1ULYA

Crystal structure analysis of the arsr homologue dna-binding protein from p. horikoshii ot3
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
190
structure length
190
Chain Sequence
b'AKKVKVITDPEVIKVMLEDTRRKILKLLRNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEMKGNLVEKYYGRTADVFYINLYLGDEELRYIARSRLKTKIDIFKRLGYQFEENELLNIMDRMSQKEFDATVRISKYIEEKEDALKDFSNEDIIHAIEWLSTAELARDEEYLELLKRLGSILK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PH1932
publication title Crystal structure of the PH1932 protein, a unique archaeal ArsR type winged-HTH transcription factor from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Dna binding protein
total genus 70
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2003-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ulyA01
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1ulyA02
1H0MA 3I54A 4G94A 4A0XA 1TBXA 1H9GA 1J2XA 4J8VD 4IJAA 3AN2B 4U88A 5HOOA 3W98C 4H9RA 5IT9K 1BI1A 3GW2A 2R3SA 1T2KA 1JE8A 1FY7A 4H9RB 4CO8A 4MNUA 3I59B 4IRGA 1P3OC 4HV5A 3HTUA 2VOOA 4IXAA 5AY8C 4BAYA 4EMSA 3A6ND 4MTDA 3WKJD 2QQ9A 4GYIA 1M18C 1EH6A 2VBXA 3F8BA 1HQCA 5L3FA 5DD4A 2VT2A 2P6TA 5B24D 4O5VA 2GAUA 1Z6TA 1E2XA 2Z99A 5B1MA 3RELC 1B6WA 5FD6A 4DRAA 5BPDA 3W99C 3LELD 2FEZA 2IVMA 2XAHA 3ZMVA 3WE2A 5B1MB 2XAQA 3MVDD 3GO5A 3SHFA 5G49A 5J6XA 4KN7X 1ZRFA 5E18F 2C6YA 2XV4S 3HSRA 5B0YA 2JPCA 1LJ9A 4YM6D 2AROD 2XIGA 5AONA 3COAC 2RV8A 2H27A 3GZ6A 1YIOA 3K1MA 5G49B 3MGSA 5AIPA 3LJAD 3REID 1F66D 5B0YB 1TNTA 3B0DB 5GT0C 4H9OA 4A0YA 5B31G 3AZIA 3MGSB 5CPIA 4A5MA 2VT3A 3V8JA 3KWQB 4H9OB 5LEKA 3AZIB 2FSWA 5CPIB 3KXBD 5D5VB 1HSJA 4CDGA 4Y13A 1KX3A 2Y75A 1FWZA 1SAXA 2BYKA 2IW5A 3AZLD 3B02A 2ZNYA 3F8NA 3B0BA 5GXQC 3BJOA 5B2JA 3H92A 3REHA 3RYPA 4XRFA 1KX3B 2STWA 2BYKB 3J81K 3CUQA 2VBWA 5D4RA 4OMZA 1NHAA 1UHMA 3WGGA 5B2JB 3REHB 2IO5B 3G3ZA 1YW9A 1J7KA 1QZZA 3CUQB 1P3MD 3M8EA 2M5WA 4KICA 1QO0D 1Y0UA 3V7RA 2Z9OA 1S29A 4XZQB 3H3ZA 3MQ0A 2Z3YA 3DQVC 5DUIA 4WU8C 2ZCWA 1M19D 4LJZF 5L3CA 5DNNC 3FF5A 1G3YA 1AOIA 1TW2A 4J8XA 2WV0A 1P3AD 1F5TA 3EUHA 5BT1C 3AYWC 1YS7A 5E5AD 1AOIB 4J8XB 4DNCA 4BHPA 5JVTA 1P3IC 3KP4A 1RUOA 2MLKA 4LK0F 3B6GA 2WTEA 1YO5C 4DRBA 1USTA 4HQEA 3HRSA 4PZJA 3B6GB 3QPTA 2NQBD 2EFQA 3RKWA 1R7JA 1BN5A 2RVQC 4XUJD 1KA8A 4Z66C 5H6QA 1WSUA 2J5PA 3FXQA 4LB6B 4BH9A 1ZRDA 4Y15A 1CGPA 3VH5A 3X1TC 3S2WA 3E6MA 3FXUA 1G6NA 1IZ1A 1O3TA 3UTAA 3F72A 5B32D 1U5TA 2L54A 1ID3A 3WA9B 5EEGA 4EJOA 3UTAB 1JHFA 3RIRA 4G91C 3SFZA 3KETA 2PG4A 1ID3B 4UXNA 3KUYA 1XN7A 5AVBC 3T0YA 2CO5A 3ABUA 3FX3A 3AV2D 4KA4A 2EK5A 4ESBA 3JSOA 2YX7A 2OBPA 3KUYB 4I02A 4LD9C 3W96D 1HW5A 1M1AD 4AIJA 4N9HA 1LVAA 2VE9A 3DV8A 2JZYA 3ECOA 2XROA 4H9SA 2KJCA 3PQJA 3REOA 4H9QA 4F7ZA 2JRTA 1I1SA 3G73A 2ZMEA 4EJUA 1W5SA 4IRHA 2LF7A 3MAJA 1I1GA 4H9QB 3HOSA 4I09A 2CW0F 2ZMEB 2QUFA 5TRDA 1OYYA 3LA3A 2HUEC 2L4MA 5B33A 1FYLA 2XAFA 2HS5A 1YQAA 4OIOF 5AV6C 2WWYA 3UT9C 3AZGC 4AWXB 4IPAA 4KNYA 1ZLAA 4M6YA 4QWQA 3AV1D 3KP5A 3VH6T 4BHCA 4XSZF 4R8PA 4UVBA 2XUBA 1ZLAB 2EFOA 3IRQA 5B0YC 3GLXA 4R8PB 3CUOA 1HBXG 3IHUA 1ZAOA 3DKWA 1SMYF 1CF7A 2BGCA 4M9XA 5LHGA 2FF4A 3MGPB 5CPIC 2PN6A 4M6XA 2E1CA 3REKA 2DPDA 2P6SA 1CF7B 1P6RA 2H6CA 4YIIA 5E8IA 2P7VB 3R61A 1BH9A 5GT3D 4JK1X 3REKB 1KX3C 2Q2EA 2KIMA 5LBQA 3REHC 5BNVA 5B0ZA 1FZPB 2HIOC 4YG2F 3CUQC 3FMSA 5A2QZ 5B40D 5CP6D 5C3IB 1ONVA 2CFXA 4P96A 1LQ1A 2NYXA 2FJ7A 4P55A 4ESJA 1O57A 5BNVB 5J8FA 3BJ6A 4LG0A 1XSDA 3M1EA 4WK8F 3PFIA 1KX5A 4GO1A 5GSUD 3KLNA 1ZG5A 5DNMD 4X23C 3W6JB 3V8LA 3C1BD 4EGYA 1KX5B 4U7DA 1USSA 2CV5D 3I4PA 4J8VA 1LDJA 4QLCD 4J8XC 3HRMA 3X1VD 1J9IA 4RB1A 1F1EA 1U78A 1IF1A 2M8EA 4J8VB 1KU5A 2QBYA 2GQQA 3J7AO 5B1LD 5FLXK 3AZEA 3B6GC 4HYEA 4A0ZA 2BYMB 3B0CT 3NQJA 2QBYB 1YLFA 2ZJ2A 2K86A 2K7LA 3A6NA 3AZEB 3WKJA 3NQJB 3CTAA 3TGNA 4CXFA 4ZUXD 2VC1A 1KQ9A 5CLSA 3GFMA 3AZND 3A6NB 1OMIA 2M87A 3WKJB 4YFNF 1IAWA 4KIGA 1R1UA 2HOEA 5B24A 2BYVE 2EA4A 4AIHA 4L0ZB 5B24B 5LLQA 3LELA 4J8WD 1OKRA 1U5TC 3V9RA 3REJD 1ID3C 3HHGA 3BZ6A 3KFWX 1LB2A 3AZHC 3MVDA 2QWWA 3V7SA 2PYOD 3LELB 3MCZA 1Z1DA 4CYDA 3V9RB 4JQFA 2BEOA 3KUYC 1BJAA 3MVDB 1F66A 3LJAA 3REIA 5DCFA 2QLZA 3ZN0A 4FX4A 4UUZA 4B09A 2AROB 1A04A 1P3LA 3I71A 5CJ9A 5F99D 1XB4A 1F66B 3F21A 3LJAB 3REIB 3FXRA 2MLGA 2Q8KA 4CZZA 5L3EA 2LNBA 2OQGA 3U9GA 3KXBA 1EQZD 1QBJA 4I98B 3GF2A 2ZKZA 3AZLA 1XGNA 4HQMA 5H20A 3KXBB 1BOAA 3AZLB 3ZQ7A 4RS8A 5BPIA 1P3BD 3B6FD 1K78A 3D0SA 3DEUA 1P3MA 3RTRA 1O3RA 3BDDA 4KFCA 5B33C 1XMKA 4U0VA 1K78B 3M9AA 1P3MB 2UXNA 1KGSA 4HV6A 1YS6A 4LLNA 4GCVA 5D8KB 1KU7A 3JTHA 2MBFA 2QQBA 3VH5T 4FX0A 1K6OA 3AZMC 2QQAA 3RPQA 1M19A 3WAAD 2UWMA 1ZLAC 1KU3A 4EGZA 1M19B 1P3AA 3W97D 3KSYA 3C3WA 4Q48A 2L02A 4EQQA 4ZYDA 1P3AB 3P9KA 3P7NA 3WU1B 4YS3D 1TZYD 1MGTA 1KU9A 2HWVA 4KUMA 1SFUA 1AOYA 3REKC 1S32D 3OOPA 1P3FD 4XUJA 1MJ9A 3F8MA 2V1UA 1LEBA 3LA2A 2P5VA 2NQBB 2GXBA 1XDUA 3MGQD 3AZKA 1XSXA 4XUJB 5BMZA 2RQPA 5B0ZC 1BIAA 1U8RA 3AZKB 3ELKA 2FBHA 5B32A 1DUXC 3X1UD 1ZHFA 3FMRA 1FT9A 2FJ7C 2ZBKA 4Q5SF 1G4DA 2EV0A 3WTPE 2P7CB 2P8TA 5B32B 4G9YA 1BI3A 2GA1A 2DPUA 2LDUA 4HF2A 1KX5C 1R00A 1PP7U 1RUNA 1R23A 3AV2A 1R4VA 5AV9D 1LEAA 4OMYA 2F8ND 2QZ8A 3AV2B 2LSOA 1H3OA 5HS7A 2EFNA 5E20A 3W96B 1M1AB 4KYWA 3J80Z 1TNSA 1H3OB 4J8UD 1TLHB 2XASA 1P34C 2NAZA 3AZJD 3BJAA 3ULQB 4ZBJB 3B73A 3JTGA 2PJPA 3AZEC 1U3EM 4I2OA 1FP2A 1IN7A 1ZARA 3EETA 2DK8A 3A6NC 3AN2A 3WKJC 2PI0A 3L2CA 3GVAA 2PLYA 4AWLC 3WTZA 1QPMA 2V9VA 5CVVA 3I59A 3UTBA 3QRFF 3FM5A 1IXCA 2G9WA 4YIFA 1QZYA 2D1HA 3LELC 3C1DA 3UTBB 1GVJA 1SFEA 4M73A 1UCRA 4A6EA 2A3SA 3MVDC 1BIBA 1FYMA 1STZA 1VTNC 2GIVA 5B2ID 4E45A 5L3DA 2IPQX 3FM3A 2JPBA 4O6JA 3REIC 1B59A 4ZYEA 1P3LC 1T38A 3WTPD 3W6KB 2QYOA 2DQLA 2LF8A 1YW7A 3F6VA 1JHHA 3LZ0D 5GT3A 3MFKA 4WXHA 3RYRA 4A5NA 2MD5A 3BOQA 2HZTA 3W98D 1UB9A 4CHUA 5GT3B 1N1JA 3BPXA 1B4AA 2JSCA 3LZ1D 4WZSB 1P3GA 1T0FA 5CP6A 1N1JB 3VOEA 3KWQA 5AV8C 1P3GB 1P3OD 1FBQA 5B40B 5CP6B 1FPQA 3MZHA 5AY8D 5DCMA 6PAXA 1S6LA 2IRFG 2PEXA 3C1BA 1PUEE 4ZZDA 5DCMB 2ISZA 5ERIA 4NE3A 2CV5A 2EV6A 5DNMB 3R0AA 4Z5TD 1SD7A 3C1BB 2L5AA 4LK1F 3RDIA 4HLXA 3X1VA 4N9IA 3JW4A 3RELD 2CV5B 3MZYA 3E5XA 4EV0A 5HS8A 4KUDC 4XZQA 1OR7A 4B8XA 4G92C 2M30A 3HUGA 3QOPA 4QLCB 3X1VB 3SQNA 3O62D 3C7JA 5ICFA 5CPKC 5B1LA 4Z2YA 2F5DA 5JRGD 1F4KA 1R5GA 2KIUA 3LFKA 5J8CA 5B1LB 3IKVA 4ETSA 4A6DA 3V8KA 4HGAB 2CWEA 3FZVA 1REPC 4ZUXA 2QENA 5BQTA 1L0OC 1FBSA 1OYWA 3WTVC 2OZUA 3AZKC 4ZUXB 5HDNA 4BXUA 1RZ4A 1HKTA 4ASNA 4KHAA 4KT5C 4S05A 2FNPA 5B32C 2K4JA 4NQWA 4J8WA 5GXQD 4MQ9F 3REJA 4KHAB 4EO5B 4UUVA 3ISPA 3GYHX 2PYOA 4J8WB 2E1NA 3K1NA 2RKHA 4AD9A 3REJB 3M7GA 4UVAA 2VONA 2PYOB 2FU4A 3AV2C 2K27A 1BC7C 5ILVA 5D5UB 3LWFA 5F99A 5IT9Z 4XSXF 3WA9A 2JTVA 4WU8D 4LGWA 5F99B 5ILUA 4H0EA 2P4WA 4ZBJC 1EQZA 3GEZA 2IP2A 2HFHA 1P3KD 5D4SA 1UFMA 1DPRA 4JBAA 1R22A 1EQZB 5BT1D 3I0TA 3MNND 3ZMSA 2XKOA 2IT0A 3B6FA 1T98A 2FBIA 2YR2A 4EJVA 1U35D 3AN2C 2NZDA 3CJNA 2DK5A 1P3BB 3B6FB 1RNLA 4NB5A 2NZDB 1BH8A 2W84A 3F6OA 3U2RA 3UTBC 1WI9A 3WAAA 1R5HA 1BH8B 1TTYA 3QAHA 3HYIA 1L3LA 3QP6A 1BM9A 3RKYA 3W97A 3X1TD 3WAAB 3CDHA 3I53A 1F1ZA 2J5OA 1ZRCA 4IRIA 5K1YA 3TO6A 2GWRA 4D0PA 2VN2A 2E7XA 3W97B 3Q5FA 4NHJA 3ROUA 5ICGA 4K2EA 2OZ6A 3AFAD 1J5YA 4ENNA 4WNNA 4YS3A 1WQ2A 4GXOA 4WX9A 3KE2A 2IJLA 4RGUA 5AIQA 1ZG1A 4G6DA 4WNNB 5AVBD 4YS3B 1S32A 1TZYB 5B1MC 1IW7F 1HSTA 1P3FA 2ZFWA 4LD9D 5ED4A 5B32G 1XCBA 1S32B 1LDKB 3FMQA 2ESHA 3J81Z 1ZLJA 4L5IA 3MGQA 5E8GA 1P3FB 1TQIA 3RI4A 3AZFA 3WTSC 3B0DC 3MGQB 1EH7A 1P3GC 5CP6C 3MGSC 3MGPA 1BBYA 1IXRC 5HLHA 3X1UA 1HQ3D 3AZFB 1I5ZA 3C18A 4WXDA 4U7BA 1HKSA 3JSPA 3KWQC 1RIOH 3AZIC 2EWNA 3IWFA 1MJBA 3X1UB 3N4MA 5CPJD 4AVPA 4OOIA 2EB7A 4E44A 1G3TA 2ZNZA 5AV9A 4EJTA 3C1BC 4I7HA 3VB2A 1YW8A 2A69F 1W5TA 3ZP5A 5B2JC 1XCVA 2IO5C 2F8NA 3X1SD 5AV6D 5AV9B 3ZMZA 3FWEA 1TQMA 3UT9D 3RJPA 4ZYHA 3X1VC 1I6XA 3AZGD 2OU2A 2HYGD 2FMYA 2F8NB 4J8UA 4XZQC 1OYIA 4KDPA 1BI0A 1BC8C 2EFWA 3AZJA 1SFXA 1AWCA 2PMUA 5L3BA 2FOKA 2XHKA 2LY8A 4J8UB 2ELHA 5B1LC 4KGCD 1HKQA 3AZJB 5JA4A 4BYYA 1LNWA 4MHGA 3IC7A 3K1PA 1OPCA 5JA4B 4HX7A 3AAFA 4IHTA 4ZUXC 1AOIC 1MJAA 5CPID 1ZN2A 2XAGA 1ZGJA 1Z7UA 2Z5UA 4Z2MG 5K5QA 5FD5A 2AS5F 3ZMUA 2BYMA 4HZFA 2G7HA 1U6GA 2ZXJA 3BY6A 1IN8A 2L01A 4EO5C 3R45A 1ZREA 1F9NA 1D5VA 4J8WC 2DQRA 3WODF 1FSHA 1K79A 3R45B 4Q4ZF 1XSVA 2HIOD 2PYOC 2ACJA 5B2IA 4L9JA 3D5LA 2CG4A 3E6BA 2R7DA 3HIFA 5FFZA 1ZH5A 4G7OF 5B2IB 1JFIA 5D5WB 2COMA 4HW0A 1ON2A 5F99C 1ZLKA 4X23D 3WA9C 1JFIB 3UTAC 2YFVA 3LZ0A 3WTPB 2VOPA 1YG2A 2DW4A 3BROA 2YFVB 3W98A 3LZ0B 3I64A 3F8CA 5BO0B 1S7OA 4YM6A 2AROA 3LZ1A 4NE6A 1P3PD 3F8FA 3KZYA 1J75A 3W98B 2M45A 4YM6B 3LZ1B 3B6GD 2NZDC 3L09A 1O3SA 4E70A 5JHUA 3NRVA 1IN5A 1O7LA 3MEXA 3RKXA 3KP6A 4RAZA 4ESFA 5EEHA 2ZO4A 4H9SC 1I27A 3WAAC 1MKMA 2VBZA 4Z5TA 3HRUA 4OU0A 1D8KA 5F1RA 1DP7P 1Q9CA 2H09A 2KIFA 4L9TA 3WTTC 4Z5TB 4BNCA 2W24A 3KCCA 2XGXA 4YFXF 3RELB 1XDSA 2VODA 1ID3D 1KQ0A 3O62A 3AZHD 1EH8A 3KP3A 4YS3C 3P9CA 3IRRA 1ZG3A 1WWXA 2DU9A 5JRGA 2OAZA 2F2EA 3O62B 2A5YB 1B9NA 2F5CA 3VFZA 1S32C 1D3YA 4ZZLA 1TAFA 5JRGB 1P3FC 4JJND 3VEPA 4R8PC 5KDMA 3U1DA 1TAFB 3WU0A 2CSOA 3MGQC 5E5AA 1R58A 1DDNA 3AZFC 4XLNF 3WTUC 4HBLA 5KDMB 1KX4D 3MGPC 4UV9A 5E5AB 2FA5A 4ZYGA 3X1UC 3TQNA 3EYIA 5GXQB 2NQBA 1ULYA 2RN7A 3C1CD 4WU9D 2WC2A 1GHCA 3WGHA 4KMFA 5BS7A 1YTYA 5AV9C 5B33D 5DD8A 2F5EA 1WWIA 5C3IC 3F23A 3V7CA 3ZMTA 4RB3C 3HHHA 1LDDA 1X3UA 4N0BA 5DV5A 2P5LC 1KYZA 4WU8A 4I0BA 3AZMD 2EV5A 2VC0A 4HX8A 1B9MA 1ZLAD 5FLXZ 1P3KA 2QVOA 3PQKA 4XBFA 3AZJC 4WU8B 1BFMA 3TU4D 3O3KA 5LGUA 1HW2A 1JGSA 5E1ZB 3MNNA 1P3KB 1Z6RA 4XLPF 1HTAA 4L0YB 5AV5D 2HYFA 4WWCA 3MNNB 1U35A 2DFIA 3W96A 2O61A 2DO7A 2O0YA 1M1AA 4LD5A 4J8VC 1U35B 2H6BA 1Z91A 1JXSA 3LAPA 5E1WA 4H9PA 3LQRA 3NEUA 4GYGA 1MDMA 3OV8A 4R79A 4LLLA 4H9PB 3O2PE 3VH6W 1ZYRF 2AXLA 3RPUA 4KIFA 1MDMB 2RGVA 2FBKA 5LGTA 5B0ZD 4L9NA 3HSFA 2KKOA 3H3UA 2HTJA 3ZPLA 5B2IC 2FJ7D 3X1TB 3AFAA 2HKXA 5HLIA 3KZZA 3TOAA 5B24C 1FLIA 1QQIA 3AFAB 5AVBA 3GUDA 1D8JA 5B31D 4MGRA 4H9NA 4LD9A 3LZ0C 4PDKA 5AVBB 3AV1A 2G7UA 1W7PD 4P5OA 5CYVA 2FQ3A 3MGRD 5AVCD 4H9NB 4LD9B 4HAMA 1R36A 3AV1B 5HLGA 1S8NA 3IKTA 2UXXA 1G3SA 4YM6C 2AROC 3LZ1C 1P34D 1F66C 3LJAC 4KIBA 1O3QA 1HQ3A 1QGPA 3WGIA 3GWZA 3AZED 3SZPA 2IA2A 2Y48A 1HQ3B 2F8NG 5CPJA 1KU2A 3WTXC 1P92A 3T1BA 2YU3A 4MTEA 1IRGA 3HSEA 3KXBC 4L18B 4I01A 3Q9VA 5CPJB 3AZLC 3X1SA 5AV6A 2HUEB 4Z5TC 3Q9SA 3UT9A 5B40A 3AZGA 3QU3A 5BOXA 3X1SB 2PBIA 5AV6B 1B6AA 4WCGA 4EM2A 1P3MC 3UT9B 3AZGB 1R1TA 3LQQA 4A12A 1V3FA 3ZMDA 3O62C 5LEJA 3B0CW 4KGCA 3KLOA 3SZTA 2X4HA 2VE8A 5GSUA 3LA7A 5JRGC 5DNMA 1WKMA 1M18D 4KGCB 3BWGA 2FMLA 1M19C 5FO5A 5HS9A 4CGZA 3DPTA 5GSUB 5E17F 1MD0A 5K5RA 1P3LD 2QM3A 4YFKF 4QLCA 1FBUA 4M72A 1P3AC 1P4XA 4HOBA 5E5AC 3W99D 1XGOA 5BNXA 2HKOA 1V4RA 2VBYA 3DXJF 4HDVA 3FHZA 3T5XA 5BNXB 5BS6A 2UZKA 5LHIA 4WXCA 5HDGA 2HIOA 1P2FA 3WG9A 1K7AA 2Z33A 2NQBC 4TV7A 1PDNC 5GT0D 3ECHA 2HIOB 4XUJC 5AV8D 3AZNA 5BS7C 1FYKA 1S3JA 3R60A 3MWMA 3AZNB 1SD6A 5D6EA 2IA0A 2PFBA 2YX4A 4X23A 2CQKA 3CLOA 1SD5A 4UNOA 2NS0A 5CVUA 4U0WA 4G7HF 1ODDA 1P3KC 4X23B 4KMUX 3KP7A 5E1XA 5D8LB 2OA4A 2H94A 2MH9A 3BP8A 4KUDD 3MNNC 5JI6A 1P3PA 2Q0OA 5A2QK 1KYWA 1FSEA 2VXZA 2FNAA 4ENKA 2V6CA 1U35C 5CPKD 1P3PB 3W96C 2K4BA 2R7FA 1M1AC 2HGCA 2O03A 4M9ZA 5ICEA 2A6EF 5DYMA 2A07F 5KVRA 4ENJA 5DNND 3VH5W 5LGNA 4UVCA 1FNNA 1IN4A 1Q1HA 3K0LA 4LMYA 5IT3A 4MQVA 1J59A 4PGGA 2KJBA 3AYWD 2ESNA 3AZKD 4HDUA 5HVQC 3EQLF 4M74A 3TDZC 2V1XA 2V1DA 2XVCA 3CO6C 1P3BA 4G7ZF 1P3ID 3WE3A 4ZH4F 2IA1A 5DUKA 1DPUA 4ON0A 3AFAC 3AZHA 3L7WA 3DP7A 4Z2MH 1U5TB 2O8XA 3TDUC 2W25A 3M8FA 5CHLB 2RVQD 3AZHB 4Z66D 2NNYA 1WWSA 3F22A 4EJWA 4IF4A 4IVNA 2GXGA 2XRNA 5L3GA 4JJNA 1GXQA 3AV1C 1YYVA 3F3XA 4EM1A 4RB0A 4HA8A 4JJNB 5JR3A 3GFJA 2MA3A 4DQ2A 4G8XA 1KX4A 2HTSA 4BHBA 2LKPA 1TZYA 4FT8A 1HQ3C 2BV6A 1P4WA 1KX4B 1IN6A 1KQ8A 2MH2A 2HEOA 2D45A 1P4AA 4P9FA 3TO9A 2D1VA 5CPJC 3AN2D 4CSRA 3C1CA 4WU9A 4LB5A 3WTWC 5GT3C 5HDKA 1IUYA 4CSRB 3C1CB 2CGPA 4WU9B 1J0RA 2A61A 4U0YA 1XD7A 3X1SC 5B33B 2YPRA 4UHTA 3QPHA 5JFRA 2PMHA 3UTBD 5B40C 3E5UA 2EA2A 3AZMA 2BE5F 2DLLA 1HW1A 1B67A 3R0JA 3NQUA 3TU4A 3AZMB 1EV7A 2HQRA 3SXYA 3QU6A 3EYYA 4KGCC 1TQPA 4HLYA 3NQUB 4S04A 1FP1D 3TU4B 5GSUC 3VODA 5AV5A 5DNMC 1GXPA 4RAYA 1S7AA 4OIRF 5TJJA 2CV5C 5AV5B 3HTSB 2W85A 4QLCC 4GGGA 2NNNA 4G6QA 5B1MD 2O6GE 2E7WA 3ERED 2M1BA 2FRHA 3R4KA 2DT5A 4CAYA 1BH9B 5B0YD 4HGAC 1FOKA 1P3GD 3MGSD 5CVRA 3ML6A 4CAYB 5CVIA 3GFLA 5B0ZB 4NE5A 3KWQD 3TO7A 3AZNC 3AZID 3E6DA 1G3WA 2FJ7B 2KRFA 4FHTA 4I0AA 3TKYA 3CO7C 3LAJA 1WRJA 2CYYA 1ZGAA 4LG0B 2OQRA 1KX3D 1UHWA 5B31A 5FUGA 4Y17A 4HF1A 5K5OA 3REHD 1W7PA 5B2JD 3REJC 3MGRA 5AVCA 5B31B 2DTRA 4M6BA 5FUGB 2W57A 1W7PB 2Y0MA 4RGRA 3HRTA 4XZQD 1P3PC 3MGRB 5AVCB 3JAMK 1P34A 3O6BB 3GX4X 4R1HA 5LRSA 2JT1A 4A2UA 5ILSA 1P34B 3WTPA 3E3VA 2V79A 3R6SA 3E97A 5LHHA 2DBBA 5H6RA 5BO0A 1EQZC 1YFHA 4LFUA 1BI2A 1O7FA 1AOID 4J8XD 2P5KA 2HR3A 3NQOA 4PCQA 1XGMA 2OD5A 4AWLB 1PP8F 4RB2C 1P3BC 5FFXA 3B6FC 1B1BA 3J80K 5LRRA 1P3OA 4OINF 2DI3A 4PGHA 5ICCA 4P9UA 4WF2A 1XGSA 2D2WA 1H9TA 5AY8A 2F8NK 1P3OB 5F6FA 2F5FA 5DDGA 1M18A 5AY8B 4UV8A 2X0LA 2RNJA 3KEQA 1W4MA 4L9VA 5FGMA 4BQAA 3P9IA 3BPVA 4JJNC 1M18B 1T39A 3ZN1A 3V4GA 1Z05A 2NRAC 3W97C 3RELA 2XKPA 4UUZB 3WA9D 1C0WA 1P3LB 3UTAD 3W99A 3E6CC 1SMTA 2B0LA 1KX4C 3T8RA 3W99B 2O3FA 1TZYC 4HF0A 2HQNA 2YSRA 1A7WA 3T8TA 3KUYD 3K9TA 2K02A 4AIKA 2XAJA 5GT0A 3C1CC 5AV8A 4WU9C 2NZDD 1Z9CA 1R1VA 2ISYA 1RI7A 2MC3A 5GT0B 3L9FA 2GZWA 1TW3A 4RGXA 5AV8B 3GXOA 4OIPF 3I58A 2ADUA 5D5XB 2FXAA 5FB2A 5GXQA 5KK1A 4KN4X 2RC4A 5F64A 3TU4C 5DEQA 2F8NH 4OIQF 4KUDA 3DF8A 2L4AA 1IXSB 3I5UA 3ABTA 5AV5C 1HXDA 4KUDB 1MZBA 5CPKA 1SD4A 1XMAA 4G92B 3DPLC 4MEXF 4Q47A 2DAOA 3E5QA 5CPKB 3TOBA 2PQ8A 3IL2A 5DNNA 2RDPA 4J8UC 4HX4A 2JSSA 2FE3A 5CVJA 4R8PD 5DNNB 3AYWA 2TDXA 4IHSA 1U2WA 3AZFD 3IWZA 2RVCA 5D6FA 4M9SA 3JAMZ 3AYWB 1P3IA 3N97A 3MGPD 3GFIA 3K69A 3WTYC 3DFGA 2L3DA 2EJRA 1P3IB 2A68F 4L5JA 1ON1A 4WV4B 3KEOA 4LLGF 1T6SA 3REKD 4EM0B 2GA2A 4CICA 4Z66A 3QP5A 4QLCU 3L00A 2YFWA 5B31C 4R8HA 2ETHA 4Z66B 3EDPA 2STTA 4O3MA 2BBYA 2YFWB 3X1TA 3KP2A 3MGRC 5AVCC 4M71A 3GZ5A 1FX7A 2EFPA 1FC3A 3VH6A 1IRFA 1E17A 2A6HF 3HOTA 4ENMA 4NFTA 4MEYF 1QNTA 4EVIA 4RGSA 3LSTA 1KX5D 3K2ZA 3WTPC 4G91B 2HDCA
chains in the Genus database with same CATH superfamily
1H0MA 2WV1A 3I54A 4C2UA 3K10A 4G94A 3EG5B 4A0XA 4A69C 5EGOA 4HSRA 1TBXA 3RSNA 1H9GA 1J2XA 2M7AA 3W2WA 4J8VD 4IJAA 1SFKA 4IHXA 4E7JA 4U88A 5HOOA 3AN2B 3W98C 4H9RA 3FBIB 1BI1A 1POGA 2A05A 3GW2A 2R3SA 5EGOB 5IT9K 2WY7Q 1T2KA 3A0HC 1JE8A 1FY7A 4V2FA 2H1LA 3QYBA 4H9RB 3ZGKA 4CO8A 2KDOA 4MNUA 3I59B 4DGWB 1EA3A 4IRGA 1P3OC 3DKXA 2LFBA 4HV5A 3HTUA 3PNVA 3ZQLA 2VOOA 1FIPA 4IXAA 4RAFA 3L2WA 1HF0A 5AY8C 1SC7A 4BAYA 4EMSA 2E2IJ 1MW7A 3A6ND 3C1BB 4MTDA 1YIJI 3GZNB 3WKJD 4YRVA 2QQ9A 4GYIA 1YI2I 1M18C 1EH6A 2VBXA 3F8BA 1HQCA 5L3FA 1VF9A 5DD4A 2EZKA 1E3OC 2V1NA 1X4PA 2P6TA 2VT2A 5B24D 3S3OA 4O5VA 2GAUA 3JRGA 4KISA 1Z6TA 3LL7A 1E2XA 2VL8A 1RKTA 4A3JJ 2Z99A 2LY2A 5B1MA 3RELC 1B6WA 3H1CA 5FD6A 4DRAA 5BPDA 3W99C 3LELD 2FEZA 2IVMA 2XAHA 3ZMVA 2FOWA 1TWHJ 1T95A 3WE2A 5B1MB 4EATA 3CMAI 2XAQA 2R5YA 3MVDD 3GO5A 4XK4A 3SHFA 5G49A 5J6XA 4KN7X 1ZRFA 3H9QA 5E18F 2C6YA 2XV4S 1TT5B 3HSRA 5B0YA 2JPCA 1LJ9A 2F2AC 4YM6D 2AROD 2XIGA 5AONA 3COAC 2R5YB 2RV8A 3OMYA 2H27A 3GZ6A 1YIOA 4XQFA 2VASA 3K1MA 5G49B 3MGSA 5AIPA 3LJAD 3REID 1F66D 1A35A 2Y0SN 2Z16A 1TWCJ 4BBSJ 2X51A 3Q0WA 5B0YB 1TNTA 3W2AA 3B0DB 5GT0C 4H9OA 4JYKA 2V9KA 4A0YA 5B31G 2LG4A 2K9QA 2VPLA 3MGSB 3DEWA 4UUTA 3AZIA 5CPIA 1SANA 4A5MA 2VT3A 3V8JA 2MSYA 2WA0A 2NS7A 4P1WA 3KWQB 4H9OB 1D0XA 5LEKA 3AZIB 2FSWA 1X58A 5CPIB 2OTJI 2QQ8A 2GLOA 3KXBD 5D5VB 1HSJA 4CDGA 4Y13A 2DOAA 1KX3A 2JA6J 2Y75A 1FWZA 1SAXA 2BYKA 2IW5A 3AZLD 3B02A 2GBYA 2ZNYA 3F8NA 2IS2A 1I3QJ 3B0BA 2ELKA 5GXQC 3BJOA 3M3YJ 3H92A 5B2JA 3REHA 3RYPA 4XRFA 1DGWY 1KX3B 2STWA 2BYKB 3J81K 3CUQA 1FOYA 2VBWA 5D4RA 4E4HA 4OMZA 1NHAA 1UHMA 3WGGA 5B2JB 3REHB 2IO5B 1WCMJ 3G3ZA 2PJRA 1YW9A 2H8WA 1J7KA 2UUZA 1QZZA 3CUQB 1P3MD 3M8EA 2M5WA 1WGXA 1QO0D 3A1YA 4KICA 1Y0UA 3V7RA 4E7LA 1QPIA 2Z9OA 1S29A 4PJ0C 4XKBA 2WB1A 4XZQB 3H3ZA 4BACA 3MQ0A 2IBDA 1WI3A 2Z3YA 3ZQIA 2COBA 3DQVC 4HNUA 5GPCA 3CP8A 3CP2A 5DUIA 4WU8C 2ZCWA 4BEHA 1M19D 4LJZF 2M7BA 5L3CA 5DNNC 2BG1A 1D0YA 3OSFA 3FF5A 1G3YA 3SJMA 4BJ6C 1TW2A 1FIAA 1AOIA 4J8XA 4BEHB 1Y56A 1U9OA 2WV0A 1P3AD 2JVHA 5JVGF 4II2A 5IOYA 3EUHA 1F5TA 5BT1C 3AYWC 1YS7A 1OCRH 5E5AD 4F55A 1AOIB 5GAEJ 1WVRA 4W97A 3HOYJ 4J8XB 2VPRA 1X1PA 4F3QA 4DNCA 2PX9A 4BHPA 5JVTA 1P3IC 3KP4A 3Q3SA 5HNHA 1RUOA 2MLKA 4LK0F 3B6GA 2WTEA 1YO5C 2NVUB 4DRBA 1P9QC 3ASOH 5CQGA 1USTA 2HU9A 4HQEA 3HRSA 2NVXJ 4PZJA 3B6GB 4ZTJA 4C2TA 3QPTA 3CJTB 4HEA2 2NQBD 2EFQA 5IY5H 3RKWA 1R7JA 1BN5A 2RVQC 4XUJD 1KA8A 4Z66C 5FROA 2Z1DA 4XR6A 5H6QA 5J1RA 1WSUA 2J5PA 1YE9A 3FXQA 4LB6B 1U0JA 5FKOA 4BH9A 1UAAA 3CF2A 1ZRDA 3LNQA 4HSTA 4Y15A 1CGPA 1Y1VJ 3VH5A 3X1TC 3S2WA 1SVOA 3E6MA 1BR4A 1S7EA 3FXUA 1G6NA 1IZ1A 1O3TA 3UTAA 2DQNC 3F72A 5B32D 2L9RA 3RQIA 1U5TA 1TL8A 2L54A 4DOZA 1ID3A 3WA9B 5EEGA 4EJOA 3UTAB 1JHFA 3I56I 3RIRA 4G91C 3SFZA 3KETA 2QKLB 2PG4A 1ID3B 4UXNA 4D7NA 1VQLI 3KUYA 1XN7A 5AVBC 3T0YA 2CO5A 3VYTB 5IYCJ 3ABUA 3FX3A 2F4IA 2W4SA 4KA4A 3AV2D 2EK5A 4C3JJ 4ESBA 3JSOA 2YX7A 2OBPA 2QSFX 3KUYB 4I02A 4LD9C 3W96D 1HW5A 4U87A 1M1AD 2VJIA 2Y2PA 1IV8A 4AIJA 4N9HA 1OFCX 1LVAA 2VE9A 2W7NA 3DV8A 2JZYA 3ECOA 4F92B 3CCUI 2P81A 2XROA 4H9SA 2KJCA 3PQJA 3REOA 4IOAF 4H9QA 4NBQA 4F7ZA 5F1JA 1TWAJ 3S14J 3CC4I 2JRTA 3HPHA 1I1SA 2VQRA 3H0RC 3G73A 2ZMEA 3A0BC 3OYIA 2IS4A 1W5SA 4IRHA 2AQFA 4EJUA 2LF7A 4D5FA 3MAJA 1I1GA 4H9QB 1S5LC 3HOSA 4I09A 4LITA 2WAQA 2CW0F 2ZMEB 2QUFA 1XG1A 3M4OJ 2Y2KA 4BJ5C 5TRDA 1OYYA 3LA3A 2Q1ZB 2HUEC 2L4MA 2HXOA 5B33A 2NS8A 1FYLA 1A6QA 2XAFA 2EIJH 2HS5A 1YQAA 2CV2A 3S3NA 4OIOF 5AV6C 2WWYA 3PJRA 1TWGJ 3UT9C 3AZGC 4AWXB 1Y0NA 4GRIA 4IPAA 4KNYA 3Q0VA 3B6CA 4AVZA 1ZLAA 3M8JA 5M5WJ 3C2GA 2L7FP 4M6YA 4QWQA 3AV1D 3KP5A 3VH6T 4BHCA 3CZ6A 2HZDA 4XSZF 2K9MA 4R8PA 4UVBA 2CS3A 2XUBA 1ZLAB 2DDAA 3LSKA 1Z0XA 2EFOA 3IRQA 4F91B 4IL6C 5B0YC 3GLXA 4R8PB 2G0EA 4B4CA 3CUOA 1HBXG 3IHUA 2Y2QA 1ZAOA 3DKWA 1SMYF 4J01A 1CF7A 2BGCA 4M9XA 1ITYA 5LHGA 2DOEA 3ZQCA 3S1QJ 1WJ5A 4DYQA 2FF4A 2LD5A 5CPIC 3MGPB 2PN6A 3KZIC 4M6XA 2E1CA 3REKA 2DPDA 2P6SA 3B6AA 3H0LC 1CF7B 2DFEA 1P6RA 2H6CA 4YIIA 5E8IA 2P7VB 3R61A 3QYEA 1BH9A 5GT3D 4MFEA 4JK1X 3REKB 1KX3C 2K9NA 2Q2EA 3CJQB 3QPLA 2KIMA 5LBQA 1X1DA 3REHC 4MO7A 5BNVA 5B0ZA 2K5CA 2Q2EB 1FZPB 2HIOC 4YG2F 3CUQC 3FMSA 5JLXA 3ZRGA 5A2QZ 5B40D 4JX4A 5CP6D 5C3IB 1ONVA 2CFXA 4P96A 1G2HA 1LQ1A 2NYXA 2OTLI 2FJ7A 4P55A 4ESJA 1CQTA 1O57A 5BNVB 2EINH 5J8FA 3PSIA 3BJ6A 4LG0A 1XSDA 3M1EA 2LY9A 4WK8F 3PFIA 1KX5A 2MFZA 4GO1A 3BZCA 2OF7A 2TCTA 2ZM5A 5GSUD 1IUFA 2BOLA 3KLNA 3CF5F 1ZG5A 5DNMD 3W6JB 4X23C 3V8LA 3C1BD 4EGYA 1KX5B 3I4NJ 4E7ZA 3GTLJ 2EZLA 4U7DA 1USSA 2CV5D 3ABMH 3I4PA 2EIMH 2IAIA 1VQ8I 1HA8A 3DU6A 4M3EA 4J8VA 1LDJA 1ACIA 4QLCD 4J8XC 3HRMA 3X1VD 3A1IA 1J9IA 4RB1A 1F1EA 1U78A 1XC5A 3EUHC 5B1AH 1IF1A 2VKDA 2DYRH 2M8EA 1MBKA 4J8VB 1ZK8A 5C44J 3GTKJ 3IH4A 2R7XA 1KU5A 2QBYA 4BE2A 4M3FA 5B66C 2GQQA 3J7AO 5B1LD 1ORKA 5FLXK 3AZEA 4HYEA 4A0ZA 3B6GC 2BYMB 3B0CT 3NQJA 2QBYB 1T3UA 1YLFA 2ZJ2A 1A31A 2K86A 2K7LA 2ECBA 1IDYA 3QQAA 3A6NA 3LMMA 3AZEB 4HRIA 3WKJA 3LSRA 3NQJB 3FXJA 3CTAA 1EF4A 3NWSA 3TGNA 4CXFA 2M3AA 4ZUXD 1P7IA 1KQ9A 2VC1A 5CLSA 3GFMA 5K7FA 4MFDA 3K70C 4E7IA 3A6NB 1OMIA 3AZND 2M87A 3WKJB 2TRTA 4YFNF 1IAWA 4KIGA 1R1UA 2HOEA 2ZY4A 1VNDA 5B24A 1NK2P 2DCEA 2BYVE 2EA4A 3KIOA 4M3GA 4AIHA 1JKOC 4L0ZB 4RA2A 5B24B 3K4BA 5CPRB 2GIZA 5LLQA 3LELA 4J8WD 2Y2HA 5E79C 1OKRA 1U5TC 3IP4B 3V9RA 2ECCA 3HG9A 1VQKI 4ZYAA 3REJD 1NTCA 3HHGA 1MIJA 2HNHA 3BZ6A 3KFWX 3CMEI 1LB2A 3AZHC 3MVDA 2QWWA 3V7SA 2PYOD 4KITB 3LELB 3MCZA 1Z1DA 1X1CA 4CYDA 1E3HA 3V9RB 4JQFA 2VUMJ 2BEOA 2LOOA 1LFBA 2CUFA 2KMUA 1BJAA 3H5AA 3KUYC 4EEFG 3MVDB 4NC8A 4QPOA 1F66A 2DXIA 3LJAA 3REIA 5DCFA 2QLZA 2JMWA 3ZN0A 4D1QA 3OYAA 4FX4A 3ABLH 3H5RA 1JI8A 1LFUP 4UUZA 4B09A 3TEDA 2AROB 1A04A 4JX6A 3EPHA 3OIPA 3I71A 1P3LA 1HC8A 2I10A 5CJ9A 1W36D 1XB4A 3G1OA 5F99D 1F66B 3F21A 3LJAB 3REIB 3FXRA 3DBLB 2MLGA 2Q8KA 4CZZA 3ZR8X 5L3EA 3L1PA 3DPUA 3TBIA 3DLAA 3ZQFA 1Q1VA 2LNBA 1I6HJ 2OQGA 4PSWA 3U9GA 4ZJZA 2OCCH 3KXBA 1EQZD 1QBJA 4I98B 3GF2A 4BDZA 2ZKZA 3AZLA 1XGNA 2I8DA 3EUKL 4HQMA 5H20A 1APLC 3KXBB 1BOAA 3BLYA 4KT6A 1LFPA 2ZMEC 5JLWA 3AZLB 3HOXJ 3JREA 3ZQ7A 4RS8A 5HNFA 5BPIA 4RM3A 1P3BD 3B6FD 3BG9A 2XDVA 1V5GA 1K78A 3OL4A 2HPIA 3D0SA 3DEUA 1NG7A 1P3MA 3RTRA 5KHDA 3BDDA 1O3RA 4KFCA 2ZB9A 2PMZA 1IDZA 5B33C 1XMKA 4U0VA 1K78B 3JCUC 3M9AA 2RNGA 2UXNA 1KGSA 1P3MB 4HV6A 1YS6A 5FKMA 3U1KA 4LLNA 4LG3A 4GCVA 5D8KB 1KU7A 3JTHA 2MBFA 3VYRB 2QQBA 2X6XA 2RREA 3BC8A 1I3AA 4FX0A 3OYEA 3ESWB 2QQAA 3RPQA 1Y1WJ 1K6OA 2R7TA 1IRZA 1BR2A 2WBMA 3AZMC 3WAAD 4RM2A 2UWMA 2XGCA 1ZLAC 2ZXIA 1W2EA 2KT0A 1KU3A 2HI3A 5E3LA 4EGZA 1M19B 4FCYA 1P3AA 3W97D 1WJCA 3KSYA 3C3WA 4Q48A 2L02A 4EQQA 2UWXA 4ZYDA 3DCFA 1P3AB 3P9KA 3P7NA 3WU1B 1VQ6I 1V55H 4YS3D 1X19A 1TZYD 1MGTA 2F4MB 3CD6I 1KU9A 2HWVA 3LSMA 3BQZA 1ETQA 4KUMA 1SFUA 3GTMJ 3MZ8A 1AOYA 3REKC 1S32D 3FKIJ 3OOPA 2XGEA 5KCMA 1P3FD 4XUJA 1MJ9A 3F8MA 2V1UA 1LEBA 3ZQQA 3LA2A 2P5VA 2NQBB 2GXBA 1XDUA 3MGQD 4YELA 3AZKA 1XSXA 3FXMA 1X2MA 4XUJB 1D1CA 5BMZA 2E71A 2RQPA 2X6YA 5B0ZC 1BIAA 2CFOA 1U8RA 3AZKB 3ELKA 2FBHA 5B32A 1DUXC 1MSEC 3X1UD 1ZHFA 3FMRA 1FT9A 2FJ7C 2ZBKA 3PIOF 2LK2A 4Q5SF 1G4DA 2ZFUA 1K6YA 2EV0A 3H0DA 3WTPE 2P7CB 2P8TA 3KYCB 5B32B 4G9YA 1BI3A 2GA1A 4AU7A 2DPUA 2LDUA 4XL9A 4HF2A 1NG6A 2HDDA 1KX5C 3JRIA 1R00A 1PP7U 1RUNA 1R23A 3FHNA 3AV2A 1R4VA 3GTJJ 5AV9D 2ZXHA 1LEAA 3KX2A 5E3MA 1ETYA 4OMYA 2F8ND 2QZ8A 3AV2B 2LSOA 4Y33A 1H3OA 5HS7A 2R7UA 2EFNA 2LMDA 3GMEA 4N4OB 5E20A 3W96B 3CQZJ 1M1AB 1UG0A 3F6TA 4KYWA 2KHMA 3J80Z 1TNSA 3S93A 1H3OB 4J8UD 2X85A 1TLHB 2XASA 1P34C 2NAZA 3AZJD 2EPFA 3BJAA 3DU5A 3ULQB 4ZBJB 2ICWG 2OCEA 3B73A 1GV2A 3FDYA 3JTGA 1YX3A 2PJPA 3AZEC 2WB1N 2X9DA 4MLOA 4FASD 1U3EM 4I2OA 1FP2A 1IN7A 1A5JA 1ZARA 2CQ7A 2XF7A 3EETA 4D7MA 1XMXA 2DK8A 1IJWC 3A6NC 3AN2A 2KFDA 2Y2MA 3WKJC 1GLNA 3KEYA 1PZRA 3OIQA 2PI0A 4II3A 3L2CA 3GVAA 2NVTJ 5H2FC 2PLYA 4AWLC 3WTZA 1R71A 1QPMA 2V9VA 2F6CA 2DJNA 5F27A 1BA5A 2X6WA 4A3KJ 4ITVA 3CCJI 5CVVA 1RETA 3I59A 2NVQJ 2QSGX 3HL2A 4C2MJ 3UTBA 5EG0B 2A6TA 1UELB 3QRFF 3FM5A 1IXCA 2JK3A 2G9WA 4YIFA 1QZYA 2D1HA 3LELC 3C1DA 3UTBB 1GVJA 1SFEA 2K3PA 3MKZA 4M73A 1UCRA 4XKCA 4A6EA 2KRCA 2A5WA 2A3SA 3OY9A 3MVDC 2XAUA 1BIBA 1FYMA 1STZA 4XKWA 1VTNC 2GIVA 5B2ID 4E45A 2WY8Q 4PFPA 5L3DA 2IPQX 2M9HA 2JPBA 3FM3A 1WJFA 1DP3A 3GCMA 4O6JA 3REIC 4BE0A 3LSJA 1B59A 4IHYA 4ZYEA 1Z21A 1P3LC 1Z7LA 1QVUA 3MVPA 4B3XA 1T38A 2BY0A 1GVDA 3FDDA 3WTPD 3W6KB 2QYOA 3PM1A 2DQLA 4H4KC 3K4LA 1J09A 2LF8A 1YW7A 1MSFC 2XD1A 4DJAA 3F6VA 5CKTA 1JHHA 2RQQA 3LZ0D 5GT3A 2UV1A 3MFKA 3K7AJ 1ETOA 4WXHA 3RYRA 4A5NA 3CC2I 2GOMA 2MD5A 3BOQA 2HZTA 3W98D 4R8PC 1UB9A 4CHUA 2E36A 4GDFA 3S15J 5GT3B 4FETA 1N1JA 1R6RA 3BPXA 4BY1J 4CCMA 1B4AA 2JSCA 1UMQA 4WZSB 3LZ1D 2ZY3A 1P3GA 1T0FA 5CP6A 4FE7A 1ENHA 1N1JB 3DTIA 2MD0A 1F36A 3VOEA 3KWQA 5AV8C 1P3GB 1P3OD 1FBQA 2XF5A 5B40B 5CP6B 3U21A 1FPQA 3MZHA 2CRGA 1R4NB 5AY8D 1JGGA 3AG1H 5DCMA 6PAXA 2V9PA 1S6LA 1JUMA 2CUEA 2LKSA 4X1EA 3HJEA 3S2DJ 4DW6A 3OR2C 2IRFG 2PEXA 3C1BA 1PUEE 4ZZDA 5DCMB 2ISZA 3BR6A 5ERIA 4NE3A 2CV5A 5K7HA 2MC4A 1Z2CB 2EV6A 5DNMB 3R0AA 4Z5TD 1QRYA 1SD7A 2VLAA 2L5AA 2BY2A 2JN6A 4LK1F 4HLXA 3RDIA 4N9IA 3JW4A 4DZPA 1YRNB 3X1VA 3RELD 2CV5B 3NARA 3MZYA 3E5XA 4EV0A 5HS8A 4KUDC 4JX5A 4XZQA 1OR7A 2WAQN 4B8XA 4G92C 2M30A 3HUGA 3QOPA 4QLCB 3X1VB 2RAEA 1MNEA 1MMAA 3K4MA 3SQNA 1ZR4A 1ZELA 2XB0X 3C7JA 5ICFA 3O62D 5B1LA 5CPKC 2L7MP 3HUGB 4Z2YA 2GXAA 2F5DA 5JRGD 1F4KA 1R5GA 2GOXB 4B1RA 1Y6IA 2KIUA 3LFKA 4MIMA 4F52A 4PUSA 5J8CA 5B1LB 1N77A 3IKVA 1LPQA 3HKZA 4A6DA 3V8KA 4ETSA 2CWEA 3FZVA 4HGAB 1REPC 4ZUXA 2QENA 5BQTA 1L0OC 1FBSA 2Y2IA 1K4SA 5DTDA 3MKYB 5DS9A 4V2GA 4QTRA 1OYWA 3Q0UA 4XLHA 3WTVC 2OZUA 4B48A 4A3DJ 4ZUXB 3OS0A 3AZKC 5HDNA 5F0CA 4BXUA 1RZ4A 1HKTA 3W6VA 4ASNA 1X2NA 4KHAA 1X1AA 2KLOA 4KT5C 3BG7A 4S05A 1V5FA 1GT0C 2DTZA 2FNPA 5B32C 2K4JA 4NQWA 4J8WA 4BXFA 3S32A 5GXQD 4MQ9F 3REJA 4KHAB 4EO5B 1XS9A 4UUVA 1YHQI 3ISPA 3KYDB 3GYHX 5FLVA 2PYOA 2Y9ZA 4NQWB 4J8WB 2E1NA 3K1NA 2RKHA 2EZHA 4AD9A 3JRCA 3REJB 1ID3C 3M7GA 4UVAA 3X2QH 4W1UA 2VONA 5KNLA 2PYOB 2FU4A 3AV2C 2K27A 3PIPF 1BC7C 2NXNB 3DBHB 5ILVA 3LWFA 5D5UB 3OYNA 4V19K 5F99A 4A3GJ 5IT9Z 4XSXF 3S3MA 4YIRX 3SEQA 3WA9A 1TP4A 2JTVA 3OYGA 3S8PA 2EBIA 2F4OB 4LGWA 4WU8D 5F99B 5ILUA 4H0EA 2P4WA 4ZBJC 3OYBA 1EQZA 1WJBA 3GEZA 2IP2A 2HFHA 1P3KD 5D4SA 2MYSA 4XLFA 3BTJA 1UFMA 2W00A 1DPRA 4JBAA 1R22A 3ABKH 1W1WE 5DM7F 2Y2LA 5BT1D 1EQZB 3I0TA 1AU7A 3MNND 3ZMSA 2XKOA 2IT0A 3B6FA 4KJZA 4RLQA 3VWBA 1T98A 2FBIA 2YR2A 4EJVA 1U35D 3AN2C 2NZDA 2EQRA 3CJNA 2XC7A 1Z3XA 2DK5A 2X6OA 1VQ5I 1ZGWA 4DQYB 1P3BB 3B6FB 3K2AA 5JHFA 1RNLA 3C2HA 3HOZJ 4NB5A 4E6KG 2NZDB 1BW6A 2R7VA 1FTTA 1BH8A 1MMGA 4XRSA 2W84A 4CCNA 3F6OA 3U2RA 2B9SA 3K4KA 2JCHA 3UTBC 1WI9A 4PSXA 1VQNI 1H8AC 3WAAA 1R5HA 1BH8B 1QHHD 1TTYA 3QAHA 3HYIA 1L3LA 3CCEI 3QP6A 4C3HJ 4GFBA 2M34A 2MABA 1BM9A 3RPUD 3RKYA 9ANTA 3W97A 1N78A 3X1TD 1DU6A 3WAAB 3HC7A 3CDHA 3I53A 3EPLA 1F1ZA 2J5OA 1ZRCA 4IRIA 5K1YA 3TO6A 2GWRA 2VKEA 4D0PA 2VN2A 2E7XA 3HPGA 3W97B 2DFFA 3Q5FA 3L2UA 3ROUA 4IQ4A 4K2EA 5ICGA 5IPAA 4NHJA 2OZ6A 4HPQA 3A01A 1J5YA 3AFAD 2AXTC 3ZQGA 4AUXA 4ENNA 1WQ2A 4WNNA 2E1MB 5M5XJ 4YS3A 4GXOA 4WX9A 3KE2A 2IJLA 1IG7A 4RGUA 2DT7B 2L9SA 5AIQA 1ZG1A 4UPKA 3A01B 5EZHA 4G6DA 1MBJA 4WNNB 5AVBD 4YS3B 1S32A 1TZYB 5B1MC 1IW7F 1HSTA 2B63J 1KZHA 1P3FA 2ZFWA 4LD9D 5ED4A 1UZCA 1BJZA 4IZZA 5BNGA 5B32G 1XCBA 1S32B 3FISA 3L2QA 1LDKB 3FMQA 2EIKH 2ESHA 3J81Z 3CMMA 1BW5A 1ZLJA 4L5IA 3MGQA 5E8GA 1MH4A 1P3FB 2CW7A 4AYBA 5DM6F 2V6EA 1ETVA 1TQIA 3RI4A 3AZFA 3WTSC 2R7RA 3K4NA 3PL8A 1UHSA 2XSDC 3B0DC 1FMVA 2KDZA 3MGQB 1EH7A 2K85A 1P3GC 5CP6C 3MGSC 3MGPA 1WZ2A 1BBYA 1IXRC 5HLHA 3X1UA 1HQ3D 1MH3A 1I5ZA 3C18A 4WXDA 4U7BA 1HKSA 3JSPA 3AZFB 2JVGA 3KWQC 1RIOH 4IHWA 3AZIC 4QIWN 2EWNA 3IWFA 1NK3P 2AQEA 1MJBA 4FISA 2FUG2 3N4MA 3X1UB 2E2JJ 3IH2A 2HOAA 3O8HA 4AVPA 5CPJD 4OOIA 5M3FJ 2EB7A 2XSJC 3FXKA 3KFUG 4E44A 1G3TA 4RAGA 2ZNZA 5AV9A 4EJTA 3W2VA 1PJRA 5GTIC 3C1BC 2HVQA 4I7HA 3FK6A 3VB2A 1YW8A 2A69F 1W5TA 3ZP5A 5B2JC 1XCVA 2IO5C 2F8NA 4PJMA 5AV6D 3X1SD 5AV9B 3ZMZA 3FWEA 4Z6YA 1TQMA 3UT9D 3RJPA 4ZYHA 3X1VC 1I6XA 3AZGD 2OU2A 1K83J 2K3FA 2HYGD 3PNYA 4BGDA 3UKGA 1R49A 2FMYA 2F8NB 5FRMA 1BR1A 4J8UA 4XZQC 1OR7C 1OYIA 4DZJA 1BI0A 1BC8C 4KDPA 1P3PC 2EFWA 3AZJA 3A03A 1OCZH 1SFXA 1AWCA 3RKQA 4ZDLA 2PMUA 1Y8RB 5L3BA 2FOKA 2PMZN 2CU7A 2XHKA 3F0CA 2ELHA 2LY8A 5B1LC 4J8UB 4KGCD 2DMTA 1Y8QB 1HKQA 4XN0A 3AZJB 2BVLA 5JA4A 4BYYA 1LNWA 3OS2A 3OYFA 1RR7A 2Y31A 1XTAA 4MHGA 4FQGA 3IC7A 1H89C 3K1PA 1OPCA 4FTHA 4CCOA 3A02A 5JA4B 1W5CC 4HX7A 3AAFA 4IHTA 4ZUXC 4IKFA 1AOIC 3L2RA 2KRHA 1MJAA 5CPID 4LIUA 2QKMB 4CZCA 1ZN2A 2XAGA 1ZGJA 1Z7UA 2Z5UA 2HPMA 4Z2MG 5K5QA 5FD5A 2AS5F 3ZMUA 1JT6A 3BTCA 3SZGA 3DTEA 2BYMA 4HZFA 2G7HA 1O4XA 1U6GA 2ZXJA 4OAYA 3OL3A 3BY6A 1IN8A 2L01A 3I3LA 3S1NJ 2QEXI 4EO5C 2JA7J 3R45A 2ME0A 1LKXA 1ZREA 1V54H 1F9NA 1D5VA 4J8WC 4CCLA 2DQRA 3UR3C 3QYFA 3WODF 3GTQJ 1FSHA 1K79A 2M0CA 3R45B 4Q4ZF 1XSVA 2HIOD 3MMYB 2PYOC 2ACJA 3TP0A 2LYCA 5B2IA 4L9JA 4ZDOA 3D5LA 3I55I 2CG4A 1JJ8C 2ZJRF 3H0MC 3E6BA 2R7DA 2V4JC 1BL0A 3HIFA 2W1OA 3QWLA 5FFZA 1ZH5A 4G7OF 2Y2JA 5B2IB 1JFIA 5D5WB 2COMA 1OLTA 4HW0A 1ON2A 5F99C 1FEXA 1NH3A 3D1NI 1ZLKA 3LSIA 4X23D 3WA9C 1JFIB 1OCPA 3QODA 4Y52J 3KYLA 3UTAC 2YFVA 1E0EA 3LZ0A 3WTPB 4BS9A 2L9VA 2VOPA 1D1BA 1YG2A 1Z77A 2DW4A 2X1DA 3BROA 2YFVB 3W98A 3LZ0B 3I64A 3F8CA 2XGDA 2N8GA 5BO0B 1S7OA 2R93J 4QPQA 3VPRA 2AROA 4YM6A 3LZ1A 1WJAA 4NE6A 1P3PD 3F8FA 1AHDP 3KZYA 1J75A 2ZY2A 3W98B 2M45A 4N4NB 4YM6B 1MBFA 3LZ1B 3B6GD 1I39A 2NZDC 2LR8A 5GADJ 2M4GA 3L09A 1O3SA 4E70A 5JHUA 2X1EA 2ZJPF 3NRVA 2ZSIB 4HNTA 1IN5A 2DFHA 2IXSA 2VI6A 1O7LA 3G1MA 3MEXA 5LD2C 3RKXA 2XPWA 3KP6A 1U8BA 3C2BA 3UNGC 1RRJA 4RAZA 4ESFA 1LUJB 5EEHA 2ZO4A 3K70D 4H9SC 5KAIC 5GPAA 1I27A 1SEUA 3WAAC 3HDDA 2DMNA 2P0WA 3IAM2 2LVSA 1FTZA 1MKMA 2O8KA 2VBZA 4Z5TA 3AG3H 3HRUA 4OU0A 1D8KA 2KPMA 5F1RA 2Y2ZA 1DP7P 1R9TJ 2DA1A 1Q9CA 3KPHA 2H09A 2KIFA 4L9TA 2JE5A 2E1MC 3WTTC 4Z5TB 4BNCA 4BQQA 2W24A 3KCCA 2XGXA 4YFXF 3RELB 1XDSA 1T08B 1ZKGA 2VODA 1KQ0A 1ID3D 2AO9A 3O62A 3AZHD 1EH8A 3KP3A 3ONQA 3P9CA 5F04A 1W0TA 1LE8A 4YS3C 4Y4RA 2CUZA 4M6VA 1ZG3A 2FQ4A 1WWXA 2VJ5A 3PUFA 4UB8C 2DU9A 5JRGA 3CCLI 2XB5A 2OAZA 2F2EA 3O62B 2A5YB 1B9NA 1LE8B 1WHUA 2F5CA 3VFZA 1S32C 2DA3A 1T56A 1D3YA 2FD5A 4ZZLA 1TAFA 1JJ6C 1MMSA 5JRGB 5IP6A 1P3FC 4JJND 3JRBA 2E1OA 2R7OA 3VEPA 3G4SI 4A3MJ 1PUFA 3U1DA 5E3OA 3WU0A 2YU9J 2CSOA 1TAFB 3A1KA 5KDMA 3MGQC 2R7QA 5E5AA 1R58A 4NNJA 1DDNA 3MD2A 3AZFC 1LVKA 5J1UA 4XLNF 3I9V2 3WTUC 1PUFB 4HBLA 5KDMB 1KX4D 3MGPC 4FE4A 4UV9A 2FA5A 5E5AB 4ZTFA 4B3AA 1EJ9A 4ZYGA 3X1UC 3TQNA 3EYIA 3EPJA 2E5ZA 1AKHB 5GXQB 2QGUA 1YJNI 2R5ZA 2CMPA 2KZGA 2NQBA 1ULYA 2RN7A 3EPZA 2VJ4A 3C1CD 4WU9D 2EH3A 2WC2A 1GHCA 3WGHA 2DT6A 4KMFA 5BS7A 3BTIA 1YTYA 5AV9C 1M19A 2R5ZB 5B33D 1ETWA 5DD8A 2F5EA 1WWIA 2AHQA 5C3IC 3F23A 3V7CA 2LH9A 3ZMTA 3HHHA 3BCAA 4RB3C 2HOSA 1LDDA 4DBRA 3AL0B 1X3UA 4N0BA 2IEKA 3NWTA 5DV5A 2P5LC 2LP0A 1KYZA 4I76A 2D5VA 4WU8A 4I0BA 1X4OA 2EV5A 3AZMD 2VC0A 3ZXSA 4HX8A 2F5VA 1B9MA 4BL0B 1ZLAD 5B5EC 5FLXZ 1P3KA 1H88C 2QVOA 1WFXA 3PQKA 4XBFA 3AZJC 3GBGA 3P5JA 4A3BJ 4WU8B 3O3KA 5LGUA 3TU4D 1BFMA 1JTYA 2ZXWH 3AKZA 1HW2A 4A3FJ 2HDWA 1JGSA 1TT0A 5E1ZB 1WH5A 4B44A 3MNNA 1P3KB 1Z6RA 4XLPF 1HTAA 3J7AY 2JRMA 3P5JB 4L0YB 4A3CJ 5AV5D 3OYKA 1MNMC 4IO9F 4XRSG 1YJ9I 1JT0A 2HYFA 4WWCA 1QU3A 3MNNB 2DFIA 1U35A 3W96A 3IUOA 1X3WB 2O61A 2DO7A 2O0YA 1M1AA 2E19A 2VXDA 1SVMA 3SDGA 4IQJA 3ZQHA 4LD5A 1WH7A 4J8VC 1U35B 3SYTA 2H6BA 1Z91A 3HEFA 2OUMA 2VIXA 2YUSA 1K4TA 1HCRA 3H3VK 1JXSA 3LAPA 5E1WA 4H9PA 5F08A 3LQRA 3NEUA 4GYGA 2L7KA 1MDMA 5FKKA 2DMPA 4RBOA 3DEEA 3OV8A 4R79A 4LLLA 2LREA 4H9PB 3O2PE 4BKXA 3VH6W 4XLEA 3LSGA 2BY1A 5J1YA 3RQ4A 1ZYRF 1GV5A 2AXLA 3RPUA 3HGGA 4KIFA 1MDMB 2RGVA 2IGOA 2FBKA 3TMOA 4BUPA 5LGTA 5B0ZD 1D1AA 4L9NA 3HSFA 2KKOA 4CYCA 3W3CA 3H3UA 2HTJA 3ZPLA 5B2IC 1VQMI 2FJ7D 3WU2C 3HKZN 3X1TB 5B1BH 3K6GA 3BTLA 1BOBA 3BR3A 4CYCB 3AFAA 5EG0A 2HKXA 5HLIA 1JUPA 5M3MJ 3WHCA 2MGQA 3KZZA 4IEJA 3TOAA 1WJDA 5B24C 1FLIA 1QQIA 3AFAB 5AVBA 1S9HA 2QCOA 3IP4C 4XKVA 3HOUJ 2DYSH 3GUDA 1D8JA 3S16J 2CUJA 4IX7A 4A93J 5B31D 3H5NA 4MGRA 4H9NA 4LD9A 4XONA 3LZ0C 1IRXA 4PDKA 5AVBB 2G7UA 3AV1A 4X0GA 2KIQA 1W7PD 4P5OA 4PJJA 5CYVA 2JSPA 2FQ3A 3NAUA 5J4VA 2E2HJ 1ZQ3P 1RESA 1QA6A 5AVCD 3MGRD 3PFYA 1X1BA 4H9NB 4LD9B 2Z2SB 4HAMA 1R36A 2CQNA 2O9LA 5HLGA 1S8NA 3AV1B 3LOCA 3IKTA 2UXXA 1G3SA 4YM6C 4XM3A 2AROC 3LZ1C 4G12A 3JR9A 1P34D 1F66C 4UUSA 3LJAC 4BJTA 3DTKA 4KIBA 1O3QA 2K40A 2W48A 1HQ3A 3H35A 1QGPA 3WGIA 4WJ3C 3GWZA 4CCJA 3AZED 1FMWA 3SZPA 3MKLA 2IA2A 4UUSB 2Y48A 2VKVA 5FKNA 1HQ3B 3LSHA 2F8NG 1VZ0A 1KU2A 5CPJA 1P92A 3WTXC 3T1BA 2YU3A 1VQ7I 4MTEA 2KP6A 3JRAA 2HQ5A 1IRGA 1SAUA 3HSEA 3KXBC 1B72A 5IYDJ 2WAFA 4L18B 4I01A 3Q9VA 4E7SA 5CPJB 3AZLC 1SVLA 3ZOBA 4XRMA 2BY3A 3HM5A 1B72B 2BHZA 3X1SA 5AV6A 2HUEB 3N05A 4Z5TC 3Q9SA 3UT9A 1JKQC 5B40A 3AZGA 3L2VA 4A3LJ 1N75A 3QU3A 5BOXA 3X1SB 2PBIA 5AV6B 1B6AA 5CQEA 4WCGA 4EM2A 1P3MC 1WPKA 3UT9B 3RZDJ 4Y3OA 1R1TA 3AZGB 3OYJA 3LQQA 4A12A 1V3FA 3ZMDA 3O62C 3PO2J 5LEJA 3B0CW 4KGCA 3KLOA 5EYRA 3SZTA 2XPVA 2DA2A 2X4HA 5F0HA 2QSHX 2VE8A 5GSUA 3LA7A 3BG5A 1ZR2A 5JRGC 5DNMA 2R7ZJ 1WKMA 4D9JA 1M18D 5FKLA 4KGCB 3BWGA 2FMLA 1M19C 5FO5A 5HS9A 1YJWI 1GDTA 3CMYA 1YRNA 4CGZA 3DPTA 5GSUB 5E17F 3OR1C 5J40A 2KZVA 1MD0A 5C4XJ 5K5RA 1P3LD 3QPSA 2QM3A 4YFKF 4QLCA 1FBUA 4M72A 2RIQA 1P3AC 1EKEA 1P4XA 1OJLA 2BXZA 1TZLA 4HOBA 5E5AC 3W99D 1XGOA 4DBQA 2FFFB 5BNXA 2HKOA 2DF4C 1V4RA 1JUSA 2VBYA 2X48A 3DXJF 5EEAA 2IGNA 2DN0A 2O5RA 3EUAA 4HDVA 3FHZA 3T5XA 5BNXB 3E0JB 4PK4A 2DA5A 2H8RA 5BS6A 2UZKA 5LHIA 2DMUA 4WXCA 5HDGA 2LY1A 2HIOA 3S1MJ 1P2FA 3WG9A 4F93B 5FLMJ 1K7AA 2Z33A 3VYUB 3QOEA 2NQBC 4TV7A 4CUGA 3CESA 1PDNC 5GT0D 3ECHA 2JA8J 2HIOB 4XUJC 3RCOA 5AV8D 3AZNA 3OIOA 4HG2A 1N25A 2LBFA 4C9YA 3AL0C 5BS7C 5IOZA 2BZTA 1FYKA 1S3JA 4AM3A 3ERMA 4ZDPA 3R60A 3OYCA 1UJ8A 2R7WA 2PJRB 4PJLA 3MWMA 4AYBN 3AZNB 1SD6A 5D6EA 2KISA 2IA0A 2LBFB 2PFBA 2YX4A 1HDPA 3G2BA 2G5HC 4X23A 2CQKA 3CLOA 1SD5A 4UNOA 2Y2GA 2XD5A 2NS0A 1RC9A 5CVUA 4U0WA 4G7HF 1ODDA 1P3KC 4X23B 4KMUX 1ZTRA 3KP7A 3CCYA 3AG2H 1T33A 5E1XA 2H1KA 5D8LB 1RKWA 2MW8A 2OA4A 2OPTA 5HODA 2H94A 2MH9A 3BP8A 2IS1A 3MNNC 4KUDD 5JI6A 1P3PA 1E3PA 2Q0OA 5A2QK 1KYWA 1FSEA 2DA6A 2VXZA 2WAEA 1M1EB 2FNAA 2E34A 4ENKA 2E60A 2V6CA 1U35C 5CPKD 2VQGA 3H36A 5K7ZA 1P3PB 3W96C 2JJ7A 4B43A 3HXLA 2K4BA 2R7FA 1M1AC 2HGCA 2O03A 4M9ZA 3S17J 1S72I 3IV5A 5ICEA 2LC2A 4RMNA 2A6EF 5DYMA 4BXXJ 1ETKA 5J3LA 1AA7A 3IH3A 3ZCOA 1HDDC 2A07F 5C4JJ 3OWTA 5KVRA 4BDYA 4JP0A 4ENJA 5DNND 3JRHA 3VH5W 5LGNA 2DA4A 4UVCA 1FNNA 1IN4A 1Q1HA 3K0LA 4LMYA 5IT3A 4MQVA 5HLTA 1XPXA 4ZC3A 4PGGA 1J59A 4S0HB 1IC8A 4IHVA 2KJBA 3GTOJ 2JUCA 3AYWD 5F0FA 2ESNA 1K61A 2ME6A 3AZKD 4HDUA 5HVQC 3EQLF 3I4MJ 4L5EA 2R92J 4M74A 3TDZC 2V1XA 2V1DA 2XVCA 3CO6C 1P3BA 4G7ZF 1P3ID 3OYHA 1YOVB 3WE3A 4ZH4F 4X6AJ 3BG3A 2IA1A 5DUKA 4CH7A 2R7SA 1DPUA 4ON0A 4XN3A 2EZIA 3AFAC 3AZHA 3L7WA 2CQQA 2M2EA 3DP7A 2LRDA 4Z2MH 1U5TB 2O8XA 3TDUC 4D5CA 2W25A 1RR8C 3M8FA 3J7ZI 5CHLB 1ERDA 2RVQD 3AZHB 4Z66D 2NNYA 1WWSA 3F22A 2L9NA 4EJWA 4IF4A 4IVNA 2Y0SA 2GXGA 3CCRI 1KONA 2XRNA 4BBRJ 5L3GA 2LKXA 3BCBA 2F48A 4AIDA 1D0ZA 4JJNA 1GXQA 2E5NA 3AV1C 1YYVA 3F3XA 4EM1A 4RB0A 3WHBA 4HA8A 1JTXA 4AC0A 4DIQA 2VB6A 3M07A 1P7JA 4JJNB 5JR3A 3GFJA 2MA3A 2XRLA 4DQ2A 1DQUA 2Y30A 4G8XA 1KX4A 2HTSA 4OAZA 3DBRB 4BHBA 2ZSHB 2LKPA 1TZYA 4FT8A 1HQ3C 2BV6A 1P4WA 1OCCH 1VQ4I 5EDNA 1KX4B 1IN6A 1IGNA 2MH2A 2HEOA 4M3BA 2D45A 1KQ8A 3VH5T 4LOCA 1P4AA 4P9FA 3VSLA 2OJED 3TO9A 2D1VA 5CPJC 3AN2D 3CDIA 4CSRA 3C1CA 4WU9A 4LB5A 3WTWC 2VJJA 5GT3C 2LTPA 3WG7H 5HDKA 3CLQA 3HGYA 1IUYA 2NOGA 2W8SA 1R4MB 5IYBJ 3BQYA 2CGPA 4CSRB 1J0RA 2A61A 3C1CB 4WU9B 2EILH 4U0YA 5GTHC 1XD7A 3X1SC 2HYJA 2K9SA 5B33B 2YPRA 2DOFA 3QPHA 4UHTA 5JFRA 5LFAA 5IP7J 1FOWA 2PMHA 1T0FC 3UTBD 5B40C 3E5UA 2EA2A 3AZMA 2BE5F 2DLLA 1HW1A 1PVEA 2QF7A 4NUBA 3VYSB 2O7OA 3H9GA 2MG4A 1IO2A 5FRNA 1B67A 3R0JA 3HB9A 3NQUA 4I99C 3TU4A 3AZMB 1EV7A 2HQRA 3SXYA 1VQOI 3QU6A 3EYYA 1MMNA 2M4KA 4XOTA 1YX5A 4KGCC 1TQPA 5GAGJ 1U9NA 4HLYA 4S04A 3NQUB 1FP1D 4OWRB 5M5YJ 5GSUC 1OCOH 4C30A 3VODA 3HZJA 5AV5A 3TU4B 5DNMC 4XICA 1GXPA 4RAYA 1V5EA 1S7AA 2VQLA 4OIRF 5TJJA 2CV5C 3D5RC 5AV5B 3HTSB 4BQNA 2WADA 2W85A 4QLCC 4GGGA 3GTPJ 2NNNA 2DODA 4J00A 4G6QA 5B1MD 2O6GE 2E7WA 3ERED 4Y7NJ 3HOWJ 2M8GX 2M1BA 1B8IA 2JQ7A 1D5YA 3JRDA 4YEJA 2DA7A 2FRHA 3R4KA 2DT5A 2X1CA 2QA4I 4CAYA 1BH9B 1B8IB 5B0YD 3BR5A 4HGAC 3S2HJ 1FOKA 4XLAA 1P3GD 3MGSD 5CVRA 4BQOA 3ML6A 3V42A 4CAYB 1F43A 5CVIA 3FXLA 3GFLA 5B0ZB 3CC7I 4NE5A 3KWQD 2HOTA 1VI0A 3TO7A 3AZNC 3AZID 3OS1A 2IS6A 2KQRA 3E6DA 2Y2OA 4XOPA 1G3WA 2FJ7B 2KRFA 1Y39A 4FHTA 4DYRA 4I0AA 3TKYA 3CO7C 2R0QC 3DWLE 1FJLA 4XMYA 3LAJA 1WRJA 2CYYA 1ZGAA 4A3IJ 3A2KA 4LG0B 2K9LA 2OQRA 3VDXA 1KX3D 1UHWA 3EPKA 5B31A 5FUGA 2Y2NA 4Y17A 4HF1A 1RPWA 2OV7A 5K5OA 3REHD 1W7PA 5B2JD 1TC3C 3REJC 5EZGA 2HVSA 3MGRA 5AVCA 5B31B 2DTRA 4M6BA 5FUGB 3MN2A 2W57A 1FOXA 1W7PB 2DDBA 3OYMA 3G71I 2Y0MA 3PSFA 4RGRA 3HRTA 4XZQD 1MBGA 3BR1A 3G6EI 3CCQI 4PJNA 4A3EJ 3JAMK 1W0UA 5AVCB 3MGRB 3O6BB 1P34A 1Z67A 3GX4X 1T8IA 4R1HA 2CH0A 1HOMA 5LRSA 2JT1A 1ETXA 4A2UA 5E3NA 1VQPI 5ILSA 1W36C 1P34B 3WTPA 3E3VA 2ZY5A 1DU0A 2V79A 4ANJA 3GLLA 3R6SA 3E97A 3IAS2 1G59A 2VQCA 2DBBA 5LHHA 1YITI 3HBLA 5C3EJ 4C3IJ 5H6RA 5BO0A 1EQZC 1YFHA 4LFUA 2NOJB 3LFUA 1BI2A 2W82A 3A4CA 1O7FA 4ABZA 1AOID 4J8XD 2P5KA 2HR3A 4UY8I 2JWTA 3NQOA 3S1RJ 3BR2A 4PCQA 1XGMA 2OD5A 4AWLB 5KAFC 5GP9A 1PP8F 4RB2C 1VQ9I 2VKHA 4I6ZA 3BR0A 3M1CA 3FBNB 5FFXA 1B1BA 1P3BC 3B6FC 3J80K 5LRRA 1P3OA 4OINF 1JKPC 2DI3A 4PGHA 3SFIA 3VSKA 5ICCA 5EF6A 4P9UA 4WF2A 1XGSA 5GAHJ 4CCKA 2D2WA 1H9TA 5AY8A 2F8NK 5TGTA 1P3OB 5F6FA 2F5FA 3D5SC 2CQXA 4NC7A 3TP3A 2HVRA 5DDGA 2CV1A 1M18A 5AY8B 2V26A 2LLKA 2NVYJ 4UV8A 1VFCA 2X0LA 2RNJA 3KEQA 1W4MA 4L9VA 5FGMA 3CCSI 4BQAA 3P9IA 2GM4A 1OISA 2CW8A 3BPVA 3O8GA 4JJNC 1M18B 1T39A 3ZN1A 3V4GA 1Z05A 4PFOA 2NRAC 3W97C 3RELA 2XKPA 4UUZB 3WA9D 1QHGA 3AG4H 1C0WA 3F9KA 1P3LB 1X3ZB 2B7EA 3UTAD 3CDLA 3W99A 3FK7A 3E6CC 1SMTA 2V7FA 2YS9A 2B0LA 1KX4C 3PO3J 1QZEA 2DJIA 3T8RA 4NDLA 4BY7J 3BT9A 2FX0A 3W99B 2O3FA 1TZYC 4HF0A 2HQNA 3HOVJ 1I50J 2YSRA 1SFOJ 3MKWB 3G1LA 1A7WA 3T8TA 3KUYD 3K9TA 2K02A 1A6IA 3FKJA 4AIKA 4M3DA 4LIVA 4BU2A 1UG2A 2XAJA 5GT0A 3C1CC 5AV8A 4WU9C 2NZDD 2I5UA 1QVTA 1Z9CA 1R1VA 2ISYA 1RI7A 1MBEA 2MC3A 4XORA 4QSHA 5GT0B 2BHYA 3L9FA 2GZWA 1TW3A 4RGXA 5AV8B 2E35A 5TISC 4XLCA 3GXOA 4OIPF 3I58A 2ADUA 5D5XB 2FXAA 5FB2A 1AKHA 3K4JA 4RLFA 2HQAA 4HNVA 3IRRA 3AFHA 2L5QA 5GXQA 5KK1A 4KN4X 2ID6A 2RC4A 5F64A 4E7KA 3TU4C 2R4GA 5DEQA 2F8NH 4OIQF 4KUDA 3OOUA 3DF8A 2L4AA 1IXSB 3I5UA 3TL4X 5J47A 3ABTA 3CJRB 4CA0A 2VQHA 5AV5C 1HXDA 3ASNH 2XF6A 1MZBA 3OSGA 4KUDB 5CPKA 1SD4A 4G6TB 2IGKA 1XMAA 4G92B 2L0KA 3DPLC 4MEXF 4Q47A 4DYCA 2DAOA 3E5QA 1MMDA 1XX5A 2BW3A 1DGRM 1HLVA 2IGMA 5CPKB 4J19A 3PNTA 3TOBA 2PQ8A 1OQYA 3IL2A 5DNNA 2BW3B 2RDPA 4J8UC 2L2OA 4HX4A 2JSSA 2L7ZA 5B3SH 3GTGJ 2FE3A 1MBHA 5CVJA 2FJ1A 4UB6C 4R8PD 3E7LA 5DNNB 3FIWA 3AYWA 5IP9J 2TDXA 4IHSA 1IV6A 3JRFA 1A36A 1U2WA 3TW6A 3BZKA 2DMQA 3AZFD 3IWZA 2BXYA 2RVCA 5D6FA 4M9SA 3JAMZ 3AYWB 1P3IA 3PUBA 3N97A 3MGPD 3GFIA 3DKYA 3K69A 3WTYC 3DFGA 2JA2A 3OYDA 3H0GJ 3LSPA 4JOMA 1Z3YA 2L3DA 3OYLA 2ELJA 2EJRA 1P3IB 1JKRC 2A68F 4L5JA 1ON1A 4WV4B 3KEOA 1R5ID 1PYVA 3BG6A 2Y9YA 4LLGF 1T6SA 3REKD 4EM0B 2GA2A 2CJJA 4CICA 3J7YJ 1TWFJ 2G5IC 4Z66A 2ID3A 2JUGA 3QP5A 5EJCA 4QLCU 3L00A 2CV0A 2XPUA 2YFWA 2ZJQF 1MNDA 4RDUA 4R8HA 4B47A 5B31C 2ETHA 2BVMA 3DLLF 3SEZA 4Z66B 3EDPA 3SDBA 2STTA 4O3MA 2BBYA 2YFWB 3X1TA 3KP2A 4BE1A 4CSWA 4IOCF 3E1SA 1OCTC 5AVCC 3FXOA 3MGRC 2M0MA 4M71A 3GZ5A 1FX7A 1WJEA 2KL4A 2EFPA 1FC3A 2J8PA 2Y69H 3VH6A 4NC6A 1IRFA 1E17A 4XNFA 3CCVI 2A6HF 3HOTA 1GUUA 4ENMA 4NFTA 2OC6A 2ZC2A 4MEYF 1QNTA 3K4CA 4EVIA 4RGSA 3CCMI 3RZOJ 1G8XA 3H9JA 3LSTA 1KX5D 3K2ZA 3WTPC 2JA5J 5J4YA 4E7HA 2HXIA 4G91B 4XIDA 3TW7A 2HDCA 5FJ8J
chains in the Genus database with same CATH topology
1H0MA 3I54A 4G94A 3EG5B 4A0XA 1TBXA 1H9GA 1J2XA 4J8VD 4IJAA 3AN2B 4U88A 5HOOA 3W98C 4H9RA 5IT9K 1BI1A 3GW2A 2R3SA 1T2KA 1JE8A 1FY7A 4H9RB 4CO8A 4MNUA 3I59B 4IRGA 1P3OC 4HV5A 3HTUA 2VOOA 4IXAA 5AY8C 4BAYA 4EMSA 3A6ND 4MTDA 3WKJD 2QQ9A 4GYIA 1M18C 1EH6A 2VBXA 3F8BA 1HQCA 5L3FA 5DD4A 2VT2A 2P6TA 5B24D 4O5VA 2GAUA 1Z6TA 1E2XA 2Z99A 5B1MA 3RELC 1B6WA 5FD6A 4DRAA 5BPDA 3W99C 3LELD 2FEZA 2IVMA 2XAHA 3ZMVA 3WE2A 5B1MB 2XAQA 3MVDD 3GO5A 3SHFA 5G49A 5J6XA 4KN7X 1ZRFA 5E18F 2C6YA 2XV4S 3HSRA 5B0YA 2JPCA 1LJ9A 2F2AC 4YM6D 2AROD 2XIGA 5AONA 3COAC 2RV8A 2H27A 3GZ6A 1YIOA 3K1MA 5G49B 3MGSA 5AIPA 3LJAD 3REID 1F66D 5B0YB 1TNTA 3B0DB 5GT0C 4H9OA 4A0YA 5B31G 3AZIA 3MGSB 5CPIA 4A5MA 2VT3A 3V8JA 3KWQB 4H9OB 5LEKA 3AZIB 2FSWA 5CPIB 3KXBD 5D5VB 1HSJA 4CDGA 4Y13A 1KX3A 2Y75A 1FWZA 1SAXA 2BYKA 2IW5A 3AZLD 3B02A 2ZNYA 3F8NA 3B0BA 5GXQC 3BJOA 5B2JA 3H92A 3REHA 3RYPA 4XRFA 1KX3B 2STWA 2BYKB 3J81K 3CUQA 2VBWA 5D4RA 4OMZA 1NHAA 1UHMA 3WGGA 5B2JB 3REHB 2IO5B 3G3ZA 1YW9A 1J7KA 1QZZA 3CUQB 1P3MD 3M8EA 2M5WA 4KICA 1QO0D 1Y0UA 3V7RA 2Z9OA 1S29A 4XZQB 3H3ZA 3MQ0A 2Z3YA 3DQVC 5DUIA 4WU8C 2ZCWA 1M19D 4LJZF 5L3CA 5DNNC 2BG1A 3FF5A 1G3YA 1AOIA 1TW2A 4J8XA 2WV0A 1P3AD 1F5TA 3EUHA 5BT1C 3AYWC 1YS7A 5E5AD 1AOIB 4J8XB 4DNCA 4BHPA 5JVTA 1P3IC 3KP4A 1RUOA 2MLKA 4LK0F 3B6GA 2WTEA 1YO5C 4DRBA 1USTA 4HQEA 3HRSA 4PZJA 3B6GB 3QPTA 2NQBD 2EFQA 3RKWA 1R7JA 1BN5A 2RVQC 4XUJD 1KA8A 4Z66C 5H6QA 1WSUA 2J5PA 3FXQA 4LB6B 4BH9A 1ZRDA 4Y15A 1CGPA 3VH5A 3X1TC 3S2WA 3E6MA 3FXUA 1G6NA 1IZ1A 1O3TA 3UTAA 2DQNC 3F72A 5B32D 1U5TA 2L54A 1ID3A 3WA9B 5EEGA 4EJOA 3UTAB 1JHFA 3RIRA 4G91C 3SFZA 3KETA 2PG4A 1ID3B 4UXNA 3KUYA 1XN7A 5AVBC 3T0YA 2CO5A 3ABUA 3FX3A 3AV2D 4KA4A 2EK5A 4ESBA 3JSOA 2YX7A 2OBPA 3KUYB 4I02A 4LD9C 3W96D 1HW5A 1M1AD 2Y2PA 4AIJA 4N9HA 1LVAA 2VE9A 3DV8A 2JZYA 3ECOA 2XROA 4H9SA 2KJCA 3PQJA 3REOA 4H9QA 4F7ZA 3H0RC 2JRTA 1I1SA 2VQRA 3G73A 2ZMEA 4EJUA 1W5SA 4IRHA 2LF7A 3MAJA 1I1GA 4H9QB 3HOSA 4I09A 2CW0F 2ZMEB 2QUFA 2Y2KA 5TRDA 1OYYA 3LA3A 2HUEC 2L4MA 5B33A 1FYLA 2XAFA 2HS5A 1YQAA 4OIOF 5AV6C 2WWYA 3UT9C 3AZGC 4AWXB 4IPAA 4KNYA 1ZLAA 4M6YA 4QWQA 3AV1D 3KP5A 3VH6T 4BHCA 4XSZF 4R8PA 4UVBA 2XUBA 1ZLAB 2EFOA 3IRQA 5B0YC 3GLXA 4R8PB 3CUOA 1HBXG 3IHUA 2Y2QA 1ZAOA 3DKWA 1SMYF 1CF7A 2BGCA 4M9XA 5LHGA 2FF4A 3MGPB 5CPIC 2PN6A 4M6XA 2E1CA 3REKA 2DPDA 2P6SA 3H0LC 1CF7B 1P6RA 2H6CA 4YIIA 5E8IA 2P7VB 3R61A 1BH9A 5GT3D 4JK1X 3REKB 1KX3C 2Q2EA 2KIMA 5LBQA 3REHC 5BNVA 5B0ZA 1FZPB 2HIOC 4YG2F 3CUQC 3FMSA 5A2QZ 5B40D 5CP6D 5C3IB 1ONVA 2CFXA 4P96A 1LQ1A 2NYXA 2FJ7A 4P55A 4ESJA 1O57A 5BNVB 5J8FA 3BJ6A 4LG0A 1XSDA 3M1EA 4WK8F 3PFIA 1KX5A 4GO1A 2ZM5A 5GSUD 3KLNA 1ZG5A 5DNMD 4X23C 3W6JB 3V8LA 3C1BD 4EGYA 1KX5B 4U7DA 1USSA 2CV5D 3I4PA 4J8VA 1LDJA 4QLCD 4J8XC 3HRMA 3X1VD 3A1IA 1J9IA 4RB1A 1F1EA 1U78A 1IF1A 2M8EA 4J8VB 1KU5A 2QBYA 2GQQA 3J7AO 5B1LD 5FLXK 3AZEA 3B6GC 4HYEA 4A0ZA 2BYMB 3B0CT 3NQJA 2QBYB 1T3UA 1YLFA 2ZJ2A 2K86A 2K7LA 3A6NA 3AZEB 3WKJA 3NQJB 3CTAA 3TGNA 4CXFA 4ZUX