Y0MA 4P96A 3EYIA 5AV6C 3B6FC 1WJCA 3FF5A 4CDGA 1JKRC 2ME0A 3G3ZA 1KX3D 2RV8A 4DJAA 4MEXF 1MBJA 3I4MJ 2AXLA 2FMYA 1I6HJ 4XZQB 1ULYA 2K7LA 5FROA 5B33A 2ZKZA 4UB6C 3IH2A 2OD5A 5B33B 2L5QA 1Z2CB 2DU9A 4DW6A 3CCLI 5BPDA 3GW2A 4RB0A 3WTUC 2K9MA 1RIOH 1EQZC 4KGCB 2KRFA 1YO5C 3REJC 4EMSA 2O9LA 5D4SA 4Q5SF 1Z21A 4D7NA 5H6QA 4G7OF 3ZQQA 3VH6A 5FFXA 5HLIA 4WZSB 1D1BA 2BYMA 4ZYDA 4HLYA 1Z0XA 2BYMB 3ZMVA 4RLQA 1QU3A 3VSKA 5LD2C 3AZJB 1ETXA 3KUYD 1V54H 2LREA 4L18B 1IV8A 5BNVA 3HRUA 3KP4A 4C3HJ 5BNVB 5F99C 4BJ6C 3J7AO 5IP9J 1W4MA 4IQ4A 4C2MJ 1NG6A 2EH3A 4FE4A 1ZTRA 5GAGJ 5J4YA 2R7OA 3C1CC 2FUG2 1O4XA 3PSFA 2KIFA 4HLXA 2W24A 4CCJA 5D5WB 2K5CA 4YIFA 3NQUA 1XD7A 1Y6IA 2KRCA 4FCYA 5E5AC 4A3DJ 3GTGJ 3REHD 3ZQHA 2CW8A 1UMQA 3I9V2 4E7ZA 3A2KA 4PUSA 3F6TA 2HQRA 4J8UD 2M7AA 2KDOA 2STTA 3F8NA 3SZTA 3K1MA 1N77A 2D2WA 3TL4X 2YFWA 3BR2A 4GXOA 5AV9D 1M19A 4MO7A 4WXDA 3MGPA 2E7WA 3AV1A 2XF5A 1M19B 3FIWA 5DD8A 3CMMA 1YFHA 3MGPB 1GUUA 3AV1B 1PUFA 5IT9K 1IRXA 2BHYA 2KL4A 1LDKB 3NQOA 1MD0A 3LJAA 1KA8A 2RGVA 3MGRA 2IA2A 2LH9A 4JX4A 3MGRB 1D0XA 2ZY5A 1PVEA 1R4NB 3ZN0A 4RB1A 1R58A 4D1QA 3TDUC 1FOKA 2BXZA 1VQKI 1B9MA 3G2BA 3VEPA 3MMYB 4YFXF 3OS1A 4WU9B 2CWEA 3VDXA 4HSRA 4HAMA 5B1BH 1WWIA 3CMEI 4UUZA 2DTZA 2Y30A 2Y2MA 2M1BA 2C6YA 1T38A 1E3OC 3LZ1C 3WAAB 2XF6A 2E1MC 4BJ5C 1MMGA 2XB0X 1U6GA 4DIQA 5CP6A 3FKIJ 5J6XA 1T39A 4BY7J 1EF4A 1P3IA 3BJOA 2LD5A 3W97A 1YS6A 5JRGA 2O3FA 1MZBA 3PSIA 3LELB 3W97B 5C3IB 1HF0A 2DF4C 2H8RA 1ZR4A 2PFBA 2V9PA 4E7KA 4BBSJ 3X1VC 3IRRA 3GEZA 2VASA 4CCOA 2LNBA 2JSCA 1BI2A 4NC7A 4XLEA 3CCUI 1ID3C 2WB1N 4Z5TB 3KSYA 3DEWA 4Y33A 2MC4A 3HEFA 1V5GA 4HNUA 3W98C 2LRDA 5DDGA 4X0GA 1M18C 5AV6A 4F52A 2ELHA 5E18F 4J00A 2XGCA 2Y9YA 2DT7B 3B6FA 1ZK8A 3GFIA 3B6FB 3R61A 2ICWG 5JI6A 5IOYA 2OQGA 4CZCA 4P55A 3IKTA 3CDIA 1I27A 3A6NC 3HJEA 2K9SA 3RYPA 3Q3SA 2HXIA 1P34C 1SD6A 2HQ5A 1ZLAB 2I10A 3V8LA 2NS0A 5CPJC 1EQZA 5B31G 5LHGA 1IJWC 1LE8A 5JVGF 3OYEA 5AV8B 2GA2A 4WU8C 3M3YJ 1FMVA 3REJA 2E5NA 3WG9A 4BHBA 4ZZDA 3UTAC 1FIAA 5ILUA 4S04A 1P92A 2LBFB 3AG3H 4I76A 1JJ8C 3TW6A 4EJOA 1FEXA 1FP1D 4EJVA 2OF7A 2NRAC 3I54A 4P5OA 5F99A 4NNJA 1EH7A 3M8FA 1JUSA 4AU7A 4DZJA 2MYSA 4XIDA 2L4AA 1T08B 3A01B 3C2BA 5CJ9A 3C1CB 3JR9A 2PBIA 4KUMA 3L1PA 3V7SA 3J7AY 3W99D 3B0CT 5JHUA 2VQRA 4J8VD 5L3EA 4MFEA 5IP6A 5E5AA 4HSTA 1BH9B 1YS7A 2I8DA 1YW9A 1A36A 5E5AB 2A07F 3BTJA 2WAQN 5KAIC 3ISPA 3KIOA 2HOSA 1NHAA 2PJPA 2DLLA 3I58A 5ILVA 1R36A 4LG3A 5GT3D 1R5ID 3KZZA 1QPMA 4CA0A 1P3OC 3AZFC 3X1TD 3ML6A 2FJ7C 4HF2A 4JK1X 1YX5A 5GXQD 1C0WA 2LF7A 4PZJA 1X1CA 3S17J 4M9XA 3HTUA 2HFHA 2ZFUA 1PP7U 1WPKA 3KUYB 4N4NB 1TWHJ 2QQ9A 5B2JD 2Y0SN 1XMXA 1BW6A 1P3BB 1T0FC 4L0ZB 1OQYA 3CC7I 1D1CA 1SFXA 2XV4S 3QP5A 4D9JA 5CPKC 2M4KA 3H3UA 2NVXJ 1BR4A 2ZC2A 3OR1C 3CCJI 4RLFA 1YI2I 1H8AC 4DRAA 1M19C 4XKVA 2Y2JA 3OWTA 4H4KC 1DGWY 4BJTA 1ETKA 2YR2A 3CC4I 3EUAA 3MNND 1F1EA 3BG3A 3LZ1A 4HV6A 2CO5A 2K3FA 3AZMC 2XRNA 1KQ8A 3AV2C 5H20A 5GSUC 1OKRA 2IAIA 2M2EA 4R1HA 3WE3A 3TU4D 1P6RA 5AV9B 3AZLD 4X6AJ 2R7UA 2A6EF 4A5MA 4AVZA 4XLAA 4L5EA 2IGNA 3OYAA 3X1VA 4IX7A 4DBQA 3JSPA 1QPIA 3FMSA 4MEYF 4IL6C 3MWMA 1Y56A 4HYEA 1ID3A 1K78B 1D8KA 4HRIA 1J5YA 2FSWA 5K5RA 3W98A 4RB3C 4O5VA 1M18A 3W98B 3H3ZA 3CJQB 4Q4ZF 1M18B 3RI4A 3CLQA 3FXLA 4L5IA 1JHHA 2V1UA 3WGGA 3LA3A 2EZLA 3A6NA 2XUBA 3ASNH 3X1SD 2M9HA 2DK5A 2G5IC 1P34A 2O8KA 2LR8A 3WTYC 3VH5A 3UT9C 2VQCA 2XD5A 5CPJA 1PDNC 1MH4A 3RZOJ 1HQ3C 2H6CA 2JSSA 1OR7C 2CGPA 4ENJA 4WU8A 4XKBA 4IHVA 4Y17A 2X6OA 1ETYA 1OFCX 2R7DA 3UTAA 4ETSA 1IDYA 1P7IA 5F1RA 1SVOA 1RNLA 1YIOA 2A5YB 2R7QA 3F23A 4IOCF 5AVBC 5B0ZC 1JGGA 4F3QA 2FD5A 3WGHA 4RAZA 4XLHA 5E1XA 1M1AC 1USTA 2KKOA 3HC7A 2Z99A 3M07A 4DNCA 4W97A 2CW7A 2IGMA 4MTDA 2Y48A 1F4KA 5HS8A 2NNNA 1J75A 5EDNA 3O6BB 1MSFC 4XOTA 3JRFA 3UKGA 1TP4A 4BDZA 2K3PA 2O6GE 3DBLB 1BIBA 3QYEA 1R23A 1XC5A 3GTOJ 4YS3C 2LG4A 3U21A 4XNFA 3BLYA 1JFIB 1I3QJ 3LMMA 2X85A 4I6ZA 3R45B 1P3OA 3AZFA 4WF2A 2FJ7A 4ZUXC 1P3OB 2H09A 2KFDA 3AZFB 3W2VA 5EZHA 3DTKA 3JREA 2L9VA 5D5UB 3RKQA 3SQNA 2JA5J 1BR2A 4RGUA 2QSGX 2RVQC 1ZARA 5HDNA 2Y2NA 3Q5FA 3EPZA 3PUFA 4BHCA 3PFYA 3M1EA 5GTHC 5DUIA 2IEKA 2JZYA 4F7ZA 2VKDA 1T0FA 1DQUA 1TTYA 2QKLB 4YM6D 5EEGA 2VBXA 5DNMC 3DF8A 3F72A 5CPKA 4HQEA 1NG7A 3F8FA 3F8MA 3S2WA 4H0EA 2R92J 3MVDD 3W99B 2LKSA 3HSRA 2M30A 3CTAA 5L3BA 3AN2D 1UZCA 2VE9A 1YW8A 4LB6B 2EV5A 4EM1A 3ZQLA 2W1OA 1SAUA 3ZRGA 1BOBA 5CPRB 4G94A 4QIWN 5GXQB 3PNTA 4XOPA 4J8WD 3AZMA 3AV2A 5GSUA 3GFLA 3C18A 1RZ4A 5JLWA 3JSOA 3QWLA 4Z66D 1S9HA 3DU5A 1D5VA 3L2QA 4PJMA 3HOUJ 3IH3A 2HXOA 1ZG1A 3BZKA 2EFPA 4NQWA 5HS9A 1LPQA 1IN6A 4YIRX 2DT6A 2PJRA 4KIGA 2PQ8A 1TAFB 2PJRB 2O8XA 4LK0F 1MJAA 4F55A 4N9IA 1MBKA 5CPIC 5KDMA 5GTIC 2X9DA 5ICGA 3DLAA 1P3FD 2W82A 2VBWA 5BNXB 3MD2A 2V79A 5EJCA 3W96D 2L5AA 2F5VA 1HQCA 4HX8A 2BW3A 2K9QA 5K7FA 2LYCA 4KUDC 1N78A 4EVIA 2VKHA 4II2A 4M3FA 2R5ZA 3IRQA 4LB5A 3CP2A 3PQJA 2R5ZB 1B6AA 2R0QC 1IN7A 2IGKA 3NWSA 5GP9A 3TKYA 3AYWC 1TC3C 1ZRDA 3UT9A 3AZLB 3MQ0A 3UT9B 1HQ3A 2ETHA 1YOVB 1OR7A 2RKHA 1WGXA 1TNSA 3DPUA 2P6SA 3JAMK 3QU6A 1KONA 2FOKA 3T0YA 2ZY2A 3GVAA 4A6EA 1HKQA 2EIJH 2P5VA 3A03A 2EFQA 4GCVA 1GVJA 2VQGA 3CZ6A 3EYYA 3B6GC 4XONA 5AVBA 5B0ZA 5B31D 2Y2ZA 5B0ZB 4A3MJ 4A3FJ 4XN3A 1UFMA 1M1AA 2TDXA 2W4SA 3LNQA 1R71A 4KYWA 2RNJA 2AQFA 1WZ2A 2BYKA 1T6SA 3JCUC 1S8NA 3AAFA 2H27A 3QQAA 3ZMZA 2GBYA 2G0EA 4XLPF 2NVQJ 2GIZA 2A6TA 2AHQA 2OU2A 3UTBD 2EV6A 3F9KA 2WA0A 2CUEA 4FISA 2XF7A 4XN0A 5C44J 3HDDA 4H9RA 2LLKA 3K4NA 2Z33A 4YS3A 2V1DA 4G6TB 2AROD 4WNNB 4M72A 4CZZA 3IKVA 3K10A 3IWFA 1BR1A 2MABA 5DCMA 3J80K 2IW5A 3NARA 1KU5A 2W48A 4ZUXA 1W36D 1X2MA 1JXSA 1P3KD 3E6BA 4IKFA 3L2CA 4U0YA 4A3KJ 1HSJA 1FPQA 3HOXJ 3LSGA 1VFCA 2NQBC 5A2QZ 3FHNA 4PCQA 1XN7A 3F21A 4LIVA 1JT0A 3HOTA 2ZY3A 4G8XA 1R4MB 4ZBJC 5DNMA 2JK3A 2HIOD 5B32G 2YFVA 2DBBA 1QQIA 2WAEA 3LAPA 2EPFA 5ILSA 3BCAA 4S05A 1VQ4I 3E6DA 3AZNC 3JRIA 2R7SA 1O7FA 4UUSA 2H1KA 5AY8C 4IVNA 3KEYA 5BT1C 3VYUB 3B0CW 3BJAA 3GLLA 1TLHB 1MW7A 1ZRFA 3WODF 1Q9CA 2XKPA 5B33D 2F8NG 5IPAA 1EH8A 1TT5B 5TJJA 5B2IC 1BI1A 4KGCD 5IP7J 1X2NA 2DQLA 1B8IA 5K7HA 3KWQC 2FBKA 2MG4A 1B8IB 3EPKA 5LRRA 1LNWA 3U1KA 3ZQ7A 4OIRF 3MKLA 3GFJA 4A3EJ 3P9IA 2DA5A 1EA3A 2AXTC 2OZUA 4YM6B 2F2AC 4NC8A 1XSXA 2GIVA 4LIUA 5ICFA 1YJNI 1RUOA 2CS3A 2HKOA 1HA8A 4B43A 1VQ9I 1USSA 3DP7A 1D0ZA 1LVKA 5CPIA 3AZJD 1K4TA 4MQ9F 3AFAB 3AN2B 4AD9A 1W1WE 1FJLA 2WV0A 5G49A 4LD9C 3MKZA 2F5FA 2A68F 4YELA 2XKOA 2DPDA 1MIJA 5AVCC 2BV6A 1IUYA 5D8LB 2EBIA 3RTRA 5JHFA 4KUDA 3ULQB 4Q48A 1KU3A 2L7KA 5E3NA 1D1AA 3RSNA 3N4MA 2JA8J 3WTWC 3AYWA 4PGGA 1BC8C 4XMYA 4CAYA 3JRBA 2QBYA 2F6CA 1X4OA 1P4XA 2OAZA 4ON0A 2L9NA 2CQNA 3W6JB 3HUGA 4M6BA 2ZSHB 2IS2A 4CCMA 4KN4X 3HUGB 4EM0B 3E0JB 2ID3A 1POGA 3IP4C 3HBLA 3ZMSA 3MGSC 2FBHA 1SANA 4BACA 3M7GA 5CVIA 2E1CA 4R8PC 1VQNI 3B6GA 4HDUA 4EM2A 2GQQA 2JE5A 1M19D 1P3FB 1MJ9A 1GV5A 3MGPD 3AV1D 1TNTA 3W96B 3TEDA 3IV5A 4XRMA 1TL8A 3LZ0C 3HOYJ 1PJRA 4B1RA 3LJAD 3MGRD 2IRFG 5JA4A 3MKYB 1APLC 3B0BA 5JA4B 3A0BC 2HYGD 2R7FA 3IC7A 4ZYGA 4O6JA 2IS6A 5HVQC 3WTTC 4WU9D 4E70A 5GAEJ 1LJ9A 1XGMA 3AZIC 1Z77A 1MBEA 1IN5A 3WTZA 1P3GC 3S3OA 2N8GA 4GFBA 2WBMA 3T1BA 3OYIA 5DCFA 1L3LA 2CUFA 2VBZA 5CP6D 5H6RA 5CKTA 1R1TA 5F0CA 3HRSA 5JRGD 3W97D 5B31B 1G59A 4JJNC 2NQBA 1MH3A 1UB9A 2NQBB 1FBSA 3TO9A 4BGDA 1KQ0A 3FISA 4RAFA 3K1NA 4FE7A 3E6CC 2K02A 4G92C 3WTPE 1ZLJA 1ETVA 2E2HJ 4Z5TD 5DNNC 2XRLA 4E7LA 4E4HA 2P8TA 2Q2EA 3QYFA 4LLLA 3AZNA 1BN5A 1U8BA 1V5FA 2HQAA 3TOAA 5AV6D 3B6FD 4GRIA 3D1NI 2AROB 5ERIA 1K6YA 4IF4A 2DA2A 4UHTA 5AY8A 5BO0A 2L7ZA 5B3SH 1A5JA 3QOPA 1TZYC 2W57A 3UR3C 5B0YC 5DTDA 4B09A 5LEKA 2YU3A 2W7NA 3GXOA 5B2IA 2E19A 2D1VA 3H1CA 4FASD 3KWQA 1ZYRF 4PSWA 1P4AA 2FXAA 1EQZD 4BDYA 3KWQB 3AZGB 4LK1F 3LL7A 3REJD 3VYSB 2FF4A 3ABTA 1K83J 2QEXI 1FBUA 1IUFA 1LFUP 2KRHA 2KJBA 3OYLA 2O61A 2FFFB 1SD4A 3I3LA 2KDZA 4MGRA 2F4OB 1ODDA 2Y2OA 2DFHA 3DFGA 4JP0A 5D6EA 5LLQA 3O62C 4F91B 4XKWA 2MLGA 5F99D 4LD9A 3OYBA 2X48A 2RREA 1HKTA 2Z1DA 5AVCA 1KX5C 1H9GA 4IHTA 1J2XA 2HI3A 3OL3A 3RELC 1VQ5I 3QP6A 3C1CD 3OS0A 4Y3OA 4BL0B 1MMNA 2ZJQF 1OMIA 3F6VA 1U35C 1E3PA 4KMFA 2I5UA 5D6FA 1JI8A 5E5AD 2E35A 3Q9VA 4R79A 2DT5A 4ZJZA 1IN4A 1J0RA 2DFIA 2VPRA 2Y2GA 3VWBA 4E44A 2PI0A 3WA9C 1S32C 3CF5F 3MGSA 2L3DA 4KITB 2M0MA 1RR7A 5GT0C 3MGSB 3MZ8A 3IUOA 2EFNA 3SHFA 4R8PA 5JLXA 2CFOA 2MD5A 1CQTA 3OIQA 3H5RA 1O7LA 3MFKA 3S3MA 2M45A 3LFUA 1H88C 2L01A 4BE2A 5GAHJ 2VBYA 3LZ0A 1YYVA 3B0DC 2BY0A 4LD5A 4BXUA 1M1EB 2QZ8A 1U5TC 4E6KG 2XPVA 1SVMA 1MJBA 4CICA 1MNEA 3WHCA 4B44A 5ICEA 3NQUB 2Z2SB 2V6EA 4ZYAA 1IGNA 4HF1A 3AZIA 4DQ2A 3CC2I 1P3GA 2BHZA 1IV6A 2R7VA 1MNDA 2NOJB 1Z3XA 5EF6A 2W8SA 1P3GB 5IYDJ 2A05A 2ZXJA 2NZDC 3LZ1D 1B67A 2ZNYA 3QOEA 2R7RA 2HUEC 2PMZN 2VE8A 1LEAA 3G73A 3G1OA 1Z6RA 2M5WA 2QUFA 1CF7A 1WJDA 2YFWB 4JJNA 2DJNA 4QPOA 3E97A 3VSLA 3HOSA 1S29A 3V4GA 2DCEA 1B6WA 2E71A 4EGZA 2YX4A 1PUFB 3BR0A 3LJAB 3X1VD 3S8PA 1OJLA 2NYXA 3G71I 3J7YJ 4BQAA 3GFMA 2IA1A 4A3GJ 3BPVA 4GYIA 5DNNA 1ID3D 3LA2A 3KP5A 1HDDC 1EKEA 3H36A 2VXDA 3W98D 1M18D 3OYFA 1IG7A 3KEOA 4I2OA 4UUZB 1J9IA 1VQ6I 1L0OC 3FXJA 1D8JA 4EO5C 5CP6B 4BU2A 3ZMTA 4C3JJ 1TZYA 5B0YA 3A6ND 2B63J 1P3IB 1P34D 5JRGB 1YHQI 1XCBA 1OCOH 4FX4A 3GTPJ 5CPJD 1E17A 5CQGA 3CO6C 1BOAA 3REHC 4HW0A 1QBJA 4WU8D 2GXBA 3NWTA 2ELKA 3PIPF 1VQPI 2Y2QA 5B40C 4KT5C 3UTAD 4IJAA 2V7FA 2BGCA 4XSXF 1F5TA 2HZDA 5HNFA 3S14J 2Y2IA 1GLNA 3ZP5A 3D5LA 1R1VA 3O62A 5AV6B 5B1MC 1FYKA 2OCCH 2K85A 4M74A 1YX3A 5B32C 4JBAA 3K70C 1I1SA 1KX5A 4QLCC 1H0MA 2HWVA 3RELA 2MH9A 2JN6A 4PGHA 1EJ9A 3RELB 1U35A 3EQLF 2OQRA 1U35B 3FX3A 3A1IA 2DOAA 3ZQFA 4DYQA 4CUGA 1EQZB 2UUZA 3GZ5A 5EYRA 1ON2A 1LE8B 3ESWB 1WJEA 2H94A 2CSOA 2DI3A 3OSFA 1GDTA 5KAFC 2M3AA 2M87A 3REJB 3TW7A 2AS5F 2VKEA 1P3OD 4RB2C 1S32A 3AZFD 2FJ7D 3WA9A 2ISZA 1ACIA 4ZH4F 2Y75A 3E5QA 3HPGA 3SFZA 1QNTA 3CD6I 2IBDA 5GT0A 2WV1A 5GT0B 5M3FJ 2X6WA 3FM5A 1Z05A 4X23C 1FZPB 5L3GA 5EGOA 4DYRA 1AU7A 5AIPA 2Y2HA 5F99B 3CDLA 5L3DA 1YJWI 4PJLA 1XX5A 4A6DA 1Z91A 2DFFA 4LMYA 3J81Z 5AIQA 2R93J 2E34A 1U5TA 2ZBKA 5CPKD 2DW4A 1U5TB 2Y31A 3PO2J 4MQVA 4AYBN 4RGXA 3H0GJ 5HNHA 4BNCA 2YU9J 1IXCA 3C7JA 2KQRA 2MA3A 3KZYA 5FLMJ 3CCEI 3AZEC 3TDZC 4ZTJA 1RKWA 4YIIA 2CJJA 2NZDA 2OC6A 2DTRA 1XG1A 4XBFA 5LEJA 5FJ8J 1FSHA 1STZA 3BWGA 2HQNA 3OYCA 1O3SA 2HUEB 2MH2A 3AV2D 1TWAJ 3K4BA 1WVRA 5GSUD 1TWGJ 4LLGF 1V55H 2ZSIB 3REIC 2KP6A 2HPIA 3ZMUA 1OYWA 2HDCA 4UVCA 4H9PA 1S7OA 3OYJA 3GYHX 1ZH5A 4D5FA 3NQJA 4II3A 4LFUA 4H9PB 4Z2MG 1G6NA 1X4PA 2XC7A 4JYKA 2Z9OA 3CCQI 3H0DA 1D3YA 1KU2A 2MC3A 3LSIA 3MVPA 5CVJA 4ANJA 1X19A 1X3ZB 1A35A 4CSWA 1YRNA 1G3TA 1YRNB 3R0JA 3RQIA 3LZ1B 1KQ9A 5C3EJ 4N0BA 5B1LC 2E1MB 4EO5B 1HLVA 2XB5A 3JTGA 2F5DA 5LHHA 3PNVA 4BYYA 1OYYA 2XROA 3UT9D 1WJAA 2VIXA 3RKYA 2UZKA 3CJTB 3REHA 1RKTA 1XGOA 1XTAA 1Y0UA 5KCMA 3WG7H 2DPUA 3X1VB 5HODA 3AZKC 1F9NA 3DU6A 4HGAC 3ELKA 4AC0A 4M3GA 5B40A 5D8KB 1BA5A 5B40B 2ELJA 3BG7A 1ID3B 2WY8Q 3L2VA 1VI0A 3K4MA 2L9SA 3X1TC 5B0ZD 1K79A 5KHDA 3GWZA 2L4MA 2EZKA 2QQBA 1M1AD 2RDPA 4EEFG 5B1MA 4JX6A 5B2JC 3DCFA 3K9TA 2ESNA 5B32A 1E3HA 2BY1A 3I4PA 4QLCA 5EEHA 3K7AJ 3GTKJ 4QLCB 3N05A 2A69F 1SVLA 3A6NB 1P3BC 5EEAA 1W5TA 4CSRA 1P34B 3VODA 2RNGA 2WTEA 3JTHA 4HA8A 2PMHA 1ZREA 5CPJB 1B59A 2W25A 5AV5C 4QLCU 4WU8B 3TOBA 4YS3D 2EZHA 4M3EA 1DPRA 5DD4A 3KFUG 2F8NA 5HS7A 3GUDA 2HU9A 5FLVA 4NFTA 3UTAB 3A1YA 2XAHA 1YIJI 1E2XA 2LP0A 1ERDA 1I3AA 4MFDA 1YITI 5L3FA 3BQZA 2ME6A 4ZDPA 2FA5A 4X23A 5B1AH 2RVQD 1VNDA 3D0SA 3OMYA 3LAJA 4X23B 3WU0A 4D7MA 3WU1B 3AL0C 4ZZLA 1IRZA 2LSOA 1FYMA 2JUGA 4ABZA 2IVMA 4UY8I 2QCOA 2FU4A 1F36A 3KP3A 4M73A 1OISA 5DNMD 1HBXG 3JRHA 4B3XA 2E2IJ 1OCPA 1UHMA 2FNAA 3G1LA 4M9SA 1KYWA 4Z2YA 4BQNA 1MNMC 3LELD 2HZTA 1T56A 2OBPA 4HNVA 2VJJA 1IC8A 3AZEA 4XRSG 4Y4RA 3AZEB 3KP6A 4DGWB 3N97A 3OYGA 2FJ7B 3X1UC 3WTSC 4RM3A 3ABKH 4C2TA 2NVUB 4IRIA 1P3LC 1MBHA 3FDDA 2KZVA 1QO0D 1ETWA 2JRTA 2R4GA 1JUPA 3REIA 5J8CA 2B9SA 4I01A 1HC8A 2M8EA 3FDYA 1KU7A 2ZB9A 3F3XA 4G9YA 5JFRA 1ZQ3P 2KIMA 2RVCA 4JX5A 2XPWA 3F8BA 5CPKB 3H3VK 3ZMDA 1F66C 4FHTA 3SZPA 4P9FA 2R5YA 5ICCA 1WJFA 5IYBJ 2R5YB 2GLOA 3AFAD 5CPID 3WKJC 2FE3A 2F2EA 4H9NA 4J19A 2V4JC 1QRYA 2KMUA 3VFZA 3C1DA 1R7JA 2YSRA 2XD1A 3FXRA 3W6KB 4XQFA 2IPQX 4U0VA 2STWA 4G91C 5B1LA 4Y7NJ 2D1HA 1HCRA 3AZMB 1NK2P 3AV2B 1MMAA 2XAJA 4N4OB 3AYWD 5GSUB 2JPBA 4UV8A 1OCZH 3L2RA 3BJ6A 1W2EA 3JRAA 3EG5B 3JRCA 2AQEA 3B02A 4NQWB 2WADA 1WJ5A 3AZKA 1U3EM 1U78A 3OYKA 3FZVA 2FNPA 3AZKB 2P81A 2FEZA 3QODA 4HGAB 1QA6A 2DDBA 1BIAA 2Q0OA 6PAXA 3X1TA 2VT3A 1FP2A 3B6GD 3OOPA 1SMYF 5KDMB 1QZYA 2VOOA 1TW2A 1YW7A 1Z1DA 2QWWA 4B48A 1BW5A 1TQIA 2BW3B 1UHSA 5B2JA 5FLXZ 1FY7A 1B1BA 2JTVA 3ZQIA 3H5NA 3DPTA 5IOZA 3RKXA 2QSHX 1LEBA 3WTPC 2CMPA 2X1CA 3K4JA 5AONA 1P3BA 2PLYA 2V26A 3M9AA 2HTJA 2O0YA 5LGUA 4G6QA 4E7SA 3BG9A 2X0LA 3HM5A 3WGIA 2R7WA 1HQ3B 2RIQA 5AV5A 4XKCA 1T95A 5AV5B 3SJMA 1WKMA 3I53A 1S72I 3MGQC 4XL9A 1HKSA 3BR1A 1DP3A 4C9YA 3I55I 3B73A 3ONQA 2UV1A 4IOAF 3KZIC 3KXBC 4V19K 1FT9A 1HOMA 3HSFA 5D4RA 3WE2A 3P9CA 5AVBB 3TP3A 3K4CA 1TW3A 4DZPA 2A61A 4HQMA 1XSVA 1M1AB 2NQBD 1AOIC 3K1PA 4J8XC 2ZJPF 3FBIB 1P2FA 3KP2A 2BYKB 3FKJA 1KX4C 1R00A 4WK8F 2EA2A 4RAGA 1SEUA 1Z67A 4ENMA 2P6TA 4LJZF 4M6VA 4U7DA 3C1BC 1H3OA 4K2EA 3FXQA 1QHGA 2WC2A 5KVRA 3LSKA 4H9RB 4QTRA 5DM7F 3AZND 2IXSA 1LB2A 4M71A 4YS3B 2J5OA 1SD5A 2HGCA 2ZXHA 2ACJA 5AY8D 4YRVA 2XAFA 4G7ZF 3CCVI 5BT1D 5DCMB 4L0YB 2J5PA 1P3MC 4ZUXB 3X1UA 3X1UB 3VB2A 5B2ID 3OYNA 1P3LA 3KWQD 3AZGD 1P3LB 4BAYA 1BM9A 4RAYA 5FUGA 5B24C 1Y1VJ 5FUGB 4B3AA 1IXSB 1S3JA 2D45A 4LITA 4ENNA 3VYRB 1LFPA 3ZN1A 3HHHA 3DTIA 2P4WA 5A2QK 3M8JA 1VTNC 5DNMB 2RQPA 2QQ8A 4RDUA 2R7TA 3GZ6A 2YFVB 3ZOBA 1REPC 1GV2A 3LFKA 5FKOA 4M3DA 5BQTA 1F66B 4NE3A 3LWFA 3F6OA 4KN7X 5FO5A 4ESFA 3WKJA 3A0HC 3ZGKA 1H9TA 3WKJB 1WH7A 5LHIA 4ZDOA 1RR8C 2OTJI 5CYVA 3I59A 5K1YA 4UUSB 4ZTFA 4ITVA 4LD9D 3FBNB 5H2FC 3VH6T 5AVCD 3GLXA 5IT3A 1FC3A 5E8GA 4A3IJ 1OLTA 5LRSA 1B4AA 2DA1A 2P0WA 2W85A 1SMTA 3KEQA 1YG2A 4HX4A 3CCSI 3J7ZI 3G6EI 3V7RA 3VYTB 3GTMJ 4IO9F 1BH8A 3HGGA 5FKMA 3OSGA 4KIFA 4YG2F 3L09A 3B6AA 4RMNA 2GAUA 3BZ6A 1WWXA 3MGSD 1Y1WJ 2DYRH 4NB5A 2JRMA 3W2WA 1B72A 2HVSA 1BJZA 5KNLA 1RI7A 4OOIA 3V9RA 3V9RB 2ZMEC 1X3UA 4AUXA 4R8PD 5CPIB 2XASA 4DOZA 1N1JA 3A1KA 4OIQF 1N1JB 2KISA 2XPUA 1KGSA 5G49B 1P3AC 4A5NA 1I39A 2CV5C 3DWLE 3WU2C 1G4DA 4XM3A 3NEUA 4AIDA 5C4JJ 1S7AA 5IY5H 3WTVC 2FBIA 3LZ0D 4KUDB 3KX2A 3WTPA 4XUJC 2PYOC 2HIOC 3AYWB 2NOGA 3VPRA 4CAYB 3H9GA 2QBYB 1Q1VA 3AZID 3E1SA 3BTCA 5HLTA 1JGSA 2XHKA 1P3GD 1WRJA 4NDLA 3S1RJ 1FWZA 5E17F 1P3PC 4ESBA 2F4IA 2LKXA 1ZG5A 3MGQA 2WB1A 3MGQB 2HPMA 4XZQC 1P7JA 3S1NJ 3KXBA 2QLZA 3B6GB 2Y9ZA 4ZDLA 2A5WA 3OY9A 4RGSA 3K0LA 4JJND 4KGCC 3PL8A 2CU7A 1AOIA 2EINH 3R4KA 3CJRB 4J8XA 1RPWA 1MMSA 5FGMA 4J8XB 2X51A 1AHDP 1KX4A 3RPQA 2CQKA 2QKMB 1U8RA 2DA3A 3F8CA 2HOAA 5B66C 3HSEA 5DNND 1QGPA 2P5KA 4QSHA 5KK1A 3C1BA 1EV7A 2NNYA 3AZJC 4JQFA 1IRFA 4WXCA 1DGRM 3P9KA 4WJ3C 1V5EA 5GADJ 4NHJA 3L00A 1BFMA 1U9OA 2CQQA 1G3WA 4YEJA 3RPUA 4AWLC 4HNTA 1I5ZA 1ORKA 1XMKA 1P3MA 1TZYD 3ZCOA 1P3MB 5B0YD 1P3ID 2JPCA 3DKWA 4D5CA 4AWXB 3JRGA 4KFCA 1FTZA 2X4HA 1XPXA 2AO9A 1MBGA 3OYHA 2HDDA 3REKC 3AG1H 1W7PA 3HIFA 5B24A 3DTEA 5B24B 1W7PB 4P1WA 2XGXA 2JMWA 4RGRA 4BBRJ 1F66A 3EPHA 1JKQC 2EWNA 3HKZA 4ZBJB 4KMUX 3QPLA 3AZHC 2E36A 4U88A 3R6SA 3SYTA 4F92B 2EZIA 3V7CA 2HOEA 4M9ZA 2Q2EB 4MHGA 3MN2A 2DFEA 4PJNA 1Z6TA 3AZNB 3ERMA 4YFKF 2LF8A 1UAAA 4BQOA 5TISC 5AY8B 1AKHA 1O3RA 2HVRA 1TWCJ 3W6VA 5EG0A 5BO0B 2VOPA 1KX5D 4AIJA 5F0FA 2YPRA 3RELD 3KE2A 2V9KA 1U35D 4L9NA 1KU9A 1MSEC 1YQAA 5B2IB 5IYCJ 3PNYA 1NK3P 1IDZA 4OAZA 2VONA 2EQRA 1BI3A 3CF2A 2Y2KA 4WU9C 3IAM2 1XGSA 2DQNC 2EILH 3H0LC 4OAYA 3ZQCA 4AM3A 2HTSA 1LVAA 3H5AA 2L54A 3KFWX 2J8PA 4H9SC 3WAAC 3WA9D 3F0CA 2XAUA 3W3CA 4CCKA 1S32D 5GT0D 3MCZA 2EIMH 5F1JA 2ZMEA 5J1UA 2GOXB 2ZMEB 4HBLA 3LELC 5C3IC 5CHLB 2R3SA 1P3AA 2ZFWA 3H92A 5B5EC 2QYOA 4LD9B 4D0PA 2IO5C 4I7HA 2CV5A 2QM3A 3GO5A 5AVCB 3ZR8X 2V6CA 2JUCA 2JWTA 2G5HC 4AIKA 1R9TJ 4I09A 1WJBA 3L2WA 4XUJA 2PYOA 1QZEA 2OCEA 3K4LA 2HIOA 4Z5TC 4XUJB 1N75A 3LSJA 4G12A 1VQOI 4IHXA 2ESHA 3ECHA 4KJZA 2NXNB 2HNHA 4BY1J 1MBFA 1K61A 1HTAA 4ENKA 2K4JA 3ZQGA 1LQ1A 1OCTC 3IP4B 1P3PA 2XGEA 2NZDD 1P3PB 1O57A 4XZQA 5CVVA 4I0AA 1ZN2A 1Z9CA 4BH9A 4R8PB 1ZLAC 2ZM5A 3K6GA 2MW8A 5E1WA 1T33A 5ED4A 1IF1A 1WWSA 4KGCA 2BXYA 2UXXA 3MZYA 2ZY4A 4Z6YA 1AWCA 5AV8C 3Q0VA 4S0HB 4CCNA 1ZLKA 2VODA 3LZ0B 1WCMJ 2VQLA 2CFXA 2CRGA 3KYCB 2VUMJ 3ABMH 3FK7A 2VXZA 4A3CJ 2FQ3A 4I99C 5DUKA 5E3LA 2EIKH 5CQEA 3QYBA 4I02A 2KPMA 1LDDA 4NBQA 2UWMA 2V1NA 3AZIB 1ETOA 3AZJA 2F8NH 4IHSA 3QPTA 2GZWA 2OZ6A 2YUSA 3K4KA 3LSHA 4L5JA 2XVCA 2IJLA 2ZXWH 5FB2A 3DEUA 3HYIA 4Y13A 2EFWA 2TCTA 1KX3C 1YJ9I 4O3MA 2VI6A 2IT0A 4AWLB 2FQ4A 2Z16A 2JSPA 2XIGA 2KHMA 3FXMA 3M4OJ 3HHGA 3BZCA 3RZDJ 3V8JA 2CQ7A 4JJNB 1CF7B 3SZGA 1X1AA 1XS9A 3LQRA 3REKA 4DQYB 3PFIA 3Q0WA 4U7BA 1IAWA 1RRJA 3REKB 1UG0A 3BCBA 3K2ZA 5B40D 4G92B 2RAEA 2F5CA 4U87A 3AZHA 1S5LC 2PMUA 3AZHB 5DNNB 3VH5T 4NC6A 3FWEA 4DBRA 4NE6A 5J1RA 2HDWA 2MGQA 5IT9Z 4H9QA 3KUYC 4H9QB 1BL0A 5B1MD 1T2KA 5B32D 3K70D 4ESJA 5E3OA 3QPSA 4QLCD 5F64A 1TZYB 4FETA 2XSJC 5B0YB 4BUPA 3GMEA 2HOTA 4HV5A 3U1DA 2GXAA 2VC1A 3TQNA 2V1XA 2JA7J 2LKPA 5TRDA 4WU9A 4ZYHA 4XRSA 4Q47A 4PJJA 3NAUA 1OPCA 2L7MP 5FD5A 2DODA 2X1DA 4PFOA 3I5UA 3P7NA 2F8ND 4C30A 4NUBA 4FX0A 2PG4A 4H9SA 2K86A 2HVQA 2ADUA 3KYDB 4IPAA 4J8UC 4J01A 3KYLA 2ZCWA 3BROA 4HDVA 4RBOA 1VQ8I 4OIPF 1ITYA 2EK5A 1ETQA 2G9WA 3CLOA 4RS8A 2DXIA 3MEXA 2X6YA 1TZLA 4X23D 4UVBA 3LELA 5AV9C 3O62B 1MDMA 4C2UA 2ZJ2A 3CDHA 2BEOA 1MDMB 4XRFA 2HYFA 2IO5B 1KX5B 5K5QA 1GT0C 1QVUA 1XMAA 3H9JA 4BS9A 4FT8A 4CH7A 3CMAI 2LY1A 5M3MJ 1KZHA 4Z5TA 5TGTA 1WI9A 2M0CA 4EJWA 3VH6W 5FRMA 2KZGA 3K69A 3E5UA 3BY6A 2VL8A 3SEQA 4F93B 3AZED 2H8WA 1UJ8A 3E5XA 1SFEA 2BZTA 3BTIA 3IL2A 1D5YA 3WA9B 1S6LA 3TMOA 1X1BA 4A3LJ 4E45A 2Q1ZB 1W5CC 1ZGJA 1ZLAA 1OCCH 3TO7A 2P5LC 5LFAA 1IW7F 1RUNA 1ON1A 5EGOB 1K7AA 3REID 3E6MA 3O8HA 3E7LA 4R8HA 2OTLI 4PJ0C 5AV8A 1DU6A 3B0DB 3JW4A 3T5XA 4BEHA 4A93J 3AKZA 3BDDA 2VJIA 4BEHB 1R5HA 3S16J 4BE1A 3OR2C 2GXGA 1WH5A 2LBFA 1XDUA 3CCRI 2V9VA 3BR3A 3J81K 1SD7A 5J4VA 1U9NA 2DOFA 3T8TA 2JCHA 4WV4B 1V3FA 4CO8A 2BVLA 5EZGA 4IHYA 3AG2H 3I71A 5GPCA 3OS2A 1SC7A 3AG4H 2FRHA 4OIOF 1KX3A 2NZDB 1KX3B 3CQZJ 5B1LD 2BY3A 5L3CA 3GTLJ 3AZMD 3A01A 3SEZA 2COMA 3KLNA 1WHUA 3C1CA 3HKZN 1LFBA 2FX0A 2O03A 2K9NA 1T8IA 4FQGA 3HTSB 4XSZF 4H9OA 4ASNA 1RETA 1BH9A 4ZYEA 4H9OB 2P7CB 4LGWA 1U2WA 3C2GA 4N9HA 2NAZA 3GBGA 2E2JJ 4L9VA 2EFOA 4OU0A 3NQJB 3AZKD 3A4CA 1JTYA 1MKMA 2BE5F 1JKOC 3S15J 2MSYA 3R0AA 3LSTA 3EUKL 2VPLA 2G7UA 2CV1A 5FKKA 2ISYA 5J8FA 2BBYA 2LK2A 5BPIA 2DQRA 3BP8A 2DAOA 2L02A 4U0WA 3KUYA 1VF9A 1T98A 4AIHA 5FFZA 4IXAA 2KT0A 2M34A 4IQJA 3HRTA 3C3WA 5C4XJ 4KDPA 2XDVA 1F1ZA 5F0HA 3CCMI 4A2UA 4UNOA 1P3BD 4EJUA 2ZO4A 2F5EA 2F4MB 4UV9A 3W99C 1PP8F 2FMLA 4J8VC 5DEQA 1HQ3D 4XK4A 2VC0A 5F6FA 5AV5D 3REHB 4IRGA 3RIRA 2K40A 1RC9A 1RESA 3P5JA 5GT3C 3P5JB 2ID6A 2L9RA 3PUBA 5CVUA 5HDKA 4J8UA 2YS9A 3H9QA 4A3JJ 5GXQC 5AVBD 4J8UB 3FXKA 1IXRC 3BOQA 1GXQA 5AV9A 2E5ZA 2XAQA 2L0KA 1JTXA 4E7HA 1W5SA 5B1MB 1HW2A 5F08A 5B32B 2DMNA 2KLOA 3X2QH 3DXJF 1S7EA 1R5GA 4JOMA 1ZAOA 2NS8A 3B6CA 3EPJA 3CJNA 3O62D 4TV7A 4UVAA 1G8XA 1Z7UA 2KIUA 2M8GX 4CSRB 1K78A 3LQQA 4MIMA 5E1ZB 1R6RA 1ZG3A 3ABUA 3FXUA 2MLKA 2DYSH 2F8NB 1IZ1A 4HX7A 1VQMI 3COAC 1FX7A 2VLAA 3MNNC 1HXDA 1KYZA 4ZUXD 2CQXA 4UUVA 2LMDA 3X1UD 5J40A 5E8IA 5J47A 1CGPA 2HR3A 2KIQA 2RQQA 1A6IA 2RN7A 3TU4C 1P3LD 3LSRA 2JVGA 2RC4A 4A12A 2D5VA 3AZLC 3O3KA 1BI0A 4C3IJ 4GO1A 5HOOA 4WX9A 1O3TA 4W1UA 3HPHA 1JE8A 4IHWA 4X1EA 4BE0A 1JUMA 4A0ZA 1Y8QB 1F66D 1X1PA 2JT1A 2COBA 2IS1A 3H0RC 4KICA 4XICA 3WKJD 1QHHD 3L2UA 3MAJA 2X1EA 3M1CA 4I98B 2DA4A 2BG1A 3DLLF 1A31A 1FTTA 4A3BJ 1Q1HA 3WTXC 3TO6A 2QF7A 4CYDA 2NS7A 5BS7C 1AOYA 1G3SA 4A0YA 1FIPA 2F48A 4PFPA 3X1SC 3FHZA 4DRBA 3OOUA 2JQ7A 2OJED 3ERED 1X3WB 2JVHA 1SFKA 3ASOH 3LA7A 2EB7A 3REIB 3AFHA 1HSTA 2VN2A 1DPUA 3BR5A 5GPAA 3OYMA 3D5RC 1JFIA 2IP2A 4MNUA 2R7ZJ 2CH0A 2PN6A 3Q9SA 3R45A 1I6XA 2QENA 4OINF 2LY2A 2UXNA 1Y8RB 3E3VA 1FYLA 1K4SA 2TRTA 1LKXA 1QZZA 4H9NB 2K9LA 1W0UA 2VT2A 5DV5A 1J09A 3O2PE 4KT6A 3SXYA 3WHBA 4G7HF 4UUTA 1DU0A 4KUDD 1FOWA 2Z3YA 2DOEA 2LFBA 3DKXA 2ECBA 3IH4A 3CO7C 4FTHA 5B1LB 2LVSA 3WTPD 3L9FA 5D5XB 3W99A 3FK6A 1WSUA 2XSDC 4J8VA 2X6XA 9ANTA 2VJ4A 1ZHFA 4J8VB 3W2AA 3EDPA 3RQ4A 2H6BA 5FD6A 4Y15A 1BBYA 1WI3A 3KLOA 2B7EA 1FNNA 1P4WA 1R22A 4EGYA 3BQYA 2E1OA 4IZZA 1TBXA 3BC8A 3FM3A 5E79C 5GT3A 2XGDA 2GA1A 3MGQD 5GT3B 3FMRA 4WCGA 1QVTA 3KXBD 3X1TB 2DMQA 3SDBA 1SFOJ 5GXQA 2CV2A 2H1LA 4WXHA 1JKPC 2VKVA 4BXXJ 2MD0A 5M5WJ 1T3UA 1AOID 4NE5A 4J8XD 3ECOA 2JA2A 5B2JB 4ZC3A 1KX4D 3OIOA 3VH5W 5J1YA 4YM6C 2M7BA 3ROUA 2HS5A 1XSDA 2Y69H 1I50J 1Z3YA 2K4BA 3FMQA 3H35A 5FLXK 2IGOA 1TAFA 1H89C 3DQVC 3MVDC 3C1BD 1PUEE 1MMDA 2CG4A 3RJPA 3TP0A 3AFAC 2DK8A 4M6XA 3AN2C 4XLNF 1FSEA 3S2DJ 5BNXA 4LLNA 3HGYA 3EPLA 1TQPA 3RPUD 4DYCA 4KA4A 2JA6J 2PEXA 1VZ0A 3MNNA 1P3MD 3BG6A 1YLFA 1IN8A 3MNNB 1NTCA
chains in the Genus database with same CATH topology
1UHWA 2IA0A 4J8WC 3BPXA 1G3YA 3REOA 3JAMZ 4WWCA 4Z2MH 4QWQA 3TU4A 3AZLA 3TU4B 4Z66C 2Z5UA 5B24D 1W7PD 2GWRA 1UCRA 5JVTA 3I64A 3DPLC 2LY8A 3CUOA 2XAGA 2YX7A 1EH6A 4PDKA 1H3OB 1R1UA 1P3FC 3W96C 2G7HA 4CXFA 5BS7A 2EJRA 1XGNA 2CYYA 3X1SA 4KIBA 3X1SB 5K5OA 1PZRA 5LGNA 4A0XA 2E1NA 3CUQC 3J80Z 1JHFA 4WNNA 3EETA 3I0TA 1YTYA 2B0LA 5E20A 4B8XA 3RDIA 5B31C 2HEOA 1DP7P 1P3AD 3I59B 4L9TA 5D5VB 5LGTA 2CV5D 1ZRCA 1FLIA 2E7XA 1IRGA 3MZHA 4G91B 4M6YA 4XUJD 2PYOD 1OYIA 3UTBC 4KNYA 1HW1A 1FBQA 4CGZA 1WQ2A 1J59A 1XCVA 2AROC 5CLSA 1BH8B 2OA4A 1P3PD 5JR3A 4XZQD 1P3KC 2K27A 5CVRA 1MGTA 4I0BA 3QRFF 1R4VA 5HLHA 4OMZA 5BOXA 3AZGC 3U9GA 4HZFA 1K6OA 3KETA 4IRHA 4YM6A 3NRVA 3WTPB 3T8RA 1SFUA 1BJAA 3MVDA 3MVDB 1V4RA 3AFAA 3AN2A 2HKXA 3KCCA 3H0MC 2Y2LA 3KP7A 2BYVE 1DUXC 3IWZA 3L7WA 1HW5A 2EA4A 4EV0A 3U2RA 5B33C 3KXBB 2W84A 4HOBA 4J8WA 4J8WB 1AOIB 4Z66A 2LDUA 4GGGA 3REKD 4Z66B 2F8NK 2ZNZA 2A3SA 4G6DA 4KHAA 1KX4B 4KHAB 1GHCA 3AZHD 4AVPA 2A6HF 5DYMA 2KJCA 1A04A 3C1BB 1TQMA 3IHUA 1P3FA 1ONVA 4LG0A 4LG0B 3W96A 2QQAA 3DV8A 4UXNA 1XB4A 2UWXA 3VOEA 5HDGA 4EQQA 3CUQA 4P9UA 3CUQB 4GYGA 1A7WA 2DO7A 3WAAD 1LDJA 3R60A 4OMYA 1XDSA 4BHPA 3ZPLA 1O3QA 3GX4X 3TGNA 1GXPA 5B31A 3GF2A 1DDNA 3O62D 3LELD 4EJTA 3OV8A 2CW0F 5HLGA 1M19C 2MBFA 2Y2PA 3MGPC 3AV1C 4CHUA 3M8EA 3RKWA 3QPHA 3V8KA 3LJAC 3MGRC 3HRMA 3UTBA 3UTBB 1I1GA 1SAXA 5BMZA 1ZGAA 2P7VB 2AROA 4UPKA 3RYRA 2QVOA 5CP6C 4L9JA 1P3KA 1B9NA 1BC7C 1P3KB 1P3IC 1ZLAD 5JRGC 3W97C 2EV0A 3PQKA 1P3AB 3QAHA 3AZGA 5BS6A 5AV8D 2CV5B 4MTEA 3QU3A 5LBQA 3EUHA 2WWYA 1J7KA 2PYOB 4YFNF 2HIOB 3F22A 4HF0A 2Q8KA 2Y0MA 4P96A 3EYIA 5AV6C 3B6FC 3FF5A 4CDGA 3G3ZA 1KX3D 2RV8A 4MEXF 2AXLA 2FMYA 4XZQB 1ULYA 2K7LA 5B33A 2ZKZA 2OD5A 5B33B 1Z2CB 2DU9A 5BPDA 3GW2A 4RB0A 3WTUC 1RIOH 1EQZC 4KGCB 2KRFA 1YO5C 3REJC 4EMSA 5D4SA 4Q5SF 5H6QA 4G7OF 3VH6A 5FFXA 5HLIA 4WZSB 2BYMA 4ZYDA 4HLYA 2BYMB 3ZMVA 3AZJB 3KUYD 4L18B 5BNVA 3HRUA 3KP4A 5BNVB 5F99C 3J7AO 1W4MA 3C1CC 2KIFA 5D5WB 4HLXA 2W24A 4YIFA 3NQUA 1XD7A 5E5AC 3REHD 3F6TA 2HQRA 4J8UD 2STTA 3F8NA 3SZTA 3K1MA 2D2WA 2YFWA 1M19A 4GXOA 5AV9D 4WXDA 1M19B 3MGPA 2E7WA 3AV1A 5DD8A 1YFHA 3MGPB 3AV1B 5IT9K 1LDKB 3NQOA 1MD0A 3LJAA 1KA8A 2RGVA 3MGRA 2IA2A 3MGRB 2ZY5A 3ZN0A 4RB1A 1R58A 3TDUC 1FOKA 1B9MA 3VEPA 4YFXF 4WU9B 2CWEA 4HAMA 1WWIA 4UUZA 2Y2MA 2M1BA 2C6YA 1T38A 3LZ1C 3WAAB 5CP6A 1U6GA 5J6XA 1T39A 1P3IA 3BJOA 3W97A 1YS6A 5JRGA 2O3FA 1MZBA 3W97B 3LELB 5C3IB 2DF4C 2PFBA 3X1VC 3IRRA 3GEZA 2LNBA 2JSCA 1BI2A 1ID3C 4Z5TB 3KSYA 3W98C 5DDGA 1M18C 5AV6A 3B6FA 2ELHA 5E18F 3B6FB 3GFIA 3R61A 5JI6A 2OQGA 3IKTA 4P55A 1I27A 3A6NC 3RYPA 1P34C 1SD6A 1ZLAB 3V8LA 2NS0A 5CPJC 1EQZA 5B31G 5LHGA 5AV8B 2GA2A 4WU8C 3REJA 3WG9A 4BHBA 4ZZDA 3UTAC 5ILUA 4S04A 1P92A 4EJOA 1FP1D 4EJVA 2NRAC 3I54A 4P5OA 5F99A 1EH7A 3M8FA 2L4AA 5CJ9A 3C1CB 2PBIA 4KUMA 3W99D 3V7SA 3B0CT 5JHUA 2VQRA 4J8VD 5L3EA 5E5AA 1BH9B 1YS7A 5E5AB 1YW9A 2A07F 3ISPA 1NHAA 2PJPA 2DLLA 3I58A 5ILVA 1R36A 5GT3D 3KZZA 1QPMA 1P3OC 3AZFC 3X1TD 3ML6A 2FJ7C</