1ULYA

Crystal structure analysis of the arsr homologue dna-binding protein from p. horikoshii ot3
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
190
structure length
190
Chain Sequence
AKKVKVITDPEVIKVMLEDTRRKILKLLRNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEMKGNLVEKYYGRTADVFYINLYLGDEELRYIARSRLKTKIDIFKRLGYQFEENELLNIMDRMSQKEFDATVRISKYIEEKEDALKDFSNEDIIHAIEWLSTAELARDEEYLELLKRLGSILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the PH1932 protein, a unique archaeal ArsR type winged-HTH transcription factor from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Dna binding protein
molecule keywords hypothetical protein PH1932
total genus 70
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2003-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ulyA01
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1ulyA02
2EFQA 3TO7A 4KIGA 2H6BA 3REOA 1P3OA 5GT3C 1P3IC 1K78A 4G94A 1U8RA 4CDGA 1HQ3D 3ZMUA 4YFKF 3WTPD 5ICFA 5B40C 1I1GA 2HS5A 4ESFA 2Y0MA 5CPKB 3ZN0A 5B1MD 3SFZA 4WWCA 2EA2A 1ZN2A 2CQKA 3DF8A 3KUYA 1AOIC 2RQPA 1G3TA 3NEUA 4ZYHA 2A69F 3E3VA 4YS3C 2EV0A 3W98D 1IN7A 3CTAA 5B32B 3LQQA 1HKTA 1ZRCA 1P3AB 3C1DA 2OQRA 2ISYA 4J8WA 4XBFA 3NQJB 2CV5A 2HFHA 2AXLA 1ZARA 2BE5F 3QPHA 2D45A 2EWNA 1P92A 3CDHA 4XZQA 3B6FC 4X23B 5CPJC 1U35D 3B6FA 3HTSB 1LDKB 3I58A 5B24C 1O3SA 3FXQA 4A2UA 4YS3A 1P3GB 2F8NB 3AV2D 2QBYA 4X23A 1BH9A 5CPJA 3AZNB 3P9IA 3QAHA 3EDPA 3T1BA 5CPKD 3W99C 3AZIA 5B33C 5EEHA 5E20A 2GAUA 3CLOA 3IHUA 2HWVA 1EH8A 2R7FA 3X1VB 4AWLB 3BOQA 5B32C 1QGPA 1WWSA 1G3YA 1SD7A 4MTDA 1DUXC 4I2OA 2DW4A 1P3FD 3K0LA 4XZQD 4AVPA 5B0YC 5F99C 2WC2A 5F99B 5CYVA 5BNVB 1F66D 3G73A 1XGMA 4UUZA 3DXJF 3GUDA 2PYOA 2ZMEB 2JZYA 2NZDD 5CPJD 3AN2B 4U0WA 4X23D 3MGPC 1HSTA 5BNXB 2DFIA 3EYIA 5AVBA 5TJJA 4KICA 1KX3D 1ULYA 3UT9B 1UHWA 3NRVA 4WK8F 4Q4ZF 4G7ZF 4LFUA 1U35A 1P4AA 3AFAD 2PI0A 3BPXA 5CVIA 2IP2A 3IRQA 3B0DC 2VXZA 5FD5A 3DEUA 1OYIA 3HTUA 2QQBA 2UXXA 1QZYA 2G7HA 5KVRA 3BWGA 3L2CA 4AWLC 1VTNC 2OBPA 4HX4A 3D5LA 2NQBB 3G3ZA 3REID 2XUBA 4EJTA 5LLQA 1SMYF 3TOBA 2YR2A 4P96A 1IAWA 4UVCA 4KDPA 3W96C 3MVDA 3NQJA 4RB3C 3VEPA 4OIQF 3V9RA 1RZ4A 4PGHA 3X1UD 3EUHA 3X1VD 3W6KB 3IWFA 5B33D 3FMQA 4XLPF 3LELD 3C7JA 3WU1B 2F2EA 1G6NA 3BY6A 3FM3A 3MGQC 4OIRF 3MGRD 3LA2A 1D8JA 3AZLB 1Z6TA 3AV1C 1P3BC 2MLKA 3EYYA 3AZFD 5AIPA 1M1AD 3UTAD 4M73A 1P3OD 1XDUA 1W5TA 4PZJA 5BPIA 3VOEA 1KX3B 1YW8A 1AWCA 1BN5A 4D0PA 3F8NA 5DNMD 1P3AD 3AN2D 2QVOA 3ZMDA 1Z05A 3K9TA 3MGPD 1ZH5A 4HX7A 3HHGA 1TNSA 4KUDA 3FX3A 1JFIA 3KEOA 5AV6A 2D2WA 4XUJC 3KWQD 2EFPA 1YW7A 5BPDA 4BHPA 1J7KA 4DNCA 3JTHA 1DDNA 4H9SC 3JAMK 4JBAA 1KQ8A 2YU3A 5KDMA 1Z1DA 2NQBC 2CV5C 5AVCC 3A6NC 3RKWA 2ZFWA 4ENJA 4EJVA 1PDNC 4QLCA 3E5UA 5E5AD 3LWFA 1BIBA 2IA2A 2O3FA 3TU4D 5H6RA 4O3MA 3KP4A 1FX7A 3KXBC 5FUGB 2NNYA 4KMFA 1L3LA 5BS6A 5GT0D 2R3SA 5GT0B 1D5VA 2F8NG 2H27A 5DNMC 3REKD 3GO5A 5AV5D 2E1NA 2V9VA 4Z5TB 1FC3A 3DPTA 3LZ1D 4R1HA 4ON0A 4XUJB 1ZRDA 3C1CA 1ZGAA 2BYVE 3I53A 3RDIA 5DNNB 2D1VA 1S8NA 3I71A 1UHMA 4WX9A 2F5DA 2L4AA 3D0SA 1B6WA 1FPQA 3AZLA 1HW2A 1Y0UA 2ESNA 1V4RA 3W96D 4NHJA 5B24B 4QLCU 4J8XD 4DRBA 3RKYA 2P7VB 5BMZA 1P3BA 3C1CD 3O2PE 4KUDB 3L9FA 2L02A 3GZ6A 5GT3A 2XRNA 4U88A 5ICEA 2W57A 5DEQA 5AV5A 1KX3A 3HSFA 1N1JA 3TDUC 3N97A 3MGQB 1LQ1A 5E8IA 3PFIA 5B1MC 2EV5A 1J0RA 4B09A 3CUQB 2NNNA 5E1WA 5AV5C 3VFZA 2AROB 3AZGD 2FJ7B 4I09A 2CV5B 5GXQB 5FFXA 2NS0A 3AZFB 5BO0A 3R0JA 4EGYA 1KX3C 1Z9CA 1XMAA 5AVBB 3B6FB 4FX0A 3MGPA 1BC7C 3HOSA 1MGTA 5K5RA 1P4XA 3JTGA 1R36A 4L9TA 1HBXG 2UZKA 1EQZB 3O62D 4QLCD 5CPIB 3RPQA 5B33B 3AV2A 2DT5A 3WKJC 5ILVA 1X3UA 3REJD 3WKJB 3KP2A 4KMUX 2ZCWA 4ENMA 3KLNA 4E44A 1TQPA 3B0CW 4R8PB 3VH6T 5B40B 5B1LB 5B33A 3V4GA 3TU4C 4J8UB 3W99D 3AZJA 3MGSC 2FJ7D 1S32A 1P3PD 1IRGA 1OPCA 1IRFA 1IF1A 2ZJ2A 4HDUA 3W97C 3QU3A 2G7UA 1ID3C 2XIGA 3WTWC 3UTAC 2QWWA 2EV6A 4MHGA 3KP7A 3B0CT 4TV7A 4IRIA 4A0ZA 4ZZDA 4Z5TC 2HOEA 4KIBA 4I0BA 1BH8A 4N0BA 1MKMA 3ERED 1B59A 5ED4A 4M9XA 4J8WC 3X1TC 1YYVA 5DNNC 2CWEA 4IXAA 3LAPA 1FY7A 2C6YA 1KU9A 1GXQA 5AVBD 5FFZA 2FRHA 2PMHA 3GEZA 3KEQA 4I02A 5E1XA 3QU6A 5BNXA 3WTPA 3WTSC 1TW3A 4HYEA 4MQ9F 3MQ0A 2KJCA 3WA9C 1W4MA 1SD4A 2KIFA 4UVBA 3WU0A 3C1BC 2DTRA 1BJAA 4CAYB 2KRFA 5B0ZC 1IW7F 3T0YA 1KYWA 4EM1A 4G6DA 3GYHX 5HDNA 4P55A 1FBSA 3RELB 1F1EA 4IPAA 4YIFA 1K78B 3AZGC 5HLHA 2NYXA 2AROD 1YTYA 2ZMEA 3AZGB 5BQTA 1G3SA 5LEKA 3ULQB 1GXPA 1CGPA 3TU4B 5CPKA 4CZZA 3RYPA 3TGNA 1EQZA 1NHAA 1TZYB 4OIPF 2DBBA 3K69A 5K1YA 3F3XA 1P4WA 3C18A 3FHZA 4LD9B 1YS6A 2HZTA 4GYGA 2PQ8A 2TDXA 2MD5A 1U6GA 1EQZD 1KX5B 3AZMC 4HAMA 1YLFA 3JSOA 3B6GD 1O7FA 2AROA 4CGZA 5CPIC 5B2IB 1V3FA 5C3IC 5H6QA 3KSYA 3AZIB 5FUGA 5E18F 5L3FA 2MBFA 1LJ9A 4OMYA 2VT2A 3LJAA 3WAAD 3MGRB 1F9NA 4ZUXB 2HIOC 2HUEC 3WTXC 1QNTA 4QLCB 4J8UC 2DAOA 4JJNA 3M8EA 3ECHA 3AZEC 3AZEB 1BFMA 4HF1A 2VN2A 1PUEE 4RB1A 5HLIA 1HQ3A 5GT0C 3E6DA 5AVCD 1J2XA 3A6ND 1HSJA 2FNAA 4L0YB 5B31G 3AZHA 2W85A 5AV8D 2H09A 4Y15A 2OU2A 5B0YA 1XB4A 3KWQB 1M19C 1M18C 2M8EA 4NB5A 4M71A 4U0VA 4Z66A 4CXFA 5CP6D 4J8XB 1S32D 5B1LD 1P3PA 3ECOA 2E7WA 5J8CA 4KHAA 1F66B 1P2FA 2DPUA 3REJB 5GXQA 3E6MA 4Y13A 3MNNB 4HF2A 5JRGB 2NZDC 4GO1A 1Z6RA 4KN7X 4L9JA 4HGAB 3VB2A 3NQUA 3JW4A 1IUYA 4IJAA 1D8KA 4E70A 4H9NA 4NE3A 5BT1C 4EGZA 4NQWA 3ZN1A 3O62A 3GWZA 2M30A 3X1SD 1WRJA 3AZJC 5F99D 3MVDB 4G91B 2A6EF 3P9KA 1ZG5A 2ELHA 3AZFC 1TZYC 4M6XA 1LNWA 4XLNF 1DP7P 1P3LA 4YIIA 4J8VB 1ZLAD 4WNNA 1BBYA 3S2WA 3KUYB 3X1TD 5D5VB 3TO6A 4M74A 5LHIA 2VBZA 2VONA 4NFTA 5GSUB 3AZMB 5B0ZA 2KKOA 1ZG3A 1KX5C 4EMSA 2V1XA 3X1VC 1QQIA 1EH7A 2JTVA 1B67A 1S32B 5C3IB 4EJOA 4IF4A 5D5XB 2ZNYA 2X0LA 5JA4B 3REIC 5B0ZD 1P3IA 2EFOA 4RGSA 3QP5A 3MVDC 5BT1D 4ZUXC 1ZYRF 1K6OA 1J9IA 3RJPA 2XROA 3WAAB 3W98C 4S04A 3REHA 5CVRA 5EEGA 4ZYGA 3AZNA 2BBYA 1TNTA 3KCCA 4H9QA 3W96A 3UT9C 1AOID 2BYKB 5G49A 3AZLD 1FSEA 1P3OB 2MH2A 1P3AC 3H92A 2K4JA 3W98A 1RNLA 4XRFA 3F72A 3LZ1B 4EM0B 1HXDA 3ZMVA 3BJ6A 3GZ5A 5LHHA 3ELKA 3KLOA 4Z2YA 4UV9A 2IRFG 1T98A 5AV5B 4ZZLA 3ZMSA 4IHSA 1B4AA 1M19A 4KT5C 4UHTA 3AZKD 3AZKB 2IW5A 5J8FA 3R61A 1YW9A 1ZLAC 1ODDA 4A5MA 3BROA 1U2WA 2DPDA 3X1UC 3I0TA 3B6GB 4HLYA 3F23A 3ROUA 3LQRA 1P3BB 3C1CB 3Q9VA 4J8UA 5L3BA 5D6EA 4CO8A 3DPLC 4J8UD 2LKPA 5B0YB 3P9CA 5AV8A 2HQRA 2JSSA 3EETA 5AV9D 2VE9A 1KU2A 5AV9B 1UCRA 4G7OF 3WG9A 4ASNA 5F1RA 3BPVA 3TO9A 3TDZC 2UWMA 4I98B 4U0YA 4I01A 2FBHA 4G7HF 2ESHA 1F4KA 3UT9D 2DK5A 1YO5C 5DCMA 3REKB 1P3MD 1IN6A 2JPCA 1O3TA 1XD7A 5GSUA 3REHC 4EVIA 5LRSA 3WTPE 4J8VD 1W5SA 3CO6C 1HKSA 1HQ3B 4LMYA 1ID3A 2FBKA 3FF5A 1PP8F 3J7AO 3GX4X 1YQAA 5AIQA 3K1PA 4HX8A 3DV8A 1RUOA 5CJ9A 2CSOA 1GHCA 5E1ZB 1UFMA 1R5HA 5CPKC 4GGGA 4HDVA 1CF7A 5LHGA 1KX5A 4M6BA 4LB6B 4KGCC 3EQLF 1O57A 2DI3A 3B02A 5L3CA 5DCFA 2XAHA 1AOIB 3J80K 5B32D 3MNND 4YFXF 3T5XA 2W84A 2GWRA 5ILSA 1EV7A 2H94A 1KQ9A 2V1DA 1TW2A 5DUIA 1TZYA 3I5UA 3OOPA 1HW5A 4MEXF 1REPC 4WU8D 1I1SA 1U35B 4AD9A 3KETA 3IKVA 2LY8A 4OIOF 5LBQA 4WV4B 1S6LA 1P3IB 2ZKZA 3AZJB 4H9PA 4YM6B 3HRUA 5D4RA 1KU7A 4LG0B 2YFVA 4U7BA 4XUJD 3F22A 1M18B 3R60A 2P5VA 4LD9C 3COAC 1R00A 2PBIA 3E6BA 4G6QA 2PFBA 3X1UB 2PLYA 3O62B 2FNPA 4R8PD 1U5TB 3ABUA 3DP7A 4KUMA 4WXCA 2CW0F 3W97D 3OV8A 4S05A 2DU9A 1DPRA 3IC7A 4ZUXD 3AZHB 5AONA 1S32C 3ML6A 1P6RA 1ZGJA 5B31A 1SFXA 3KXBD 1U5TA 1W7PB 3J80Z 3GVAA 1BH8B 4WNNB 1CF7B 3V7SA 4WU8B 3B73A 2HIOB 2HUEB 3MGQD 3ZMZA 5LEJA 4KGCB 3ISPA 5AY8D 5A2QZ 3QP6A 4H0EA 5H20A 3I59A 2LF8A 4WU9C 2HIOA 3B6FD 2P5KA 4R79A 1P3OC 1B9NA 3FMRA 3RKXA 3W99A 3WA9D 3RTRA 4QWQA 3C1BA 2PYOB 1O3QA 4G92B 2O0YA 4J8WD 2F8NK 2YPRA 3F8BA 2GA2A 4R8PC 2VE8A 4YM6A 1P3FB 5CHLB 5JFRA 5FLXK 4JJND 5ICCA 3AZNC 3JAMZ 1XSXA 6PAXA 3AZMA 4Z5TA 5FB2A 1D3YA 4OMZA 3E6CC 1FNNA 2QQ9A 1P3MA 1P3PC 4XZQB 1OR7A 4XZQC 3UTAA 1HQCA 1E17A 2HYGD 3WAAC 2GXGA 3U9GA 2HIOD 1TQIA 2IJLA 2RVQC 5IT3A 4LD5A 3AV1B 4HQMA 4M6YA 3V9RB 4RS8A 4BNCA 2OAZA 2Q8KA 1LVAA 2BYMB 4OINF 2PEXA 5HS7A 4IVNA 3X1UA 1K79A 3U2RA 3M8FA 1R4VA 5LGTA 5BS7C 1XSVA 4HW0A 1R22A 2F8NA 4KN4X 2GQQA 2EFWA 3AFAB 3WTVC 3WA9B 4A6EA 1LEAA 5B2ID 4LD9D 1TQMA 5AY8A 5CP6B 3MGQA 3R6SA 4CYDA 3K2ZA 4WCGA 3SZPA 4ZBJC 4EJWA 3LZ0D 3LZ0B 4JQFA 2CYYA 1BI0A 3VODA 3O62C 3DQVC 4IRHA 1BC8C 2F5EA 4XSZF 3GFLA 2A68F 2NAZA 3LELB 5IT9K 3LELC 3RELD 1XGNA 3GFJA 5E5AC 5AVCB 3A6NB 1QZZA 2KIUA 5E17F 4DRAA 4P9FA 3H3UA 2K86A 1MDMA 1B1BA 1M18A 1DPUA 5L3GA 3ABTA 2L4MA 4XUJA 5F64A 5D4SA 2QYOA 2EJRA 2FF4A 2MA3A 2J5PA 1IZ1A 3MGPB 4Q48A 2QBYB 3O3KA 1H9GA 2DLLA 3GLXA 3TU4A 1SD6A 3L09A 4P5OA 2HR3A 2F8ND 1FSHA 4LLLA 1EQZC 4WU9A 1TAFB 3KP6A 2VC1A 4O5VA 4GCVA 3ZPLA 2VOOA 4G92C 2Z99A 2XKPA 2X4HA 4EO5B 2BEOA 1IN4A 3FZVA 3WTYC 5JRGD 3L7WA 3RI4A 1P3FC 5CVUA 1Q1HA 4LK1F 4UUVA 2IPQX 3AYWA 2FXAA 1H3OA 3FM5A 3NQOA 2IA1A 4L9NA 2IO5B 2HEOA 1W7PA 3V7RA 4KUDD 3KP5A 1S3JA 2CV5D 4ESJA 5DDGA 3VH6W 2BGCA 2RGVA 2GA1A 3REJA 2KJBA 2L01A 1KU3A 4KYWA 1OKRA 1GVJA 2JSCA 5GXQC 3BJAA 3KUYD 1R58A 3LA7A 1A7WA 2BV6A 2W25A 1QO0D 5B24A 1BM9A 5B31D 4WXDA 1F1ZA 2F8NH 5B1MA 4ZUXA 1MJAA 2UXNA 1FYKA 1P3GC 2AS5F 1SFUA 2RVCA 2B0LA 3X1VA 3U1DA 1MJBA 2M5WA 4A0YA 1I5ZA 4KFCA 2XGXA 3HIFA 3TOAA 2YFWA 4M72A 3B0BA 3REIA 1USSA 4UV8A 2A61A 5L3EA 2STWA 3V7CA 4Z2MH 5LGNA 3AZND 3MWMA 2VOPA 4OOIA 3AZKA 3CUQC 3M1EA 1F5TA 4IRGA 1ON2A 2IVMA 2XHKA 5CVJA 4LJZF 3QPTA 1FZPB 3HRTA 1T6SA 5D8LB 2Z33A 1P3BD 2EA4A 3AV1A 1TZYD 5DYMA 1LEBA 4N9IA 1Q9CA 3NQUB 3E5XA 1JHFA 3P7NA 4DQ2A 1P3PB 1KYZA 3AN2C 2Y75A 5D5WB 3J81Z 4YFNF 2FU4A 2QQAA 2W24A 5DNMB 1P3KD 4H9QB 2K4BA 3T8TA 2QM3A 1F66A 4WU9B 1T2KA 4WU9D 5DNNA 1ZREA 1HW1A 3R45B 4RGRA 3LZ1A 5DNND 5B2IC 3BZ6A 1XGOA 3B0DB 2G9WA 4H9PB 1BIAA 4EO5C 1FP1D 4YM6C 2MC3A 3AZID 4Z66C 2ACJA 3HRMA 2ISZA 4B8XA 4KUDC 3C1BB 4MTEA 2PG4A 3N4MA 3KZZA 1FWZA 2WWYA 5HLGA 3AYWC 3KXBB 4ZBJB 3SQNA 3KZYA 1P3KA 3KP3A 1SD5A 3F6VA 3GFMA 1MD0A 3AZLC 5D6FA 3UTBC 3MGSD 2LF7A 3UTBA 2XAJA 2HTSA 3AV1D 3H3ZA 1P3KC 3AZHC 4BXUA 2IT0A 5CP6A 5E5AB 3X1SA 1J75A 1C0WA 2V1UA 2A3SA 4MQVA 4AIJA 4WU8C 5B2JC 1A04A 1JE8A 1YIOA 3MEXA 1KX4D 3UT9A 1ONVA 2O8XA 3F6OA 3VH5W 2XV4S 2F5FA 4UUZB 3PQJA 5B24D 4LB5A 3DKWA 5CPIA 1T0FA 3RPUA 3V8JA 5AVCA 5JVTA 3A6NA 4G9YA 5CPID 1FT9A 5JRGC 3LZ0C 5ICGA 4LD9A 5B2IA 4LLNA 5HOOA 2H6CA 4A6DA 1AOYA 1ZHFA 1OMIA 3LELA 1LDDA 4MGRA 2J5OA 2YSRA 1WQ2A 5HDGA 2YX4A 5B1LA 1ZG1A 3AZHD 4XSXF 2CGPA 3FMSA 3MGSB 4CAYA 3ZMTA 1BH9B 3AYWD 3W97B 5B2JB 3AYWB 3CUQA 4M9ZA 3KUYC 1AOIA 2VBWA 3RELC 1TLHB 3B6GA 3MZYA 4KGCA 3AZJD 3X1SC 1R1VA 5DV5A 4YS3B 1N1JB 3AFAA 3WTUC 3Q9SA 4CSRA 2RNJA 5LRRA 4Q5SF 1P3ID 1MZBA 2GIVA 2ADUA 3KWQC 4R8HA 1BI2A 3F8CA 4YM6D 1R1TA 5CLSA 1S29A 3BJOA 4L18B 2JPBA 5BS7A 4H9RA 4Z66B 1P34A 5B1LC 2PYOD 4J8XC 1S7OA 1U3EM 2BYMA 4QLCC 1SAXA 4ENKA 1H0MA 2QENA 1W7PD 3VH5A 3WAAA 4H9RB 2A5YB 3X1TA 2FBIA 2RDPA 1KU5A 1R7JA 1U78A 1WSUA 3MCZA 2V6CA 3HHHA 4R8PA 1STZA 1XCBA 5JRGA 3F8FA 4E45A 5B1MB 1TAFA 3AZED 3MGRC 2A6HF 3LZ0A 1UB9A 2ZBKA 3I64A 4KA4A 4G91C 4P9UA 2DQLA 2FOKA 4LG0A 4Z2MG 4HZFA 1USTA 1ZLKA 2IA0A 5AV6C 4YS3D 2FMLA 4BHCA 1QPMA 5JI6A 3W97A 5TRDA 2JRTA 3AV2C 3WKJA 4I7HA 5GXQD 4RAZA 4BQAA 3LAJA 5CVVA 2FQ3A 4EQQA 3LSTA 4K2EA 3T8RA 1HQ3C 2PJPA 1G3WA 1B9MA 1M18D 5B40A 4ESBA 5B0ZB 4JJNB 1U5TC 3C1CC 1ZLJA 2VBYA 2RC4A 1RUNA 1WWIA 3AZEA 4Z66D 3J81K 3MZHA 2O03A 1KX4B 2Q0OA 1P3GD 4F7ZA 5B32A 3WGIA 1ZAOA 3LFKA 1TTYA 5E8GA 4A0XA 3AAFA 4GXOA 2P7CB 4A5NA 3L00A 4HLXA 5B0YD 2A07F 1KA8A 4CHUA 4H9OA 4HV6A 3W98B 3Q5FA 2JT1A 5HDKA 3WODF 5AV6B 1P34D 2EB7A 1OYYA 3REKC 3TKYA 5HS9A 3MNNC 3WGGA 3MNNA 3LZ1C 4AIKA 5E5AA 3X1SB 2YFWB 1U35C 2LDUA 1KGSA 2QUFA 2FJ7A 4ZYDA 4Z5TD 1SFEA 4LLGF 3AZMD 5B2JD 2XKOA 2MLGA 4AWXB 2STTA 5FGMA 5JA4A 3GFIA 1L0OC 3X1TB 1O7LA 1KX4C 1FOKA 1XDSA 3FXRA 2WTEA 2ETHA 5AVBC 4N9HA 4G8XA 4J8VC 3KWQA 2Q2EA 4Q47A 3GF2A 1HKQA 3M7GA 2HYFA 2M45A 3AZGA 1Z7UA 1IN8A 3FXUA 3R4KA 4FT8A 3V8KA 4LGWA 4RAYA 2EK5A 4EJUA 5DNMA 3K1NA 3W6JB 3LJAD 5FO5A 3LJAB 2Z3YA 4BHBA 1T39A 3UTBB 3GW2A 3SHFA 1QBJA 3WGHA 4RGUA 3F21A 4PGGA 4X23C 1MJ9A 5CPJB 5DD4A 4UXNA 4WXHA 1EH6A 1H3OB 4YG2F 3WTTC 4H9NB 1IXSB 1WWXA 3KXBA 2PN6A 1OYWA 3WA9A 3MGRA 2L54A 5KK1A 4H9SA 1KX4A 1YS7A 2Z5UA 1JFIB 2XAQA 2ZO4A 4ZH4F 1T38A 2YFVB 1LDJA 1ID3B 5ERIA 3UTAB 3VH6A 2L3DA 3E97A 4AIHA 2E7XA 3FWEA 4KHAB 3QRFF 3F8MA 4PDKA 3IRRA 1FYLA 3CO7C 5GT3D 5GSUC 5DD8A 2NQBA 1G4DA 4HV5A 1ON1A 3C3WA 3ZQ7A 3REJC 4RB0A 1I27A 1XN7A 2COMA 2LNBA 2Z9OA 1IXCA 1J5YA 3REIB 4FHTA 1FYMA 4L5IA 2NQBD 2CO5A 1XSDA 2GZWA 2XASA 1BI3A 4OU0A 5HVQC 3CJNA 2P6SA 2RVQD 3E5QA 4GYIA 5K5OA 2OZUA 4WU8A 4EM2A 2QLZA 1BOAA 5D5UB 2XAFA 2GXBA 2FE3A 2ZXJA 5B31C 2YX7A 1J59A 3M9AA 5B32G 2CG4A 4L5JA 1TBXA 1ID3D 1FBUA 5AV8B 4HBLA 1ZRFA 5AV6D 1P34B 1KX5D 4L9VA 1P3KB 4CSRB 1ZLAA 2WV0A 1P3LB 5GSUD 1I6XA 1FP2A 3MFKA 4BAYA 5KDMB 2E1CA 1RIOH 1LB2A 1M19B 2VC0A 2V79A 2HDCA 1P3MC 3ZP5A 1ZLAB 1RI7A 2IO5C 1JXSA 1XGSA 4HF0A 3HSRA 5DUKA 1HTAA 2P8TA 1BI1A 1H9TA 1SMTA 3JSPA 1XCVA 4WF2A 1JGSA 3WE3A 2DQRA 4HOBA 3C1BD 2BYKA 5G49B 4KIFA 4BYYA 4JK1X 1Z91A 1O3RA 3AN2A 4KGCD 4PCQA 2O61A 2Y48A 3I54A 5JHUA 3HYIA 4A12A 5B2JA 2F5CA 2XAGA 1YFHA 3DFGA 5F99A 2K27A 1XMKA 3R0AA 4IHTA 4L0ZB 2QZ8A 4FX4A 4ZYEA 4MEYF 4MNUA 4HQEA 4UNOA 2FEZA 2DO7A 3K1MA 4HA8A 5B31B 4ENNA 2K7LA 2CFXA 5HS8A 4O6JA 4I0AA 5BNVA 1M19D 3HRSA 2RV8A 4CICA 1M1AA 3PQKA 3AZFA 2RKHA 4ETSA 2M1BA 4NE5A 1P3LC 1YG2A 1P3GA 4J8WB 3KE2A 2NZDA 5K5QA 2OD5A 5LGUA 1S7AA 5D8KB 2HQNA 3W96B 1R1UA 3WTPB 2HKXA 3AZIC 5B40D 3KFWX 2DK8A 3LA3A 5AV9C 3WTPC 2RN7A 2D1HA 5BO0B 1R23A 4RB2C 2EFNA 2XVCA 3MVDD 1FBQA 1MDMB 3WKJD 4U7DA 4M9SA 3IWZA 5F6FA 5DCMB 3REKA 1F66C 1KQ0A 2LSOA 2P4WA 4J8XA 3UTBD 3MGSA 2VBXA 1M1AC 3REHB 3REHD 4HGAC 3I4PA 3HOTA 5AV8C 1R5GA 5A2QK 5JR3A 2K02A 3CUOA 3WE2A 1P34C 2OZ6A 3QOPA 5GT3B 3HUGA 4Y17A 1P3FA 5AY8C 3MAJA 4BH9A 1PP7U 3AFAC 3IL2A 1JHHA 3AZKC 5J6XA 1P3LD 2P6TA 5CP6C 5L3DA 1P3MB 3R45A 5ILUA 5GT0A 1WI9A 2NRAC 3AV2B 4LK0F 3TQNA 2PMUA 2FMYA 4RGXA 3W99B 2R7DA 1IXRC 2OQGA 1IN5A 5FLXZ 2O6GE 3RELA 3B6GC 2OA4A 4JJNC 4J8VA 1K7AA 2L5AA 3I59B 3WTZA 3RIRA 3BP8A 2VODA 1P3AA 3BDDA 2AROC 2KIMA 3LJAC 2FJ7C 5BOXA 2NZDB 5FD6A 1FLIA 1WKMA 3RYRA 3GXOA 4NE6A 2VT3A 3O6BB 4WZSB 5AY8B 3HSEA 2HKOA 3SZTA 2HGCA 4UVAA 5AV9A 2FSWA 1B6AA 1E2XA 4KNYA 3V8LA 4H9OB 3IKTA 4EV0A 2M87A 3SXYA 3VH5T 2MH9A 2FA5A 2P5LC 1M1AB 2HTJA 2PYOC 5IT9Z 2ZNZA
chains in the Genus database with same CATH superfamily
2Q1ZB 2EFQA 3TO7A 3GZNB 4KIGA 5GP9A 2VXDA 2H6BA 1BJZA 2YUSA 3REOA 4HNUA 4X0GA 2E2JJ 1P3OA 2HZDA 5GT3C 1P3IC 1X1DA 5GAGJ 4BDYA 4G94A 4DJAA 1K78A 1U8RA 4CDGA 1HQ3D 3ZMUA 4YFKF 3WTPD 5ICFA 4ZDOA 5B40C 5BNGA 2H1KA 2OV7A 1I1GA 2HS5A 4ESFA 1HCRA 2Y0MA 4IHYA 3SDBA 5CPKB 4JOMA 3ZN0A 5B1MD 2VJIA 1TWHJ 4II2A 3BG3A 3KYDB 2Z16A 4A3IJ 4XKVA 3SFZA 2LD5A 4B48A 4WWCA 1I6HJ 2EA2A 1VQ6I 3H5NA 4U87A 1ZN2A 2CQKA 3DF8A 3KUYA 1AOIC 3K4JA 4NC6A 5K7ZA 3W2WA 4A3MJ 2RQPA 1G3TA 3NEUA 1LPQA 1W5CC 4ZYHA 1Z21A 2A69F 3E3VA 4YS3C 2EV0A 3W98D 2K40A 3V42A 2R5YA 1ERDA 2XD5A 1IN7A 3CTAA 5B32B 1SC7A 2ID6A 3LQQA 1HKTA 1ZRCA 1P3AB 3C1DA 2OQRA 2ISYA 4J8WA 4XBFA 3NQJB 5IYCJ 2CV5A 2HFHA 2WB1N 2AXLA 1YRNB 4B1RA 4UB6C 1ZARA 3U21A 2BE5F 3RKQA 3QPHA 1HF0A 3HKZA 2D45A 2EWNA 1P92A 4N4OB 3CDHA 1OR7C 4XZQA 3B6FC 4X23B 5CPJC 1U35D 4IZZA 3B6FA 3HTSB 1LDKB 3I58A 5B24C 2ELKA 1O3SA 3FXQA 4A2UA 1FJLA 4YS3A 2VKDA 1P3GB 4DYCA 2F8NB 3AV2D 5E3LA 2QBYA 4X23A 1BH9A 5CPJA 3AZNB 2K9NA 3P9IA 1HOMA 3QAHA 3EDPA 1MH3A 1QHGA 3CMYA 4YIRX 1RR7A 3T1BA 5CPKD 1LFBA 1GLNA 1T56A 1POGA 3W99C 3AZIA 2MW8A 5B33C 2VKVA 5E20A 2GAUA 4XLFA 5EEHA 1D1CA 2B63J 2LBFA 2Q2EB 3CLOA 3IHUA 4J19A 2HWVA 5JVGF 3GCMA 1EH8A 3HOWJ 3CCRI 3PM1A 3UR3C 1PJRA 4D5FA 2R7FA 3X1VB 4AWLB 1BR4A 3BOQA 2X6OA 5B32C 1QGPA 2LVSA 4PUSA 3OYNA 1WWSA 1G3YA 2IBDA 1SD7A 4B44A 3JRHA 4MTDA 4PJJA 1DUXC 2DW4A 4I2OA 1P3FD 3K0LA 4XZQD 1VZ0A 4AVPA 5B0YC 1D0XA 4ZTJA 5F99C 2WC2A 1N77A 5F99B 5KHDA 5CYVA 5BNVB 1F66D 3G73A 1XGMA 4UUZA 3DXJF 3GUDA 2ELJA 2PYOA 2ZMEB 2KISA 2F6CA 2JZYA 3CC7I 2NZDD 5CPJD 5M3MJ 4XKBA 4JP0A 3AN2B 1WJDA 4U0WA 4X23D 3MGPC 1HSTA 3O8HA 5BNXB 2DFIA 2BXZA 3EYIA 4CYCB 5AVBA 5TJJA 4KICA 1KX3D 1ULYA 3UT9B 1UHWA 3NRVA 4WK8F 4Q4ZF 3GLLA 2DOFA 4BKXA 3K2AA 4G7ZF 3G2BA 4LFUA 1U35A 1P4AA 1QVUA 3AFAD 2PI0A 3BPXA 5CVIA 1WJBA 2IP2A 3IRQA 3B0DC 1FOXA 2VL8A 2ZJRF 2VXZA 5FD5A 5B66C 1VFCA 3DEUA 1OYIA 2ZY4A 3HTUA 3P5JB 1Y56A 2QQBA 2UXXA 1QZYA 2G7HA 1HDPA 3BWGA 5KVRA 4LG3A 3L2CA 1DU6A 4AWLC 2OBPA 1VTNC 4HX4A 3D5LA 3DTKA 3F9KA 2NQBB 3G3ZA 2FX0A 2XUBA 1FMVA 2DTZA 1H89C 5LLQA 1SMYF 4EJTA 3REID 3TOBA 5M5WJ 2YR2A 4P96A 1IAWA 4UVCA 4KDPA 3W96C 3MVDA 3GBGA 3NQJA 4RB3C 4EATA 3X2QH 3LSRA 3VEPA 4OIQF 3V9RA 1RZ4A 3VYRB 2Y30A 3OWTA 4PGHA 3X1UD 3EUHA 3X1VD 2JA5J 3DKXA 4GDFA 1NK2P 2VUMJ 3W6KB 4IL6C 1SEUA 3IWFA 5B33D 3FMQA 4XLPF 3LELD 3C7JA 3WU1B 4DBRA 2F2EA 2XSDC 1G6NA 3BY6A 3FM3A 5GTIC 3MGQC 4OIRF 1FOWA 3L1PA 3MGRD 3LA2A 1D8JA 3AZLB 1Z6TA 2QSHX 4RDUA 3AV1C 1P3BC 3M07A 2JN6A 1SVLA 5J3LA 2MLKA 3EYYA 4B47A 3AZFD 3PJRA 5AIPA 1P7JA 4A3CJ 1M1AD 3UTAD 4M73A 1P3OD 1XDUA 1W5TA 1Y8QB 3OYBA 4PZJA 3ERMA 2DQNC 5BPIA 5IYDJ 1Z77A 5J1YA 3VOEA 1KX3B 1YW8A 3PUBA 4N4NB 2EQRA 1AWCA 1BN5A 4D0PA 3F8NA 2O9LA 5DNMD 3OIQA 1P3AD 3VDXA 3AN2D 2QVOA 3ZMDA 1Z05A 3K9TA 3MGPD 1ZH5A 4HX7A 3HHGA 1TNSA 4KUDA 3FX3A 2VB6A 1JFIA 4J01A 3KEOA 5AV6A 3EPHA 2CV1A 3SYTA 2D2WA 5FKNA 4XUJC 5F0HA 2EIMH 3KWQD 3ABMH 2EFPA 5K7HA 2M3AA 2CH0A 1YW7A 5BPDA 2CV2A 3BR1A 5C4XJ 5C3EJ 4XOTA 1J7KA 4BHPA 4DNCA 1RC9A 1SVMA 2RIQA 2DF4C 3JTHA 1G8XA 1DDNA 4H9SC 3JAMK 3CCMI 4JBAA 1KQ8A 2CRGA 2YU3A 5KDMA 1Z1DA 4NC7A 2NQBC 2DYRH 2F48A 2CV5C 5AVCC 3A6NC 3RKWA 2ZFWA 4ENJA 4EJVA 1PDNC 4QLCA 3E5UA 2BY2A 5E5AD 3LWFA 1BIBA 2IA2A 2VJ5A 2O3FA 3IAS2 5H6RA 3TU4D 4BJ5C 4BY7J 5DM6F 4O3MA 3KP4A 1FX7A 1WFXA 3KXBC 5FUGB 4F3QA 3H0DA 2NNYA 4KMFA 1L3LA 5BS6A 2OC6A 5GT0D 2R3SA 5GT0B 1D5VA 1OISA 3HKZN 2F8NG 2H27A 5DNMC 3REKD 4NNJA 3GO5A 2BVLA 5AV5D 2E1NA 3JRGA 2V9VA 3LOCA 4Z5TB 1FC3A 3DPTA 5JLWA 1IRXA 2VIXA 3FHNA 1VQLI 4R1HA 2ZXWH 4ON0A 5HNFA 3LZ1D 4XUJB 2KIQA 1EJ9A 1ZRDA 3C1CA 1ZGAA 2BYVE 2E1OA 1YJWI 2G0EA 3I53A 3RDIA 5DNNB 2D1VA 1S8NA 3I71A 1UHMA 2WV1A 5K7FA 2EZIA 3CC4I 4WX9A 2F5DA 2L4AA 2QGUA 3D0SA 1ACIA 1D0ZA 1B6WA 2XB0X 1FPQA 3AZLA 2JSPA 1HW2A 1Y0UA 1FOYA 1V4RA 2ESNA 3QYEA 4NHJA 3W96D 2GBYA 5B24B 4QLCU 1IRZA 2G5HC 4DRBA 4J8XD 3RKYA 2P7VB 3S3NA 5BMZA 1P3BA 3C1CD 3O2PE 4KUDB 3L9FA 1W0UA 2L02A 3GZ6A 5GT3A 1IC8A 2XRNA 4U88A 5ICEA 2W57A 1MMAA 2DOAA 3DKYA 4DZPA 5DEQA 2ME6A 4RBOA 1WZ2A 3BG9A 5AV5A 1KX3A 2E35A 3VYUB 1PUFA 3HSFA 1N1JA 3TDUC 2ECBA 1ETWA 5J4YA 3N97A 3OR1C 3MGQB 3G71I 3OS0A 1LQ1A 5E8IA 3FXLA 3PFIA 4A3LJ 5B1MC 3DU6A 3FK7A 2J8PA 2EV5A 1J0RA 2Z1DA 4B09A 3CUQB 2NNNA 5E1WA 5AV5C 3DBRB 3VFZA 2AROB 3AZGD 2FJ7B 4I09A 1BR2A 2FJ1A 2CV5B 5GXQB 5FFXA 2NS0A 3PNTA 1DGWY 3RQ4A 1T0FC 3AZFB 4HNVA 5BO0A 3R0JA 1K4SA 1VI0A 5M5XJ 2YU9J 4EGYA 3S1QJ 1KX3C 1Z9CA 1APLC 3OL3A 5GAHJ 1XMAA 4CYCA 5EG0A 2E2HJ 5AVBB 3BR0A 3B6FB 4FX0A 3S16J 3MGPA 1W36C 3MN2A 1PVEA 3HOSA 1BC7C 1MGTA 5K5RA 1P4XA 4BBRJ 3ZR8X 3JTGA 1R36A 3OMYA 4L9TA 1HBXG 2E36A 2MG4A 1UAAA 2QA4I 3KIOA 2UZKA 3NWSA 1EQZB 3O62D 4CA0A 2GOMA 2OPTA 4QLCD 3QQAA 5CPIB 3RPQA 5B33B 3AV2A 1ORKA 2DT5A 2UUZA 3WKJC 5ILVA 1X3UA 3REJD 3WKJB 3KP2A 2R7ZJ 3KYLA 4KMUX 3RCOA 2ZCWA 4ENMA 3VWBA 2E60A 3KLNA 4E44A 4M6VA 2QEXI 1TQPA 2OUMA 3PSFA 3B0CW 4R8PB 3VH6T 5B40B 5B1LB 5B33A 3V4GA 3TU4C 3CDIA 4ITVA 4J8UB 1UJ8A 3W99D 3EPJA 3DCFA 3SEQA 3AZJA 2Y2QA 1S9HA 3H36A 2HU9A 1MH4A 4Z6YA 5IP9J 4JX6A 3MGSC 2FJ7D 2BZTA 1S32A 1P3PD 2M4GA 1IRGA 1OPCA 2DT7B 1IRFA 1IF1A 2ZJ2A 4HDUA 3W97C 3QU3A 3WU2C 2G7UA 2NOGA 2XIGA 1ID3C 3CESA 3WTWC 2F4MB 2VPLA 1WPKA 1NTCA 3UTAC 2QWWA 2EV6A 2O5RA 4MHGA 3KP7A 3B0CT 2VQHA 4TV7A 2VLAA 1VQ5I 4A0ZA 1IGNA 4XN3A 4ZZDA 3M1CA 4IRIA 5TGTA 4Z5TC 2HOEA 4KIBA 1D5YA 4I0BA 3EPKA 3K7AJ 4N0BA 4FCYA 1BH8A 2CS3A 2Y2LA 3I4MJ 1MKMA 3ERED 1B59A 5ED4A 4XORA 4M9XA 1Q9CA 4J8WC 2NVTJ 3CCEI 3H5AA 3X1TC 2X51A 1YYVA 3PUFA 3CCLI 5DNNC 2CWEA 3KPHA 4IXAA 1FY7A 3LAPA 1KU9A 2R5YB 2C6YA 1GXQA 5AVBD 5FFZA 2FRHA 2PMHA 3GEZA 3KEQA 4I02A 5E1XA 3QU6A 5BNXA 3WTPA 3WTSC 1TW3A 4HYEA 4MQ9F 3MQ0A 1GT0C 2L9SA 2QCOA 2KJCA 1OJLA 3WA9C 3CMAI 1W4MA 1SD4A 2KIFA 4UVBA 3CCJI 3WU0A 1VQKI 3C1BC 4UPKA 2DTRA 1BJAA 2JCHA 5EGOB 2A5WA 5J4VA 4CAYB 2AO9A 1WJ5A 2KRFA 2W00A 2ZSIB 1JUPA 1IW7F 5B0ZC 4E7KA 3T0YA 1KYWA 3A0BC 4G6DA 4EM1A 1FIAA 3K4LA 3GYHX 3FIWA 3QYBA 5HDNA 4P55A 1FBSA 3RELB 1F1EA 1WVRA 4IPAA 4XQFA 5GPAA 4YIFA 2MD0A 2IS6A 1K78B 2HPMA 5HLHA 2NYXA 3AZGC 3F0CA 2AROD 1YTYA 2ZMEA 3AZGB 5BQTA 1G3SA 3FXMA 3KFUG 5LEKA 4XLCA 2E19A 3ULQB 5KCMA 1GDTA 4IX7A 1VQ8I 5KAIC 4HNTA 5E3MA 1GXPA 1CGPA 3TU4B 5E3NA 5CPKA 4CZZA 1ZQ3P 3RYPA 2WAEA 3TGNA 1EQZA 1NHAA 1TZYB 2W1OA 4OIPF 2DBBA 3K69A 4W1UA 2NXNB 1H8AC 3CJTB 5K1YA 2ECCA 3F3XA 3OYLA 2H8WA 1P4WA 3C18A 3FHZA 4QSHA 1T08B 3DLLF 2Y2PA 2PJRB 2DOEA 4LD9B 1YS6A 2HZTA 4GYGA 2LH9A 3JR9A 2PQ8A 2DFEA 2TDXA 2MD5A 1U6GA 2B9SA 1EQZD 4I99C 3ZQHA 1KX5B 2VQGA 2DMTA 3AZMC 4HAMA 4LOCA 3PNYA 1YLFA 3QPSA 3VYSB 1SVOA 5DS9A 3JSOA 3MKZA 3LSMA 5JLXA 3B6GD 1O7FA 1QZEA 3BG7A 2AROA 4CGZA 5CPIC 5B2IB 3K4BA 5F08A 3HB9A 1V3FA 5C3IC 5H6QA 3KSYA 3AZIB 1Y1WJ 3CD6I 5FUGA 5E18F 1DU0A 4A93J 5L3FA 2MBFA 1LJ9A 4JX5A 2VJ4A 4C2UA 2IS4A 4OMYA 2VT2A 3LJAA 1HLVA 3WAAD 3MGRB 1IO2A 1F9NA 3N05A 4ZUXB 2HIOC 2HUEC 3WTXC 1QNTA 4QLCB 4A3GJ 2DAOA 4J8UC 2LKSA 2BG1A 4JJNA 2IAIA 3L2WA 3KX2A 2BXYA 3M8EA 3ECHA 3BLYA 3EPLA 3AZEC 2L9VA 3AZEB 4BEHB 2A6TA 3I9V2 1BFMA 3FBIB 3BQZA 4HF1A 2VN2A 1PUEE 1X1CA 4RB1A 5HLIA 1HQ3A 5GT0C 3E6DA 5AVCD 1J2XA 3A6ND 3ZQIA 1HSJA 2R7WA 3BTJA 4RA2A 3AKZA 1OCRH 1MBHA 2FNAA 4L0YB 5B31G 3OSGA 3AZHA 2EBIA 2W85A 2L7ZA 5AV8D 2H09A 4Y15A 2DCEA 1JJ6C 2OU2A 3BR6A 5FKMA 5B0YA 4IQJA 3JRAA 4AC0A 1XB4A 2ZSHB 4E7SA 3KWQB 2LYCA 4DYRA 3AG4H 1SFKA 3S2DJ 4HRIA 1M19C 1M18C 4XICA 2M8EA 3BTCA 2ZM5A 3ABLH 2XPWA 4NB5A 4M71A 4U0VA 4Z66A 1BOBA 4CXFA 5CP6D 2X1DA 4J8XB 1S32D 5B1LD 1P3PA 5EG0B 2AQEA 2Y31A 3C2BA 3ECOA 3H9JA 4XMYA 4KISA 2E7WA 4FETA 1XC5A 2HVSA 5J8CA 4KHAA 3HOVJ 1F66B 3S15J 1P2FA 2DPUA 3REJB 1BL0A 5GXQA 1YX5A 3E6MA 4Y13A 3MNNB 3LSKA 3LFUA 1O4XA 2W4SA 4HF2A 2JE5A 5JRGB 2R7TA 2NZDC 4GO1A 1Z6RA 4KN7X 2JJ7A 4L9JA 3VB2A 3OOUA 3JW4A 3NQUA 4HGAB 1IUYA 4IJAA 1D8KA 4E70A 3FDDA 4H9NA 3ZQLA 4NE3A 1X4OA 5BT1C 4UUSA 4EGZA 4A3BJ 4NQWA 4DOZA 1ZR2A 3ZN1A 3O62A 4RMNA 3FKJA 4BQQA 2K85A 3GWZA 3OYCA 4A69C 1NG6A 2M30A 1WRJA 3X1SD 3AZJC 5F99D 1AKHA 2HQAA 3MVDB 4G91B 2A6EF 3HBLA 4AVZA 2CFOA 3P9KA 4L0ZB 2X6WA 1ZG5A 2ELHA 4BY1J 4C30A 3AZFC 1TZYC 1U9NA 1EKEA 4M6XA 1LNWA 1JUMA 4XLNF 1DP7P 1TWFJ 4AYBN 1JTYA 2Y9YA 2M0CA 1P3LA 4RLFA 4YIIA 4J8VB 2DJNA 1ZLAD 3A4CA 1MBGA 4Y4RA 3FXOA 4WNNA 1BBYA 2V9PA 1MSEC 3S2WA 3Q3SA 3KUYB 3X1TD 1ETQA 5D5VB 3TO6A 2NOJB 4M74A 5LHIA 3KEYA 2VBZA 4CCKA 2VONA 4NFTA 5GSUB 3AZMB 5B0ZA 2KKOA 1ZG3A 3ZQFA 2XPVA 1KX5C 4EMSA 3S3MA 2V1XA 3X1VC 1QQIA 3D5RC 1EH7A 2L7KA 3CF5F 2BW3B 2JTVA 2IGOA 1B67A 4WJ3C 2DA6A 1X3ZB 2PMZA 1S32B 2CQNA 2DMPA 4BQNA 4EJOA 4XIDA 5C3IB 4IF4A 5D5XB 1WCMJ 1WJFA 2ZNYA 2X0LA 5JA4B 3REIC 3E0JB 1S72I 5B0ZD 1P3IA 2EFOA 4RGSA 3QP5A 5IY5H 1MIJA 5FKLA 3MVDC 4KITB 5BT1D 4ZUXC 1IDYA 3D1NI 2ICWG 1UG2A 1ZYRF 5IOYA 3ASOH 1K6OA 1J9IA 1ZGWA 1W0TA 3RJPA 2XROA 3WAAB 3W98C 4S04A 3REHA 2JQ7A 3G1OA 5CKTA 1UZCA 5CVRA 5EEGA 4ZYGA 3AZNA 2BBYA 3M4OJ 1TNTA 3KCCA 3GTPJ 4H9QA 1MNEA 3W96A 3UT9C 1AOID 1DP3A 3JRFA 2BYKB 5G49A 1FSEA 3AZLD 1P3OB 2MH2A 3QODA 1P3AC 3H92A 2K4JA 1E3OC 3W98A 1A35A 1RNLA 4XRFA 3F72A 1E3PA 3LZ1B 4EM0B 1Y1VJ 1HXDA 3RZDJ 3ZMVA 4E4HA 3BJ6A 3GZ5A 5LHHA 3J7ZI 3ELKA 3KLOA 4Z2YA 4UV9A 2IRFG 2IS1A 3S93A 3PIPF 1T98A 5AV5B 3EPZA 4ZZLA 3ZMSA 2OTLI 5FJ8J 4IHSA 1B4AA 1M19A 4KT5C 4UHTA 4BUPA 3HG9A 4CH7A 1HA8A 3AZKD 5EF6A 3AZKB 2BVMA 3FXKA 2MABA 2IW5A 5J8FA 3NQUB 3DTIA 3R61A 2KP6A 1YW9A 1ENHA 2JVGA 2NVQJ 4PK4A 1UG0A 3I55I 1ZLAC 3K4NA 2ZFUA 4BJ6C 1YOVB 1ODDA 2DODA 4A5MA 3BROA 1U2WA 2DPDA 3CMMA 3X1UC 3I0TA 2HNHA 1SAUA 4UY8I 3B6GB 4HLYA 4QTRA 1P7IA 3F23A 1X19A 2NVYJ 3EUAA 3LQRA 3ROUA 1P3BB 1UHSA 3C1CB 1Y0NA 1I50J 3Q9VA 4J8UA 5L3BA 2RQQA 5D6EA 4CO8A 3CJRB 2WAFA 3DPLC 3I56I 4J8UD 2LKPA 3K70D 4DBQA 5B0YB 3P9CA 2GM4A 5AV8A 2HQRA 2WAQA 2JSSA 4ZTFA 1GV2A 2KHMA 3EETA 2VE9A 2QSGX 1KU2A 5AV9B 5AV9D 1UCRA 4G7OF 3WG9A 4ASNA 5F1RA 1ETVA 2L7MP 3DLAA 3RPUD 3BPVA 3TO9A 3TDZC 2UWMA 4I98B 4U0YA 2V6EA 3DEEA 3CP8A 4A3FJ 1X1PA 4I01A 3CMEI 2FBHA 2IGNA 2LKXA 3LSGA 4G7HF 2ESHA 4E7HA 2R5ZB 1F4KA 3BQYA 1DQUA 2DK5A 3UT9D 1YO5C 3ZQCA 3NAUA 2O8KA 5DCMA 4E7JA 3REKB 3H35A 2OF7A 1P3MD 1IN6A 2JPCA 1OCTC 1A5JA 1O3TA 4DIQA 1XD7A 5IOZA 5GSUA 3REHC 4EVIA 5LRSA 3WTPE 4BE2A 4IQ4A 4J8VD 1B8IA 4IHWA 1MMGA 1W5SA 2HOSA 3CO6C 1HKSA 2CQ7A 4LMYA 1HQ3B 2BY1A 2KRHA 1ID3A 2FBKA 4A3KJ 3FF5A 1PP8F 2K5CA 3J7AO 3GX4X 3G6EI 1YQAA 1WHUA 5AIQA 3K1PA 1WJAA 4XN0A 4HX8A 5GAEJ 3CZ6A 3DV8A 1LKXA 4CCMA 3IV5A 5IYBJ 4LITA 5CJ9A 1RUOA 2CSOA 1GHCA 5E1ZB 2HDDA 1UFMA 1R5HA 5CPKC 4GGGA 4HDVA 2RAEA 1CF7A 3A02A 5LHGA 3A1IA 2LY1A 1KX5A 4M6BA 3I3LA 4UUSB 4E7LA 1GVDA 4LB6B 4KGCC 3E1SA 2MYSA 3EQLF 1O57A 2DI3A 3B02A 5L3CA 1QVTA 5DCFA 2XAHA 1AOIB 3K6GA 2AQFA 3J80K 5B32D 3MNND 4YFXF 3BZCA 5J1UA 3T5XA 2TRTA 2W84A 2GWRA 5ILSA 1EV7A 1V5FA 4G12A 2VKHA 3P5JA 2H94A 1KQ9A 2V1DA 1TW2A 5JHFA 5DUIA 1PUFB 2XF5A 2CMPA 3VSKA 3I5UA 3OOPA 1TZYA 1HW5A 3MMYB 4MEXF 1REPC 4V2GA 4WU8D 3A03A 1I1SA 2EIJH 1U35B 4AD9A 3KETA 2LG4A 4XRSA 1U9OA 3IKVA 5F0FA 3IH3A 4OIOF 4FQGA 2LY8A 5LBQA 4WV4B 1S6LA 3RSNA 2QKLB 2H8RA 2XD1A 1P3IB 2CQQA 2ZKZA 3AZJB 4CCJA 1I39A 2X1CA 3CC2I 4H9PA 4YM6B 3HRUA 5D4RA 5EEAA 1KU7A 4LG0B 2YFVA 2BW3A 4U7BA 4XUJD 5J1RA 2ME0A 3F22A 2DA1A 3PSIA 1M18B 3R60A 2P5VA 4LD9C 2HXOA 3COAC 1R00A 2PBIA 4DQYB 5J40A 4ZYAA 2JK3A 2LK2A 4II3A 3BR5A 3E6BA 3MVPA 4G6QA 2PFBA 3J7AY 3A01B 1YHQI 3X1UB 2PLYA 2VQCA 3O62B 1XG1A 2FNPA 1IDZA 4R8PD 1U5TB 3ABUA 3DP7A 4KUMA 4WXCA 3HGYA 1YIJI 2CW0F 3W97D 3OV8A 4S05A 5EDNA 2Y2NA 2DU9A 1DPRA 3IC7A 3K4KA 4ZUXD 3CJQB 2AXTC 2LFBA 5AONA 3ML6A 3AZHB 1S32C 1P6RA 3G1LA 1ZGJA 5B31A 1YI2I 1SFXA 3CDLA 3KXBD 1U5TA 1W7PB 3GVAA 3J80Z 1BH8B 4I6ZA 3Q0UA 4WNNB 1CF7B 3V7SA 3OS2A 4WU8B 3GTJJ 2MFZA 3B73A 2HIOB 2HUEB 3MGQD 3ESWB 3ZMZA 5LEJA 4D7NA 4KGCB 3ISPA 5AY8D 2X6YA 2E5NA 5A2QZ 1IJWC 2F4OB 3QP6A 4H0EA 4BACA 1I3AA 5H20A 3I59A 1JT6A 2LF8A 2HDWA 1H88C 4WU9C 2I8DA 1A6QA 1OCOH 2HIOA 3B6FD 2P5KA 4R79A 1P3OC 2L7FP 1B9NA 3FMRA 1R5ID 3RKXA 3W99A 1E0EA 3WA9D 3RTRA 4QWQA 3C1BA 2PYOB 1JKQC 2R7UA 2DA3A 5F04A 4HG2A 5M3FJ 1O3QA 2O0YA 4G92B 1WI3A 3B6AA 3JCUC 2M9HA 3S2HJ 4J8WD 1FTTA 4PFPA 2F8NK 4NDLA 4ZJZA 2YPRA 2R0QC 3SFIA 2JMWA 3DBHB 3REIB 3F8BA 3TBIA 4ZC3A 2GA2A 4R8PC 2VE8A 3VSLA 4YM6A 1R9TJ 5HNHA 2HVQA 5F27A 1P3FB 5CHLB 3S17J 5JFRA 1FMWA 5FLXK 3A2KA 5TISC 3HL2A 1BA5A 2Y2HA 2W8SA 5ICCA 4JJND 4HSTA 1MBEA 2XPUA 3JAMZ 3AZNC 2Y69H 1XSXA 6PAXA 4OWRB 3AZMA 4Z5TA 4C2MJ 5FB2A 1D3YA 4OMZA 2V9KA 3E6CC 1FNNA 2QQ9A 1P3MA 1P3PC 2XB5A 4XZQB 1Z7LA 2E5ZA 1OR7A 4XZQC 3UTAA 1HQCA 1E17A 2HYGD 3WAAC 2GXGA 2BOLA 3U9GA 1BW5A 1LFUP 2HIOD 1TQIA 2IJLA 4M3BA 2RVQC 1XX5A 3HXLA 4LD5A 5IT3A 3AV1B 3DTEA 4HQMA 3WG7H 4M6YA 1TC3C 2JA2A 2K3FA 3HPHA 4C9YA 3V9RB 3S3OA 1Z3YA 2ID3A 1JUSA 2M8GX 4RS8A 4C2TA 4BNCA 2LR8A 2KZVA 1LVAA 2OAZA 3IAM2 2Q8KA 1VQ9I 2BYMB 4OINF 2DT6A 2PEXA 4PJMA 2NS7A 5HS7A 5J47A 2KZGA 2OTJI 2HXIA 4IVNA 1K79A 2V7FA 3U2RA 4AM3A 3X1UA 5FKKA 2DFHA 3LSHA 2MSYA 3M8FA 5LGTA 1R4VA 5BS7C 1XSVA 2V1NA 1WJEA 2ZMEC 4HW0A 1R22A 2F8NA 4KN4X 3H9QA 2GQQA 4A3JJ 2EFWA 4IHVA 3AFAB 3WTVC 4A3EJ 3WA9B 2K9MA 1LEAA 4A6EA 1PZRA 5B2ID 3ABKH 4LD9D 3BG5A 1TQMA 4XNFA 5AY8A 4B3XA 2WADA 3S32A 5CP6B 3FBNB 3MGQA 3R6SA 4CYDA 4E7ZA 3K2ZA 2L0KA 4WCGA 3SZPA 3TP0A 1YRNA 4PJ0C 4M3DA 1B72A 4ZBJC 4EJWA 3LZ0D 1HC8A 3LZ0B 4JQFA 3A1YA 4BU2A 2CYYA 1BI0A 3VODA 3O62C 3DQVC 4IRHA 1BC8C 2F5EA 4AIDA 1QPIA 4XSZF 3GFLA 1XTAA 2DA7A 2A68F 2NAZA 2MGQA 3LELB 1G59A 5IT9K 3LELC 2EH3A 2DA5A 3RELD 1XGNA 3GFJA 5E5AC 5AVCB 3A6NB 1X2MA 1QZZA 4XM3A 1T95A 2KIUA 1K83J 5E17F 1RETA 1LVKA 4DRAA 2VKEA 4P9FA 3H3UA 3OYIA 2K86A 1X1AA 2LTPA 1MDMA 1B1BA 1M18A 1DPUA 3OIPA 5L3GA 3IP4C 3ABTA 1X1BA 3QWLA 2L4MA 1ZK8A 4XUJA 5F64A 5D4SA 2QYOA 2EJRA 2FF4A 2MA3A 2J5PA 2IS2A 1IZ1A 2R93J 3MGPB 4Q48A 2QBYB 3O3KA 4YEJA 5CQEA 1H9GA 2WBMA 1TZLA 2DLLA 3GLXA 4BEHA 2X1EA 4D7MA 1Q1VA 1SD6A 2QF7A 4DZJA 3TU4A 4GFBA 3L09A 5HLTA 2ZXHA 2HR3A 3BT9A 3H0GJ 3M8JA 4P5OA 2F8ND 4M3FA 4LLLA 1NG7A 4DGWB 1FSHA 1TWAJ 1NK3P 1EQZC 3OIOA 4WU9A 1TAFB 3KP6A 4MFEA 2VC1A 4XLEA 4O5VA 4GCVA 4CSWA 1ZTRA 3ZPLA 2VOOA 4G92C 2Z99A 2CV0A 2XKPA 2X4HA 4EO5B 3K4MA 2ZJQF 3ZQGA 2BEOA 1IN4A 2K9SA 3FZVA 3WTYC 1BW6A 5JRGD 3L7WA 3RI4A 4QIWN 1P3FC 5CVUA 1Q1HA 4LK1F 4J00A 2EZLA 2IPQX 4UUVA 2FXAA 3AYWA 1H3OA 4BQOA 3FM5A 3NQOA 2IA1A 4L9NA 4LIUA 2IO5B 1DGRM 5CQGA 2HEOA 4IOAF 3NWTA 3OYKA 1W7PA 3A0HC 3V7RA 1QA6A 4KUDD 2XGCA 4B3AA 3MKLA 3KP5A 3BC8A 1S3JA 2CV5D 4ESJA 5DDGA 4UUTA 3VH6W 2BGCA 4B43A 3ZQQA 1Y6IA 2RGVA 2Y2JA 5H2FC 3LL7A 2GA1A 2IGKA 3REJA 2DA2A 2KJBA 2CU7A 2L01A 1KU3A 3PO2J 4KYWA 1OKRA 2R7SA 1GVJA 3GTOJ 3BTIA 2JSCA 2M4KA 3BJAA 4C3JJ 1JKRC 5GXQC 3KUYD 1AU7A 1KONA 4IOCF 2L2OA 1R58A 3LA7A 1A7WA 3MD2A 3J7YJ 2BV6A 2W25A 1QO0D 4BXFA 5B24A 1BM9A 4XL9A 2L5QA 5B31D 4WXDA 1F1ZA 2F8NH 5B1MA 3E7LA 4ZUXA 3BTLA 1MJAA 2OJED 2UXNA 4MIMA 1N75A 1FYKA 2ZY5A 1CQTA 1P3GC 2AS5F 1SFUA 3OSFA 2LY2A 2RVCA 5GPCA 2B0LA 2DJIA 1OQYA 4MLOA 2R7RA 1LUJB 3X1VA 3U1DA 1MJBA 4IEJA 2M5WA 4A0YA 1I5ZA 2WA0A 3K10A 2HVRA 4KFCA 1X2NA 4BS9A 2JA6J 2XGXA 3HIFA 3TOAA 3MKYB 2YFWA 4M72A 2EILH 3B0BA 3REIA 1USSA 1WGXA 4UV8A 5EJCA 2K3PA 2A61A 3ZCOA 3FDYA 3UNGC 5L3EA 5F1JA 2STWA 2MC4A 3V7CA 5B5EC 5LGNA 3GTKJ 4Z2MH 3AZND 2EZHA 3MWMA 4OOIA 2VOPA 4XLHA 3OY9A 2YS9A 3AZKA 2KL4A 3CUQC 3M1EA 4BE0A 1F5TA 4IRGA 4BXXJ 1ON2A 2IVMA 2XHKA 4BE1A 2FUG2 5CVJA 4LJZF 3QPTA 1VQ4I 1T3UA 1FZPB 1WH5A 3HRTA 1T6SA 5D8LB 4X6AJ 3H1CA 2Z33A 4PSWA 3OYFA 1P3BD 4NBQA 2EA4A 3AV1A 2LRDA 1TZYD 5DYMA 1LEBA 4N9IA 4BDZA 1R49A 3E5XA 1JHFA 3P7NA 4DQ2A 3LSPA 1KYZA 3JRDA 4M3GA 1TL8A 3AN2C 3CCQI 2Y75A 2CQXA 5D5WB 3J81Z 4YFNF 2FU4A 2QQAA 2W24A 5DNMB 5FROA 1P3KD 2N8GA 4H9QB 2K4BA 3T8TA 2QM3A 1F66A 4KT6A 4WU9B 4YRVA 1ETXA 2PMZN 1T2KA 4KJZA 5FRMA 4Y52J 1M1EB 4WU9D 2LLKA 2LMDA 2K9QA 5DNNA 1ZREA 1HW1A 3R45B 4RGRA 3LZ1A 2VPRA 5DNND 1UMQA 5B2IC 4W97A 3BZ6A 1XGOA 4BL0B 3AG1H 3B0DB 2QKMB 3HDDA 2Y2MA 3HEFA 2G9WA 2X6XA 4H9PB 1BIAA 4EO5C 2NVUB 1FP1D 1X3WB 5IPAA 4YM6C 2MC3A 3AZID 4Z66C 2F2AC 2ACJA 3HRMA 2ISZA 4B8XA 1X4PA 5KAFC 4KUDC 3C1BB 4PJNA 4XOPA 3IH2A 4MTEA 2PG4A 2HI3A 3KZZA 3N4MA 1FWZA 2Y0SA 2WWYA 5HLGA 3AYWC 1RPWA 3KXBB 1F43A 4ZBJB 3SQNA 3KZYA 1P3KA 4HPQA 2W7NA 3KP3A 1I3QJ 1SD5A 3F6VA 3GFMA 4XLAA 1MD0A 4C3HJ 2R92J 2ZJPF 3AZLC 5D6FA 3UTBC 3MGSD 2LF7A 3UTBA 1ETKA 2LREA 2XAJA 2HTSA 3AV1D 1FIPA 2M0MA 3H3ZA 3TW7A 5IP6A 2XC7A 1P3KC 3CF2A 5FRNA 3AZHC 2DFFA 4BXUA 2IT0A 2KDOA 5CP6A 5E5AB 1S7EA 3X1SA 3PL8A 1J75A 4XKCA 1C0WA 3H5RA 1JT0A 5HODA 2HOTA 1U0JA 2V4JC 2V1UA 2A3SA 4MQVA 4ZDPA 3DWLE 4AIJA 4WU8C 3QPLA 5B2JC 1A04A 2WY7Q 4V2FA 1JE8A 1YIOA 3MEXA 3K4CA 1KX4D 3UT9A 1ONVA 2UWXA 2O8XA 5FLMJ 3F6OA 3VH5W 2XV4S 2F5FA 1YITI 3PQJA 3WHBA 2GXAA 3RZOJ 4UUZB 5B24D 2L9NA 4LB5A 3DKWA 1NH3A 2DDAA 5CPIA 2E34A 1T0FA 3RPUA 1RESA 3V8JA 5AVCA 5JVTA 3OYMA 2Y2ZA 2NS8A 3A6NA 1D0YA 4G9YA 3Q0VA 5CPID 1FT9A 2JA7J 5JRGC 3LZ0C 5ICGA 2KMUA 3HOUJ 4LD9A 1SANA 5B2IA 4LLNA 4NUBA 2H6CA 5HOOA 2FFFB 1A36A 3U1KA 4A6DA 5C4JJ 1MW7A 2EPFA 1FEXA 1AOYA 4CUGA 1ZHFA 3HOYJ 1OMIA 3LELA 1LDDA 4MGRA 2J5OA 2YSRA 3AFHA 1WQ2A 3H9GA 1T33A 5HDGA 2YX4A 1OLTA 4RAFA 1JKOC 5B1LA 1ZG1A 3AZHD 3ZRGA 4XSXF 2CGPA 3FMSA 1TP4A 3MGSB 4CAYA 2M7BA 3ZMTA 1BH9B 3CCYA 3AYWD 3W97B 5B2JB 3AYWB 2V26A 4F52A 3VYTB 2VI6A 5B1BH 3CUQA 2ZY2A 4M9ZA 1WH7A 3BR3A 4C3IJ 3KUYC 2I10A 1AOIA 2VBWA 3RELC 1TLHB 5LFAA 3B6GA 3MZYA 5CPRB 4KGCA 2E2IJ 2LP0A 2CW8A 1BR1A 1R1VA 1B72B 5DV5A 3L2RA 3W2AA 3AZJD 3X1SC 4YS3B 3NARA 1N1JB 3Q0WA 3AFAA 3WTUC 3Q9SA 2DDBA 2M34A 1OCPA 3B6CA 4CSRA 2RNJA 5LRRA 4Q5SF 3DPUA 2JUCA 4FE7A 4BGDA 1P3ID 1MZBA 9ANTA 2GIVA 2ADUA 3KWQC 4Y7NJ 4R8HA 1BI2A 3F8CA 4YM6D 1R1TA 1MBFA 3ONQA 5CLSA 1S29A 2KPMA 3BJOA 2CW7A 5GADJ 4L18B 2JPBA 3M3YJ 1GV5A 5BS7A 4H9RA 3AG3H 4Z66B 1P34A 5B1LC 2PYOD 4J8XC 1S7OA 1U3EM 2BYMA 4QLCC 4MO7A 1SAXA 4ENKA 2NVXJ 2EZKA 1MMNA 4PFOA 1H0MA 2QENA 1W7PD 3ZOBA 2QSFX 3VH5A 3WAAA 4IHXA 4H9RB 2A5YB 2DYSH 3X1TA 1V55H 2FBIA 2RDPA 1KU5A 1R7JA 4ABZA 1RKTA 5KNLA 1U78A 1WSUA 3MCZA 2V6CA 1E3HA 3HHHA 4R8PA 1ETOA 1STZA 1XCBA 5JRGA 1UELB 4V19K 3F8FA 3C2GA 2GOXB 2BHYA 5B1MB 4E45A 1TAFA 1K4TA 3AZED 2XDVA 3MGRC 1Z0XA 2A6HF 3LZ0A 1YX3A 1UB9A 2ZBKA 3I64A 4KA4A 4G91C 1AA7A 2Y0SN 4D5CA 4P9UA 3CCUI 5LD2C 2DQLA 2FOKA 1VQPI 3HOXJ 4LG0A 4Z2MG 2R7OA 4HZFA 4FASD 1USTA 1ZLKA 3HGGA 2IA0A 5AV6C 4YS3D 2FMLA 1MMSA 4BHCA 1QPMA 3W2VA 3L2QA 5JI6A 4A3DJ 1RR8C 3W97A 5TRDA 2JRTA 2KDZA 3AV2C 3WKJA 2X9DA 4OAYA 3H3VK 3HZJA 4I7HA 5GXQD 3S1NJ 4RAZA 4BQAA 3LAJA 5CVVA 2FQ3A 4EQQA 3LSTA 4K2EA 3T8RA 1OCZH 4FE4A 4XKWA 1G3WA 2PJPA 1HQ3C 1B9MA 1M18D 1R6RA 2RREA 2KRCA 3CLQA 2F4IA 4ESBA 5B40A 5B0ZB 4JJNB 1U5TC 3C1CC 1ZLJA 4XRSG 2VBYA 2RC4A 3BR2A 2HOAA 1RUNA 1WWIA 5FLVA 1XS9A 1LE8B 3AZEA 4Z66D 1JTXA 3J81K 3MZHA 2O03A 1KX4B 2Q0OA 4NQWB 5DTDA 4F7ZA 1P3GD 5B32A 3WGIA 1ZAOA 3LFKA 1TTYA 5E8GA 4A0XA 3AAFA 4GXOA 2P7CB 4A5NA 3L00A 1LFPA 4HLXA 2DMUA 5B0YD 3HC7A 4QPQA 2A07F 1KA8A 4XRMA 1ZKGA 3A01A 4CHUA 2E1MC 4H9OA 2G5IC 4EEFG 2FD5A 1D1AA 4HV6A 3W98B 3Q5FA 2JT1A 5HDKA 1TWGJ 3WODF 5AV6B 1P34D 2EB7A 2DMQA 1OYYA 2FQ4A 2X48A 3K70C 3REKC 4HEA2 3TKYA 5HS9A 3MNNC 3WGGA 3DBLB 3MNNA 2R7QA 2R7XA 3LZ1C 3SDGA 4AIKA 2HPIA 1TT5B 5E5AA 3X1SB 2YFWB 1U35C 2LDUA 1KGSA 2QUFA 2Y9ZA 2FJ7A 3G4SI 3S1MJ 2CUEA 4ZYDA 1SFEA 4Z5TD 2XSJC 4LLGF 3AZMD 3JREA 5B2JD 2XKOA 2MLGA 1RKWA 4RM2A 4Y33A 1MBKA 4AWXB 3GTGJ 2STTA 5FGMA 5JA4A 3GFIA 1L0OC 3X1TB 1O7LA 2JA8J 1KX4C 1FOKA 1XDSA 3FXRA 2WTEA 2ETHA 3IUOA 2L9RA 2AHQA 5AVBC 1ITYA 4N9HA 4G8XA 4J8VC 3KWQA 2Q2EA 2LBFB 4Q47A 4ANJA 3GF2A 1Y39A 3ZXSA 1HKQA 3M7GA 2HYFA 2M45A 2ZXIA 4B4CA 4P1WA 3AZGA 1Z7UA 2OCCH 3OR2C 1IN8A 3FXUA 4I76A 3R4KA 4FT8A 3V8KA 4LGWA 3W6VA 4RAYA 1ZELA 5IP7J 2EK5A 2DN0A 3AL0B 1X58A 4EJUA 5DNMA 2K9LA 2O7OA 2FOWA 3K1NA 3W6JB 3LJAD 5FO5A 3LJAB 3KZIC 3DU5A 4CCOA 4JX4A 2Z3YA 4BHBA 4F92B 1IV6A 2P0WA 2XF7A 3HPGA 1T39A 4PSXA 3UTBB 3GW2A 5E79C 2VASA 1AKHB 3TEDA 3SHFA 2XGDA 3OS1A 1QBJA 3WGHA 4RGUA 4CZCA 3F21A 1VNDA 3HJEA 4PGGA 4X23C 1MJ9A 5CPJB 1VQMI 5DD4A 4UXNA 4WXHA 1EH6A 1H3OB 4YG2F 3WTTC 4H9NB 1IXSB 1WWXA 3KXBA 1S5LC 2PN6A 4RAGA 1OYWA 3ZGKA 3WA9A 3MGRA 1MNMC 2L54A 5KK1A 2DXIA 4H9SA 2XRLA 1YS7A 1W36D 1KX4A 3CCSI 1B8IB 2Z5UA 1JGGA 1JFIB 3FISA 1D1BA 2XAQA 2ZO4A 4ZH4F 5EZGA 1T8IA 1T38A 2YFVB 1LDJA 1ID3B 5ERIA 3UTAB 4OAZA 3VH6A 2L3DA 1AHDP 3E97A 4AIHA 2E7XA 3FWEA 3CCVI 3QRFF 4KHAB 3F8MA 4PDKA 3IRRA 5C44J 1FYLA 3CO7C 5GT3D 5GSUC 1A31A 5DD8A 3TP3A 3OYAA 1G4DA 2PJRA 3GMEA 4HV5A 2NQBA 1ON1A 1IUFA 3C3WA 3ZQ7A 3REJC 3HM5A 4RB0A 5DM7F 1I27A 1XN7A 2COMA 2LNBA 2LY9A 3PNVA 4HSRA 4XONA 2Z9OA 4BBSJ 1P3PB 3PFYA 1IXCA 2TCTA 1PYVA 3KYCB 3I4NJ 1IV8A 1MBJA 1J5YA 2PX9A 2CUZA 4FHTA 1FYMA 4L5IA 3L2VA 3C2HA 2CO5A 2W48A 2GLOA 2NQBD 4IO9F 2GZWA 2XASA 3HUGB 1Z67A 1XSDA 1BI3A 4OU0A 1F36A 1HDDC 4E7IA 5HVQC 3CJNA 1JKPC 1OCCH 2P6SA 2D5VA 3IP4B 2RVQD 3A1KA 3E5QA 4GYIA 1MMDA 4DYQA 2OZUA 5K5OA 2Y2GA 4EM2A 2XF6A 4WU8A 4BJTA 3TMOA 2QLZA 3PIOF 1BOAA 5E3OA 5D5UB 2XAFA 2GXBA 2FE3A 1P9QC 1V54H 2ZXJA 5B31C 2Y2OA 3AL0C 2YX7A 1J59A 2R4GA 2B7EA 2DMNA 2KQRA 1VQ7I 3M9AA 2VQLA 5B32G 1R71A 5EGOA 2CG4A 4PJLA 2Y2IA 4FISA 1TBXA 4L5JA 1ID3D 1FBUA 2WB1A 5AV8B 3DEWA 4HBLA 1ZRFA 5AV6D 1VQOI 1P34B 1KX5D 4L9VA 1P3KB 4CSRB 3SEZA 1N25A 1ZLAA 2H1LA 2WV0A 3MZ8A 1P3LB 5GSUD 2WY8Q 1I6XA 1ZR4A 1FP2A 3EUHC 3MFKA 3OYDA 4BAYA 5KDMB 1MNDA 2F5VA 2E1CA 3OL4A 1RIOH 3BCBA 1YJNI 2VC0A 1LB2A 1QU3A 1M19B 2V79A 2KFDA 2HDCA 2Z2SB 1P3MC 1QRYA 3ZP5A 1ZLAB 1RI7A 2IO5C 5B1AH 3TW6A 3OYGA 1XGSA 2UV1A 2W82A 4HF0A 3HSRA 3OYHA 1JXSA 5DUKA 1HTAA 2P8TA 1BI1A 2A05A 3ASNH 1H9TA 1RRJA 2ZY3A 4XK4A 1FTZA 1QHHD 3H0RC 3OYJA 1SMTA 2HQ5A 1XCVA 4RLQA 4WF2A 3JSPA 1JGSA 3WE3A 2DQRA 4E6KG 4HOBA 3C1BD 2BYKA 5G49B 3IH4A 4KIFA 4BYYA 4JK1X 1Z91A 2IGMA 1O3RA 3AN2A 4KGCD 4PCQA 1V5EA 2O61A 2HYJA 1ETYA 2Y48A 1J09A 3I54A 5JHUA 2VQRA 1JJ8C 2BHZA 2XAUA 3HYIA 4A12A 5B2JA 2F5CA 2XAGA 1YFHA 3DFGA 3FKIJ 2JUGA 5F99A 3W3CA 2K27A 3BG6A 1K6YA 1XMKA 2DA4A 3R0AA 2E1MB 1YE9A 4IHTA 3GTLJ 3FXJA 2QZ8A 2VJJA 4Y3OA 4ZYEA 4MEYF 4MNUA 4FX4A 1YJ9I 4HQEA 1Z2CB 4AUXA 2Y2KA 4UNOA 4L5EA 2FEZA 4FTHA 1VF9A 2DO7A 3K1MA 4HA8A 1N78A 3VPRA 1R4NB 1Z3XA 5B31B 4F91B 3SJMA 4ENNA 2K7LA 2CFXA 4M3EA 5HS8A 5F0CA 4O6JA 4I0AA 4F55A 5BNVA 4YELA 3FK6A 1M19D 2QQ8A 3HRSA 4NC8A 2CUFA 2IXSA 1K61A 2RV8A 4MFDA 4CICA 1M1AA 2WAQN 3PQKA 2BY3A 3AZFA 3EG5B 3WHCA 2RKHA 4ETSA 2M1BA 4NE5A 3QYFA 3TL4X 1P3LC 1YG2A 2E71A 1P3GA 4J8WB 5M5YJ 3KE2A 3S1RJ 2NZDA 4RM3A 5K5QA 1SFOJ 2OD5A 5LGUA 1S7AA 5D8KB 2HQNA 3W96B 3JRIA 1R1UA 3WTPB 2HKXA 3AZIC 5B40D 3KFWX 2DK8A 3LA3A 4X1EA 5AV9C 3WTPC 2IEKA 2XGEA 1W2EA 2RN7A 1TT0A 2D1HA 4G6TB 5BO0B 1R23A 2I5UA 3GTQJ 4RB2C 2EFNA 2ZC2A 3H0MC 2XVCA 3EUKL 3MVDD 1FBQA 2LC2A 5FKOA 1MDMB 3BZKA 3WKJD 4U7DA 2CUJA 3CQZJ 4M9SA 3IWZA 5F6FA 5DCMB 1XMXA 4AU7A 1KQ0A 3REKA 1F66C 2LSOA 4H4KC 3S14J 3L2UA 2P4WA 4J8XA 3UTBD 3MGSA 2VBXA 1M1AC 3REHB 3MKWB 3REHD 4HGAC 3I4PA 3HOTA 1TWCJ 5AV8C 1V5GA 1R5GA 5A2QK 2P81A 1OFCX 5JR3A 2K02A 3CUOA 4DW6A 3WE2A 1WJCA 4S0HB 2OZ6A 3QOPA 1KZHA 5GT3B 1P34C 3HUGA 4QPOA 4Y17A 4F93B 3H0LC 2EINH 1P3FA 5AY8C 1W1WE 3MAJA 3SZGA 4BH9A 3LSIA 1PP7U 3AFAC 3LMMA 1JHHA 3IL2A 3LSJA 3AZKC 5J6XA 1P3LD 3O8GA 5GTHC 2P6TA 5CP6C 5L3DA 1P3MB 3JRCA 2CJJA 2ZB9A 3R45A 5ILUA 5GT0A 1WI9A 4IKFA 3CP2A 1JI8A 3JRBA 2M7AA 1MSFC 1IG7A 2NRAC 3AV2B 2KLOA 4CCLA 4LK0F 3TQNA 2GIZA 3GTMJ 2PMUA 2RNGA 2JVHA 2FMYA 4RGXA 1Y8RB 3W99B 2R7DA 1IXRC 2OQGA 4D1QA 2R7VA 1IN5A 1R4MB 5FLXZ 1GUUA 2O6GE 2LOOA 3PO3J 3RELA 3UKGA 2OA4A 3B6GC 5EZHA 1A6IA 1U8BA 4JJNC 4J8VA 3QOEA 1K7AA 2L5AA 3D5SC 3I59B 3WTZA 3RIRA 3BP8A 2M2EA 2VODA 1P3AA 3BDDA 3S8PA 2X85A 1EA3A 2KIMA 3G1MA 4GRIA 5EYRA 5BOXA 2AROC 3LJAC 2FJ7C 2NZDB 5FD6A 4LIVA 1FLIA 2R5ZA 3LNQA 1WKMA 3RYRA 4CCNA 1G2HA 3GXOA 2JWTA 4D9JA 4UB8C 4NE6A 1LE8A 2VT3A 3O6BB 4JYKA 1XPXA 3HOZJ 4WZSB 5AY8B 3F6TA 3BCAA 3HSEA 2HKOA 3RQIA 2BY0A 4AYBA 1VQNI 3AG2H 3SZTA 2HGCA 4UVAA 2COBA 5AV9A 2FSWA 2EIKH 1EF4A 1B6AA 1E2XA 2JRMA 2KT0A 2OCEA 4KNYA 3V8LA 4H9OB 4XR6A 3OYEA 3IKTA 5B3SH 4EV0A 2M87A 3SXYA 3VH5T 2MH9A 2FA5A 2P5LC 1M1AB 4ZDLA 2HTJA 2PYOC 5IT9Z 2ZNZA
chains in the Genus database with same CATH topology
2EFQA 3TO7A 4KIGA 2H6BA 3REOA 1P3OA 5GT3C 1P3IC 1K78A 4G94A 1U8RA 4CDGA 1HQ3D 3ZMUA 4YFKF 3WTPD 5ICFA 5B40C 1I1GA 2HS5A 4ESFA 2Y0MA 5CPKB 3ZN0A 5B1MD 3SFZA 4WWCA 2EA2A 1ZN2A 2CQKA 3DF8A 3KUYA 1AOIC 2RQPA 1G3TA 3NEUA 4ZYHA 2A69F 3E3VA 4YS3C 2EV0A 3W98D 2XD5A 1IN7A 3CTAA 5B32B 3LQQA 1HKTA 1ZRCA 1P3AB 3C1DA 2OQRA 2ISYA 4J8WA 4XBFA 3NQJB 2CV5A 2HFHA 2AXLA 1ZARA 2BE5F 3QPHA 2D45A 2EWNA 1P92A 3CDHA 4XZQA 3B6FC 4X23B 5CPJC 1U35D 3B6FA 3HTSB 1LDKB 3I58A 5B24C 1O3SA 3FXQA 4A2UA 4YS3A 1P3GB 2F8NB 3AV2D 2QBYA 4X23A 1BH9A 5CPJA 3AZNB 3P9IA 3QAHA 3EDPA 3T1BA 5CPKD 3W99C 3AZIA 5B33C 5EEHA 5E20A 2GAUA 3CLOA 3IHUA 2HWVA 1EH8A 2R7FA 3X1VB 4AWLB 3BOQA 5B32C 1QGPA 1WWSA 1G3YA 1SD7A 4MTDA 1DUXC 4I2OA 2DW4A 1P3FD 3K0LA 4XZQD 4AVPA 5B0YC 5F99C 2WC2A 5F99B 5CYVA 5BNVB 1F66D 3G73A 1XGMA 4UUZA 3DXJF 3GUDA 2PYOA 2ZMEB 2JZYA 2NZDD 5CPJD 3AN2B 4U0WA 4X23D 3MGPC 1HSTA 5BNXB 2DFIA 3EYIA 5AVBA 5TJJA 4KICA 1KX3D 1ULYA 3UT9B 1UHWA 3NRVA 4WK8F 4Q4ZF 4G7ZF 4LFUA 1U35A 1P4AA 3AFAD 2PI0A 3BPXA 5CVIA 2IP2A 3IRQA 3B0DC 2VXZA 5FD5A 3DEUA 1OYIA 2ZY4A 3HTUA 3P5JB 2QQBA 2UXXA 1QZYA 2G7HA 5KVRA 3BWGA 3L2CA 4AWLC 1VTNC 2OBPA 4HX4A 3D5LA 2NQBB 3G3ZA 3REID 2XUBA 4EJTA 5LLQA 1SMYF 3TOBA 2YR2A 4P96A 1IAWA 4UVCA 4KDPA 3W96C 3MVDA 3NQJA 4RB3C 3VEPA 4OIQF 3V9RA 1RZ4A 4PGHA 3X1UD 3EUHA 3X1VD 3W6KB 3IWFA 5B33D 3FMQA 4XLPF 3LELD 3C7JA 3WU1B 2F2EA 1G6NA 3BY6A 3FM3A 3MGQC 4OIRF 3MGRD 3LA2A 1D8JA 3AZLB 1Z6TA 3AV1C 1P3BC 2MLKA 3EYYA 3AZFD 5AIPA 1M1AD 3UTAD 4M73A 1P3OD 1XDUA 1W5TA 4PZJA 2DQNC 5BPIA 3VOEA 1KX3B 1YW8A 1AWCA 1BN5A 4D0PA 3F8NA 5DNMD 1P3AD 3AN2D 2QVOA 3ZMDA 1Z05A 3K9TA 3MGPD 1ZH5A 4HX7A 3HHGA 1TNSA 4KUDA 3FX3A 1JFIA 3KEOA 5AV6A 3EPHA 2D2WA 4XUJC 3KWQD 2EFPA 1YW7A 5BPDA 4BHPA 1J7KA 4DNCA 2RIQA 2DF4C 3JTHA 1DDNA 4H9SC 3JAMK 4JBAA 1KQ8A 2YU3A 5KDMA 1Z1DA 2NQBC 2CV5C 5AVCC 3A6NC 3RKWA 2ZFWA 4ENJA 4EJVA 1PDNC 4QLCA 3E5UA 5E5AD 3LWFA 1BIBA 2IA2A 2O3FA 3TU4D 5H6RA 4O3MA 3KP4A 1FX7A 3KXBC 5FUGB 2NNYA 4KMFA 1L3LA 5BS6A 5GT0D 2R3SA 5GT0B 1D5VA 2F8NG 2H27A 5DNMC 3REKD 3GO5A 5AV5D 2E1NA 2V9VA 4Z5TB 1FC3A 3DPTA 3LZ1D 4R1HA 4ON0A 4XUJB 1ZRDA 3C1CA 1ZGAA 2BYVE 3I53A 3RDIA 5DNNB 2D1VA 1S8NA 3I71A 1UHMA 4WX9A 2F5DA 2L4AA 3D0SA 1B6WA 1FPQA 3AZLA 1HW2A 1Y0UA 2ESNA 1V4RA 3W96D 4NHJA 5B24B 4QLCU 2G5HC 4DRBA 4J8XD 3RKYA 2P7VB 5BMZA 1P3BA 3C1CD 3O2PE 4KUDB 3L9FA 2L02A 3GZ6A 5GT3A 2XRNA 4U88A 5ICEA 2W57A 5DEQA 5AV5A 1KX3A 3HSFA 1N1JA 3TDUC 3N97A 3MGQB 1LQ1A 5E8IA 3PFIA 5B1MC 2J8PA 2EV5A 1J0RA 4B09A 3CUQB 2NNNA 5E1WA 5AV5C 3VFZA 2AROB 3AZGD 2FJ7B 4I09A 2CV5B 5GXQB 5FFXA 2NS0A 3AZFB 5BO0A 3R0JA 4EGYA 1KX3C 1Z9CA 1XMAA 5AVBB 3B6FB 4FX0A 3MGPA 1BC7C 3HOSA 1MGTA 5K5RA 1P4XA 3JTGA 1R36A 4L9TA 1HBXG 2UZKA 1EQZB 3O62D 4QLCD 5CPIB 3RPQA 5B33B 3AV2A 2DT5A 3WKJC 5ILVA 1X3UA 3REJD 3WKJB 3KP2A 4KMUX 2ZCWA 4ENMA 3KLNA 4E44A 1TQPA 3B0CW 4R8PB 3VH6T 5B40B 5B1LB 5B33A 3V4GA 3TU4C 4J8UB 3W99D 3EPJA 3AZJA 2Y2QA 3MGSC 2FJ7D 1S32A 1P3PD 1IRGA 1OPCA 1IRFA 1IF1A 2ZJ2A 4HDUA 3W97C 3QU3A