1KX3A

X-ray structure of the nucleosome core particle, ncp146, at 2.0 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'(ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCAT
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 33
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx3A00
2RVQC 5F99B 1P3PA 3AV1B 5B1LC 3RELA 5B24C 3NQJA 4Z2MG 5E5AB 3AZLD 5CPIA 3C1CD 5B1MD 3AZFA 4WU9B 3MGQA 3WA9C 3KXBD 3WAAD 3WTPC 4WU9C 4H9RA 5GT3D 5JRGD 3AZJD 1P3FC 5KDMA 1TZYA 5B0ZD 2F8NA 5AV8B 4Z66A 4LD9A 5AV8C 3VH6A 3REIB 4NFTA 3B0CW 3REIC 4J8WD 3B0CT 4WU8A 4HGAB 2PYOB 5AV6A 1P3PD 3O62A 4J8UB 4HGAC 5CPJA 2PYOC 4CSRA 2AROD 1HQ3B 4J8UC 1WWSA 5BNVA 3AYWA 5AV9C 3V9RA 1HQ3C 3C1BA 3REHB 4ZUXB 3LELA 5JA4B 5GT0A 5AVCA 1ZLAD 3REHC 5AY8D 4Z5TB 3AZMA 3KWQA 3NQUB 1WWIA 1P3MD 2HIOB 2FJ7B 4Z66D 3W99D 1JFIA 3AZNC 2HIOC 2FJ7C 3MVDD 4XZQB 3W97B 5FUGB 1KX4B 4XZQC 4UUZB 5F99A 2NZDB 1F1EA 3AV1A 4WU8D 1KX4C 2BYKB 5CPJD 1R4VA 5E5AA 3REJD 2CV5B 4H9SC 3AYWD 3AZKD 1A7WA 5CPKB 1P3LB 2CV5C 5B40C 5CPKC 1ID3B 5GT0D 5AVCD 3UT9B 2NQBC 1F66D 5AV8A 3MGRC 5B0YB 3REIA 3LZ0B 1M18D 3MNND 3R45B 3LZ0C 3LZ1B 3AN2D 2F8NH 4G92B 5F99D 3LZ1C 3AV1D 1KX5B 4G92C 4J8UA 1HQ3A 1KX5C 3X1TD 5E5AD 5B32B 5B2IB 1M19B 3REHA 4ZUXA 5JA4A 5B32C 3X1SB 5B2IC 1M19C 4WNNB 3X1VD 3REKB 3W98B 3AZEB 3KUYD 4Z5TA 3X1SC 3AFAD 3W98C 3NQUA 3REKC 3AZEC 2HIOA 4R8PD 2FJ7A 3B6FB 3AZIB 1TAFB 5GXQB 3AZIC 5GXQC 3W97A 4XZQA 5FUGA 4H9PB 1KX4A 5DNND 1S32C 2NZDA 1P34C 5B2JD 5BT1C 2BYKA 1ULYA 1AOIB 1BH8B 1KX3D 2CV5A 3AV2C 3AZHB 5CPKA 1P3LA 5C3IB 3W96B 4ZUXD 1M1AB 5AV5D 1ID3A 5B33C 3W96C 5C3IC 3UT9A 4KGCD 3WKJD 5BO0B 1M1AC 3VH5W 4Z5TD 1EQZB 3VH5T 5B0YA 5B1LB 5B24B 5DNMB 1P3BB 3LZ0A 5CP6D 3MGPD 3A6NB 3R45A 5DNMC 5AVBA 1P3KB 1P3BC 3W97D 5B31G 3LZ1A 3A6NC 3WA9B 1P3KC 3WTPB 1P3OD 2NZDD 1KX5A 5GSUB 3LJAB 3UTBD 1P3FB 4Z2MH 5GSUC 3LJAC 4XUJB 5B32A 5B2IA 1M19A 1P3LD 4XUJC 3X1SA 3W98A 4YM6C 4WNNA 3REKA 4J8XB 3AZEA 1ID3D 3UT9D 5B31B 4J8XC 4X23B 4QLCB 5B31C 3B6FA 1TAFA 5B0YD 4X23C 4WZSB 4QLCC 5GXQA 3UTAD 3AZGC 3RELD 4H9PA 5AVBD 5AV9B 4WV4B 5CHLB 3B0DC 5CPID 3AZFD 3MGQD 1AOIA 4YS3B 1BH8A 4JJNC 4YS3C 3AZHA 1TZYD 3W96A 3X1UB 3AZNB 1M1AA 2F8ND 3X1UC 2YFVB 3X1SD 4LD9D 5BO0A 1P3GC 4KUDC 1EQZA 1KU5A 1U35B 1Q9CA 3B6FD 5B1LA 3MGSB 5B24A 5DNMA 1U35C 3B6GC 1P3BA 1P3IB 3MGSC 3A6NA 5AV6D 1P3KA 1P3IC 3O62D 3WA9A 3VH6T 3WTPA 4WU9A 5GSUA 5B40B 2YFWB 3LJAA 1P3FA 2NQBB 4H9NB 4J8VB 1H3OB 3C1BD 2JSSA 3LELD 1AOID 4XUJA 4J8VC 3TU4B 3MGRB 3AZHD 3AZMD 3TU4C 3KWQD 5B32G 4J8XA 5B31A 3AZLB 3C1CB 4QLCA 1EQZD 3WAAB 3AZLC 2RVQD 3C1CC 5B1LD 5GT3B 3WAAC 5B24D 3KXBC 3AZJB 2PYOA 5B0ZB 5GT3C 5JRGC 3AZJC 5AV9A 4M6BA 1B6WA 4DRAA 5B0ZC 1BFMA 3WA9D 3WTPD 4WU9D 1P3FD 4YS3A 4E44A 3X1UA 4J8WC 3AZNA 1P3PB 5AV8D 4H9QB 2YFVA 1P3PC 2AROB 1P3AB 2LY8A 2AROC 3REID 1U35A 1P3AC 1S32B 1P34B 1ZLAB 2L5AA 4UUZA 1P3IA 2CWEA 5AY8B 2PYOD 5KDMB 1ZLAC 5BNXB 5AY8C 3AV2B 1P3MB 4J8UD 4H9SA 5AV9D 1HQ3D 3W99B 1P3MC 5B40A 1N1JB 2YFWA 4Z66C 5B33B 3MVDB 4H9NA 3W99C 1H3OA 4J8VA 3REHD 2NQBA 3MVDC 3TU4A 3MGRA 3AZND 2HIOD 2FJ7D 4WU8C 4H9OB 4NE5A 3REJB 5BS7C 3AZLA 3C1CA 5CPJC 4G91B 3AZKB 3REJC 3WAAA 1U35D 4XZQD 3AYWC 5GT3A 4G91C 3AZJA 3AZKC 1KX4D 5B0ZA 1F66B 5AVCC 1F66C 2CV5D 4YM6B 5B40D 5CPKD 1M18B 2NQBD 3MNNB 4DRBA 3AN2B 1M18C 3MNNC 3MGRD 3AN2C 4H9QA 3AZGB 3AZIA 5F99C 2AROA 3AV1C 1P3AA 3X1TB 3LZ0D 1S32A 3X1TC 5E5AC 1P34A 3B0DB 1ZLAA 3LZ1D 1B67A 3X1VB 5AY8A 4NE6A 3KUYB 5BNXA 3AFAB 3X1VC 1KX5D 3AV2A 1P3MA 1BH9B 4R8PB 3KUYC 4JJNB 3AFAC 3W99A 4R8PC 1N1JA 5B32D 5B33A 5G49B 3MVDA 5B2ID 4ZBJB 4CAYB 1M19D 1P3GB 4KUDB 2HUEB 3W98D 4ZBJC 3REKD 5DNNB 3AZED 2HUEC 5B2JB 5DNNC 5BS7A 3B6GB 5B2JC 4H9OA 3AZID 4KHAB 5GXQD 3REJA 1KX3B 1P3AD 3WTPE 3AZKA 1KX3C 3KSYA 3VH6W 1S32D 1P34D 5AV5B 5BT1D 4KGCB 3WKJB 4ZUXC 1F66A 5AV5C 4KGCC 3WKJC 3AV2D 4Z5TC 4YM6A 4EO5B 5CP6B 3MGPB 1M18A 5B33D 3W96D 3MNNA 1M1AD 4EO5C 5CP6C 1HTAA 3MGPC 3AN2A 2IO5B 3W97C 4X23A 5B1MB 1P3OB 3AZGA 2IO5C 3KXBB 3UTBB 2BYMB 1P3OC 5B1MC 2NZDC 5JRGB 3X1TA 3UTBC 5DNMD 1P3BD 3A6ND 1P3KD 3X1VA 1P3LC 3B0BA 3KUYA 3AFAA 5GSUD 1BH9A 1ID3C 4R8PA 3LJAD 4JJNA 3UT9C 4J8WB 4XUJD 3UTAB 2F8NG 5G49A 5B0YC 4CAYA 4YM6D 1P3GA 3UTAC 3RELB 4KUDA 3NQJB 5AVBB 4J8XD 5DNNA 3RELC 5B31D 5B2JA 5AVBC 5CPIB 4X23D 4QLCD 3AZFB 3B6GA 4E45A 3MGQB 3AZGD 3MGSA 5CPIC 4KHAA 3AZFC 1KX3A 4H9RB 3VH5A 3MGQC 1TZYB 2F8NK 2F8NB 5AV5A 1TZYC 4Z66B 4KGCA 4LD9B 3WKJA 4AWLB 4LD9C 4AWLC 4JJND 4YS3D 5CP6A 3MGPA 4WU8B 3X1UD 3B6FC 5AV6B 1P3GD 4KUDD 3O62B 5CPJB 5AV6C 4CSRB 1P3OA 5B1MA 3O62C 5BNVB 3AYWB 3KXBA 3UTBA 2BYMA 3V9RB 3B6GD 3C1BB 3LELB 3MGSD 5JRGA 4NE3A 5GT0B 5AVCB 1P3ID 3C1BC 3LELC 1AOIC 5GT0C 3AZMB 3KWQB 3AZHC 3AZMC 3KWQC 1JFIB 4J8VD 4J8WA 1EQZC 3UTAA 3TU4D
chains in the Genus database with same CATH superfamily
2RVQC 5F99B 1P3PA 2XD5A 5B1LC 3RELA 5B24C 3AV1B 3NQJA 4Z2MG 3FDDA 5E5AB 3AZLD 5CPIA 3C1CD 5B1MD 3AZFA 4WU9B 3MGQA 3WA9C 3KXBD 3WAAD 3WTPC 4WU9C 4H9RA 2ZY3A 5GT3D 5JRGD 3AZJD 1P3FC 5KDMA 1TZYA 5B0ZD 2Y2MA 2F8NA 5AV8B 4Z66A 4LD9A 2ZY4A 5AV8C 3VH6A 3REIB 4NFTA 3B0CW 3REIC 4J8WD 3AL0C 3B0CT 2ZM5A 4WU8A 4HGAB 2PYOB 5AV6A 1P3PD 3EPJA 3O62A 4J8UB 4HGAC 5CPJA 2PYOC 4CSRA 2AROD 1HQ3B 4J8UC 1WWSA 5BNVA 3AYWA 5AV9C 3V9RA 1HQ3C 3C1BA 3REHB 4ZUXB 3LELA 5JA4B 5GT0A 5AVCA 1ZLAD 2FFFB 3REHC 5AY8D 4Z5TB 3AZMA 3KWQA 3NQUB 1WWIA 1P3MD 2HIOB 2FJ7B 4Z66D 3W99D 1JFIA 3AZNC 2HIOC 2FJ7C 3MVDD 4XZQB 3W97B 5FUGB 1KX4B 4XZQC 4UUZB 5F99A 2NZDB 1F1EA 3AV1A 4WU8D 1KX4C 2BYKB 5CPJD 1R4VA 5E5AA 3REJD 2CV5B 2VQRA 4H9SC 3AYWD 3AZKD 1A7WA 5CPKB 1P3LB 2CV5C 5B40C 5CPKC 1ID3B 5GT0D 5AVCD 3UT9B 2NQBC 1F66D 3H0LC 2Y2PA 5AV8A 3MGRC 5B0YB 3REIA 2Y2JA 3LZ0B 1M18D 3MNND 3R45B 3LZ0C 3LZ1B 3AN2D 2F8NH 4G92B 5F99D 3LZ1C 2G5IC 3AV1D 1KX5B 4G92C 4J8UA 3EPHA 1HQ3A 1KX5C 3X1TD 5E5AD 5B32B 5B2IB 1M19B 3REHA 2Y2HA 4ZUXA 5JA4A 5B32C 3X1SB 5B2IC 1M19C 4WNNB 3X1VD 2Y2NA 3REKB 3AZEB 3W98B 3KUYD 4Z5TA 2ZY5A 3AFAD 3X1SC 3NQUA 3W98C 3REKC 2Y2QA 3AZEC 2HIOA 4R8PD 2FJ7A 3B6FB 3AZIB 1TAFB 5GXQB 3AZIC 5GXQC 3EPKA 3W97A 4XZQA 5FUGA 4H9PB 1KX4A 5DNND 3EG5B 2XD1A 1S32C 3KFUG 2NZDA 1P34C 5B2JD 5BT1C 2BYKA 1ULYA 1AOIB 1BH8B 1KX3D 2CV5A 3AV2C 3AZHB 5CPKA 1P3LA 5C3IB 3W96B 4ZUXD 1M1AB 5AV5D 1ID3A 5B33C 3W96C 5C3IC 3UT9A 4KGCD 3WKJD 5BO0B 1M1AC 3VH5W 4Z5TD 1EQZB 3VH5T 5B0YA 5B1LB 5B24B 5DNMB 1P3BB 3LZ0A 5CP6D 3MGPD 3H0RC 3A6NB 3R45A 5DNMC 5AVBA 1P3KB 1P3BC 3W97D 5B31G 3LZ1A 3A6NC 3WA9B 1P3KC 3WTPB 1P3OD 2NZDD 1KX5A 5GSUB 3LJAB 3UTBD 1P3FB 4Z2MH 5GSUC 3LJAC 4XUJB 5B32A 5B2IA 1M19A 1P3LD 4XUJC 3X1SA 3W98A 4YM6C 4WNNA 3REKA 4J8XB 3AZEA 1ID3D 3UT9D 5B31B 3P5JB 4J8XC 4X23B 4QLCB 5B31C 3B6FA 1TAFA 5B0YD 4X23C 4WZSB 4QLCC 5GXQA 3UTAD 3AZGC 3RELD 2Y2IA 4H9PA 5AVBD 5AV9B 4WV4B 5CHLB 3B0DC 5CPID 1T3UA 3AZFD 3MGQD 1AOIA 4YS3B 1BH8A 4JJNC 4YS3C 3AZHA 1TZYD 3W96A 3X1UB 3AZNB 1M1AA 2F8ND 3X1UC 2YFVB 3X1SD 2BG1A 4LD9D 5BO0A 1P3GC 4KUDC 1EQZA 1KU5A 1U35B 1Q9CA 3B6FD 5B1LA 3MGSB 5B24A 5DNMA 1U35C 3B6GC 1P3BA 1P3IB 3MGSC 3A6NA 5AV6D 1P3KA 1P3IC 3O62D 3WA9A 3VH6T 3WTPA 4WU9A 5GSUA 5B40B 2YFWB 3LJAA 1P3FA 2NQBB 4H9NB 4J8VB 1H3OB 3C1BD 2JSSA 3LELD 1AOID 4XUJA 4J8VC 2DQNC 3TU4B 3MGRB 3AZHD 3AZMD 3TU4C 3KWQD 5B32G 4J8XA 5B31A 3AZLB 3C1CB 4QLCA 1EQZD 3WAAB 3AZLC 2RVQD 3C1CC 5B1LD 5GT3B 3WAAC 5B24D 3KXBC 3AZJB 2PYOA 3A1KA 5B0ZB 5GT3C 5JRGC 3AZJC 5AV9A 2RIQA 4WJ3C 4M6BA 1B6WA 4DRAA 5B0ZC 1BFMA 3WA9D 3WTPD 4WU9D 1P3FD 2ZY2A 4YS3A 4E44A 2J8PA 3X1UA 4J8WC 3AZNA 1P3PB 5AV8D 4H9QB 2YFVA 1P3PC 2AROB 1P3AB 2LY8A 2AROC 3REID 1U35A 1P3AC 1S32B 1P34B 1ZLAB 2L5AA 4UUZA 1P3IA 2CWEA 5AY8B 2PYOD 5KDMB 1ZLAC 5BNXB 5AY8C 3AV2B 1P3MB 4J8UD 4H9SA 5AV9D 1HQ3D 2Y2OA 3W99B 1P3MC 5B40A 1N1JB 2YFWA 4Z66C 5B33B 3MVDB 4H9NA 3W99C 1H3OA 4J8VA 3REHD 2NQBA 3MVDC 3TU4A 3MGRA 3AZND 2HIOD 2FJ7D 4WU8C 4H9OB 4NE5A 3REJB 5BS7C 3AZLA 3C1CA 5CPJC 4G91B 3AZKB 3REJC 3WAAA 1U35D 4XZQD 3AYWC 5GT3A 4G91C 3AZJA 3AZKC 1W2EA 1KX4D 5B0ZA 1F66B 3EPLA 5AVCC 1F66C 2CV5D 4YM6B 5B40D 5CPKD 3F6TA 1M18B 2NQBD 3MNNB 3H0MC 4DRBA 3AN2B 1M18C 3MNNC 3MGRD 3AN2C 4H9QA 3AZGB 3AZIA 5F99C 2AROA 3AV1C 1P3AA 3X1TB 3LZ0D 1Z2CB 1S32A 3X1TC 2UWXA 5E5AC 1P34A 3B0DB 1ZLAA 3LZ1D 1B67A 3X1VB 5AY8A 4NE6A 3KUYB 5BNXA 3AFAB 3X1VC 1KX5D 3AV2A 1P3MA 1BH9B 4R8PB 3KUYC 4JJNB 3AFAC 3W99A 4R8PC 1N1JA 5B32D 5B33A 5G49B 3MVDA 5B2ID 4ZBJB 4CAYB 1M19D 1P3GB 4KUDB 2HUEB 3W98D 4ZBJC 3REKD 5DNNB 3AZED 2G5HC 2HUEC 5B2JB 5DNNC 5BS7A 3B6GB 5B2JC 4H9OA 3AZID 4KHAB 5GXQD 3REJA 1KX3B 1P3AD 3WTPE 3IP4C 3AZKA 1KX3C 3KSYA 3VH6W 1S32D 1P34D 5AV5B 5BT1D 4KGCB 3WKJB 4ZUXC 1F66A 5AV5C 4KGCC 3WKJC 3AV2D 4Z5TC 2JCHA 2W8SA 4YM6A 4EO5B 5CP6B 3MGPB 1M18A 5B33D 3W96D 3MNNA 1M1AD 4EO5C 5CP6C 1HTAA 1PZRA 3MGPC 3AN2A 2IO5B 3W97C 4X23A 5B1MB 1P3OB 3AZGA 2IO5C 3KXBB 4UPKA 3UTBB 2BYMB 1P3OC 5B1MC 2NZDC 2JE5A 5JRGB 3X1TA 3UTBC 5DNMD 1P3BD 3A6ND 1P3KD 2DF4C 3X1VA 1P3LC 3B0BA 3KUYA 4DQYB 3AFAA 5GSUD 1BH9A 1ID3C 4R8PA 3LJAD 4JJNA 3UT9C 4J8WB 2Y2KA 4XUJD 3UTAB 2F8NG 5G49A 5B0YC 4CAYA 4YM6D 1P3GA 3UTAC 3RELB 4KUDA 3NQJB 5AVBB 4J8XD 5DNNA 3RELC 5B31D 5B2JA 5AVBC 5CPIB 4X23D 4QLCD 3AZFB 3B6GA 4E45A 3MGQB 3AZGD 3MGSA 5CPIC 4KHAA 3AZFC 1KX3A 4H9RB 3VH5A 3MGQC 1TZYB 2F8NK 2F8NB 5AV5A 1TZYC 4Z66B 4KGCA 4LD9B 3WKJA 4AWLB 4LD9C 4AWLC 4JJND 2Y2LA 4YS3D 2F2AC 5CP6A 3MGPA 4WU8B 3X1UD 3B6FC 5AV6B 1P3GD 4KUDD 3O62B 5CPJB 5AV6C 4CSRB 1P3OA 5B1MA 3O62C 5BNVB 3A1IA 3AYWB 3KXBA 3UTBA 2BYMA 3V9RB 3B6GD 3C1BB 3LELB 3MGSD 5JRGA 4NE3A 5GT0B 5AVCB 1P3ID 2Y2GA 3C1BC 3LELC 1AOIC 5GT0C 3AZMB 3KWQB 3AZHC 3AZMC 3KWQC 1JFIB 4J8VD 4J8WA 1EQZC 3UTAA 3TU4D
chains in the Genus database with same CATH topology
2RVQC 5F99B 1P3PA 2XD5A 5B1LC 3RELA 5B24C 3AV1B 3NQJA 4Z2MG 3FDDA 5E5AB 3AZLD 5CPIA 3C1CD 5B1MD 3AZFA 4WU9B 3MGQA 3WA9C 3KXBD 3WAAD 3WTPC 4WU9C 4H9RA 2ZY3A 5GT3D 5JRGD 3AZJD 1P3FC 5KDMA 1TZYA 5B0ZD 2Y2MA 2F8NA 5AV8B 4Z66A 4LD9A 2ZY4A 5AV8C 3VH6A 3REIB 4NFTA 3B0CW 3REIC 4J8WD 3AL0C 3B0CT 2ZM5A 4WU8A 4HGAB 2PYOB 5AV6A 1P3PD 3EPJA 3O62A 4J8UB 4HGAC 5CPJA 2PYOC 4CSRA 2AROD 1HQ3B 4J8UC 1WWSA 5BNVA 3AYWA 5AV9C 3V9RA 1HQ3C 3C1BA 3REHB 4ZUXB 3LELA 5JA4B 5GT0A 5AVCA 1ZLAD 2FFFB 3REHC 5AY8D 4Z5TB 3AZMA 3KWQA 3NQUB 1WWIA 1P3MD 2HIOB 2FJ7B 4Z66D 3W99D 1JFIA 3AZNC 2HIOC 2FJ7C 3MVDD 4XZQB 3W97B 5FUGB 1KX4B 4XZQC 4UUZB 5F99A 2NZDB 1F1EA 3AV1A 4WU8D 1KX4C 2BYKB 5CPJD 1R4VA 5E5AA 3REJD 2CV5B 2VQRA 4H9SC 3AYWD 3AZKD 1A7WA 5CPKB 1P3LB 2CV5C 5B40C 5CPKC 1ID3B 5GT0D 5AVCD 3UT9B 2NQBC 1F66D 3H0LC 2Y2PA 5AV8A 3MGRC 5B0YB 3REIA 2Y2JA 3LZ0B 1M18D 3MNND 3R45B 3LZ0C 3LZ1B 3AN2D 2F8NH 4G92B 5F99D 3LZ1C 2G5IC 3AV1D 1KX5B 4G92C 4J8UA 3EPHA 1HQ3A 1KX5C 3X1TD 5E5AD 5B32B 5B2IB 1M19B 3REHA 2Y2HA 4ZUXA 5JA4A 5B32C 3X1SB 5B2IC 1M19C 4WNNB 3X1VD 2Y2NA 3REKB 3AZEB 3W98B 3KUYD 4Z5TA 2ZY5A 3AFAD 3X1SC 3NQUA 3W98C 3REKC 2Y2QA 3AZEC 2HIOA 4R8PD 2FJ7A 3B6FB 3AZIB 1TAFB 5GXQB 3AZIC 5GXQC 3EPKA 3W97A 4XZQA 5FUGA 4H9PB 1KX4A 5DNND 3EG5B 2XD1A 1S32C 3KFUG 2NZDA 1P34C 5B2JD 5BT1C 2BYKA 1ULYA 1AOIB 1BH8B 1KX3D 2CV5A 3AV2C 3AZHB 5CPKA 1P3LA 5C3IB 3W96B 4ZUXD 1M1AB 5AV5D 1ID3A 5B33C 3W96C 5C3IC 3UT9A 4KGCD 3WKJD 5BO0B 1M1AC 3VH5W 4Z5TD 1EQZB 3VH5T 5B0YA 5B1LB 5B24B 5DNMB 1P3BB 3LZ0A 5CP6D 3MGPD 3H0RC 3A6NB 3R45A 5DNMC 5AVBA 1P3KB 1P3BC 3W97D 5B31G 3LZ1A 3A6NC 3WA9B 1P3KC 3WTPB 1P3OD 2NZDD 1KX5A 5GSUB 3LJAB 3UTBD 1P3FB 4Z2MH 5GSUC 3LJAC 4XUJB 5B32A 5B2IA 1M19A 1P3LD 4XUJC 3X1SA 3W98A 4YM6C 4WNNA 3REKA 4J8XB 3AZEA 1ID3D 3UT9D 5B31B 3P5JB 4J8XC 4X23B 4QLCB 5B31C 3B6FA 1TAFA 5B0YD 4X23C 4WZSB 4QLCC 5GXQA 3UTAD 3AZGC 3RELD 2Y2IA 4H9PA 5AVBD 5AV9B 4WV4B 5CHLB 3B0DC 5CPID 1T3UA 3AZFD 3MGQD 1AOIA 4YS3B 1BH8A 4JJNC 4YS3C 3AZHA 1TZYD 3W96A 3X1UB 3AZNB 1M1AA 2F8ND 3X1UC 2YFVB 3X1SD 2BG1A 4LD9D 5BO0A 1P3GC 4KUDC 1EQZA 1KU5A 1U35B 1Q9CA 3B6FD 5B1LA 3MGSB 5B24A 5DNMA 1U35C 3B6GC 1P3BA 1P3IB 3MGSC 3A6NA 5AV6D 1P3KA 1P3IC 3O62D 3WA9A 3VH6T 3WTPA 4WU9A 5GSUA 5B40B 2YFWB 3LJAA 1P3FA 2NQBB 4H9NB 4J8VB 1H3OB 3C1BD 2JSSA 3LELD 1AOID 4XUJA 4J8VC 2DQNC 3TU4B 3MGRB 3AZHD 3AZMD 3TU4C 3KWQD 5B32G 4J8XA 5B31A 3AZLB 3C1CB 4QLCA 1EQZD 3WAAB 3AZLC 2RVQD 3C1CC 5B1LD 5GT3B 3WAAC 5B24D 3KXBC 3AZJB 2PYOA 3A1KA 5B0ZB 5GT3C 5JRGC 3AZJC 5AV9A 2RIQA 4WJ3C 4M6BA 1B6WA 4DRAA 5B0ZC 1BFMA 3WA9D 3WTPD 4WU9D 1P3FD 2ZY2A 4YS3A 4E44A 2J8PA 3X1UA 4J8WC 3AZNA 1P3PB 5AV8D 4H9QB 2YFVA 1P3PC 2AROB 1P3AB 2LY8A 2AROC 3REID 1U35A 1P3AC 1S32B 1P34B 1ZLAB 2L5AA 4UUZA 1P3IA 2CWEA 5AY8B 2PYOD 5KDMB 1ZLAC 5BNXB 5AY8C 3AV2B 1P3MB 4J8UD 4H9SA 5AV9D 1HQ3D 2Y2OA 3W99B 1P3MC 5B40A 1N1JB 2YFWA 4Z66C 5B33B 3MVDB 4H9NA 3W99C 1H3OA 4J8VA 3REHD 2NQBA 3MVDC 3TU4A 3MGRA 3AZND 2HIOD 2FJ7D 4WU8C 4H9OB 4NE5A 3REJB 5BS7C 3AZLA 3C1CA 5CPJC 4G91B 3AZKB 3REJC 3WAAA 1U35D 4XZQD 3AYWC 5GT3A 4G91C 3AZJA 3AZKC 1W2EA 1KX4D 5B0ZA 1F66B 3EPLA 5AVCC 1F66C 2CV5D 4YM6B 5B40D 5CPKD 3F6TA 1M18B 2NQBD 3MNNB 3H0MC 4DRBA 3AN2B 1M18C 3MNNC 3MGRD 3AN2C 4H9QA 3AZGB 3AZIA 5F99C 2AROA 3AV1C 1P3AA 3X1TB 3LZ0D 1Z2CB 1S32A 3X1TC 2UWXA 5E5AC 1P34A 3B0DB 1ZLAA 3LZ1D 1B67A 3X1VB 5AY8A 4NE6A 3KUYB 5BNXA 3AFAB 3X1VC 1KX5D 3AV2A 1P3MA 1BH9B 4R8PB 3KUYC 4JJNB 3AFAC 3W99A 4R8PC 1N1JA 5B32D 5B33A 5G49B 3MVDA 5B2ID 4ZBJB 4CAYB 1M19D 1P3GB 4KUDB 2HUEB 3W98D 4ZBJC 3REKD 5DNNB 3AZED 2G5HC 2HUEC 5B2JB 5DNNC 5BS7A 3B6GB 5B2JC 4H9OA 3AZID 4KHAB 5GXQD 3REJA 1KX3B 1P3AD 3WTPE 3IP4C 3AZKA 1KX3C 3KSYA 3VH6W 1S32D 1P34D 5AV5B 5BT1D 4KGCB 3WKJB 4ZUXC 1F66A 5AV5C 4KGCC 3WKJC 3AV2D 4Z5TC 2JCHA 2W8SA 4YM6A 4EO5B 5CP6B 3MGPB 1M18A 5B33D 3W96D 3MNNA 1M1AD 4EO5C 5CP6C 1HTAA 1PZRA 3MGPC 3AN2A 2IO5B 3W97C 4X23A 5B1MB 1P3OB 3AZGA 2IO5C 3KXBB 4UPKA 3UTBB 2BYMB 1P3OC 5B1MC 2NZDC 2JE5A 5JRGB 3X1TA 3UTBC 5DNMD 1P3BD 3A6ND 1P3KD 2DF4C 3X1VA 1P3LC 3B0BA 3KUYA 4DQYB 3AFAA 5GSUD 1BH9A 1ID3C 4R8PA 3LJAD 4JJNA 3UT9C 4J8WB 2Y2KA 4XUJD 3UTAB 2F8NG 5G49A 5B0YC 4CAYA 4YM6D 1P3GA 3UTAC 3RELB 4KUDA 3NQJB 5AVBB 4J8XD 5DNNA 3RELC 5B31D 5B2JA 5AVBC 5CPIB 4X23D 4QLCD 3AZFB 3B6GA 4E45A 3MGQB 3AZGD 3MGSA 5CPIC 4KHAA 3AZFC 1KX3A 4H9RB 3VH5A 3MGQC 1TZYB 2F8NK 2F8NB 5AV5A 1TZYC 4Z66B 4KGCA 4LD9B 3WKJA 4AWLB 4LD9C 4AWLC 4JJND 2Y2LA 4YS3D 2F2AC 5CP6A 3MGPA 4WU8B 3X1UD 3B6FC 5AV6B 1P3GD 4KUDD 3O62B 5CPJB 5AV6C 4CSRB 1P3OA 5B1MA 3O62C 5BNVB 3A1IA 3AYWB 3KXBA 3UTBA 2BYMA 3V9RB 3B6GD 3C1BB 3LELB 3MGSD 5JRGA 4NE3A 5GT0B 5AVCB 1P3ID 2Y2GA 3C1BC 3LELC 1AOIC 5GT0C 3AZMB 3KWQB 3AZHC 3AZMC 3KWQC 1JFIB 4J8VD 4J8WA 1EQZC 3UTAA 3TU4D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RVQ C;  5F99 B;  1P3P A;  3AV1 B;  5B1L C;  3REL A;  5B24 C;  3NQJ A;  4Z2M G;  5E5A B;  3AZL D;  5CPI A;  3C1C D;  5B1M D;  3AZF A;  4WU9 B;  3MGQ A;  3WA9 C;  3KXB D;  3WAA D;  3WTP C;  4WU9 C;  4H9R A;  5GT3 D;  5JRG D;  3AZJ D;  1P3F C;  5KDM A;  1TZY A;  5B0Z D;  2F8N A;  5AV8 B;  4Z66 A;  4LD9 A;  5AV8 C;  3VH6 A;  3REI B;  4NFT A;  3B0C W;  3REI C;  4J8W D;  3B0C T;  4WU8 A;  4HGA B;  2PYO B;  5AV6 A;  1P3P D;  3O62 A;  4J8U B;  4HGA C;  5CPJ A;  2PYO C;  4CSR A;  2ARO D;  1HQ3 B;  4J8U C;  1WWS A;  5BNV A;  3AYW A;  5AV9 C;  3V9R A;  1HQ3 C;  3C1B A;  3REH B;  4ZUX B;  3LEL A;  5JA4 B;  5GT0 A;  5AVC A;  1ZLA D;  3REH C;  5AY8 D;  4Z5T B;  3AZM A;  3KWQ A;  3NQU B;  1WWI A;  1P3M D;  2HIO B;  2FJ7 B;  4Z66 D;  3W99 D;  1JFI A;  3AZN C;  2HIO C;  2FJ7 C;  3MVD D;  4XZQ B;  3W97 B;  5FUG B;  1KX4 B;  4XZQ C;  4UUZ B;  5F99 A;  2NZD B;  1F1E A;  3AV1 A;  4WU8 D;  1KX4 C;  2BYK B;  5CPJ D;  1R4V A;  5E5A A;  3REJ D;  2CV5 B;  4H9S C;  3AYW D;  3AZK D;  1A7W A;  5CPK B;  1P3L B;  2CV5 C;  5B40 C;  5CPK C;  1ID3 B;  5GT0 D;  5AVC D;  3UT9 B;  2NQB C;  1F66 D;  5AV8 A;  3MGR C;  5B0Y B;  3REI A;  3LZ0 B;  1M18 D;  3MNN D;  3R45 B;  3LZ0 C;  3LZ1 B;  3AN2 D;  2F8N H;  4G92 B;  5F99 D;  3LZ1 C;  3AV1 D;  1KX5 B;  4G92 C;  4J8U A;  1HQ3 A;  1KX5 C;  3X1T D;  5E5A D;  5B32 B;  5B2I B;  1M19 B;  3REH A;  4ZUX A;  5JA4 A;  5B32 C;  3X1S B;  5B2I C;  1M19 C;  4WNN B;  3X1V D;  3REK B;  3W98 B;  3AZE B;  3KUY D;  4Z5T A;  3X1S C;  3AFA D;  3W98 C;  3NQU A;  3REK C;  3AZE C;  2HIO A;  4R8P D;  2FJ7 A;  3B6F B;  3AZI B;  1TAF B;  5GXQ B;  3AZI C;  5GXQ C;  3W97 A;  4XZQ A;  5FUG A;  4H9P B;  1KX4 A;  5DNN D;  1S32 C;  2NZD A;  1P34 C;  5B2J D;  5BT1 C;  2BYK A;  1ULY A;  1AOI B;  1BH8 B;  1KX3 D;  2CV5 A;  3AV2 C;  3AZH B;  5CPK A;  1P3L A;  5C3I B;  3W96 B;  4ZUX D;  1M1A B;  5AV5 D;  1ID3 A;  5B33 C;  3W96 C;  5C3I C;  3UT9 A;  4KGC D;  3WKJ D;  5BO0 B;  1M1A C;  3VH5 W;  4Z5T D;  1EQZ B;  3VH5 T;  5B0Y A;  5B1L B;  5B24 B;  5DNM B;  1P3B B;  3LZ0 A;  5CP6 D;  3MGP D;  3A6N B;  3R45 A;  5DNM C;  5AVB A;  1P3K B;  1P3B C;  3W97 D;  5B31 G;  3LZ1 A;  3A6N C;  3WA9 B;  1P3K C;  3WTP B;  1P3O D;  2NZD D;  1KX5 A;  5GSU B;  3LJA B;  3UTB D;  1P3F B;  4Z2M H;  5GSU C;  3LJA C;  4XUJ B;  5B32 A;  5B2I A;  1M19 A;  1P3L D;  4XUJ C;  3X1S A;  3W98 A;  4YM6 C;  4WNN A;  3REK A;  4J8X B;  3AZE A;  1ID3 D;  3UT9 D;  5B31 B;  4J8X C;  4X23 B;  4QLC B;  5B31 C;  3B6F A;  1TAF A;  5B0Y D;  4X23 C;  4WZS B;  4QLC C;  5GXQ A;  3UTA D;  3AZG C;  3REL D;  4H9P A;  5AVB D;  5AV9 B;  4WV4 B;  5CHL B;  3B0D C;  5CPI D;  3AZF D;  3MGQ D;  1AOI A;  4YS3 B;  1BH8 A;  4JJN C;  4YS3 C;  3AZH A;  1TZY D;  3W96 A;  3X1U B;  3AZN B;  1M1A A;  2F8N D;  3X1U C;  2YFV B;  3X1S D;  4LD9 D;  5BO0 A;  1P3G C;  4KUD C;  1EQZ A;  1KU5 A;  1U35 B;  1Q9C A;  3B6F D;  5B1L A;  3MGS B;  5B24 A;  5DNM A;  1U35 C;  3B6G C;  1P3B A;  1P3I B;  3MGS C;  3A6N A;  5AV6 D;  1P3K A;  1P3I C;  3O62 D;  3WA9 A;  3VH6 T;  3WTP A;  4WU9 A;  5GSU A;  5B40 B;  2YFW B;  3LJA A;  1P3F A;  2NQB B;  4H9N B;  4J8V B;  1H3O B;  3C1B D;  2JSS A;  3LEL D;  1AOI D;  4XUJ A;  4J8V C;  3TU4 B;  3MGR B;  3AZH D;  3AZM D;  3TU4 C;  3KWQ D;  5B32 G;  4J8X A;  5B31 A;  3AZL B;  3C1C B;  4QLC A;  1EQZ D;  3WAA B;  3AZL C;  2RVQ D;  3C1C C;  5B1L D;  5GT3 B;  3WAA C;  5B24 D;  3KXB C;  3AZJ B;  2PYO A;  5B0Z B;  5GT3 C;  5JRG C;  3AZJ C;  5AV9 A;  4M6B A;  1B6W A;  4DRA A;  5B0Z C;  1BFM A;  3WA9 D;  3WTP D;  4WU9 D;  1P3F D;  4YS3 A;  4E44 A;  3X1U A;  4J8W C;  3AZN A;  1P3P B;  5AV8 D;  4H9Q B;  2YFV A;  1P3P C;  2ARO B;  1P3A B;  2LY8 A;  2ARO C;  3REI D;  1U35 A;  1P3A C;  1S32 B;  1P34 B;  1ZLA B;  2L5A A;  4UUZ A;  1P3I A;  2CWE A;  5AY8 B;  2PYO D;  5KDM B;  1ZLA C;  5BNX B;  5AY8 C;  3AV2 B;  1P3M B;  4J8U D;  4H9S A;  5AV9 D;  1HQ3 D;  3W99 B;  1P3M C;  5B40 A;  1N1J B;  2YFW A;  4Z66 C;  5B33 B;  3MVD B;  4H9N A;  3W99 C;  1H3O A;  4J8V A;  3REH D;  2NQB A;  3MVD C;  3TU4 A;  3MGR A;  3AZN D;  2HIO D;  2FJ7 D;  4WU8 C;  4H9O B;  4NE5 A;  3REJ B;  5BS7 C;  3AZL A;  3C1C A;  5CPJ C;  4G91 B;  3AZK B;  3REJ C;  3WAA A;  1U35 D;  4XZQ D;  3AYW C;  5GT3 A;  4G91 C;  3AZJ A;  3AZK C;  1KX4 D;  5B0Z A;  1F66 B;  5AVC C;  1F66 C;  2CV5 D;  4YM6 B;  5B40 D;  5CPK D;  1M18 B;  2NQB D;  3MNN B;  4DRB A;  3AN2 B;  1M18 C;  3MNN C;  3MGR D;  3AN2 C;  4H9Q A;  3AZG B;  3AZI A;  5F99 C;  2ARO A;  3AV1 C;  1P3A A;  3X1T B;  3LZ0 D;  1S32 A;  3X1T C;  5E5A C;  1P34 A;  3B0D B;  1ZLA A;  3LZ1 D;  1B67 A;  3X1V B;  5AY8 A;  4NE6 A;  3KUY B;  5BNX A;  3AFA B;  3X1V C;  1KX5 D;  3AV2 A;  1P3M A;  1BH9 B;  4R8P B;  3KUY C;  4JJN B;  3AFA C;  3W99 A;  4R8P C;  1N1J A;  5B32 D;  5B33 A;  5G49 B;  3MVD A;  5B2I D;  4ZBJ B;  4CAY B;  1M19 D;  1P3G B;  4KUD B;  2HUE B;  3W98 D;  4ZBJ C;  3REK D;  5DNN B;  3AZE D;  2HUE C;  5B2J B;  5DNN C;  5BS7 A;  3B6G B;  5B2J C;  4H9O A;  3AZI D;  4KHA B;  5GXQ D;  3REJ A;  1KX3 B;  1P3A D;  3WTP E;  3AZK A;  1KX3 C;  3KSY A;  3VH6 W;  1S32 D;  1P34 D;  5AV5 B;  5BT1 D;  4KGC B;  3WKJ B;  4ZUX C;  1F66 A;  5AV5 C;  4KGC C;  3WKJ C;  3AV2 D;  4Z5T C;  4YM6 A;  4EO5 B;  5CP6 B;  3MGP B;  1M18 A;  5B33 D;  3W96 D;  3MNN A;  1M1A D;  4EO5 C;  5CP6 C;  1HTA A;  3MGP C;  3AN2 A;  2IO5 B;  3W97 C;  4X23 A;  5B1M B;  1P3O B;  3AZG A;  2IO5 C;  3KXB B;  3UTB B;  2BYM B;  1P3O C;  5B1M C;  2NZD C;  5JRG B;  3X1T A;  3UTB C;  5DNM D;  1P3B D;  3A6N D;  1P3K D;  3X1V A;  1P3L C;  3B0B A;  3KUY A;  3AFA A;  5GSU D;  1BH9 A;  1ID3 C;  4R8P A;  3LJA D;  4JJN A;  3UT9 C;  4J8W B;  4XUJ D;  3UTA B;  2F8N G;  5G49 A;  5B0Y C;  4CAY A;  4YM6 D;  1P3G A;  3UTA C;  3REL B;  4KUD A;  3NQJ B;  5AVB B;  4J8X D;  5DNN A;  3REL C;  5B31 D;  5B2J A;  5AVB C;  5CPI B;  4X23 D;  4QLC D;  3AZF B;  3B6G A;  4E45 A;  3MGQ B;  3AZG D;  3MGS A;  5CPI C;  4KHA A;  3AZF C;  1KX3 A;  4H9R B;  3VH5 A;  3MGQ C;  1TZY B;  2F8N K;  2F8N B;  5AV5 A;  1TZY C;  4Z66 B;  4KGC A;  4LD9 B;  3WKJ A;  4AWL B;  4LD9 C;  4AWL C;  4JJN D;  4YS3 D;  5CP6 A;  3MGP A;  4WU8 B;  3X1U D;  3B6F C;  5AV6 B;  1P3G D;  4KUD D;  3O62 B;  5CPJ B;  5AV6 C;  4CSR B;  1P3O A;  5B1M A;  3O62 C;  5BNV B;  3AYW B;  3KXB A;  3UTB A;  2BYM A;  3V9R B;  3B6G D;  3C1B B;  3LEL B;  3MGS D;  5JRG A;  4NE3 A;  5GT0 B;  5AVC B;  1P3I D;  3C1B C;  3LEL C;  1AOI C;  5GT0 C;  3AZM B;  3KWQ B;  3AZH C;  3AZM C;  3KWQ C;  1JFI B;  4J8V D;  4J8W A;  1EQZ C;  3UTA A;  3TU4 D; 
#chains in the Genus database with same CATH topology
 2RVQ C;  5F99 B;  1P3P A;  2XD5 A;  5B1L C;  3REL A;  5B24 C;  3AV1 B;  3NQJ A;  4Z2M G;  3FDD A;  5E5A B;  3AZL D;  5CPI A;  3C1C D;  5B1M D;  3AZF A;  4WU9 B;  3MGQ A;  3WA9 C;  3KXB D;  3WAA D;  3WTP C;  4WU9 C;  4H9R A;  2ZY3 A;  5GT3 D;  5JRG D;  3AZJ D;  1P3F C;  5KDM A;  1TZY A;  5B0Z D;  2Y2M A;  2F8N A;  5AV8 B;  4Z66 A;  4LD9 A;  2ZY4 A;  5AV8 C;  3VH6 A;  3REI B;  4NFT A;  3B0C W;  3REI C;  4J8W D;  3AL0 C;  3B0C T;  2ZM5 A;  4WU8 A;  4HGA B;  2PYO B;  5AV6 A;  1P3P D;  3EPJ A;  3O62 A;  4J8U B;  4HGA C;  5CPJ A;  2PYO C;  4CSR A;  2ARO D;  1HQ3 B;  4J8U C;  1WWS A;  5BNV A;  3AYW A;  5AV9 C;  3V9R A;  1HQ3 C;  3C1B A;  3REH B;  4ZUX B;  3LEL A;  5JA4 B;  5GT0 A;  5AVC A;  1ZLA D;  2FFF B;  3REH C;  5AY8 D;  4Z5T B;  3AZM A;  3KWQ A;  3NQU B;  1WWI A;  1P3M D;  2HIO B;  2FJ7 B;  4Z66 D;  3W99 D;  1JFI A;  3AZN C;  2HIO C;  2FJ7 C;  3MVD D;  4XZQ B;  3W97 B;  5FUG B;  1KX4 B;  4XZQ C;  4UUZ B;  5F99 A;  2NZD B;  1F1E A;  3AV1 A;  4WU8 D;  1KX4 C;  2BYK B;  5CPJ D;  1R4V A;  5E5A A;  3REJ D;  2CV5 B;  2VQR A;  4H9S C;  3AYW D;  3AZK D;  1A7W A;  5CPK B;  1P3L B;  2CV5 C;  5B40 C;  5CPK C;  1ID3 B;  5GT0 D;  5AVC D;  3UT9 B;  2NQB C;  1F66 D;  3H0L C;  2Y2P A;  5AV8 A;  3MGR C;  5B0Y B;  3REI A;  2Y2J A;  3LZ0 B;  1M18 D;  3MNN D;  3R45 B;  3LZ0 C;  3LZ1 B;  3AN2 D;  2F8N H;  4G92 B;  5F99 D;  3LZ1 C;  2G5I C;  3AV1 D;  1KX5 B;  4G92 C;  4J8U A;  3EPH A;  1HQ3 A;  1KX5 C;  3X1T D;  5E5A D;  5B32 B;  5B2I B;  1M19 B;  3REH A;  2Y2H A;  4ZUX A;  5JA4 A;  5B32 C;  3X1S B;  5B2I C;  1M19 C;  4WNN B;  3X1V D;  2Y2N A;  3REK B;  3AZE B;  3W98 B;  3KUY D;  4Z5T A;  2ZY5 A;  3AFA D;  3X1S C;  3NQU A;  3W98 C;  3REK C;  2Y2Q A;  3AZE C;  2HIO A;  4R8P D;  2FJ7 A;  3B6F B;  3AZI B;  1TAF B;  5GXQ B;  3AZI C;  5GXQ C;  3EPK A;  3W97 A;  4XZQ A;  5FUG A;  4H9P B;  1KX4 A;  5DNN D;  3EG5 B;  2XD1 A;  1S32 C;  3KFU G;  2NZD A;  1P34 C;  5B2J D;  5BT1 C;  2BYK A;  1ULY A;  1AOI B;  1BH8 B;  1KX3 D;  2CV5 A;  3AV2 C;  3AZH B;  5CPK A;  1P3L A;  5C3I B;  3W96 B;  4ZUX D;  1M1A B;  5AV5 D;  1ID3 A;  5B33 C;  3W96 C;  5C3I C;  3UT9 A;  4KGC D;  3WKJ D;  5BO0 B;  1M1A C;  3VH5 W;  4Z5T D;  1EQZ B;  3VH5 T;  5B0Y A;  5B1L B;  5B24 B;  5DNM B;  1P3B B;  3LZ0 A;  5CP6 D;  3MGP D;  3H0R C;  3A6N B;  3R45 A;  5DNM C;  5AVB A;  1P3K B;  1P3B C;  3W97 D;  5B31 G;  3LZ1 A;  3A6N C;  3WA9 B;  1P3K C;  3WTP B;  1P3O D;  2NZD D;  1KX5 A;  5GSU B;  3LJA B;  3UTB D;  1P3F B;  4Z2M H;  5GSU C;  3LJA C;  4XUJ B;  5B32 A;  5B2I A;  1M19 A;  1P3L D;  4XUJ C;  3X1S A;  3W98 A;  4YM6 C;  4WNN A;  3REK A;  4J8X B;  3AZE A;  1ID3 D;  3UT9 D;  5B31 B;  3P5J B;  4J8X C;  4X23 B;  4QLC B;  5B31 C;  3B6F A;  1TAF A;  5B0Y D;  4X23 C;  4WZS B;  4QLC C;  5GXQ A;  3UTA D;  3AZG C;  3REL D;  2Y2I A;  4H9P A;  5AVB D;  5AV9 B;  4WV4 B;  5CHL B;  3B0D C;  5CPI D;  1T3U A;  3AZF D;  3MGQ D;  1AOI A;  4YS3 B;  1BH8 A;  4JJN C;  4YS3 C;  3AZH A;  1TZY D;  3W96 A;  3X1U B;  3AZN B;  1M1A A;  2F8N D;  3X1U C;  2YFV B;  3X1S D;  2BG1 A;  4LD9 D;  5BO0 A;  1P3G C;  4KUD C;  1EQZ A;  1KU5 A;  1U35 B;  1Q9C A;  3B6F D;  5B1L A;  3MGS B;  5B24 A;  5DNM A;  1U35 C;  3B6G C;  1P3B A;  1P3I B;  3MGS C;  3A6N A;  5AV6 D;  1P3K A;  1P3I C;  3O62 D;  3WA9 A;  3VH6 T;  3WTP A;  4WU9 A;  5GSU A;  5B40 B;  2YFW B;  3LJA A;  1P3F A;  2NQB B;  4H9N B;  4J8V B;  1H3O B;  3C1B D;  2JSS A;  3LEL D;  1AOI D;  4XUJ A;  4J8V C;  2DQN C;  3TU4 B;  3MGR B;  3AZH D;  3AZM D;  3TU4 C;  3KWQ D;  5B32 G;  4J8X A;  5B31 A;  3AZL B;  3C1C B;  4QLC A;  1EQZ D;  3WAA B;  3AZL C;  2RVQ D;  3C1C C;  5B1L D;  5GT3 B;  3WAA C;  5B24 D;  3KXB C;  3AZJ B;  2PYO A;  3A1K A;  5B0Z B;  5GT3 C;  5JRG C;  3AZJ C;  5AV9 A;  2RIQ A;  4WJ3 C;  4M6B A;  1B6W A;  4DRA A;  5B0Z C;  1BFM A;  3WA9 D;  3WTP D;  4WU9 D;  1P3F D;  2ZY2 A;  4YS3 A;  4E44 A;  2J8P A;  3X1U A;  4J8W C;  3AZN A;  1P3P B;  5AV8 D;  4H9Q B;  2YFV A;  1P3P C;  2ARO B;  1P3A B;  2LY8 A;  2ARO C;  3REI D;  1U35 A;  1P3A C;  1S32 B;  1P34 B;  1ZLA B;  2L5A A;  4UUZ A;  1P3I A;  2CWE A;  5AY8 B;  2PYO D;  5KDM B;  1ZLA C;  5BNX B;  5AY8 C;  3AV2 B;  1P3M B;  4J8U D;  4H9S A;  5AV9 D;  1HQ3 D;  2Y2O A;  3W99 B;  1P3M C;  5B40 A;  1N1J B;  2YFW A;  4Z66 C;  5B33 B;  3MVD B;  4H9N A;  3W99 C;  1H3O A;  4J8V A;  3REH D;  2NQB A;  3MVD C;  3TU4 A;  3MGR A;  3AZN D;  2HIO D;  2FJ7 D;  4WU8 C;  4H9O B;  4NE5 A;  3REJ B;  5BS7 C;  3AZL A;  3C1C A;  5CPJ C;  4G91 B;  3AZK B;  3REJ C;  3WAA A;  1U35 D;  4XZQ D;  3AYW C;  5GT3 A;  4G91 C;  3AZJ A;  3AZK C;  1W2E A;  1KX4 D;  5B0Z A;  1F66 B;  3EPL A;  5AVC C;  1F66 C;  2CV5 D;  4YM6 B;  5B40 D;  5CPK D;  3F6T A;  1M18 B;  2NQB D;  3MNN B;  3H0M C;  4DRB A;  3AN2 B;  1M18 C;  3MNN C;  3MGR D;  3AN2 C;  4H9Q A;  3AZG B;  3AZI A;  5F99 C;  2ARO A;  3AV1 C;  1P3A A;  3X1T B;  3LZ0 D;  1Z2C B;  1S32 A;  3X1T C;  2UWX A;  5E5A C;  1P34 A;  3B0D B;  1ZLA A;  3LZ1 D;  1B67 A;  3X1V B;  5AY8 A;  4NE6 A;  3KUY B;  5BNX A;  3AFA B;  3X1V C;  1KX5 D;  3AV2 A;  1P3M A;  1BH9 B;  4R8P B;  3KUY C;  4JJN B;  3AFA C;  3W99 A;  4R8P C;  1N1J A;  5B32 D;  5B33 A;  5G49 B;  3MVD A;  5B2I D;  4ZBJ B;  4CAY B;  1M19 D;  1P3G B;  4KUD B;  2HUE B;  3W98 D;  4ZBJ C;  3REK D;  5DNN B;  3AZE D;  2G5H C;  2HUE C;  5B2J B;  5DNN C;  5BS7 A;  3B6G B;  5B2J C;  4H9O A;  3AZI D;  4KHA B;  5GXQ D;  3REJ A;  1KX3 B;  1P3A D;  3WTP E;  3IP4 C;  3AZK A;  1KX3 C;  3KSY A;  3VH6 W;  1S32 D;  1P34 D;  5AV5 B;  5BT1 D;  4KGC B;  3WKJ B;  4ZUX C;  1F66 A;  5AV5 C;  4KGC C;  3WKJ C;  3AV2 D;  4Z5T C;  2JCH A;  2W8S A;  4YM6 A;  4EO5 B;  5CP6 B;  3MGP B;  1M18 A;  5B33 D;  3W96 D;  3MNN A;  1M1A D;  4EO5 C;  5CP6 C;  1HTA A;  1PZR A;  3MGP C;  3AN2 A;  2IO5 B;  3W97 C;  4X23 A;  5B1M B;  1P3O B;  3AZG A;  2IO5 C;  3KXB B;  4UPK A;  3UTB B;  2BYM B;  1P3O C;  5B1M C;  2NZD C;  2JE5 A;  5JRG B;  3X1T A;  3UTB C;  5DNM D;  1P3B D;  3A6N D;  1P3K D;  2DF4 C;  3X1V A;  1P3L C;  3B0B A;  3KUY A;  4DQY B;  3AFA A;  5GSU D;  1BH9 A;  1ID3 C;  4R8P A;  3LJA D;  4JJN A;  3UT9 C;  4J8W B;  2Y2K A;  4XUJ D;  3UTA B;  2F8N G;  5G49 A;  5B0Y C;  4CAY A;  4YM6 D;  1P3G A;  3UTA C;  3REL B;  4KUD A;  3NQJ B;  5AVB B;  4J8X D;  5DNN A;  3REL C;  5B31 D;  5B2J A;  5AVB C;  5CPI B;  4X23 D;  4QLC D;  3AZF B;  3B6G A;  4E45 A;  3MGQ B;  3AZG D;  3MGS A;  5CPI C;  4KHA A;  3AZF C;  1KX3 A;  4H9R B;  3VH5 A;  3MGQ C;  1TZY B;  2F8N K;  2F8N B;  5AV5 A;  1TZY C;  4Z66 B;  4KGC A;  4LD9 B;  3WKJ A;  4AWL B;  4LD9 C;  4AWL C;  4JJN D;  2Y2L A;  4YS3 D;  2F2A C;  5CP6 A;  3MGP A;  4WU8 B;  3X1U D;  3B6F C;  5AV6 B;  1P3G D;  4KUD D;  3O62 B;  5CPJ B;  5AV6 C;  4CSR B;  1P3O A;  5B1M A;  3O62 C;  5BNV B;  3A1I A;  3AYW B;  3KXB A;  3UTB A;  2BYM A;  3V9R B;  3B6G D;  3C1B B;  3LEL B;  3MGS D;  5JRG A;  4NE3 A;  5GT0 B;  5AVC B;  1P3I D;  2Y2G A;  3C1B C;  3LEL C;  1AOI C;  5GT0 C;  3AZM B;  3KWQ B;  3AZH C;  3AZM C;  3KWQ C;  1JFI B;  4J8V D;  4J8W A;  1EQZ C;  3UTA A;  3TU4 D; 
#chains in the Genus database with same CATH homology
 2RVQ C;  5F99 B;  1P3P A;  2XD5 A;  5B1L C;  3REL A;  5B24 C;  3AV1 B;  3NQJ A;  4Z2M G;  3FDD A;  5E5A B;  3AZL D;  5CPI A;  3C1C D;  5B1M D;  3AZF A;  4WU9 B;  3MGQ A;  3WA9 C;  3KXB D;  3WAA D;  3WTP C;  4WU9 C;  4H9R A;  2ZY3 A;  5GT3 D;  5JRG D;  3AZJ D;  1P3F C;  5KDM A;  1TZY A;  5B0Z D;  2Y2M A;  2F8N A;  5AV8 B;  4Z66 A;  4LD9 A;  2ZY4 A;  5AV8 C;  3VH6 A;  3REI B;  4NFT A;  3B0C W;  3REI C;  4J8W D;  3AL0 C;  3B0C T;  2ZM5 A;  4WU8 A;  4HGA B;  2PYO B;  5AV6 A;  1P3P D;  3EPJ A;  3O62 A;  4J8U B;  4HGA C;  5CPJ A;  2PYO C;  4CSR A;  2ARO D;  1HQ3 B;  4J8U C;  1WWS A;  5BNV A;  3AYW A;  5AV9 C;  3V9R A;  1HQ3 C;  3C1B A;  3REH B;  4ZUX B;  3LEL A;  5JA4 B;  5GT0 A;  5AVC A;  1ZLA D;  2FFF B;  3REH C;  5AY8 D;  4Z5T B;  3AZM A;  3KWQ A;  3NQU B;  1WWI A;  1P3M D;  2HIO B;  2FJ7 B;  4Z66 D;  3W99 D;  1JFI A;  3AZN C;  2HIO C;  2FJ7 C;  3MVD D;  4XZQ B;  3W97 B;  5FUG B;  1KX4 B;  4XZQ C;  4UUZ B;  5F99 A;  2NZD B;  1F1E A;  3AV1 A;  4WU8 D;  1KX4 C;  2BYK B;  5CPJ D;  1R4V A;  5E5A A;  3REJ D;  2CV5 B;  2VQR A;  4H9S C;  3AYW D;  3AZK D;  1A7W A;  5CPK B;  1P3L B;  2CV5 C;  5B40 C;  5CPK C;  1ID3 B;  5GT0 D;  5AVC D;  3UT9 B;  2NQB C;  1F66 D;  3H0L C;  2Y2P A;  5AV8 A;  3MGR C;  5B0Y B;  3REI A;  2Y2J A;  3LZ0 B;  1M18 D;  3MNN D;  3R45 B;  3LZ0 C;  3LZ1 B;  3AN2 D;  2F8N H;  4G92 B;  5F99 D;  3LZ1 C;  2G5I C;  3AV1 D;  1KX5 B;  4G92 C;  4J8U A;  3EPH A;  1HQ3 A;  1KX5 C;  3X1T D;  5E5A D;  5B32 B;  5B2I B;  1M19 B;  3REH A;  2Y2H A;  4ZUX A;  5JA4 A;  5B32 C;  3X1S B;  5B2I C;  1M19 C;  4WNN B;  3X1V D;  2Y2N A;  3REK B;  3AZE B;  3W98 B;  3KUY D;  4Z5T A;  2ZY5 A;  3AFA D;  3X1S C;  3NQU A;  3W98 C;  3REK C;  2Y2Q A;  3AZE C;  2HIO A;  4R8P D;  2FJ7 A;  3B6F B;  3AZI B;  1TAF B;  5GXQ B;  3AZI C;  5GXQ C;  3EPK A;  3W97 A;  4XZQ A;  5FUG A;  4H9P B;  1KX4 A;  5DNN D;  3EG5 B;  2XD1 A;  1S32 C;  3KFU G;  2NZD A;  1P34 C;  5B2J D;  5BT1 C;  2BYK A;  1ULY A;  1AOI B;  1BH8 B;  1KX3 D;  2CV5 A;  3AV2 C;  3AZH B;  5CPK A;  1P3L A;  5C3I B;  3W96 B;  4ZUX D;  1M1A B;  5AV5 D;  1ID3 A;  5B33 C;  3W96 C;  5C3I C;  3UT9 A;  4KGC D;  3WKJ D;  5BO0 B;  1M1A C;  3VH5 W;  4Z5T D;  1EQZ B;  3VH5 T;  5B0Y A;  5B1L B;  5B24 B;  5DNM B;  1P3B B;  3LZ0 A;  5CP6 D;  3MGP D;  3H0R C;  3A6N B;  3R45 A;  5DNM C;  5AVB A;  1P3K B;  1P3B C;  3W97 D;  5B31 G;  3LZ1 A;  3A6N C;  3WA9 B;  1P3K C;  3WTP B;  1P3O D;  2NZD D;  1KX5 A;  5GSU B;  3LJA B;  3UTB D;  1P3F B;  4Z2M H;  5GSU C;  3LJA C;  4XUJ B;  5B32 A;  5B2I A;  1M19 A;  1P3L D;  4XUJ C;  3X1S A;  3W98 A;  4YM6 C;  4WNN A;  3REK A;  4J8X B;  3AZE A;  1ID3 D;  3UT9 D;  5B31 B;  3P5J B;  4J8X C;  4X23 B;  4QLC B;  5B31 C;  3B6F A;  1TAF A;  5B0Y D;  4X23 C;  4WZS B;  4QLC C;  5GXQ A;  3UTA D;  3AZG C;  3REL D;  2Y2I A;  4H9P A;  5AVB D;  5AV9 B;  4WV4 B;  5CHL B;  3B0D C;  5CPI D;  1T3U A;  3AZF D;  3MGQ D;  1AOI A;  4YS3 B;  1BH8 A;  4JJN C;  4YS3 C;  3AZH A;  1TZY D;  3W96 A;  3X1U B;  3AZN B;  1M1A A;  2F8N D;  3X1U C;  2YFV B;  3X1S D;  2BG1 A;  4LD9 D;  5BO0 A;  1P3G C;  4KUD C;  1EQZ A;  1KU5 A;  1U35 B;  1Q9C A;  3B6F D;  5B1L A;  3MGS B;  5B24 A;  5DNM A;  1U35 C;  3B6G C;  1P3B A;  1P3I B;  3MGS C;  3A6N A;  5AV6 D;  1P3K A;  1P3I C;  3O62 D;  3WA9 A;  3VH6 T;  3WTP A;  4WU9 A;  5GSU A;  5B40 B;  2YFW B;  3LJA A;  1P3F A;  2NQB B;  4H9N B;  4J8V B;  1H3O B;  3C1B D;  2JSS A;  3LEL D;  1AOI D;  4XUJ A;  4J8V C;  2DQN C;  3TU4 B;  3MGR B;  3AZH D;  3AZM D;  3TU4 C;  3KWQ D;  5B32 G;  4J8X A;  5B31 A;  3AZL B;  3C1C B;  4QLC A;  1EQZ D;  3WAA B;  3AZL C;  2RVQ D;  3C1C C;  5B1L D;  5GT3 B;  3WAA C;  5B24 D;  3KXB C;  3AZJ B;  2PYO A;  3A1K A;  5B0Z B;  5GT3 C;  5JRG C;  3AZJ C;  5AV9 A;  2RIQ A;  4WJ3 C;  4M6B A;  1B6W A;  4DRA A;  5B0Z C;  1BFM A;  3WA9 D;  3WTP D;  4WU9 D;  1P3F D;  2ZY2 A;  4YS3 A;  4E44 A;  2J8P A;  3X1U A;  4J8W C;  3AZN A;  1P3P B;  5AV8 D;  4H9Q B;  2YFV A;  1P3P C;  2ARO B;  1P3A B;  2LY8 A;  2ARO C;  3REI D;  1U35 A;  1P3A C;  1S32 B;  1P34 B;  1ZLA B;  2L5A A;  4UUZ A;  1P3I A;  2CWE A;  5AY8 B;  2PYO D;  5KDM B;  1ZLA C;  5BNX B;  5AY8 C;  3AV2 B;  1P3M B;  4J8U D;  4H9S A;  5AV9 D;  1HQ3 D;  2Y2O A;  3W99 B;  1P3M C;  5B40 A;  1N1J B;  2YFW A;  4Z66 C;  5B33 B;  3MVD B;  4H9N A;  3W99 C;  1H3O A;  4J8V A;  3REH D;  2NQB A;  3MVD C;  3TU4 A;  3MGR A;  3AZN D;  2HIO D;  2FJ7 D;  4WU8 C;  4H9O B;  4NE5 A;  3REJ B;  5BS7 C;  3AZL A;  3C1C A;  5CPJ C;  4G91 B;  3AZK B;  3REJ C;  3WAA A;  1U35 D;  4XZQ D;  3AYW C;  5GT3 A;  4G91 C;  3AZJ A;  3AZK C;  1W2E A;  1KX4 D;  5B0Z A;  1F66 B;  3EPL A;  5AVC C;  1F66 C;  2CV5 D;  4YM6 B;  5B40 D;  5CPK D;  3F6T A;  1M18 B;  2NQB D;  3MNN B;  3H0M C;  4DRB A;  3AN2 B;  1M18 C;  3MNN C;  3MGR D;  3AN2 C;  4H9Q A;  3AZG B;  3AZI A;  5F99 C;  2ARO A;  3AV1 C;  1P3A A;  3X1T B;  3LZ0 D;  1Z2C B;  1S32 A;  3X1T C;  2UWX A;  5E5A C;  1P34 A;  3B0D B;  1ZLA A;  3LZ1 D;  1B67 A;  3X1V B;  5AY8 A;  4NE6 A;  3KUY B;  5BNX A;  3AFA B;  3X1V C;  1KX5 D;  3AV2 A;  1P3M A;  1BH9 B;  4R8P B;  3KUY C;  4JJN B;  3AFA C;  3W99 A;  4R8P C;  1N1J A;  5B32 D;  5B33 A;  5G49 B;  3MVD A;  5B2I D;  4ZBJ B;  4CAY B;  1M19 D;  1P3G B;  4KUD B;  2HUE B;  3W98 D;  4ZBJ C;  3REK D;  5DNN B;  3AZE D;  2G5H C;  2HUE C;  5B2J B;  5DNN C;  5BS7 A;  3B6G B;  5B2J C;  4H9O A;  3AZI D;  4KHA B;  5GXQ D;  3REJ A;  1KX3 B;  1P3A D;  3WTP E;  3IP4 C;  3AZK A;  1KX3 C;  3KSY A;  3VH6 W;  1S32 D;  1P34 D;  5AV5 B;  5BT1 D;  4KGC B;  3WKJ B;  4ZUX C;  1F66 A;  5AV5 C;  4KGC C;  3WKJ C;  3AV2 D;  4Z5T C;  2JCH A;  2W8S A;  4YM6 A;  4EO5 B;  5CP6 B;  3MGP B;  1M18 A;  5B33 D;  3W96 D;  3MNN A;  1M1A D;  4EO5 C;  5CP6 C;  1HTA A;  1PZR A;  3MGP C;  3AN2 A;  2IO5 B;  3W97 C;  4X23 A;  5B1M B;  1P3O B;  3AZG A;  2IO5 C;  3KXB B;  4UPK A;  3UTB B;  2BYM B;  1P3O C;  5B1M C;  2NZD C;  2JE5 A;  5JRG B;  3X1T A;  3UTB C;  5DNM D;  1P3B D;  3A6N D;  1P3K D;  2DF4 C;  3X1V A;  1P3L C;  3B0B A;  3KUY A;  4DQY B;  3AFA A;  5GSU D;  1BH9 A;  1ID3 C;  4R8P A;  3LJA D;  4JJN A;  3UT9 C;  4J8W B;  2Y2K A;  4XUJ D;  3UTA B;  2F8N G;  5G49 A;  5B0Y C;  4CAY A;  4YM6 D;  1P3G A;  3UTA C;  3REL B;  4KUD A;  3NQJ B;  5AVB B;  4J8X D;  5DNN A;  3REL C;  5B31 D;  5B2J A;  5AVB C;  5CPI B;  4X23 D;  4QLC D;  3AZF B;  3B6G A;  4E45 A;  3MGQ B;  3AZG D;  3MGS A;  5CPI C;  4KHA A;  3AZF C;  1KX3 A;  4H9R B;  3VH5 A;  3MGQ C;  1TZY B;  2F8N K;  2F8N B;  5AV5 A;  1TZY C;  4Z66 B;  4KGC A;  4LD9 B;  3WKJ A;  4AWL B;  4LD9 C;  4AWL C;  4JJN D;  2Y2L A;  4YS3 D;  2F2A C;  5CP6 A;  3MGP A;  4WU8 B;  3X1U D;  3B6F C;  5AV6 B;  1P3G D;  4KUD D;  3O62 B;  5CPJ B;  5AV6 C;  4CSR B;  1P3O A;  5B1M A;  3O62 C;  5BNV B;  3A1I A;  3AYW B;  3KXB A;  3UTB A;  2BYM A;  3V9R B;  3B6G D;  3C1B B;  3LEL B;  3MGS D;  5JRG A;  4NE3 A;  5GT0 B;  5AVC B;  1P3I D;  2Y2G A;  3C1B C;  3LEL C;  1AOI C;  5GT0 C;  3AZM B;  3KWQ B;  3AZH C;  3AZM C;  3KWQ C;  1JFI B;  4J8V D;  4J8W A;  1EQZ C;  3UTA A;  3TU4 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...