1KX3A

X-ray structure of the nucleosome core particle, ncp146, at 2.0 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'(ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCAT
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 33
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx3A00
5B31C 5E5AC 3REJD 2IO5B 2YFVA 1KU5A 3LZ0A 3AV2B 4YM6D 5B1MA 3W99C 1P3OD 3MNNB 1TAFA 5B1LB 5GSUA 4CAYA 1HQ3D 3REHB 2BYKB 1U35C 4H9PA 4WZSB 1P3BB 4UUZB 4LD9B 5B0ZA 4QLCA 3AZIA 1F66B 4Z2MH 5B32D 3NQUA 5F99A 3LZ0C 3AN2A 5BNVB 3AZFC 4Z66D 3UT9B 5B24A 3W98A 5AV9B 5AVBB 1P3GA 4WU8C 5CPIB 5KDMB 1EQZB 2NZDD 3X1TB 2JSSA 5AVBD 5B0ZC 1EQZD 4Z5TD 4QLCC 3AV2A 4WV4B 1BH9A 3AZIC 5B1LA 5CP6B 4EO5C 5F99C 5CP6D 3AN2C 3X1VD 1ID3A 4H9QA 1P3AD 5B24C 3V9RA 5GT0A 3C1CD 3AZGC 3W98C 4LD9A 4E44A 5C3IB 1KX3B 3LELD 3AV2C 5AV8A 1TZYD 5B1LC 3LZ1D 3UT9A 3AV1B 1AOID 5CPIA 5GT0C 2AROD 4LD9C 4J8WD 4G91C 4J8XB 2FJ7A 4G92B 3RELD 5AV8C 3UT9C 3KXBA 1Q9CA 1P3PD 5BO0B 5AV9C 4WNNA 3VH5W 5CPIC 5B33D 3MVDD 1KX3A 4XZQD 2FJ7C 1P3IB 3AV1A 4H9OB 3KXBC 3UTAD 5AV6D 1KX5B 3AZKB 3W97B 1KX3C 5BNXB 3C1BB 4J8UD 5AV5D 3B6GD 3AV1C 3AZEB 3AZJD 5FUGB 3W96B 3AZED 4R8PA 3REKD 3AYWB 1S32D 2NQBA 3MGRB 5DNNA 2RVQC 3B0CW 2CV5B 5B31B 2F8NA 4XUJD 3X1UD 3AZNA 5E5AD 3W99B 1P3MD 3KUYB 4R8PC 5BNXA 2NQBC 1U35B 3AZHA 1P3IC 5DNNC 5B40A 1KX4A 2LY8A 5FUGA 4KGCA 2YFVB 2PYOA 3AYWA 5B1MB 3REID 3MGRA 1TAFB 3W97C 5GSUB 3LZ0D 4CAYB 3AZFD 3AFAD 2CV5A 4H9PB 3AZHC 5CPKA 1KX4C 4WU8D 5B0ZB 4JJNA 4EO5B 4QLCD 3WKJA 4KGCC 2PYOC 5F99B 3AYWC 3AZID 3MGRC 3AN2D 3MGPA 5B2JA 2HIOB 3TU4B 1P3GB 5JA4A 2CV5C 5B24D 2L5AA 5CPKC 3W98D 3AZGD 1P3LA 1BH9B 3KUYC 3AV2D 4KUDA 3MNND 5B1LD 1ID3B 1BFMA 4H9QB 5AY8B 3AZMA 1N1JA 3WAAA 3MGPC 3V9RB 5GT0B 3REHD 4G91B 1P3BD 4LD9D 1P3FB 5AV8B 5B1MC 1F66D 5GSUC 3MGQB 1B6WA 3KWQA 5CPJB 2HIOA 3TU4A 1HTAA 3UT9D 3AZMC 3WAAC 5AV9D 5CPID 1P34A 4H9RA 3X1TD 2FJ7B 5DNMA 5B32G 2FJ7D 1M18B 1ZLAA 5AY8A 3KXBB 2HUEB 2HIOC 3TU4C 1P3GC 4WNNB 3WTPB 4WU9A 3KSYA 1P3FA 3LJAB 1KX3D 3REJA 5DNMC 3MGQA 5CPJA 4Z2MG 4YM6A 1ID3C 1ULYA 1ZLAC 3AV1D 5AY8C 4H9NA 3B6FB 1HQ3A 4X23B 4WU9C 1P3FC 4J8XD 2F8NK 1M18A 3REJC 5AVCA 2RVQD 3MGQC 5B32A 4H9SA 5CPJC 2F8NH 3WTPA 4R8PB 3LJAA 1HQ3C 2NQBB 1WWIA 2NZDA 3O62B 5DNNB 4Z5TA 1M18C 1P3ID 4YS3B 5AVCC 2F8NB 2HUEC 5B32C 3AZNB 4KHAB 5G49A 1P3KB 3B6FA 3WTPC 4X23A 3UTBA 1P3AA 1A7WA 3C1CA 3LJAC 1KX5D 3AZKD 3W97D 1M19A 3C1BD 2NZDC 3AZHB 5B40B 1KX4B 4Z5TC 3LELA 3AZHD 3B0DC 3LZ1A 4KGCB 2PYOB 1AOIA 3B6FC 4X23C 3W96D 3UTBC 3AYWD 1P3AC 5GXQB 3O62A 3C1CC 3MGRD 4J8WA 1M19C 4ZBJC 4YS3A 5CPKB 4NE3A 3AZLB 2CV5D 4HGAC 4KHAA 3LELC 5B31D 3RELA 1P3KA 3WTPE 3LZ1C 4JJNB 3WKJB 1P3PA 5GT3B 3W99D 5BT1C 1AOIC 3KUYD 3MVDA 3O62C 3MGPB 5B2JB 4J8WC 1U35D 5JA4B 3MGPD 4YS3C 3R45A 1M1AA 3AZNC 1P3LB 3RELC 1P3KC 5B31G 5B2IB 1P3PC 5B1MD 5GXQA 5AV6A 4KUDB 3A6NA 5GSUD 3MVDC 3AZMB 3WAAB 1N1JB 5B0YB 3AZLA 5B40C 4J8UA 5AV5A 4DRAA 5B0ZD 3B6GA 5JRGB 1M1AC 5GT3A 4NFTA 5F99D 5GXQC 5AV6C 3KWQB 3REKA 3A6NC 3MGSA 2HIOD 4ZUXB 3TU4D 3AZLC 1P3GD 1P34B 4J8UC 4H9RB 3WA9A 4JJNC 5B2IA 3B6GC 3WKJC 5GT3C 4XUJA 3X1UA 5DNMB 4J8VA 1ZLAB 2CWEA 1P3MA 5B0YA 1H3OA 5B2JC 3REKC 3MGSC 1ID3D 1ZLAD 5AY8D 3VH6A 5GT0D 5JRGA 4WU9B 1P3LC 3WA9C 3X1SA 1P3FD 5B2IC 3REJB 5AV8D 4XUJC 3X1UC 4KUDC 1BH8A 4YM6B 4J8VC 3REIA 1P3OB 3MGQD 1P3MC 5CPJD 5B0YC 4ZUXA 4H9NB 1HQ3B 3AZFA 3AFAA 5JRGC 4WU8A 3X1SC 4DRBA 5AVCB 5B32B 3KWQC 1M18D 4CSRB 5AVCD 3KXBD 3REIC 4Z66B 4ZUXC 3WTPD 1P34C 3AFAC 2NZDB 3LJAD 3AZGA 4Z5TB 1P3OA 3B0DB 5G49B 3MNNA 3X1VB 4NE5A 3UTBB 1P3AB 3B6FD 4X23D 3UTBD 3C1CB 2BYKA 3REHA 1P3BA 1M19B 4ZBJB 4NE6A 4UUZA 1M19D 4HGAB 3LELB 4YM6C 1TZYB 2IO5C 4CSRA 1P3OC 1F66A 4Z66A 3LZ1B 1AOIB 3MNNC 5BNVA 4R8PD 5BT1D 2NQBD 5AV9A 5AVBA 3REHC 2AROB 5KDMA 4J8WB 1EQZA 1P3BC 4M6BA 3X1TA 3O62D 5DNND 4H9SC 3RELB 5CP6A 4YS3D 3X1VA 1F66C 2F8ND 3AZND 4Z66C 1P3KD 1P3PB 5B33B 3MVDB 5AVBC 1EQZC 4XZQB 1TZYA 3X1TC 3VH6W 5B40D 3R45B 1KX4D 1M1AB 4AWLB 3VH5T 5CP6C 3X1VC 4KGCD 1M1AD 3VH6T 2F8NG 2PYOD 1JFIB 3UTAB 1R4VA 3B0BA 5AV6B 1B67A 2AROA 3A6NB 5GXQD 3A6ND 4J8XA 5C3IC 4J8UB 1TZYC 5AV5B 5CPKD 3AZLD 4E45A 5CHLB 3B6GB 4JJND 3WKJD 5B33A 3AZJB 5GT3D 5BO0A 2AROC 3MGSB 3REKB 1S32B 5BS7A 4XZQA 5B2JD 3MGSD 4J8XC 3NQJB 3WA9B 1P3LD 1P3IA 4G92C 1JFIA 3UTAA 4H9OA 4XUJB 3X1UB 3WA9D 5E5AB 5B2ID 4J8VB 5B33C 4KUDD 1P3MB 3B0CT 1H3OB 4J8VD 5BS7C 3AZMD 4XZQC 3W97A 3AZKA 5B0YD 1KX5A 3WAAD 2YFWB 3C1BA 2BYMB 4AWLC 1F1EA 5JRGD 3X1SB 3AZJA 3UTAC 3AZEA 1BH8B 3X1SD 1S32A 3W96A 3REIB 3KWQD 3LZ0B 1KX5C 3NQJA 3AZKC 5AV5C 3AFAB 4ZUXD 3AZFB 3C1BC 1P34D 4WU8B 5B31A 5E5AA 3AZJC 5DNMD 4QLCB 3AZEC 3VH5A 1S32C 3W99A 3AZIB 1WWSA 3W96C 3KUYA 2YFWA 3NQUB 2BYMA 3AN2B 1U35A 4WU9D 5B24B 3W98B 3AZGB
chains in the Genus database with same CATH superfamily
2ZY2A 5B31C 5E5AC 3REJD 2IO5B 2YFVA 1KU5A 3LZ0A 3AV2B 4YM6D 5B1MA 3W99C 1P3OD 3MNNB 1TAFA 5B1LB 5GSUA 4CAYA 1HQ3D 3REHB 2BYKB 1U35C 4H9PA 4WZSB 1P3BB 4UPKA 4UUZB 4LD9B 5B0ZA 4QLCA 3AZIA 1F66B 4Z2MH 5B32D 3NQUA 5F99A 3LZ0C 3AN2A 5BNVB 3AZFC 4Z66D 3UT9B 5B24A 3W98A 5AV9B 5AVBB 1P3GA 4WU8C 5CPIB 5KDMB 1EQZB 2NZDD 3X1TB 1Z2CB 2JSSA 5AVBD 5B0ZC 1EQZD 4Z5TD 4QLCC 3AV2A 4WV4B 1BH9A 3AZIC 5B1LA 5CP6B 4EO5C 5F99C 5CP6D 3AN2C 3X1VD 1ID3A 4H9QA 1P3AD 5B24C 3V9RA 5GT0A 3C1CD 3AZGC 3W98C 4LD9A 4E44A 5C3IB 1KX3B 3LELD 3AV2C 5AV8A 1TZYD 5B1LC 3LZ1D 3UT9A 3AV1B 1AOID 5CPIA 5GT0C 2AROD 4LD9C 2Y2PA 4J8WD 4G91C 4J8XB 2FJ7A 4G92B 3RELD 5AV8C 3UT9C 3KXBA 1Q9CA 1P3PD 2G5IC 5BO0B 5AV9C 4WNNA 3VH5W 5CPIC 5B33D 3MVDD 1KX3A 4XZQD 2JE5A 2FJ7C 1P3IB 3AV1A 4H9OB 3KXBC 3UTAD 5AV6D 1KX5B 3AZKB 3W97B 1KX3C 5BNXB 3C1BB 4J8UD 5AV5D 3B6GD 3AV1C 3AZEB 3AZJD 5FUGB 3W96B 3AZED 4R8PA 3REKD 3AYWB 1S32D 2NQBA 3MGRB 5DNNA 2RVQC 3B0CW 2CV5B 5B31B 2F8NA 4XUJD 3X1UD 3AZNA 5E5AD 3W99B 1P3MD 3KUYB 4WJ3C 4R8PC 5BNXA 2UWXA 2NQBC 1U35B 3AZHA 1P3IC 5DNNC 5B40A 1KX4A 2LY8A 5FUGA 4KGCA 2YFVB 2PYOA 3AYWA 5B1MB 3REID 3MGRA 1TAFB 3W97C 5GSUB 3LZ0D 4DQYB 4CAYB 3AZFD 3AFAD 2CV5A 4H9PB 3AZHC 5CPKA 1KX4C 4WU8D 5B0ZB 4JJNA 4EO5B 4QLCD 3WKJA 4KGCC 2PYOC 5F99B 3AYWC 3AZID 3MGRC 3AN2D 2Y2LA 3MGPA 5B2JA 2HIOB 3TU4B 1P3GB 5JA4A 2CV5C 5B24D 2L5AA 5CPKC 3W98D 3AZGD 1P3LA 2F2AC 1BH9B 2Y2JA 3KUYC 3AV2D 4KUDA 3MNND 5B1LD 1ID3B 1BFMA 3EPJA 4H9QB 5AY8B 3AZMA 1N1JA 3WAAA 3MGPC 3V9RB 5GT0B 3REHD 4G91B 1P3BD 4LD9D 1P3FB 5AV8B 5B1MC 1F66D 5GSUC 3MGQB 1B6WA 3KWQA 5CPJB 2HIOA 3TU4A 1HTAA 3UT9D 3AZMC 3WAAC 5AV9D 5CPID 1P34A 4H9RA 3X1TD 2FJ7B 5DNMA 5B32G 2FJ7D 2Y2QA 1M18B 1ZLAA 5AY8A 3KXBB 2HUEB 2HIOC 3TU4C 2W8SA 1P3GC 4WNNB 3WTPB 3H0LC 4WU9A 3KSYA 1P3FA 3LJAB 1KX3D 3REJA 5DNMC 3MGQA 5CPJA 4Z2MG 4YM6A 1ID3C 1ULYA 2Y2KA 1ZLAC 3AV1D 5AY8C 2BG1A 4H9NA 3EPLA 3B6FB 1HQ3A 4X23B 4WU9C 1P3FC 4J8XD 2F8NK 1M18A 3REJC 5AVCA 3FDDA 2RVQD 3MGQC 5B32A 4H9SA 5CPJC 2F8NH 3WTPA 4R8PB 3LJAA 1HQ3C 2NQBB 1WWIA 2NZDA 2ZY4A 3O62B 5DNNB 4Z5TA 1M18C 1P3ID 4YS3B 5AVCC 2F8NB 2HUEC 5B32C 3AZNB 4KHAB 5G49A 1P3KB 3B6FA 3WTPC 4X23A 3UTBA 2G5HC 1P3AA 1A7WA 3C1CA 3LJAC 1KX5D 3AZKD 3W97D 1M19A 3C1BD 2NZDC 3AZHB 5B40B 1KX4B 4Z5TC 3LELA 3AZHD 3B0DC 3LZ1A 4KGCB 2PYOB 1AOIA 3B6FC 4X23C 3W96D 3UTBC 3AYWD 1P3AC 5GXQB 3O62A 3C1CC 3MGRD 4J8WA 1M19C 4ZBJC 2ZY5A 4YS3A 2Y2OA 4NE3A 3AZLB 5CPKB 2CV5D 4HGAC 4KHAA 3LELC 5B31D 3RELA 1P3KA 3WTPE 3H0RC 3LZ1C 4JJNB 1P3PA 3WKJB 5GT3B 3W99D 5BT1C 1AOIC 3KUYD 2ZY3A 3MVDA 3O62C 3MGPB 5B2JB 4J8WC 2DF4C 1U35D 5JA4B 3MGPD 4YS3C 3R45A 1M1AA 2Y2HA 3AZNC 1P3LB 3RELC 1P3KC 2XD5A 5B31G 5B2IB 1P3PC 5B1MD 5GXQA 5AV6A 4KUDB 3A6NA 5GSUD 3MVDC 3AZMB 1PZRA 1N1JB 5B0YB 3AZLA 5B40C 3WAAB 4J8UA 5AV5A 4DRAA 5B0ZD 3B6GA 5JRGB 1M1AC 5GT3A 4NFTA 2Y2IA 5F99D 2Y2MA 5GXQC 5AV6C 3KWQB 3REKA 3A6NC 3MGSA 2HIOD 4ZUXB 3TU4D 3AZLC 1P3GD 1P34B 4J8UC 4H9RB 3EPHA 3WA9A 3A1IA 4JJNC 5B2IA 3B6GC 3WKJC 5GT3C 4XUJA 3X1UA 5DNMB 4J8VA 1ZLAB 2CWEA 1P3MA 5B0YA 1H3OA 5B2JC 3REKC 3MGSC 1ID3D 1ZLAD 5AY8D 3VH6A 5GT0D 5JRGA 4WU9B 1P3LC 2RIQA 2VQRA 3WA9C 3X1SA 1P3FD 5B2IC 3REJB 5AV8D 4XUJC 3X1UC 4KUDC 2Y2NA 1BH8A 4YM6B 4J8VC 3REIA 1P3OB 3MGQD 1P3MC 5CPJD 5B0YC 4ZUXA 4H9NB 1HQ3B 3AZFA 3AFAA 3A1KA 5JRGC 4WU8A 3AL0C 3X1SC 4DRBA 5AVCB 5B32B 3KWQC 1M18D 4CSRB 5AVCD 3KXBD 3REIC 4Z66B 4ZUXC 3WTPD 1P34C 3AFAC 3P5JB 2NZDB 3LJAD 3AZGA 1T3UA 4Z5TB 1P3OA 3B0DB 5G49B 3MNNA 3X1VB 4NE5A 3UTBB 1P3AB 3B6FD 4X23D 3UTBD 3C1CB 2BYKA 3REHA 1P3BA 1M19B 4ZBJB 4NE6A 3EG5B 4UUZA 1M19D 4HGAB 3LELB 3KFUG 4YM6C 1TZYB 2IO5C 4CSRA 1P3OC 1F66A 4Z66A 3LZ1B 1AOIB 3MNNC 5BNVA 4R8PD 5BT1D 2NQBD 5AV9A 5AVBA 3REHC 2AROB 5KDMA 4J8WB 1EQZA 1P3BC 4M6BA 3X1TA 3O62D 5DNND 4H9SC 1W2EA 3RELB 5CP6A 4YS3D 3X1VA 1F66C 2F8ND 3EPKA 4Z66C 3AZND 1P3KD 1P3PB 2XD1A 5B33B 3MVDB 5AVBC 1EQZC 4XZQB 1TZYA 3X1TC 3VH6W 5B40D 3R45B 1KX4D 1M1AB 4AWLB 3VH5T 5CP6C 3X1VC 2DQNC 1M1AD 3VH6T 4KGCD 2Y2GA 2F8NG 2PYOD 1JFIB 3UTAB 1R4VA 3B0BA 5AV6B 1B67A 2AROA 3A6NB 5GXQD 3A6ND 4J8XA 5C3IC 4J8UB 1TZYC 5AV5B 5CPKD 3AZLD 3H0MC 4E45A 5CHLB 3B6GB 4JJND 3WKJD 5B33A 3AZJB 5GT3D 5BO0A 2FFFB 2AROC 3MGSB 3REKB 1S32B 5BS7A 4XZQA 5B2JD 3MGSD 2JCHA 4J8XC 3NQJB 3WA9B 2J8PA 1P3LD 1P3IA 4G92C 1JFIA 3UTAA 4H9OA 4XUJB 3X1UB 3WA9D 5E5AB 5B2ID 4J8VB 5B33C 4KUDD 1P3MB 3B0CT 1H3OB 4J8VD 5BS7C 3AZMD 4XZQC 3W97A 3AZKA 5B0YD 1KX5A 3WAAD 2YFWB 3C1BA 2BYMB 4AWLC 1F1EA 5JRGD 3X1SB 3AZJA 3UTAC 3AZEA 3IP4C 1BH8B 3X1SD 1S32A 3W96A 3REIB 3KWQD 3LZ0B 1KX5C 3NQJA 3AZKC 5AV5C 3AFAB 4ZUXD 3AZFB 3C1BC 1P34D 4WU8B 5B31A 5E5AA 3AZJC 5DNMD 2ZM5A 4QLCB 3AZEC 3VH5A 1S32C 3W99A 3AZIB 1WWSA 3W96C 3KUYA 2YFWA 3NQUB 2BYMA 3AN2B 1U35A 4WU9D 5B24B 3F6TA 3W98B 3AZGB
chains in the Genus database with same CATH topology
2ZY2A 5B31C 5E5AC 3REJD 2IO5B 2YFVA 1KU5A 3LZ0A 3AV2B 4YM6D 5B1MA 3W99C 1P3OD 3MNNB 1TAFA 5B1LB 5GSUA 4CAYA 1HQ3D 3REHB 2BYKB 1U35C 4H9PA 4WZSB 1P3BB 4UPKA 4UUZB 4LD9B 5B0ZA 4QLCA 3AZIA 1F66B 4Z2MH 5B32D 3NQUA 5F99A 3LZ0C 3AN2A 5BNVB 3AZFC 4Z66D 3UT9B 5B24A 3W98A 5AV9B 5AVBB 1P3GA 4WU8C 5CPIB 5KDMB 1EQZB 2NZDD 3X1TB 1Z2CB 2JSSA 5AVBD 5B0ZC 1EQZD 4Z5TD 4QLCC 3AV2A 4WV4B 1BH9A 3AZIC 5B1LA 5CP6B 4EO5C 5F99C 5CP6D 3AN2C 3X1VD 1ID3A 4H9QA 1P3AD 5B24C 3V9RA 5GT0A 3C1CD 3AZGC 3W98C 4LD9A 4E44A 5C3IB 1KX3B 3LELD 3AV2C 5AV8A 1TZYD 5B1LC 3LZ1D 3UT9A 3AV1B 1AOID 5CPIA 5GT0C 2AROD 4LD9C 2Y2PA 4J8WD 4G91C 4J8XB 2FJ7A 4G92B 3RELD 5AV8C 3UT9C 3KXBA 1Q9CA 1P3PD 2G5IC 5BO0B 5AV9C 4WNNA 3VH5W 5CPIC 5B33D 3MVDD 1KX3A 4XZQD 2JE5A 2FJ7C 1P3IB 3AV1A 4H9OB 3KXBC 3UTAD 5AV6D 1KX5B 3AZKB 3W97B 1KX3C 5BNXB 3C1BB 4J8UD 5AV5D 3B6GD 3AV1C 3AZEB 3AZJD 5FUGB 3W96B 3AZED 4R8PA 3REKD 3AYWB 1S32D 2NQBA 3MGRB 5DNNA 2RVQC 3B0CW 2CV5B 5B31B 2F8NA 4XUJD 3X1UD 3AZNA 5E5AD 3W99B 1P3MD 3KUYB 4WJ3C 4R8PC 5BNXA 2UWXA 2NQBC 1U35B 3AZHA 1P3IC 5DNNC 5B40A 1KX4A 2LY8A 5FUGA 4KGCA 2YFVB 2PYOA 3AYWA 5B1MB 3REID 3MGRA 1TAFB 3W97C 5GSUB 3LZ0D 4DQYB 4CAYB 3AZFD 3AFAD 2CV5A 4H9PB 3AZHC 5CPKA 1KX4C 4WU8D 5B0ZB 4JJNA 4EO5B 4QLCD 3WKJA 4KGCC 2PYOC 5F99B 3AYWC 3AZID 3MGRC 3AN2D 2Y2LA 3MGPA 5B2JA 2HIOB 3TU4B 1P3GB 5JA4A 2CV5C 5B24D 2L5AA 5CPKC 3W98D 3AZGD 1P3LA 2F2AC 1BH9B 2Y2JA 3KUYC 3AV2D 4KUDA 3MNND 5B1LD 1ID3B 1BFMA 3EPJA 4H9QB 5AY8B 3AZMA 1N1JA 3WAAA 3MGPC 3V9RB 5GT0B 3REHD 4G91B 1P3BD 4LD9D 1P3FB 5AV8B 5B1MC 1F66D 5GSUC 3MGQB 1B6WA 3KWQA 5CPJB 2HIOA 3TU4A 1HTAA 3UT9D 3AZMC 3WAAC 5AV9D 5CPID 1P34A 4H9RA 3X1TD 2FJ7B 5DNMA 5B32G 2FJ7D 2Y2QA 1M18B 1ZLAA 5AY8A 3KXBB 2HUEB 2HIOC 3TU4C 2W8SA 1P3GC 4WNNB 3WTPB 3H0LC 4WU9A 3KSYA 1P3FA 3LJAB 1KX3D 3REJA 5DNMC 3MGQA 5CPJA 4Z2MG 4YM6A 1ID3C 1ULYA 2Y2KA 1ZLAC 3AV1D 5AY8C 2BG1A 4H9NA 3EPLA 3B6FB 1HQ3A 4X23B 4WU9C 1P3FC 4J8XD 2F8NK 1M18A 3REJC 5AVCA 3FDDA 2RVQD 3MGQC 5B32A 4H9SA 5CPJC 2F8NH 3WTPA 4R8PB 3LJAA 1HQ3C 2NQBB 1WWIA 2NZDA 2ZY4A 3O62B 5DNNB 4Z5TA 1M18C 1P3ID 4YS3B 5AVCC 2F8NB 2HUEC 5B32C 3AZNB 4KHAB 5G49A 1P3KB 3B6FA 3WTPC 4X23A 3UTBA 2G5HC 1P3AA 1A7WA 3C1CA 3LJAC 1KX5D 3AZKD 3W97D 1M19A 3C1BD 2NZDC 3AZHB 5B40B 1KX4B 4Z5TC 3LELA 3AZHD 3B0DC 3LZ1A 4KGCB 2PYOB 1AOIA 3B6FC 4X23C 3W96D 3UTBC 3AYWD 1P3AC 5GXQB 3O62A 3C1CC 3MGRD 4J8WA 1M19C 4ZBJC 2ZY5A 4YS3A 2Y2OA 4NE3A 3AZLB 5CPKB 2CV5D 4HGAC 4KHAA 3LELC 5B31D 3RELA 1P3KA 3WTPE 3H0RC 3LZ1C 4JJNB 1P3PA 3WKJB 5GT3B 3W99D 5BT1C 1AOIC 3KUYD 2ZY3A 3MVDA 3O62C 3MGPB 5B2JB 4J8WC 2DF4C 1U35D 5JA4B 3MGPD 4YS3C 3R45A 1M1AA 2Y2HA 3AZNC 1P3LB 3RELC 1P3KC 2XD5A 5B31G 5B2IB 1P3PC 5B1MD 5GXQA 5AV6A 4KUDB 3A6NA 5GSUD 3MVDC 3AZMB 1PZRA 1N1JB 5B0YB 3AZLA 5B40C 3WAAB 4J8UA 5AV5A 4DRAA 5B0ZD 3B6GA 5JRGB 1M1AC 5GT3A 4NFTA 2Y2IA 5F99D 2Y2MA 5GXQC 5AV6C 3KWQB 3REKA 3A6NC 3MGSA 2HIOD 4ZUXB 3TU4D 3AZLC 1P3GD 1P34B 4J8UC 4H9RB 3EPHA 3WA9A 3A1IA 4JJNC 5B2IA 3B6GC 3WKJC 5GT3C 4XUJA 3X1UA 5DNMB 4J8VA 1ZLAB 2CWEA 1P3MA 5B0YA 1H3OA 5B2JC 3REKC 3MGSC 1ID3D 1ZLAD 5AY8D 3VH6A 5GT0D 5JRGA 4WU9B 1P3LC 2RIQA 2VQRA 3WA9C 3X1SA 1P3FD 5B2IC 3REJB 5AV8D 4XUJC 3X1UC 4KUDC 2Y2NA 1BH8A 4YM6B 4J8VC 3REIA 1P3OB 3MGQD 1P3MC 5CPJD 5B0YC 4ZUXA 4H9NB 1HQ3B 3AZFA 3AFAA 3A1KA 5JRGC 4WU8A 3AL0C 3X1SC 4DRBA 5AVCB 5B32B 3KWQC 1M18D 4CSRB 5AVCD 3KXBD 3REIC 4Z66B 4ZUXC 3WTPD 1P34C 3AFAC 3P5JB 2NZDB 3LJAD 3AZGA 1T3UA 4Z5TB 1P3OA 3B0DB 5G49B 3MNNA 3X1VB 4NE5A 3UTBB 1P3AB 3B6FD 4X23D 3UTBD 3C1CB 2BYKA 3REHA 1P3BA 1M19B 4ZBJB 4NE6A 3EG5B 4UUZA 1M19D 4HGAB 3LELB 3KFUG 4YM6C 1TZYB 2IO5C 4CSRA 1P3OC 1F66A 4Z66A 3LZ1B 1AOIB 3MNNC 5BNVA 4R8PD 5BT1D 2NQBD 5AV9A 5AVBA 3REHC 2AROB 5KDMA 4J8WB 1EQZA 1P3BC 4M6BA 3X1TA 3O62D 5DNND 4H9SC 1W2EA 3RELB 5CP6A 4YS3D 3X1VA 1F66C 2F8ND 3EPKA 4Z66C 3AZND 1P3KD 1P3PB 2XD1A 5B33B 3MVDB 5AVBC 1EQZC 4XZQB 1TZYA 3X1TC 3VH6W 5B40D 3R45B 1KX4D 1M1AB 4AWLB 3VH5T 5CP6C 3X1VC 2DQNC 1M1AD 3VH6T 4KGCD 2Y2GA 2F8NG 2PYOD 1JFIB 3UTAB 1R4VA 3B0BA 5AV6B 1B67A 2AROA 3A6NB 5GXQD 3A6ND 4J8XA 5C3IC 4J8UB 1TZYC 5AV5B 5CPKD 3AZLD 3H0MC 4E45A 5CHLB 3B6GB 4JJND 3WKJD 5B33A 3AZJB 5GT3D 5BO0A 2FFFB 2AROC 3MGSB 3REKB 1S32B 5BS7A 4XZQA 5B2JD 3MGSD 2JCHA 4J8XC 3NQJB 3WA9B 2J8PA 1P3LD 1P3IA 4G92C 1JFIA 3UTAA 4H9OA 4XUJB 3X1UB 3WA9D 5E5AB 5B2ID 4J8VB 5B33C 4KUDD 1P3MB 3B0CT 1H3OB 4J8VD 5BS7C 3AZMD 4XZQC 3W97A 3AZKA 5B0YD 1KX5A 3WAAD 2YFWB 3C1BA 2BYMB 4AWLC 1F1EA 5JRGD 3X1SB 3AZJA 3UTAC 3AZEA 3IP4C 1BH8B 3X1SD 1S32A 3W96A 3REIB 3KWQD 3LZ0B 1KX5C 3NQJA 3AZKC 5AV5C 3AFAB 4ZUXD 3AZFB 3C1BC 1P34D 4WU8B 5B31A 5E5AA 3AZJC 5DNMD 2ZM5A 4QLCB 3AZEC 3VH5A 1S32C 3W99A 3AZIB 1WWSA 3W96C 3KUYA 2YFWA 3NQUB 2BYMA 3AN2B 1U35A 4WU9D 5B24B 3F6TA 3W98B 3AZGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B31 C;  5E5A C;  3REJ D;  2IO5 B;  2YFV A;  1KU5 A;  3LZ0 A;  3AV2 B;  4YM6 D;  5B1M A;  3W99 C;  1P3O D;  3MNN B;  1TAF A;  5B1L B;  5GSU A;  4CAY A;  1HQ3 D;  3REH B;  2BYK B;  1U35 C;  4H9P A;  4WZS B;  1P3B B;  4UUZ B;  4LD9 B;  5B0Z A;  4QLC A;  3AZI A;  1F66 B;  4Z2M H;  5B32 D;  3NQU A;  5F99 A;  3LZ0 C;  3AN2 A;  5BNV B;  3AZF C;  4Z66 D;  3UT9 B;  5B24 A;  3W98 A;  5AV9 B;  5AVB B;  1P3G A;  4WU8 C;  5CPI B;  5KDM B;  1EQZ B;  2NZD D;  3X1T B;  2JSS A;  5AVB D;  5B0Z C;  1EQZ D;  4Z5T D;  4QLC C;  3AV2 A;  4WV4 B;  1BH9 A;  3AZI C;  5B1L A;  5CP6 B;  4EO5 C;  5F99 C;  5CP6 D;  3AN2 C;  3X1V D;  1ID3 A;  4H9Q A;  1P3A D;  5B24 C;  3V9R A;  5GT0 A;  3C1C D;  3AZG C;  3W98 C;  4LD9 A;  4E44 A;  5C3I B;  1KX3 B;  3LEL D;  3AV2 C;  5AV8 A;  1TZY D;  5B1L C;  3LZ1 D;  3UT9 A;  3AV1 B;  1AOI D;  5CPI A;  5GT0 C;  2ARO D;  4LD9 C;  4J8W D;  4G91 C;  4J8X B;  2FJ7 A;  4G92 B;  3REL D;  5AV8 C;  3UT9 C;  3KXB A;  1Q9C A;  1P3P D;  5BO0 B;  5AV9 C;  4WNN A;  3VH5 W;  5CPI C;  5B33 D;  3MVD D;  1KX3 A;  4XZQ D;  2FJ7 C;  1P3I B;  3AV1 A;  4H9O B;  3KXB C;  3UTA D;  5AV6 D;  1KX5 B;  3AZK B;  3W97 B;  1KX3 C;  5BNX B;  3C1B B;  4J8U D;  5AV5 D;  3B6G D;  3AV1 C;  3AZE B;  3AZJ D;  5FUG B;  3W96 B;  3AZE D;  4R8P A;  3REK D;  3AYW B;  1S32 D;  2NQB A;  3MGR B;  5DNN A;  2RVQ C;  3B0C W;  2CV5 B;  5B31 B;  2F8N A;  4XUJ D;  3X1U D;  3AZN A;  5E5A D;  3W99 B;  1P3M D;  3KUY B;  4R8P C;  5BNX A;  2NQB C;  1U35 B;  3AZH A;  1P3I C;  5DNN C;  5B40 A;  1KX4 A;  2LY8 A;  5FUG A;  4KGC A;  2YFV B;  2PYO A;  3AYW A;  5B1M B;  3REI D;  3MGR A;  1TAF B;  3W97 C;  5GSU B;  3LZ0 D;  4CAY B;  3AZF D;  3AFA D;  2CV5 A;  4H9P B;  3AZH C;  5CPK A;  1KX4 C;  4WU8 D;  5B0Z B;  4JJN A;  4EO5 B;  4QLC D;  3WKJ A;  4KGC C;  2PYO C;  5F99 B;  3AYW C;  3AZI D;  3MGR C;  3AN2 D;  3MGP A;  5B2J A;  2HIO B;  3TU4 B;  1P3G B;  5JA4 A;  2CV5 C;  5B24 D;  2L5A A;  5CPK C;  3W98 D;  3AZG D;  1P3L A;  1BH9 B;  3KUY C;  3AV2 D;  4KUD A;  3MNN D;  5B1L D;  1ID3 B;  1BFM A;  4H9Q B;  5AY8 B;  3AZM A;  1N1J A;  3WAA A;  3MGP C;  3V9R B;  5GT0 B;  3REH D;  4G91 B;  1P3B D;  4LD9 D;  1P3F B;  5AV8 B;  5B1M C;  1F66 D;  5GSU C;  3MGQ B;  1B6W A;  3KWQ A;  5CPJ B;  2HIO A;  3TU4 A;  1HTA A;  3UT9 D;  3AZM C;  3WAA C;  5AV9 D;  5CPI D;  1P34 A;  4H9R A;  3X1T D;  2FJ7 B;  5DNM A;  5B32 G;  2FJ7 D;  1M18 B;  1ZLA A;  5AY8 A;  3KXB B;  2HUE B;  2HIO C;  3TU4 C;  1P3G C;  4WNN B;  3WTP B;  4WU9 A;  3KSY A;  1P3F A;  3LJA B;  1KX3 D;  3REJ A;  5DNM C;  3MGQ A;  5CPJ A;  4Z2M G;  4YM6 A;  1ID3 C;  1ULY A;  1ZLA C;  3AV1 D;  5AY8 C;  4H9N A;  3B6F B;  1HQ3 A;  4X23 B;  4WU9 C;  1P3F C;  4J8X D;  2F8N K;  1M18 A;  3REJ C;  5AVC A;  2RVQ D;  3MGQ C;  5B32 A;  4H9S A;  5CPJ C;  2F8N H;  3WTP A;  4R8P B;  3LJA A;  1HQ3 C;  2NQB B;  1WWI A;  2NZD A;  3O62 B;  5DNN B;  4Z5T A;  1M18 C;  1P3I D;  4YS3 B;  5AVC C;  2F8N B;  2HUE C;  5B32 C;  3AZN B;  4KHA B;  5G49 A;  1P3K B;  3B6F A;  3WTP C;  4X23 A;  3UTB A;  1P3A A;  1A7W A;  3C1C A;  3LJA C;  1KX5 D;  3AZK D;  3W97 D;  1M19 A;  3C1B D;  2NZD C;  3AZH B;  5B40 B;  1KX4 B;  4Z5T C;  3LEL A;  3AZH D;  3B0D C;  3LZ1 A;  4KGC B;  2PYO B;  1AOI A;  3B6F C;  4X23 C;  3W96 D;  3UTB C;  3AYW D;  1P3A C;  5GXQ B;  3O62 A;  3C1C C;  3MGR D;  4J8W A;  1M19 C;  4ZBJ C;  4YS3 A;  5CPK B;  4NE3 A;  3AZL B;  2CV5 D;  4HGA C;  4KHA A;  3LEL C;  5B31 D;  3REL A;  1P3K A;  3WTP E;  3LZ1 C;  4JJN B;  3WKJ B;  1P3P A;  5GT3 B;  3W99 D;  5BT1 C;  1AOI C;  3KUY D;  3MVD A;  3O62 C;  3MGP B;  5B2J B;  4J8W C;  1U35 D;  5JA4 B;  3MGP D;  4YS3 C;  3R45 A;  1M1A A;  3AZN C;  1P3L B;  3REL C;  1P3K C;  5B31 G;  5B2I B;  1P3P C;  5B1M D;  5GXQ A;  5AV6 A;  4KUD B;  3A6N A;  5GSU D;  3MVD C;  3AZM B;  3WAA B;  1N1J B;  5B0Y B;  3AZL A;  5B40 C;  4J8U A;  5AV5 A;  4DRA A;  5B0Z D;  3B6G A;  5JRG B;  1M1A C;  5GT3 A;  4NFT A;  5F99 D;  5GXQ C;  5AV6 C;  3KWQ B;  3REK A;  3A6N C;  3MGS A;  2HIO D;  4ZUX B;  3TU4 D;  3AZL C;  1P3G D;  1P34 B;  4J8U C;  4H9R B;  3WA9 A;  4JJN C;  5B2I A;  3B6G C;  3WKJ C;  5GT3 C;  4XUJ A;  3X1U A;  5DNM B;  4J8V A;  1ZLA B;  2CWE A;  1P3M A;  5B0Y A;  1H3O A;  5B2J C;  3REK C;  3MGS C;  1ID3 D;  1ZLA D;  5AY8 D;  3VH6 A;  5GT0 D;  5JRG A;  4WU9 B;  1P3L C;  3WA9 C;  3X1S A;  1P3F D;  5B2I C;  3REJ B;  5AV8 D;  4XUJ C;  3X1U C;  4KUD C;  1BH8 A;  4YM6 B;  4J8V C;  3REI A;  1P3O B;  3MGQ D;  1P3M C;  5CPJ D;  5B0Y C;  4ZUX A;  4H9N B;  1HQ3 B;  3AZF A;  3AFA A;  5JRG C;  4WU8 A;  3X1S C;  4DRB A;  5AVC B;  5B32 B;  3KWQ C;  1M18 D;  4CSR B;  5AVC D;  3KXB D;  3REI C;  4Z66 B;  4ZUX C;  3WTP D;  1P34 C;  3AFA C;  2NZD B;  3LJA D;  3AZG A;  4Z5T B;  1P3O A;  3B0D B;  5G49 B;  3MNN A;  3X1V B;  4NE5 A;  3UTB B;  1P3A B;  3B6F D;  4X23 D;  3UTB D;  3C1C B;  2BYK A;  3REH A;  1P3B A;  1M19 B;  4ZBJ B;  4NE6 A;  4UUZ A;  1M19 D;  4HGA B;  3LEL B;  4YM6 C;  1TZY B;  2IO5 C;  4CSR A;  1P3O C;  1F66 A;  4Z66 A;  3LZ1 B;  1AOI B;  3MNN C;  5BNV A;  4R8P D;  5BT1 D;  2NQB D;  5AV9 A;  5AVB A;  3REH C;  2ARO B;  5KDM A;  4J8W B;  1EQZ A;  1P3B C;  4M6B A;  3X1T A;  3O62 D;  5DNN D;  4H9S C;  3REL B;  5CP6 A;  4YS3 D;  3X1V A;  1F66 C;  2F8N D;  3AZN D;  4Z66 C;  1P3K D;  1P3P B;  5B33 B;  3MVD B;  5AVB C;  1EQZ C;  4XZQ B;  1TZY A;  3X1T C;  3VH6 W;  5B40 D;  3R45 B;  1KX4 D;  1M1A B;  4AWL B;  3VH5 T;  5CP6 C;  3X1V C;  4KGC D;  1M1A D;  3VH6 T;  2F8N G;  2PYO D;  1JFI B;  3UTA B;  1R4V A;  3B0B A;  5AV6 B;  1B67 A;  2ARO A;  3A6N B;  5GXQ D;  3A6N D;  4J8X A;  5C3I C;  4J8U B;  1TZY C;  5AV5 B;  5CPK D;  3AZL D;  4E45 A;  5CHL B;  3B6G B;  4JJN D;  3WKJ D;  5B33 A;  3AZJ B;  5GT3 D;  5BO0 A;  2ARO C;  3MGS B;  3REK B;  1S32 B;  5BS7 A;  4XZQ A;  5B2J D;  3MGS D;  4J8X C;  3NQJ B;  3WA9 B;  1P3L D;  1P3I A;  4G92 C;  1JFI A;  3UTA A;  4H9O A;  4XUJ B;  3X1U B;  3WA9 D;  5E5A B;  5B2I D;  4J8V B;  5B33 C;  4KUD D;  1P3M B;  3B0C T;  1H3O B;  4J8V D;  5BS7 C;  3AZM D;  4XZQ C;  3W97 A;  3AZK A;  5B0Y D;  1KX5 A;  3WAA D;  2YFW B;  3C1B A;  2BYM B;  4AWL C;  1F1E A;  5JRG D;  3X1S B;  3AZJ A;  3UTA C;  3AZE A;  1BH8 B;  3X1S D;  1S32 A;  3W96 A;  3REI B;  3KWQ D;  3LZ0 B;  1KX5 C;  3NQJ A;  3AZK C;  5AV5 C;  3AFA B;  4ZUX D;  3AZF B;  3C1B C;  1P34 D;  4WU8 B;  5B31 A;  5E5A A;  3AZJ C;  5DNM D;  4QLC B;  3AZE C;  3VH5 A;  1S32 C;  3W99 A;  3AZI B;  1WWS A;  3W96 C;  3KUY A;  2YFW A;  3NQU B;  2BYM A;  3AN2 B;  1U35 A;  4WU9 D;  5B24 B;  3W98 B;  3AZG B; 
#chains in the Genus database with same CATH topology
 2ZY2 A;  5B31 C;  5E5A C;  3REJ D;  2IO5 B;  2YFV A;  1KU5 A;  3LZ0 A;  3AV2 B;  4YM6 D;  5B1M A;  3W99 C;  1P3O D;  3MNN B;  1TAF A;  5B1L B;  5GSU A;  4CAY A;  1HQ3 D;  3REH B;  2BYK B;  1U35 C;  4H9P A;  4WZS B;  1P3B B;  4UPK A;  4UUZ B;  4LD9 B;  5B0Z A;  4QLC A;  3AZI A;  1F66 B;  4Z2M H;  5B32 D;  3NQU A;  5F99 A;  3LZ0 C;  3AN2 A;  5BNV B;  3AZF C;  4Z66 D;  3UT9 B;  5B24 A;  3W98 A;  5AV9 B;  5AVB B;  1P3G A;  4WU8 C;  5CPI B;  5KDM B;  1EQZ B;  2NZD D;  3X1T B;  1Z2C B;  2JSS A;  5AVB D;  5B0Z C;  1EQZ D;  4Z5T D;  4QLC C;  3AV2 A;  4WV4 B;  1BH9 A;  3AZI C;  5B1L A;  5CP6 B;  4EO5 C;  5F99 C;  5CP6 D;  3AN2 C;  3X1V D;  1ID3 A;  4H9Q A;  1P3A D;  5B24 C;  3V9R A;  5GT0 A;  3C1C D;  3AZG C;  3W98 C;  4LD9 A;  4E44 A;  5C3I B;  1KX3 B;  3LEL D;  3AV2 C;  5AV8 A;  1TZY D;  5B1L C;  3LZ1 D;  3UT9 A;  3AV1 B;  1AOI D;  5CPI A;  5GT0 C;  2ARO D;  4LD9 C;  2Y2P A;  4J8W D;  4G91 C;  4J8X B;  2FJ7 A;  4G92 B;  3REL D;  5AV8 C;  3UT9 C;  3KXB A;  1Q9C A;  1P3P D;  2G5I C;  5BO0 B;  5AV9 C;  4WNN A;  3VH5 W;  5CPI C;  5B33 D;  3MVD D;  1KX3 A;  4XZQ D;  2JE5 A;  2FJ7 C;  1P3I B;  3AV1 A;  4H9O B;  3KXB C;  3UTA D;  5AV6 D;  1KX5 B;  3AZK B;  3W97 B;  1KX3 C;  5BNX B;  3C1B B;  4J8U D;  5AV5 D;  3B6G D;  3AV1 C;  3AZE B;  3AZJ D;  5FUG B;  3W96 B;  3AZE D;  4R8P A;  3REK D;  3AYW B;  1S32 D;  2NQB A;  3MGR B;  5DNN A;  2RVQ C;  3B0C W;  2CV5 B;  5B31 B;  2F8N A;  4XUJ D;  3X1U D;  3AZN A;  5E5A D;  3W99 B;  1P3M D;  3KUY B;  4WJ3 C;  4R8P C;  5BNX A;  2UWX A;  2NQB C;  1U35 B;  3AZH A;  1P3I C;  5DNN C;  5B40 A;  1KX4 A;  2LY8 A;  5FUG A;  4KGC A;  2YFV B;  2PYO A;  3AYW A;  5B1M B;  3REI D;  3MGR A;  1TAF B;  3W97 C;  5GSU B;  3LZ0 D;  4DQY B;  4CAY B;  3AZF D;  3AFA D;  2CV5 A;  4H9P B;  3AZH C;  5CPK A;  1KX4 C;  4WU8 D;  5B0Z B;  4JJN A;  4EO5 B;  4QLC D;  3WKJ A;  4KGC C;  2PYO C;  5F99 B;  3AYW C;  3AZI D;  3MGR C;  3AN2 D;  2Y2L A;  3MGP A;  5B2J A;  2HIO B;  3TU4 B;  1P3G B;  5JA4 A;  2CV5 C;  5B24 D;  2L5A A;  5CPK C;  3W98 D;  3AZG D;  1P3L A;  2F2A C;  1BH9 B;  2Y2J A;  3KUY C;  3AV2 D;  4KUD A;  3MNN D;  5B1L D;  1ID3 B;  1BFM A;  3EPJ A;  4H9Q B;  5AY8 B;  3AZM A;  1N1J A;  3WAA A;  3MGP C;  3V9R B;  5GT0 B;  3REH D;  4G91 B;  1P3B D;  4LD9 D;  1P3F B;  5AV8 B;  5B1M C;  1F66 D;  5GSU C;  3MGQ B;  1B6W A;  3KWQ A;  5CPJ B;  2HIO A;  3TU4 A;  1HTA A;  3UT9 D;  3AZM C;  3WAA C;  5AV9 D;  5CPI D;  1P34 A;  4H9R A;  3X1T D;  2FJ7 B;  5DNM A;  5B32 G;  2FJ7 D;  2Y2Q A;  1M18 B;  1ZLA A;  5AY8 A;  3KXB B;  2HUE B;  2HIO C;  3TU4 C;  2W8S A;  1P3G C;  4WNN B;  3WTP B;  3H0L C;  4WU9 A;  3KSY A;  1P3F A;  3LJA B;  1KX3 D;  3REJ A;  5DNM C;  3MGQ A;  5CPJ A;  4Z2M G;  4YM6 A;  1ID3 C;  1ULY A;  2Y2K A;  1ZLA C;  3AV1 D;  5AY8 C;  2BG1 A;  4H9N A;  3EPL A;  3B6F B;  1HQ3 A;  4X23 B;  4WU9 C;  1P3F C;  4J8X D;  2F8N K;  1M18 A;  3REJ C;  5AVC A;  3FDD A;  2RVQ D;  3MGQ C;  5B32 A;  4H9S A;  5CPJ C;  2F8N H;  3WTP A;  4R8P B;  3LJA A;  1HQ3 C;  2NQB B;  1WWI A;  2NZD A;  2ZY4 A;  3O62 B;  5DNN B;  4Z5T A;  1M18 C;  1P3I D;  4YS3 B;  5AVC C;  2F8N B;  2HUE C;  5B32 C;  3AZN B;  4KHA B;  5G49 A;  1P3K B;  3B6F A;  3WTP C;  4X23 A;  3UTB A;  2G5H C;  1P3A A;  1A7W A;  3C1C A;  3LJA C;  1KX5 D;  3AZK D;  3W97 D;  1M19 A;  3C1B D;  2NZD C;  3AZH B;  5B40 B;  1KX4 B;  4Z5T C;  3LEL A;  3AZH D;  3B0D C;  3LZ1 A;  4KGC B;  2PYO B;  1AOI A;  3B6F C;  4X23 C;  3W96 D;  3UTB C;  3AYW D;  1P3A C;  5GXQ B;  3O62 A;  3C1C C;  3MGR D;  4J8W A;  1M19 C;  4ZBJ C;  2ZY5 A;  4YS3 A;  2Y2O A;  4NE3 A;  3AZL B;  5CPK B;  2CV5 D;  4HGA C;  4KHA A;  3LEL C;  5B31 D;  3REL A;  1P3K A;  3WTP E;  3H0R C;  3LZ1 C;  4JJN B;  1P3P A;  3WKJ B;  5GT3 B;  3W99 D;  5BT1 C;  1AOI C;  3KUY D;  2ZY3 A;  3MVD A;  3O62 C;  3MGP B;  5B2J B;  4J8W C;  2DF4 C;  1U35 D;  5JA4 B;  3MGP D;  4YS3 C;  3R45 A;  1M1A A;  2Y2H A;  3AZN C;  1P3L B;  3REL C;  1P3K C;  2XD5 A;  5B31 G;  5B2I B;  1P3P C;  5B1M D;  5GXQ A;  5AV6 A;  4KUD B;  3A6N A;  5GSU D;  3MVD C;  3AZM B;  1PZR A;  1N1J B;  5B0Y B;  3AZL A;  5B40 C;  3WAA B;  4J8U A;  5AV5 A;  4DRA A;  5B0Z D;  3B6G A;  5JRG B;  1M1A C;  5GT3 A;  4NFT A;  2Y2I A;  5F99 D;  2Y2M A;  5GXQ C;  5AV6 C;  3KWQ B;  3REK A;  3A6N C;  3MGS A;  2HIO D;  4ZUX B;  3TU4 D;  3AZL C;  1P3G D;  1P34 B;  4J8U C;  4H9R B;  3EPH A;  3WA9 A;  3A1I A;  4JJN C;  5B2I A;  3B6G C;  3WKJ C;  5GT3 C;  4XUJ A;  3X1U A;  5DNM B;  4J8V A;  1ZLA B;  2CWE A;  1P3M A;  5B0Y A;  1H3O A;  5B2J C;  3REK C;  3MGS C;  1ID3 D;  1ZLA D;  5AY8 D;  3VH6 A;  5GT0 D;  5JRG A;  4WU9 B;  1P3L C;  2RIQ A;  2VQR A;  3WA9 C;  3X1S A;  1P3F D;  5B2I C;  3REJ B;  5AV8 D;  4XUJ C;  3X1U C;  4KUD C;  2Y2N A;  1BH8 A;  4YM6 B;  4J8V C;  3REI A;  1P3O B;  3MGQ D;  1P3M C;  5CPJ D;  5B0Y C;  4ZUX A;  4H9N B;  1HQ3 B;  3AZF A;  3AFA A;  3A1K A;  5JRG C;  4WU8 A;  3AL0 C;  3X1S C;  4DRB A;  5AVC B;  5B32 B;  3KWQ C;  1M18 D;  4CSR B;  5AVC D;  3KXB D;  3REI C;  4Z66 B;  4ZUX C;  3WTP D;  1P34 C;  3AFA C;  3P5J B;  2NZD B;  3LJA D;  3AZG A;  1T3U A;  4Z5T B;  1P3O A;  3B0D B;  5G49 B;  3MNN A;  3X1V B;  4NE5 A;  3UTB B;  1P3A B;  3B6F D;  4X23 D;  3UTB D;  3C1C B;  2BYK A;  3REH A;  1P3B A;  1M19 B;  4ZBJ B;  4NE6 A;  3EG5 B;  4UUZ A;  1M19 D;  4HGA B;  3LEL B;  3KFU G;  4YM6 C;  1TZY B;  2IO5 C;  4CSR A;  1P3O C;  1F66 A;  4Z66 A;  3LZ1 B;  1AOI B;  3MNN C;  5BNV A;  4R8P D;  5BT1 D;  2NQB D;  5AV9 A;  5AVB A;  3REH C;  2ARO B;  5KDM A;  4J8W B;  1EQZ A;  1P3B C;  4M6B A;  3X1T A;  3O62 D;  5DNN D;  4H9S C;  1W2E A;  3REL B;  5CP6 A;  4YS3 D;  3X1V A;  1F66 C;  2F8N D;  3EPK A;  4Z66 C;  3AZN D;  1P3K D;  1P3P B;  2XD1 A;  5B33 B;  3MVD B;  5AVB C;  1EQZ C;  4XZQ B;  1TZY A;  3X1T C;  3VH6 W;  5B40 D;  3R45 B;  1KX4 D;  1M1A B;  4AWL B;  3VH5 T;  5CP6 C;  3X1V C;  2DQN C;  1M1A D;  3VH6 T;  4KGC D;  2Y2G A;  2F8N G;  2PYO D;  1JFI B;  3UTA B;  1R4V A;  3B0B A;  5AV6 B;  1B67 A;  2ARO A;  3A6N B;  5GXQ D;  3A6N D;  4J8X A;  5C3I C;  4J8U B;  1TZY C;  5AV5 B;  5CPK D;  3AZL D;  3H0M C;  4E45 A;  5CHL B;  3B6G B;  4JJN D;  3WKJ D;  5B33 A;  3AZJ B;  5GT3 D;  5BO0 A;  2FFF B;  2ARO C;  3MGS B;  3REK B;  1S32 B;  5BS7 A;  4XZQ A;  5B2J D;  3MGS D;  2JCH A;  4J8X C;  3NQJ B;  3WA9 B;  2J8P A;  1P3L D;  1P3I A;  4G92 C;  1JFI A;  3UTA A;  4H9O A;  4XUJ B;  3X1U B;  3WA9 D;  5E5A B;  5B2I D;  4J8V B;  5B33 C;  4KUD D;  1P3M B;  3B0C T;  1H3O B;  4J8V D;  5BS7 C;  3AZM D;  4XZQ C;  3W97 A;  3AZK A;  5B0Y D;  1KX5 A;  3WAA D;  2YFW B;  3C1B A;  2BYM B;  4AWL C;  1F1E A;  5JRG D;  3X1S B;  3AZJ A;  3UTA C;  3AZE A;  3IP4 C;  1BH8 B;  3X1S D;  1S32 A;  3W96 A;  3REI B;  3KWQ D;  3LZ0 B;  1KX5 C;  3NQJ A;  3AZK C;  5AV5 C;  3AFA B;  4ZUX D;  3AZF B;  3C1B C;  1P34 D;  4WU8 B;  5B31 A;  5E5A A;  3AZJ C;  5DNM D;  2ZM5 A;  4QLC B;  3AZE C;  3VH5 A;  1S32 C;  3W99 A;  3AZI B;  1WWS A;  3W96 C;  3KUY A;  2YFW A;  3NQU B;  2BYM A;  3AN2 B;  1U35 A;  4WU9 D;  5B24 B;  3F6T A;  3W98 B;  3AZG B; 
#chains in the Genus database with same CATH homology
 2ZY2 A;  5B31 C;  5E5A C;  3REJ D;  2IO5 B;  2YFV A;  1KU5 A;  3LZ0 A;  3AV2 B;  4YM6 D;  5B1M A;  3W99 C;  1P3O D;  3MNN B;  1TAF A;  5B1L B;  5GSU A;  4CAY A;  1HQ3 D;  3REH B;  2BYK B;  1U35 C;  4H9P A;  4WZS B;  1P3B B;  4UPK A;  4UUZ B;  4LD9 B;  5B0Z A;  4QLC A;  3AZI A;  1F66 B;  4Z2M H;  5B32 D;  3NQU A;  5F99 A;  3LZ0 C;  3AN2 A;  5BNV B;  3AZF C;  4Z66 D;  3UT9 B;  5B24 A;  3W98 A;  5AV9 B;  5AVB B;  1P3G A;  4WU8 C;  5CPI B;  5KDM B;  1EQZ B;  2NZD D;  3X1T B;  1Z2C B;  2JSS A;  5AVB D;  5B0Z C;  1EQZ D;  4Z5T D;  4QLC C;  3AV2 A;  4WV4 B;  1BH9 A;  3AZI C;  5B1L A;  5CP6 B;  4EO5 C;  5F99 C;  5CP6 D;  3AN2 C;  3X1V D;  1ID3 A;  4H9Q A;  1P3A D;  5B24 C;  3V9R A;  5GT0 A;  3C1C D;  3AZG C;  3W98 C;  4LD9 A;  4E44 A;  5C3I B;  1KX3 B;  3LEL D;  3AV2 C;  5AV8 A;  1TZY D;  5B1L C;  3LZ1 D;  3UT9 A;  3AV1 B;  1AOI D;  5CPI A;  5GT0 C;  2ARO D;  4LD9 C;  2Y2P A;  4J8W D;  4G91 C;  4J8X B;  2FJ7 A;  4G92 B;  3REL D;  5AV8 C;  3UT9 C;  3KXB A;  1Q9C A;  1P3P D;  2G5I C;  5BO0 B;  5AV9 C;  4WNN A;  3VH5 W;  5CPI C;  5B33 D;  3MVD D;  1KX3 A;  4XZQ D;  2JE5 A;  2FJ7 C;  1P3I B;  3AV1 A;  4H9O B;  3KXB C;  3UTA D;  5AV6 D;  1KX5 B;  3AZK B;  3W97 B;  1KX3 C;  5BNX B;  3C1B B;  4J8U D;  5AV5 D;  3B6G D;  3AV1 C;  3AZE B;  3AZJ D;  5FUG B;  3W96 B;  3AZE D;  4R8P A;  3REK D;  3AYW B;  1S32 D;  2NQB A;  3MGR B;  5DNN A;  2RVQ C;  3B0C W;  2CV5 B;  5B31 B;  2F8N A;  4XUJ D;  3X1U D;  3AZN A;  5E5A D;  3W99 B;  1P3M D;  3KUY B;  4WJ3 C;  4R8P C;  5BNX A;  2UWX A;  2NQB C;  1U35 B;  3AZH A;  1P3I C;  5DNN C;  5B40 A;  1KX4 A;  2LY8 A;  5FUG A;  4KGC A;  2YFV B;  2PYO A;  3AYW A;  5B1M B;  3REI D;  3MGR A;  1TAF B;  3W97 C;  5GSU B;  3LZ0 D;  4DQY B;  4CAY B;  3AZF D;  3AFA D;  2CV5 A;  4H9P B;  3AZH C;  5CPK A;  1KX4 C;  4WU8 D;  5B0Z B;  4JJN A;  4EO5 B;  4QLC D;  3WKJ A;  4KGC C;  2PYO C;  5F99 B;  3AYW C;  3AZI D;  3MGR C;  3AN2 D;  2Y2L A;  3MGP A;  5B2J A;  2HIO B;  3TU4 B;  1P3G B;  5JA4 A;  2CV5 C;  5B24 D;  2L5A A;  5CPK C;  3W98 D;  3AZG D;  1P3L A;  2F2A C;  1BH9 B;  2Y2J A;  3KUY C;  3AV2 D;  4KUD A;  3MNN D;  5B1L D;  1ID3 B;  1BFM A;  3EPJ A;  4H9Q B;  5AY8 B;  3AZM A;  1N1J A;  3WAA A;  3MGP C;  3V9R B;  5GT0 B;  3REH D;  4G91 B;  1P3B D;  4LD9 D;  1P3F B;  5AV8 B;  5B1M C;  1F66 D;  5GSU C;  3MGQ B;  1B6W A;  3KWQ A;  5CPJ B;  2HIO A;  3TU4 A;  1HTA A;  3UT9 D;  3AZM C;  3WAA C;  5AV9 D;  5CPI D;  1P34 A;  4H9R A;  3X1T D;  2FJ7 B;  5DNM A;  5B32 G;  2FJ7 D;  2Y2Q A;  1M18 B;  1ZLA A;  5AY8 A;  3KXB B;  2HUE B;  2HIO C;  3TU4 C;  2W8S A;  1P3G C;  4WNN B;  3WTP B;  3H0L C;  4WU9 A;  3KSY A;  1P3F A;  3LJA B;  1KX3 D;  3REJ A;  5DNM C;  3MGQ A;  5CPJ A;  4Z2M G;  4YM6 A;  1ID3 C;  1ULY A;  2Y2K A;  1ZLA C;  3AV1 D;  5AY8 C;  2BG1 A;  4H9N A;  3EPL A;  3B6F B;  1HQ3 A;  4X23 B;  4WU9 C;  1P3F C;  4J8X D;  2F8N K;  1M18 A;  3REJ C;  5AVC A;  3FDD A;  2RVQ D;  3MGQ C;  5B32 A;  4H9S A;  5CPJ C;  2F8N H;  3WTP A;  4R8P B;  3LJA A;  1HQ3 C;  2NQB B;  1WWI A;  2NZD A;  2ZY4 A;  3O62 B;  5DNN B;  4Z5T A;  1M18 C;  1P3I D;  4YS3 B;  5AVC C;  2F8N B;  2HUE C;  5B32 C;  3AZN B;  4KHA B;  5G49 A;  1P3K B;  3B6F A;  3WTP C;  4X23 A;  3UTB A;  2G5H C;  1P3A A;  1A7W A;  3C1C A;  3LJA C;  1KX5 D;  3AZK D;  3W97 D;  1M19 A;  3C1B D;  2NZD C;  3AZH B;  5B40 B;  1KX4 B;  4Z5T C;  3LEL A;  3AZH D;  3B0D C;  3LZ1 A;  4KGC B;  2PYO B;  1AOI A;  3B6F C;  4X23 C;  3W96 D;  3UTB C;  3AYW D;  1P3A C;  5GXQ B;  3O62 A;  3C1C C;  3MGR D;  4J8W A;  1M19 C;  4ZBJ C;  2ZY5 A;  4YS3 A;  2Y2O A;  4NE3 A;  3AZL B;  5CPK B;  2CV5 D;  4HGA C;  4KHA A;  3LEL C;  5B31 D;  3REL A;  1P3K A;  3WTP E;  3H0R C;  3LZ1 C;  4JJN B;  1P3P A;  3WKJ B;  5GT3 B;  3W99 D;  5BT1 C;  1AOI C;  3KUY D;  2ZY3 A;  3MVD A;  3O62 C;  3MGP B;  5B2J B;  4J8W C;  2DF4 C;  1U35 D;  5JA4 B;  3MGP D;  4YS3 C;  3R45 A;  1M1A A;  2Y2H A;  3AZN C;  1P3L B;  3REL C;  1P3K C;  2XD5 A;  5B31 G;  5B2I B;  1P3P C;  5B1M D;  5GXQ A;  5AV6 A;  4KUD B;  3A6N A;  5GSU D;  3MVD C;  3AZM B;  1PZR A;  1N1J B;  5B0Y B;  3AZL A;  5B40 C;  3WAA B;  4J8U A;  5AV5 A;  4DRA A;  5B0Z D;  3B6G A;  5JRG B;  1M1A C;  5GT3 A;  4NFT A;  2Y2I A;  5F99 D;  2Y2M A;  5GXQ C;  5AV6 C;  3KWQ B;  3REK A;  3A6N C;  3MGS A;  2HIO D;  4ZUX B;  3TU4 D;  3AZL C;  1P3G D;  1P34 B;  4J8U C;  4H9R B;  3EPH A;  3WA9 A;  3A1I A;  4JJN C;  5B2I A;  3B6G C;  3WKJ C;  5GT3 C;  4XUJ A;  3X1U A;  5DNM B;  4J8V A;  1ZLA B;  2CWE A;  1P3M A;  5B0Y A;  1H3O A;  5B2J C;  3REK C;  3MGS C;  1ID3 D;  1ZLA D;  5AY8 D;  3VH6 A;  5GT0 D;  5JRG A;  4WU9 B;  1P3L C;  2RIQ A;  2VQR A;  3WA9 C;  3X1S A;  1P3F D;  5B2I C;  3REJ B;  5AV8 D;  4XUJ C;  3X1U C;  4KUD C;  2Y2N A;  1BH8 A;  4YM6 B;  4J8V C;  3REI A;  1P3O B;  3MGQ D;  1P3M C;  5CPJ D;  5B0Y C;  4ZUX A;  4H9N B;  1HQ3 B;  3AZF A;  3AFA A;  3A1K A;  5JRG C;  4WU8 A;  3AL0 C;  3X1S C;  4DRB A;  5AVC B;  5B32 B;  3KWQ C;  1M18 D;  4CSR B;  5AVC D;  3KXB D;  3REI C;  4Z66 B;  4ZUX C;  3WTP D;  1P34 C;  3AFA C;  3P5J B;  2NZD B;  3LJA D;  3AZG A;  1T3U A;  4Z5T B;  1P3O A;  3B0D B;  5G49 B;  3MNN A;  3X1V B;  4NE5 A;  3UTB B;  1P3A B;  3B6F D;  4X23 D;  3UTB D;  3C1C B;  2BYK A;  3REH A;  1P3B A;  1M19 B;  4ZBJ B;  4NE6 A;  3EG5 B;  4UUZ A;  1M19 D;  4HGA B;  3LEL B;  3KFU G;  4YM6 C;  1TZY B;  2IO5 C;  4CSR A;  1P3O C;  1F66 A;  4Z66 A;  3LZ1 B;  1AOI B;  3MNN C;  5BNV A;  4R8P D;  5BT1 D;  2NQB D;  5AV9 A;  5AVB A;  3REH C;  2ARO B;  5KDM A;  4J8W B;  1EQZ A;  1P3B C;  4M6B A;  3X1T A;  3O62 D;  5DNN D;  4H9S C;  1W2E A;  3REL B;  5CP6 A;  4YS3 D;  3X1V A;  1F66 C;  2F8N D;  3EPK A;  4Z66 C;  3AZN D;  1P3K D;  1P3P B;  2XD1 A;  5B33 B;  3MVD B;  5AVB C;  1EQZ C;  4XZQ B;  1TZY A;  3X1T C;  3VH6 W;  5B40 D;  3R45 B;  1KX4 D;  1M1A B;  4AWL B;  3VH5 T;  5CP6 C;  3X1V C;  2DQN C;  1M1A D;  3VH6 T;  4KGC D;  2Y2G A;  2F8N G;  2PYO D;  1JFI B;  3UTA B;  1R4V A;  3B0B A;  5AV6 B;  1B67 A;  2ARO A;  3A6N B;  5GXQ D;  3A6N D;  4J8X A;  5C3I C;  4J8U B;  1TZY C;  5AV5 B;  5CPK D;  3AZL D;  3H0M C;  4E45 A;  5CHL B;  3B6G B;  4JJN D;  3WKJ D;  5B33 A;  3AZJ B;  5GT3 D;  5BO0 A;  2FFF B;  2ARO C;  3MGS B;  3REK B;  1S32 B;  5BS7 A;  4XZQ A;  5B2J D;  3MGS D;  2JCH A;  4J8X C;  3NQJ B;  3WA9 B;  2J8P A;  1P3L D;  1P3I A;  4G92 C;  1JFI A;  3UTA A;  4H9O A;  4XUJ B;  3X1U B;  3WA9 D;  5E5A B;  5B2I D;  4J8V B;  5B33 C;  4KUD D;  1P3M B;  3B0C T;  1H3O B;  4J8V D;  5BS7 C;  3AZM D;  4XZQ C;  3W97 A;  3AZK A;  5B0Y D;  1KX5 A;  3WAA D;  2YFW B;  3C1B A;  2BYM B;  4AWL C;  1F1E A;  5JRG D;  3X1S B;  3AZJ A;  3UTA C;  3AZE A;  3IP4 C;  1BH8 B;  3X1S D;  1S32 A;  3W96 A;  3REI B;  3KWQ D;  3LZ0 B;  1KX5 C;  3NQJ A;  3AZK C;  5AV5 C;  3AFA B;  4ZUX D;  3AZF B;  3C1B C;  1P34 D;  4WU8 B;  5B31 A;  5E5A A;  3AZJ C;  5DNM D;  2ZM5 A;  4QLC B;  3AZE C;  3VH5 A;  1S32 C;  3W99 A;  3AZI B;  1WWS A;  3W96 C;  3KUY A;  2YFW A;  3NQU B;  2BYM A;  3AN2 B;  1U35 A;  4WU9 D;  5B24 B;  3F6T A;  3W98 B;  3AZG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...