1KX3A

X-ray structure of the nucleosome core particle, ncp146, at 2.0 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (5'(ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCAT
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx3A00
5B0ZB 2BYMB 5B33B 3LELB 1P3FB 4R8PD 3LJAA 3VH6A 1P3MC 4G91C 2HIOD 3WAAD 1P3BC 2HUEC 1M1AD 4J8WA 2BYKA 3MGQC 3MGPC 3AZNA 3NQJA 1N1JA 2FJ7A 4E44A 3LZ1D 4KGCA 5JRGB 5CP6C 3X1TA 1U35C 4Z2MG 3X1UB 5CPKB 4LD9D 1HQ3A 1AOID 4Z5TB 3AZLA 3B6FA 3C1CC 5AV8D 3AZMC 3B6GB 3AZEB 5AVBD 3W98C 3X1SA 3LZ0D 4QLCC 3AZGA 1B6WA 4X23A 3C1CB 3AV1D 4UUZB 1EQZD 5BO0B 4J8XC 3UT9D 3X1VD 4AWLC 4ZUXA 1P3IA 3AZFB 3LJAC 3REID 3AZHA 4AWLB 4YM6A 1P3OC 5DNNA 3UTAB 5B0ZD 5B24B 3LJAB 4J8WC 5B1LB 4Z2MH 5B33D 3LELD 1P3OB 3KSYA 4H9PB 5AVCB 3AZNC 2FJ7C 5CPJA 3AZJA 5BNXA 4H9NA 4KGCC 2YFVB 3X1TC 3AZKA 1TZYC 1KX5B 1HQ3C 1P3MD 4KHAB 3AN2B 1P3LA 3AZLC 2NQBB 3B6FC 4WU8B 3WA9B 1TZYB 5DNMA 1P3KA 1P34A 3X1SC 3X1UD 5CPKD 3AZGC 4X23C 1ZLAB 4Z5TD 1U35D 4ZUXC 3AZED 1R4VA 1P3IC 4G92C 3AZHC 3C1CD 5BNVB 4YM6C 2CWEA 5DNNC 4ZBJB 3WTPB 3W98D 2NZDA 1H3OB 5GXQB 5B31B 4E45A 4XZQA 2AROA 3AZFD 3V9RA 1P3GA 5CPJC 3AZJC 3REJB 4EO5C 3AZIA 3UTAD 1P3PB 5B24D 3LJAD 1P3OD 5AVCD 5B2JA 3AV2A 1F66A 5DNMC 3KWQC 3KXBC 4J8WD 1P34C 1P3KC 5G49B 1M18A 1KX5D 3AN2D 3REHA 3KWQB 3KXBB 3MGRA 5B32B 3WA9D 1TZYD 1ID3A 5B40A 3W96A 3VH5W 5F99B 3VH5T 2YFWA 3MNNA 5KDMA 5AY8A 3X1SD 2NZDC 3AYWB 3KUYB 4XZQC 2AROC 4JJNA 4H9QB 3RELB 3UTBA 4H9OB 1P3GC 3REKA 4KUDB 3AZIC 2JSSA 5AVBB 5GXQD 4XUJA 5AV5A 5B31D 3LZ0B 5B2JC 3AV2C 1F66C 4J8UB 3MGSB 1EQZB 3R45A 1JFIB 3UT9B 1KX4B 1M18C 1P3PD 3AZJD 3REHC 3MGRC 4H9SA 4WU9B 1ID3C 3MVDA 5B40C 4H9RA 1S32A 3W96C 3REHB 3TU4C 3NQUB 1B67A 3MNNC 5B31G 5DNMD 3KWQD 3KXBD 5AY8C 5B32D 3TU4B 1BH9B 5E5AC 5F99D 4JJNC 1P3MB 5AV9A 3C1BA 4G91B 3REKC 2F8NB 1P3BB 2HUEB 1P3AA 5E5AB 2RVQD 4XUJC 5AV5C 3MGPB 3MGQB 3KUYD 3AYWD 3RELD 5B1MC 5CP6B 1U35B 2PYOA 4KUDD 5B32G 3AFAA 5B1MB 1P3GD 4H9SC 5FUGB 4J8UD 3MGSD 3W97C 1KX3A 5CPIA 5GSUA 3AZMB 3MVDC 3WKJA 1S32C 3W98B 1KX4D 4QLCB 2CV5A 3W97B 4J8XB 1M18D 4WU9D 1Q9CA 3REHD 3W99A 3MGRD 5AV9C 3C1BC 5B40D 1P3AC 3W96D 3TU4D 4J8WB 1TAFA 2BYKB 5C3IC 5AV6A 3AZNB 3B0DC 3NQJB 4J8VA 1N1JB 5AY8D 4YS3A 2FJ7B 4KGCB 2F8ND 2IO5C 3X1TB 1P3BD 2PYOC 5E5AD 3AFAC 1HQ3B 3MGQD 3MGPD 3AZLB 3B6FB 3WKJC 1KX3C 5CPIC 5GSUC 4WNNA 3VH5A 3X1SB 3VH6T 5CP6D 1M19A 2CV5C 3AZGB 1HTAA 4X23B 5B1MD 5B0YA 4ZUXB 3AZMD 2F8NG 5JA4A 1F1EA 1P3IB 3W99C 4G92B 4Z66A 4QLCD 3AZHB 3W97D 4YM6B 3MVDD 5DNNB 5B2IA 4J8XD 4R8PA 3O62A 5AV6C 3AZKC 2HIOA 5CHLB 4J8VC 3WAAA 4YS3C 1M1AA 5CPJB 3AZJB 5BNXB 4H9NB 1BH8A 1P3LC 4M6BA 4EO5B 3AZKB 4DRAA 3LZ1A 1P3LB 3AZND 4LD9A 1P3AD 2FJ7D 5DNMB 4KGCD 1P3KB 1P34B 1AOIA 3X1TD 2F8NH 1M19C 5AV8A 1HQ3D 5B0YC 3AZLD 3B6FD 3AFAD 2LY8A 5B0YB 4Z66C 4CSRA 3X1VA 3AZGD 4X23D 5B2IC 3A6NA 4R8PC 4ZUXD 3REIA 3O62C 2CV5D 2NZDB 2HIOC 1P3ID 4XZQB 2AROB 3WAAC 3V9RB 1M1AC 1P3GB 3AZHD 5B0ZA 4YM6D 2BYMA 5B33A 3LELA 1P3FA 5DNND 3AZIB 3B0BA 3LZ1C 4CAYA 5B2JB 3AV2B 1F66B 4LD9C 5CPJD 4HGAC 1AOIC 5BT1C 3AZKD 1M18B 4HGAB 4DRBA 1P3LD 3MGRB 5JRGA 3X1UA 5CPKA 1WWSA 4NFTA 1ID3B 5B40B 1P3KD 1P34D 4Z5TA 3W96B 2YFWB 3X1VC 1BFMA 3MNNB 5KDMB 3B6GA 3AZEA 3A6NC 5AY8B 3UTBC 1M19D 3REIC 3C1CA 4UUZA 5B0YD 5BO0A 4JJNB 3A6NB 3UTBB 5B0ZC 3REKB 3LELC 1P3FC 5GT0A 5GT3A 3AZFA 4Z66D 2NZDD 4XUJB 5AV5B 4XZQD 2AROD 1A7WA 5B2ID 3UTAA 3R45B 5B24A 5B1LA 3O62D 1P3OA 4CAYB 4H9PA 5AVCA 3AZID 2YFVA 5JRGC 5B2JD 3AV2D 1F66D 3X1UC 5CPKC 1KX5A 3MVDB 4H9RB 4KHAA 4Z5TC 3AN2A 1S32B 2NQBA 4WU8A 3WA9A 1TZYA 2F8NK 3B6GC 3AZEC 5BS7A 5BT1D 1ID3D 1ZLAA 5AV9B 3C1BB 3MNND 5GT3C 5GT0C 1P3AB 3AZFC 5BNVA 5C3IB 3B0DB 5GT0B 5GT3B 3WTPA 3A6ND 4JJND 3UTAC 3UTBD 5B24C 3REKD 5B1LC 2IO5B 1H3OA 5B31A 5GXQA 2PYOB 5AVCC 4WZSB 3AFAB 3VH6W 4XUJD 5AV5D 1P3FD 3REJA 3WKJB 1KX3B 5CPIB 5GSUB 1KX5C 1P3PA 3AN2C 2NQBC 2CV5B 1ULYA 4WU8C 3WA9C 5BS7C 5G49A 1ZLAC 1S32D 3W99B 3KWQA 3KXBA 5JRGD 5B32A 5F99A 1TAFB 5AV6B 3B6GD 4J8VB 4ZBJC 3WTPC 4YS3B 5AV9D 3C1BD 5GXQC 5B31C 3KUYA 3AYWA 4H9QA 3RELA 4H9OA 2L5AA 3REJC 5GT3D 5GT0D 4KUDA 1P3PC 4WNNB 5AVBA 4NE3A 3LZ0A 1M19B 2PYOD 4J8UA 3MGSA 3AV1A 1EQZA 1JFIA 3UT9A 5B1LD 1KX4A 3WKJD 1KX3D 5CPID 5GSUD 5JA4B 4NE5A 4Z66B 5B32C 4WU9A 5B2IB 5F99C 4R8PB 2NQBD 3NQUA 3O62B 4WU8D 2HIOB 3W99D 3WAAB 1M1AB 1WWIA 3TU4A 2RVQC 1BH8B 3AYWC 3KUYC 1BH9A 1ZLAD 3RELC 3LZ1B 1P3MA 5AV6D 2F8NA 4WV4B 4J8VD 1P3BA 1KU5A 5AV8C 4YS3D 5E5AA 4KUDC 4LD9B 1AOIB 5AVBC 3MGQA 3LZ0C 3MGPA 4J8UC 3WTPD 5AV8B 4NE6A 3MGSC 3AV1C 1EQZC 3UT9C 3B0CW 5CP6A 1U35A 3B0CT 1KX4C 3AV1B 5B1MA 3WTPE 3X1VB 4CSRB 3REJD 5FUGA 4WU9C 3AZMA 3W98A 4QLCA 3REIB 3W97A 5B33C 4J8XA
chains in the Genus database with same CATH superfamily
5B0ZB 2BYMB 2RIQA 5B33B 3LELB 1P3FB 4R8PD 3LJAA 3VH6A 1P3MC 4G91C 2HIOD 3WAAD 1P3BC 2HUEC 1M1AD 4J8WA 2BYKA 3MGQC 2W8SA 3MGPC 3AZNA 3NQJA 1N1JA 2FJ7A 4E44A 3LZ1D 4KGCA 5JRGB 5CP6C 3X1TA 1U35C 4Z2MG 3X1UB 5CPKB 4LD9D 1HQ3A 1AOID 4Z5TB 3AZLA 3B6FA 3C1CC 5AV8D 3AZMC 3B6GB 3AZEB 5AVBD 3W98C 3X1SA 3LZ0D 4QLCC 3AZGA 1B6WA 4X23A 3C1CB 3AV1D 4UUZB 1EQZD 5BO0B 4J8XC 3UT9D 3H0LC 3X1VD 4AWLC 4ZUXA 2UWXA 3A1KA 1P3IA 3AZFB 3LJAC 2XD5A 3REID 3AZHA 4AWLB 4YM6A 1P3OC 5DNNA 3F6TA 3UTAB 5B0ZD 5B24B 3LJAB 4J8WC 5B1LB 4Z2MH 5B33D 3LELD 1P3OB 3KSYA 4H9PB 5AVCB 3AZNC 2FJ7C 5CPJA 3AZJA 5BNXA 4H9NA 4KGCC 2YFVB 3X1TC 3AZKA 1TZYC 1KX5B 1HQ3C 1P3MD 4KHAB 3AN2B 1P3LA 3AZLC 2NQBB 3B6FC 4WU8B 3WA9B 1TZYB 5DNMA 1P3KA 1P34A 3X1SC 2JCHA 2Y2QA 3X1UD 5CPKD 3AZGC 4X23C 1ZLAB 4Z5TD 3EPLA 1U35D 4ZUXC 3AZED 1R4VA 1P3IC 2Y2PA 4G92C 3AZHC 3C1CD 5BNVB 4YM6C 2CWEA 5DNNC 4ZBJB 3WTPB 3FDDA 3W98D 3H0RC 3EPKA 2NZDA 1H3OB 5B31B 5GXQB 2ZY5A 4E45A 4XZQA 2AROA 3AZFD 3V9RA 2ZY2A 1P3GA 5CPJC 3AZJC 3REJB 4EO5C 3AZIA 3UTAD 2G5IC 1P3PB 5B24D 3LJAD 1P3OD 5AVCD 5B2JA 3AV2A 1F66A 5DNMC 3KWQC 3KXBC 4J8WD 2XD1A 1P34C 1P3KC 5G49B 1M18A 1KX5D 3AN2D 3REHA 3H0MC 3KXBB 3KWQB 3MGRA 5B32B 3WA9D 1TZYD 1ID3A 5B40A 3W96A 3VH5W 5F99B 3VH5T 2YFWA 3IP4C 3MNNA 5KDMA 5AY8A 2Y2KA 3X1SD 3EPHA 2NZDC 3AYWB 3KUYB 4XZQC 2AROC 4JJNA 4H9QB 3RELB 3UTBA 4H9OB 1P3GC 3REKA 2JE5A 3EPJA 4KUDB 3AZIC 2JSSA 5AVBB 5GXQD 4XUJA 5AV5A 5B31D 3LZ0B 5B2JC 3AV2C 1F66C 4J8UB 3MGSB 1EQZB 3R45A 1JFIB 3UT9B 1KX4B 1M18C 1P3PD 3AZJD 3REHC 3MGRC 4H9SA 4WU9B 1ID3C 1Z2CB 3MVDA 5B40C 4H9RA 1S32A 3W96C 3REHB 3TU4C 3NQUB 1B67A 3MNNC 5B31G 5DNMD 3KWQD 3KXBD 5AY8C 5B32D 3TU4B 1BH9B 5E5AC 5F99D 4JJNC 1P3MB 5AV9A 3C1BA 4G91B 3REKC 2F8NB 1P3BB 2HUEB 1P3AA 5E5AB 2RVQD 4XUJC 5AV5C 3MGPB 3MGQB 3KUYD 3AYWD 3RELD 5B1MC 5CP6B 1U35B 2PYOA 4KUDD 5B32G 3AFAA 5B1MB 1P3GD 4H9SC 5FUGB 4J8UD 3MGSD 3W97C 1KX3A 5CPIA 5GSUA 3AZMB 3MVDC 3WKJA 1S32C 3W98B 1KX4D 4QLCB 2CV5A 3W97B 1PZRA 4J8XB 1M18D 4WU9D 1Q9CA 3REHD 3W99A 3MGRD 5AV9C 3C1BC 5B40D 1P3AC 3W96D 3TU4D 4J8WB 5AV6A 1TAFA 2BYKB 5C3IC 3A1IA 3AZNB 3B0DC 3NQJB 4J8VA 1N1JB 5AY8D 4YS3A 2FJ7B 4KGCB 2F8ND 2IO5C 3X1TB 1P3BD 2PYOC 5E5AD 3AFAC 1HQ3B 3MGQD 3MGPD 3AZLB 3B6FB 3WKJC 1KX3C 5CPIC 5GSUC 4WNNA 3VH5A 3X1SB 3VH6T 5CP6D 1M19A 2CV5C 3AZGB 1HTAA 4X23B 5B1MD 5B0YA 4ZUXB 3AZMD 2F8NG 5JA4A 1F1EA 1P3IB 3W99C 4G92B 4Z66A 4QLCD 3AZHB 3W97D 4YM6B 3MVDD 5DNNB 5B2IA 4J8XD 4R8PA 3O62A 5AV6C 3AZKC 2HIOA 5CHLB 4J8VC 3WAAA 4YS3C 1M1AA 5CPJB 3AZJB 5BNXB 4H9NB 1BH8A 1P3LC 4M6BA 4EO5B 3AZKB 4DRAA 3LZ1A 1P3LB 3AZND 4LD9A 1P3AD 2FJ7D 5DNMB 4KGCD 1T3UA 1P3KB 1P34B 1AOIA 3X1TD 2F8NH 2Y2NA 1M19C 4WJ3C 5AV8A 1HQ3D 5B0YC 3AZLD 3B6FD 3AFAD 2LY8A 5B0YB 4Z66C 4CSRA 3X1VA 3AZGD 4X23D 5B2IC 3A6NA 4R8PC 4ZUXD 3REIA 3O62C 2CV5D 2NZDB 2HIOC 1P3ID 4XZQB 2AROB 3WAAC 3V9RB 1M1AC 1P3GB 3AZHD 5B0ZA 4YM6D 2BYMA 5B33A 3LELA 1P3FA 5DNND 3AZIB 4UPKA 3B0BA 3LZ1C 4DQYB 4CAYA 5B2JB 3AV2B 1F66B 4LD9C 5CPJD 4HGAC 1AOIC 5BT1C 3AZKD 1M18B 4HGAB 4DRBA 1P3LD 3MGRB 5JRGA 3X1UA 5CPKA 1WWSA 4NFTA 1ID3B 5B40B 1P3KD 2ZY3A 1P34D 4Z5TA 3W96B 2YFWB 3X1VC 1BFMA 3MNNB 5KDMB 3B6GA 3AZEA 3A6NC 5AY8B 3UTBC 1M19D 3REIC 3C1CA 2Y2HA 4UUZA 5B0YD 5BO0A 4JJNB 3A6NB 3UTBB 2BG1A 5B0ZC 3REKB 3LELC 1P3FC 5GT0A 5GT3A 3AZFA 4Z66D 2NZDD 4XUJB 5AV5B 4XZQD 2AROD 1A7WA 5B2ID 3UTAA 3R45B 5B24A 5B1LA 3O62D 2DF4C 1P3OA 4CAYB 4H9PA 5AVCA 3AZID 2YFVA 5JRGC 5B2JD 3AV2D 1F66D 3X1UC 5CPKC 1KX5A 3KFUG 3MVDB 4H9RB 4KHAA 4Z5TC 3AN2A 1S32B 2NQBA 4WU8A 3WA9A 1TZYA 2F8NK 3B6GC 3AZEC 2VQRA 5BS7A 5BT1D 2Y2LA 1ID3D 1ZLAA 2ZM5A 2Y2JA 5AV9B 3C1BB 3MNND 5GT3C 5GT0C 1P3AB 3AZFC 5BNVA 5C3IB 2J8PA 3B0DB 5GT0B 5GT3B 3WTPA 3A6ND 4JJND 3UTAC 3UTBD 5B24C 3REKD 2F2AC 5B1LC 2IO5B 3EG5B 1H3OA 5B31A 5GXQA 2PYOB 5AVCC 4WZSB 3AFAB 3VH6W 1W2EA 4XUJD 5AV5D 1P3FD 2FFFB 3REJA 3WKJB 1KX3B 5CPIB 5GSUB 1KX5C 1P3PA 3AN2C 3P5JB 2NQBC 2DQNC 2Y2MA 2CV5B 1ULYA 4WU8C 3WA9C 5BS7C 5G49A 1ZLAC 1S32D 3W99B 3KWQA 3KXBA 5JRGD 5B32A 5F99A 1TAFB 5AV6B 3B6GD 4J8VB 4ZBJC 3WTPC 4YS3B 5AV9D 3C1BD 5GXQC 5B31C 3KUYA 3AYWA 2ZY4A 4H9QA 3RELA 4H9OA 2L5AA 3REJC 5GT3D 5GT0D 4KUDA 3AL0C 1P3PC 4WNNB 5AVBA 4NE3A 3LZ0A 2Y2GA 1M19B 2PYOD 4J8UA 3MGSA 3AV1A 1EQZA 1JFIA 3UT9A 5B1LD 1KX4A 3WKJD 1KX3D 5CPID 5GSUD 5JA4B 2Y2IA 4NE5A 4Z66B 5B32C 4WU9A 5B2IB 5F99C 4R8PB 2NQBD 3NQUA 3O62B 4WU8D 2HIOB 3W99D 3WAAB 1M1AB 1WWIA 3TU4A 2RVQC 1BH8B 3AYWC 3KUYC 1BH9A 1ZLAD 3RELC 3LZ1B 1P3MA 5AV6D 2F8NA 4WV4B 4J8VD 1P3BA 1KU5A 5AV8C 4YS3D 5E5AA 4KUDC 4LD9B 1AOIB 5AVBC 3MGQA 3LZ0C 3MGPA 4J8UC 2Y2OA 5AV8B 4NE6A 3WTPD 3MGSC 3AV1C 1EQZC 3UT9C 3B0CW 5CP6A 1U35A 3B0CT 1KX4C 3AV1B 5B1MA 3WTPE 2G5HC 3X1VB 4CSRB 3REJD 5FUGA 4WU9C 3AZMA 3W98A 4QLCA 3REIB 3W97A 5B33C 4J8XA
chains in the Genus database with same CATH topology
5B0ZB 2BYMB 2RIQA 5B33B 3LELB 1P3FB 4R8PD 3LJAA 3VH6A 1P3MC 4G91C 2HIOD 3WAAD 1P3BC 2HUEC 1M1AD 4J8WA 2BYKA 3MGQC 2W8SA 3MGPC 3AZNA 3NQJA 1N1JA 2FJ7A 4E44A 3LZ1D 4KGCA 5JRGB 5CP6C 3X1TA 1U35C 4Z2MG 3X1UB 5CPKB 4LD9D 1HQ3A 1AOID 4Z5TB 3AZLA 3B6FA 3C1CC 5AV8D 3AZMC 3B6GB 3AZEB 5AVBD 3W98C 3X1SA 3LZ0D 4QLCC 3AZGA 1B6WA 4X23A 3C1CB 3AV1D 4UUZB 1EQZD 5BO0B 4J8XC 3UT9D 3H0LC 3X1VD 4AWLC 4ZUXA 2UWXA 3A1KA 1P3IA 3AZFB 3LJAC 2XD5A 3REID 3AZHA 4AWLB 4YM6A 1P3OC 5DNNA 3F6TA 3UTAB 5B0ZD 5B24B 3LJAB 4J8WC 5B1LB 4Z2MH 5B33D 3LELD 1P3OB 3KSYA 4H9PB 5AVCB 3AZNC 2FJ7C 5CPJA 3AZJA 5BNXA 4H9NA 4KGCC 2YFVB 3X1TC 3AZKA 1TZYC 1KX5B 1HQ3C 1P3MD 4KHAB 3AN2B 1P3LA 3AZLC 2NQBB 3B6FC 4WU8B 3WA9B 1TZYB 5DNMA 1P3KA 1P34A 3X1SC 2JCHA 2Y2QA 3X1UD 5CPKD 3AZGC 4X23C 1ZLAB 4Z5TD 3EPLA 1U35D 4ZUXC 3AZED 1R4VA 1P3IC 2Y2PA 4G92C 3AZHC 3C1CD 5BNVB 4YM6C 2CWEA 5DNNC 4ZBJB 3WTPB 3FDDA 3W98D 3H0RC 3EPKA 2NZDA 1H3OB 5B31B 5GXQB 2ZY5A 4E45A 4XZQA 2AROA 3AZFD 3V9RA 2ZY2A 1P3GA 5CPJC 3AZJC 3REJB 4EO5C 3AZIA 3UTAD 2G5IC 1P3PB 5B24D 3LJAD 1P3OD 5AVCD 5B2JA 3AV2A 1F66A 5DNMC 3KWQC 3KXBC 4J8WD 2XD1A 1P34C 1P3KC 5G49B 1M18A 1KX5D 3AN2D 3REHA 3H0MC 3KXBB 3KWQB 3MGRA 5B32B 3WA9D 1TZYD 1ID3A 5B40A 3W96A 3VH5W 5F99B 3VH5T 2YFWA 3IP4C 3MNNA 5KDMA 5AY8A 2Y2KA 3X1SD 3EPHA 2NZDC 3AYWB 3KUYB 4XZQC 2AROC 4JJNA 4H9QB 3RELB 3UTBA 4H9OB 1P3GC 3REKA 2JE5A 3EPJA 4KUDB 3AZIC 2JSSA 5AVBB 5GXQD 4XUJA 5AV5A 5B31D 3LZ0B 5B2JC 3AV2C 1F66C 4J8UB 3MGSB 1EQZB 3R45A 1JFIB 3UT9B 1KX4B 1M18C 1P3PD 3AZJD 3REHC 3MGRC 4H9SA 4WU9B 1ID3C 1Z2CB 3MVDA 5B40C 4H9RA 1S32A 3W96C 3REHB 3TU4C 3NQUB 1B67A 3MNNC 5B31G 5DNMD 3KWQD 3KXBD 5AY8C 5B32D 3TU4B 1BH9B 5E5AC 5F99D 4JJNC 1P3MB 5AV9A 3C1BA 4G91B 3REKC 2F8NB 1P3BB 2HUEB 1P3AA 5E5AB 2RVQD 4XUJC 5AV5C 3MGPB 3MGQB 3KUYD 3AYWD 3RELD 5B1MC 5CP6B 1U35B 2PYOA 4KUDD 5B32G 3AFAA 5B1MB 1P3GD 4H9SC 5FUGB 4J8UD 3MGSD 3W97C 1KX3A 5CPIA 5GSUA 3AZMB 3MVDC 3WKJA 1S32C 3W98B 1KX4D 4QLCB 2CV5A 3W97B 1PZRA 4J8XB 1M18D 4WU9D 1Q9CA 3REHD 3W99A 3MGRD 5AV9C 3C1BC 5B40D 1P3AC 3W96D 3TU4D 4J8WB 5AV6A 1TAFA 2BYKB 5C3IC 3A1IA 3AZNB 3B0DC 3NQJB 4J8VA 1N1JB 5AY8D 4YS3A 2FJ7B 4KGCB 2F8ND 2IO5C 3X1TB 1P3BD 2PYOC 5E5AD 3AFAC 1HQ3B 3MGQD 3MGPD 3AZLB 3B6FB 3WKJC 1KX3C 5CPIC 5GSUC 4WNNA 3VH5A 3X1SB 3VH6T 5CP6D 1M19A 2CV5C 3AZGB 1HTAA 4X23B 5B1MD 5B0YA 4ZUXB 3AZMD 2F8NG 5JA4A 1F1EA 1P3IB 3W99C 4G92B 4Z66A 4QLCD 3AZHB 3W97D 4YM6B 3MVDD 5DNNB 5B2IA 4J8XD 4R8PA 3O62A 5AV6C 3AZKC 2HIOA 5CHLB 4J8VC 3WAAA 4YS3C 1M1AA 5CPJB 3AZJB 5BNXB 4H9NB 1BH8A 1P3LC 4M6BA 4EO5B 3AZKB 4DRAA 3LZ1A 1P3LB 3AZND 4LD9A 1P3AD 2FJ7D 5DNMB 4KGCD 1T3UA 1P3KB 1P34B 1AOIA 3X1TD 2F8NH 2Y2NA 1M19C 4WJ3C 5AV8A 1HQ3D 5B0YC 3AZLD 3B6FD 3AFAD 2LY8A 5B0YB 4Z66C 4CSRA 3X1VA 3AZGD 4X23D 5B2IC 3A6NA 4R8PC 4ZUXD 3REIA 3O62C 2CV5D 2NZDB 2HIOC 1P3ID 4XZQB 2AROB 3WAAC 3V9RB 1M1AC 1P3GB 3AZHD 5B0ZA 4YM6D 2BYMA 5B33A 3LELA 1P3FA 5DNND 3AZIB 4UPKA 3B0BA 3LZ1C 4DQYB 4CAYA 5B2JB 3AV2B 1F66B 4LD9C 5CPJD 4HGAC 1AOIC 5BT1C 3AZKD 1M18B 4HGAB 4DRBA 1P3LD 3MGRB 5JRGA 3X1UA 5CPKA 1WWSA 4NFTA 1ID3B 5B40B 1P3KD 2ZY3A 1P34D 4Z5TA 3W96B 2YFWB 3X1VC 1BFMA 3MNNB 5KDMB 3B6GA 3AZEA 3A6NC 5AY8B 3UTBC 1M19D 3REIC 3C1CA 2Y2HA 4UUZA 5B0YD 5BO0A 4JJNB 3A6NB 3UTBB 2BG1A 5B0ZC 3REKB 3LELC 1P3FC 5GT0A 5GT3A 3AZFA 4Z66D 2NZDD 4XUJB 5AV5B 4XZQD 2AROD 1A7WA 5B2ID 3UTAA 3R45B 5B24A 5B1LA 3O62D 2DF4C 1P3OA 4CAYB 4H9PA 5AVCA 3AZID 2YFVA 5JRGC 5B2JD 3AV2D 1F66D 3X1UC 5CPKC 1KX5A 3KFUG 3MVDB 4H9RB 4KHAA 4Z5TC 3AN2A 1S32B 2NQBA 4WU8A 3WA9A 1TZYA 2F8NK 3B6GC 3AZEC 2VQRA 5BS7A 5BT1D 2Y2LA 1ID3D 1ZLAA 2ZM5A 2Y2JA 5AV9B 3C1BB 3MNND 5GT3C 5GT0C 1P3AB 3AZFC 5BNVA 5C3IB 2J8PA 3B0DB 5GT0B 5GT3B 3WTPA 3A6ND 4JJND 3UTAC 3UTBD 5B24C 3REKD 2F2AC 5B1LC 2IO5B 3EG5B 1H3OA 5B31A 5GXQA 2PYOB 5AVCC 4WZSB 3AFAB 3VH6W 1W2EA 4XUJD 5AV5D 1P3FD 2FFFB 3REJA 3WKJB 1KX3B 5CPIB 5GSUB 1KX5C 1P3PA 3AN2C 3P5JB 2NQBC 2DQNC 2Y2MA 2CV5B 1ULYA 4WU8C 3WA9C 5BS7C 5G49A 1ZLAC 1S32D 3W99B 3KWQA 3KXBA 5JRGD 5B32A 5F99A 1TAFB 5AV6B 3B6GD 4J8VB 4ZBJC 3WTPC 4YS3B 5AV9D 3C1BD 5GXQC 5B31C 3KUYA 3AYWA 2ZY4A 4H9QA 3RELA 4H9OA 2L5AA 3REJC 5GT3D 5GT0D 4KUDA 3AL0C 1P3PC 4WNNB 5AVBA 4NE3A 3LZ0A 2Y2GA 1M19B 2PYOD 4J8UA 3MGSA 3AV1A 1EQZA 1JFIA 3UT9A 5B1LD 1KX4A 3WKJD 1KX3D 5CPID 5GSUD 5JA4B 2Y2IA 4NE5A 4Z66B 5B32C 4WU9A 5B2IB 5F99C 4R8PB 2NQBD 3NQUA 3O62B 4WU8D 2HIOB 3W99D 3WAAB 1M1AB 1WWIA 3TU4A 2RVQC 1BH8B 3AYWC 3KUYC 1BH9A 1ZLAD 3RELC 3LZ1B 1P3MA 5AV6D 2F8NA 4WV4B 4J8VD 1P3BA 1KU5A 5AV8C 4YS3D 5E5AA 4KUDC 4LD9B 1AOIB 5AVBC 3MGQA 3LZ0C 3MGPA 4J8UC 2Y2OA 5AV8B 4NE6A 3WTPD 3MGSC 3AV1C 1EQZC 3UT9C 3B0CW 5CP6A 1U35A 3B0CT 1KX4C 3AV1B 5B1MA 3WTPE 2G5HC 3X1VB 4CSRB 3REJD 5FUGA 4WU9C 3AZMA 3W98A 4QLCA 3REIB 3W97A 5B33C 4J8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0Z B;  2BYM B;  5B33 B;  3LEL B;  1P3F B;  4R8P D;  3LJA A;  3VH6 A;  1P3M C;  4G91 C;  2HIO D;  3WAA D;  1P3B C;  2HUE C;  1M1A D;  4J8W A;  2BYK A;  3MGQ C;  3MGP C;  3AZN A;  3NQJ A;  1N1J A;  2FJ7 A;  4E44 A;  3LZ1 D;  4KGC A;  5JRG B;  5CP6 C;  3X1T A;  1U35 C;  4Z2M G;  3X1U B;  5CPK B;  4LD9 D;  1HQ3 A;  1AOI D;  4Z5T B;  3AZL A;  3B6F A;  3C1C C;  5AV8 D;  3AZM C;  3B6G B;  3AZE B;  5AVB D;  3W98 C;  3X1S A;  3LZ0 D;  4QLC C;  3AZG A;  1B6W A;  4X23 A;  3C1C B;  3AV1 D;  4UUZ B;  1EQZ D;  5BO0 B;  4J8X C;  3UT9 D;  3X1V D;  4AWL C;  4ZUX A;  1P3I A;  3AZF B;  3LJA C;  3REI D;  3AZH A;  4AWL B;  4YM6 A;  1P3O C;  5DNN A;  3UTA B;  5B0Z D;  5B24 B;  3LJA B;  4J8W C;  5B1L B;  4Z2M H;  5B33 D;  3LEL D;  1P3O B;  3KSY A;  4H9P B;  5AVC B;  3AZN C;  2FJ7 C;  5CPJ A;  3AZJ A;  5BNX A;  4H9N A;  4KGC C;  2YFV B;  3X1T C;  3AZK A;  1TZY C;  1KX5 B;  1HQ3 C;  1P3M D;  4KHA B;  3AN2 B;  1P3L A;  3AZL C;  2NQB B;  3B6F C;  4WU8 B;  3WA9 B;  1TZY B;  5DNM A;  1P3K A;  1P34 A;  3X1S C;  3X1U D;  5CPK D;  3AZG C;  4X23 C;  1ZLA B;  4Z5T D;  1U35 D;  4ZUX C;  3AZE D;  1R4V A;  1P3I C;  4G92 C;  3AZH C;  3C1C D;  5BNV B;  4YM6 C;  2CWE A;  5DNN C;  4ZBJ B;  3WTP B;  3W98 D;  2NZD A;  1H3O B;  5GXQ B;  5B31 B;  4E45 A;  4XZQ A;  2ARO A;  3AZF D;  3V9R A;  1P3G A;  5CPJ C;  3AZJ C;  3REJ B;  4EO5 C;  3AZI A;  3UTA D;  1P3P B;  5B24 D;  3LJA D;  1P3O D;  5AVC D;  5B2J A;  3AV2 A;  1F66 A;  5DNM C;  3KWQ C;  3KXB C;  4J8W D;  1P34 C;  1P3K C;  5G49 B;  1M18 A;  1KX5 D;  3AN2 D;  3REH A;  3KWQ B;  3KXB B;  3MGR A;  5B32 B;  3WA9 D;  1TZY D;  1ID3 A;  5B40 A;  3W96 A;  3VH5 W;  5F99 B;  3VH5 T;  2YFW A;  3MNN A;  5KDM A;  5AY8 A;  3X1S D;  2NZD C;  3AYW B;  3KUY B;  4XZQ C;  2ARO C;  4JJN A;  4H9Q B;  3REL B;  3UTB A;  4H9O B;  1P3G C;  3REK A;  4KUD B;  3AZI C;  2JSS A;  5AVB B;  5GXQ D;  4XUJ A;  5AV5 A;  5B31 D;  3LZ0 B;  5B2J C;  3AV2 C;  1F66 C;  4J8U B;  3MGS B;  1EQZ B;  3R45 A;  1JFI B;  3UT9 B;  1KX4 B;  1M18 C;  1P3P D;  3AZJ D;  3REH C;  3MGR C;  4H9S A;  4WU9 B;  1ID3 C;  3MVD A;  5B40 C;  4H9R A;  1S32 A;  3W96 C;  3REH B;  3TU4 C;  3NQU B;  1B67 A;  3MNN C;  5B31 G;  5DNM D;  3KWQ D;  3KXB D;  5AY8 C;  5B32 D;  3TU4 B;  1BH9 B;  5E5A C;  5F99 D;  4JJN C;  1P3M B;  5AV9 A;  3C1B A;  4G91 B;  3REK C;  2F8N B;  1P3B B;  2HUE B;  1P3A A;  5E5A B;  2RVQ D;  4XUJ C;  5AV5 C;  3MGP B;  3MGQ B;  3KUY D;  3AYW D;  3REL D;  5B1M C;  5CP6 B;  1U35 B;  2PYO A;  4KUD D;  5B32 G;  3AFA A;  5B1M B;  1P3G D;  4H9S C;  5FUG B;  4J8U D;  3MGS D;  3W97 C;  1KX3 A;  5CPI A;  5GSU A;  3AZM B;  3MVD C;  3WKJ A;  1S32 C;  3W98 B;  1KX4 D;  4QLC B;  2CV5 A;  3W97 B;  4J8X B;  1M18 D;  4WU9 D;  1Q9C A;  3REH D;  3W99 A;  3MGR D;  5AV9 C;  3C1B C;  5B40 D;  1P3A C;  3W96 D;  3TU4 D;  4J8W B;  1TAF A;  2BYK B;  5C3I C;  5AV6 A;  3AZN B;  3B0D C;  3NQJ B;  4J8V A;  1N1J B;  5AY8 D;  4YS3 A;  2FJ7 B;  4KGC B;  2F8N D;  2IO5 C;  3X1T B;  1P3B D;  2PYO C;  5E5A D;  3AFA C;  1HQ3 B;  3MGQ D;  3MGP D;  3AZL B;  3B6F B;  3WKJ C;  1KX3 C;  5CPI C;  5GSU C;  4WNN A;  3VH5 A;  3X1S B;  3VH6 T;  5CP6 D;  1M19 A;  2CV5 C;  3AZG B;  1HTA A;  4X23 B;  5B1M D;  5B0Y A;  4ZUX B;  3AZM D;  2F8N G;  5JA4 A;  1F1E A;  1P3I B;  3W99 C;  4G92 B;  4Z66 A;  4QLC D;  3AZH B;  3W97 D;  4YM6 B;  3MVD D;  5DNN B;  5B2I A;  4J8X D;  4R8P A;  3O62 A;  5AV6 C;  3AZK C;  2HIO A;  5CHL B;  4J8V C;  3WAA A;  4YS3 C;  1M1A A;  5CPJ B;  3AZJ B;  5BNX B;  4H9N B;  1BH8 A;  1P3L C;  4M6B A;  4EO5 B;  3AZK B;  4DRA A;  3LZ1 A;  1P3L B;  3AZN D;  4LD9 A;  1P3A D;  2FJ7 D;  5DNM B;  4KGC D;  1P3K B;  1P34 B;  1AOI A;  3X1T D;  2F8N H;  1M19 C;  5AV8 A;  1HQ3 D;  5B0Y C;  3AZL D;  3B6F D;  3AFA D;  2LY8 A;  5B0Y B;  4Z66 C;  4CSR A;  3X1V A;  3AZG D;  4X23 D;  5B2I C;  3A6N A;  4R8P C;  4ZUX D;  3REI A;  3O62 C;  2CV5 D;  2NZD B;  2HIO C;  1P3I D;  4XZQ B;  2ARO B;  3WAA C;  3V9R B;  1M1A C;  1P3G B;  3AZH D;  5B0Z A;  4YM6 D;  2BYM A;  5B33 A;  3LEL A;  1P3F A;  5DNN D;  3AZI B;  3B0B A;  3LZ1 C;  4CAY A;  5B2J B;  3AV2 B;  1F66 B;  4LD9 C;  5CPJ D;  4HGA C;  1AOI C;  5BT1 C;  3AZK D;  1M18 B;  4HGA B;  4DRB A;  1P3L D;  3MGR B;  5JRG A;  3X1U A;  5CPK A;  1WWS A;  4NFT A;  1ID3 B;  5B40 B;  1P3K D;  1P34 D;  4Z5T A;  3W96 B;  2YFW B;  3X1V C;  1BFM A;  3MNN B;  5KDM B;  3B6G A;  3AZE A;  3A6N C;  5AY8 B;  3UTB C;  1M19 D;  3REI C;  3C1C A;  4UUZ A;  5B0Y D;  5BO0 A;  4JJN B;  3A6N B;  3UTB B;  5B0Z C;  3REK B;  3LEL C;  1P3F C;  5GT0 A;  5GT3 A;  3AZF A;  4Z66 D;  2NZD D;  4XUJ B;  5AV5 B;  4XZQ D;  2ARO D;  1A7W A;  5B2I D;  3UTA A;  3R45 B;  5B24 A;  5B1L A;  3O62 D;  1P3O A;  4CAY B;  4H9P A;  5AVC A;  3AZI D;  2YFV A;  5JRG C;  5B2J D;  3AV2 D;  1F66 D;  3X1U C;  5CPK C;  1KX5 A;  3MVD B;  4H9R B;  4KHA A;  4Z5T C;  3AN2 A;  1S32 B;  2NQB A;  4WU8 A;  3WA9 A;  1TZY A;  2F8N K;  3B6G C;  3AZE C;  5BS7 A;  5BT1 D;  1ID3 D;  1ZLA A;  5AV9 B;  3C1B B;  3MNN D;  5GT3 C;  5GT0 C;  1P3A B;  3AZF C;  5BNV A;  5C3I B;  3B0D B;  5GT0 B;  5GT3 B;  3WTP A;  3A6N D;  4JJN D;  3UTA C;  3UTB D;  5B24 C;  3REK D;  5B1L C;  2IO5 B;  1H3O A;  5B31 A;  5GXQ A;  2PYO B;  5AVC C;  4WZS B;  3AFA B;  3VH6 W;  4XUJ D;  5AV5 D;  1P3F D;  3REJ A;  3WKJ B;  1KX3 B;  5CPI B;  5GSU B;  1KX5 C;  1P3P A;  3AN2 C;  2NQB C;  2CV5 B;  1ULY A;  4WU8 C;  3WA9 C;  5BS7 C;  5G49 A;  1ZLA C;  1S32 D;  3W99 B;  3KWQ A;  3KXB A;  5JRG D;  5B32 A;  5F99 A;  1TAF B;  5AV6 B;  3B6G D;  4J8V B;  4ZBJ C;  3WTP C;  4YS3 B;  5AV9 D;  3C1B D;  5GXQ C;  5B31 C;  3KUY A;  3AYW A;  4H9Q A;  3REL A;  4H9O A;  2L5A A;  3REJ C;  5GT3 D;  5GT0 D;  4KUD A;  1P3P C;  4WNN B;  5AVB A;  4NE3 A;  3LZ0 A;  1M19 B;  2PYO D;  4J8U A;  3MGS A;  3AV1 A;  1EQZ A;  1JFI A;  3UT9 A;  5B1L D;  1KX4 A;  3WKJ D;  1KX3 D;  5CPI D;  5GSU D;  5JA4 B;  4NE5 A;  4Z66 B;  5B32 C;  4WU9 A;  5B2I B;  5F99 C;  4R8P B;  2NQB D;  3NQU A;  3O62 B;  4WU8 D;  2HIO B;  3W99 D;  3WAA B;  1M1A B;  1WWI A;  3TU4 A;  2RVQ C;  1BH8 B;  3AYW C;  3KUY C;  1BH9 A;  1ZLA D;  3REL C;  3LZ1 B;  1P3M A;  5AV6 D;  2F8N A;  4WV4 B;  4J8V D;  1P3B A;  1KU5 A;  5AV8 C;  4YS3 D;  5E5A A;  4KUD C;  4LD9 B;  1AOI B;  5AVB C;  3MGQ A;  3LZ0 C;  3MGP A;  4J8U C;  3WTP D;  5AV8 B;  4NE6 A;  3MGS C;  3AV1 C;  1EQZ C;  3UT9 C;  3B0C W;  5CP6 A;  1U35 A;  3B0C T;  1KX4 C;  3AV1 B;  5B1M A;  3WTP E;  3X1V B;  4CSR B;  3REJ D;  5FUG A;  4WU9 C;  3AZM A;  3W98 A;  4QLC A;  3REI B;  3W97 A;  5B33 C;  4J8X A; 
#chains in the Genus database with same CATH topology
 5B0Z B;  2BYM B;  2RIQ A;  5B33 B;  3LEL B;  1P3F B;  4R8P D;  3LJA A;  3VH6 A;  1P3M C;  4G91 C;  2HIO D;  3WAA D;  1P3B C;  2HUE C;  1M1A D;  4J8W A;  2BYK A;  3MGQ C;  2W8S A;  3MGP C;  3AZN A;  3NQJ A;  1N1J A;  2FJ7 A;  4E44 A;  3LZ1 D;  4KGC A;  5JRG B;  5CP6 C;  3X1T A;  1U35 C;  4Z2M G;  3X1U B;  5CPK B;  4LD9 D;  1HQ3 A;  1AOI D;  4Z5T B;  3AZL A;  3B6F A;  3C1C C;  5AV8 D;  3AZM C;  3B6G B;  3AZE B;  5AVB D;  3W98 C;  3X1S A;  3LZ0 D;  4QLC C;  3AZG A;  1B6W A;  4X23 A;  3C1C B;  3AV1 D;  4UUZ B;  1EQZ D;  5BO0 B;  4J8X C;  3UT9 D;  3H0L C;  3X1V D;  4AWL C;  4ZUX A;  2UWX A;  3A1K A;  1P3I A;  3AZF B;  3LJA C;  2XD5 A;  3REI D;  3AZH A;  4AWL B;  4YM6 A;  1P3O C;  5DNN A;  3F6T A;  3UTA B;  5B0Z D;  5B24 B;  3LJA B;  4J8W C;  5B1L B;  4Z2M H;  5B33 D;  3LEL D;  1P3O B;  3KSY A;  4H9P B;  5AVC B;  3AZN C;  2FJ7 C;  5CPJ A;  3AZJ A;  5BNX A;  4H9N A;  4KGC C;  2YFV B;  3X1T C;  3AZK A;  1TZY C;  1KX5 B;  1HQ3 C;  1P3M D;  4KHA B;  3AN2 B;  1P3L A;  3AZL C;  2NQB B;  3B6F C;  4WU8 B;  3WA9 B;  1TZY B;  5DNM A;  1P3K A;  1P34 A;  3X1S C;  2JCH A;  2Y2Q A;  3X1U D;  5CPK D;  3AZG C;  4X23 C;  1ZLA B;  4Z5T D;  3EPL A;  1U35 D;  4ZUX C;  3AZE D;  1R4V A;  1P3I C;  2Y2P A;  4G92 C;  3AZH C;  3C1C D;  5BNV B;  4YM6 C;  2CWE A;  5DNN C;  4ZBJ B;  3WTP B;  3FDD A;  3W98 D;  3H0R C;  3EPK A;  2NZD A;  1H3O B;  5B31 B;  5GXQ B;  2ZY5 A;  4E45 A;  4XZQ A;  2ARO A;  3AZF D;  3V9R A;  2ZY2 A;  1P3G A;  5CPJ C;  3AZJ C;  3REJ B;  4EO5 C;  3AZI A;  3UTA D;  2G5I C;  1P3P B;  5B24 D;  3LJA D;  1P3O D;  5AVC D;  5B2J A;  3AV2 A;  1F66 A;  5DNM C;  3KWQ C;  3KXB C;  4J8W D;  2XD1 A;  1P34 C;  1P3K C;  5G49 B;  1M18 A;  1KX5 D;  3AN2 D;  3REH A;  3H0M C;  3KXB B;  3KWQ B;  3MGR A;  5B32 B;  3WA9 D;  1TZY D;  1ID3 A;  5B40 A;  3W96 A;  3VH5 W;  5F99 B;  3VH5 T;  2YFW A;  3IP4 C;  3MNN A;  5KDM A;  5AY8 A;  2Y2K A;  3X1S D;  3EPH A;  2NZD C;  3AYW B;  3KUY B;  4XZQ C;  2ARO C;  4JJN A;  4H9Q B;  3REL B;  3UTB A;  4H9O B;  1P3G C;  3REK A;  2JE5 A;  3EPJ A;  4KUD B;  3AZI C;  2JSS A;  5AVB B;  5GXQ D;  4XUJ A;  5AV5 A;  5B31 D;  3LZ0 B;  5B2J C;  3AV2 C;  1F66 C;  4J8U B;  3MGS B;  1EQZ B;  3R45 A;  1JFI B;  3UT9 B;  1KX4 B;  1M18 C;  1P3P D;  3AZJ D;  3REH C;  3MGR C;  4H9S A;  4WU9 B;  1ID3 C;  1Z2C B;  3MVD A;  5B40 C;  4H9R A;  1S32 A;  3W96 C;  3REH B;  3TU4 C;  3NQU B;  1B67 A;  3MNN C;  5B31 G;  5DNM D;  3KWQ D;  3KXB D;  5AY8 C;  5B32 D;  3TU4 B;  1BH9 B;  5E5A C;  5F99 D;  4JJN C;  1P3M B;  5AV9 A;  3C1B A;  4G91 B;  3REK C;  2F8N B;  1P3B B;  2HUE B;  1P3A A;  5E5A B;  2RVQ D;  4XUJ C;  5AV5 C;  3MGP B;  3MGQ B;  3KUY D;  3AYW D;  3REL D;  5B1M C;  5CP6 B;  1U35 B;  2PYO A;  4KUD D;  5B32 G;  3AFA A;  5B1M B;  1P3G D;  4H9S C;  5FUG B;  4J8U D;  3MGS D;  3W97 C;  1KX3 A;  5CPI A;  5GSU A;  3AZM B;  3MVD C;  3WKJ A;  1S32 C;  3W98 B;  1KX4 D;  4QLC B;  2CV5 A;  3W97 B;  1PZR A;  4J8X B;  1M18 D;  4WU9 D;  1Q9C A;  3REH D;  3W99 A;  3MGR D;  5AV9 C;  3C1B C;  5B40 D;  1P3A C;  3W96 D;  3TU4 D;  4J8W B;  5AV6 A;  1TAF A;  2BYK B;  5C3I C;  3A1I A;  3AZN B;  3B0D C;  3NQJ B;  4J8V A;  1N1J B;  5AY8 D;  4YS3 A;  2FJ7 B;  4KGC B;  2F8N D;  2IO5 C;  3X1T B;  1P3B D;  2PYO C;  5E5A D;  3AFA C;  1HQ3 B;  3MGQ D;  3MGP D;  3AZL B;  3B6F B;  3WKJ C;  1KX3 C;  5CPI C;  5GSU C;  4WNN A;  3VH5 A;  3X1S B;  3VH6 T;  5CP6 D;  1M19 A;  2CV5 C;  3AZG B;  1HTA A;  4X23 B;  5B1M D;  5B0Y A;  4ZUX B;  3AZM D;  2F8N G;  5JA4 A;  1F1E A;  1P3I B;  3W99 C;  4G92 B;  4Z66 A;  4QLC D;  3AZH B;  3W97 D;  4YM6 B;  3MVD D;  5DNN B;  5B2I A;  4J8X D;  4R8P A;  3O62 A;  5AV6 C;  3AZK C;  2HIO A;  5CHL B;  4J8V C;  3WAA A;  4YS3 C;  1M1A A;  5CPJ B;  3AZJ B;  5BNX B;  4H9N B;  1BH8 A;  1P3L C;  4M6B A;  4EO5 B;  3AZK B;  4DRA A;  3LZ1 A;  1P3L B;  3AZN D;  4LD9 A;  1P3A D;  2FJ7 D;  5DNM B;  4KGC D;  1T3U A;  1P3K B;  1P34 B;  1AOI A;  3X1T D;  2F8N H;  2Y2N A;  1M19 C;  4WJ3 C;  5AV8 A;  1HQ3 D;  5B0Y C;  3AZL D;  3B6F D;  3AFA D;  2LY8 A;  5B0Y B;  4Z66 C;  4CSR A;  3X1V A;  3AZG D;  4X23 D;  5B2I C;  3A6N A;  4R8P C;  4ZUX D;  3REI A;  3O62 C;  2CV5 D;  2NZD B;  2HIO C;  1P3I D;  4XZQ B;  2ARO B;  3WAA C;  3V9R B;  1M1A C;  1P3G B;  3AZH D;  5B0Z A;  4YM6 D;  2BYM A;  5B33 A;  3LEL A;  1P3F A;  5DNN D;  3AZI B;  4UPK A;  3B0B A;  3LZ1 C;  4DQY B;  4CAY A;  5B2J B;  3AV2 B;  1F66 B;  4LD9 C;  5CPJ D;  4HGA C;  1AOI C;  5BT1 C;  3AZK D;  1M18 B;  4HGA B;  4DRB A;  1P3L D;  3MGR B;  5JRG A;  3X1U A;  5CPK A;  1WWS A;  4NFT A;  1ID3 B;  5B40 B;  1P3K D;  2ZY3 A;  1P34 D;  4Z5T A;  3W96 B;  2YFW B;  3X1V C;  1BFM A;  3MNN B;  5KDM B;  3B6G A;  3AZE A;  3A6N C;  5AY8 B;  3UTB C;  1M19 D;  3REI C;  3C1C A;  2Y2H A;  4UUZ A;  5B0Y D;  5BO0 A;  4JJN B;  3A6N B;  3UTB B;  2BG1 A;  5B0Z C;  3REK B;  3LEL C;  1P3F C;  5GT0 A;  5GT3 A;  3AZF A;  4Z66 D;  2NZD D;  4XUJ B;  5AV5 B;  4XZQ D;  2ARO D;  1A7W A;  5B2I D;  3UTA A;  3R45 B;  5B24 A;  5B1L A;  3O62 D;  2DF4 C;  1P3O A;  4CAY B;  4H9P A;  5AVC A;  3AZI D;  2YFV A;  5JRG C;  5B2J D;  3AV2 D;  1F66 D;  3X1U C;  5CPK C;  1KX5 A;  3KFU G;  3MVD B;  4H9R B;  4KHA A;  4Z5T C;  3AN2 A;  1S32 B;  2NQB A;  4WU8 A;  3WA9 A;  1TZY A;  2F8N K;  3B6G C;  3AZE C;  2VQR A;  5BS7 A;  5BT1 D;  2Y2L A;  1ID3 D;  1ZLA A;  2ZM5 A;  2Y2J A;  5AV9 B;  3C1B B;  3MNN D;  5GT3 C;  5GT0 C;  1P3A B;  3AZF C;  5BNV A;  5C3I B;  2J8P A;  3B0D B;  5GT0 B;  5GT3 B;  3WTP A;  3A6N D;  4JJN D;  3UTA C;  3UTB D;  5B24 C;  3REK D;  2F2A C;  5B1L C;  2IO5 B;  3EG5 B;  1H3O A;  5B31 A;  5GXQ A;  2PYO B;  5AVC C;  4WZS B;  3AFA B;  3VH6 W;  1W2E A;  4XUJ D;  5AV5 D;  1P3F D;  2FFF B;  3REJ A;  3WKJ B;  1KX3 B;  5CPI B;  5GSU B;  1KX5 C;  1P3P A;  3AN2 C;  3P5J B;  2NQB C;  2DQN C;  2Y2M A;  2CV5 B;  1ULY A;  4WU8 C;  3WA9 C;  5BS7 C;  5G49 A;  1ZLA C;  1S32 D;  3W99 B;  3KWQ A;  3KXB A;  5JRG D;  5B32 A;  5F99 A;  1TAF B;  5AV6 B;  3B6G D;  4J8V B;  4ZBJ C;  3WTP C;  4YS3 B;  5AV9 D;  3C1B D;  5GXQ C;  5B31 C;  3KUY A;  3AYW A;  2ZY4 A;  4H9Q A;  3REL A;  4H9O A;  2L5A A;  3REJ C;  5GT3 D;  5GT0 D;  4KUD A;  3AL0 C;  1P3P C;  4WNN B;  5AVB A;  4NE3 A;  3LZ0 A;  2Y2G A;  1M19 B;  2PYO D;  4J8U A;  3MGS A;  3AV1 A;  1EQZ A;  1JFI A;  3UT9 A;  5B1L D;  1KX4 A;  3WKJ D;  1KX3 D;  5CPI D;  5GSU D;  5JA4 B;  2Y2I A;  4NE5 A;  4Z66 B;  5B32 C;  4WU9 A;  5B2I B;  5F99 C;  4R8P B;  2NQB D;  3NQU A;  3O62 B;  4WU8 D;  2HIO B;  3W99 D;  3WAA B;  1M1A B;  1WWI A;  3TU4 A;  2RVQ C;  1BH8 B;  3AYW C;  3KUY C;  1BH9 A;  1ZLA D;  3REL C;  3LZ1 B;  1P3M A;  5AV6 D;  2F8N A;  4WV4 B;  4J8V D;  1P3B A;  1KU5 A;  5AV8 C;  4YS3 D;  5E5A A;  4KUD C;  4LD9 B;  1AOI B;  5AVB C;  3MGQ A;  3LZ0 C;  3MGP A;  4J8U C;  2Y2O A;  5AV8 B;  4NE6 A;  3WTP D;  3MGS C;  3AV1 C;  1EQZ C;  3UT9 C;  3B0C W;  5CP6 A;  1U35 A;  3B0C T;  1KX4 C;  3AV1 B;  5B1M A;  3WTP E;  2G5H C;  3X1V B;  4CSR B;  3REJ D;  5FUG A;  4WU9 C;  3AZM A;  3W98 A;  4QLC A;  3REI B;  3W97 A;  5B33 C;  4J8X A; 
#chains in the Genus database with same CATH homology
 5B0Z B;  2BYM B;  2RIQ A;  5B33 B;  3LEL B;  1P3F B;  4R8P D;  3LJA A;  3VH6 A;  1P3M C;  4G91 C;  2HIO D;  3WAA D;  1P3B C;  2HUE C;  1M1A D;  4J8W A;  2BYK A;  3MGQ C;  2W8S A;  3MGP C;  3AZN A;  3NQJ A;  1N1J A;  2FJ7 A;  4E44 A;  3LZ1 D;  4KGC A;  5JRG B;  5CP6 C;  3X1T A;  1U35 C;  4Z2M G;  3X1U B;  5CPK B;  4LD9 D;  1HQ3 A;  1AOI D;  4Z5T B;  3AZL A;  3B6F A;  3C1C C;  5AV8 D;  3AZM C;  3B6G B;  3AZE B;  5AVB D;  3W98 C;  3X1S A;  3LZ0 D;  4QLC C;  3AZG A;  1B6W A;  4X23 A;  3C1C B;  3AV1 D;  4UUZ B;  1EQZ D;  5BO0 B;  4J8X C;  3UT9 D;  3H0L C;  3X1V D;  4AWL C;  4ZUX A;  2UWX A;  3A1K A;  1P3I A;  3AZF B;  3LJA C;  2XD5 A;  3REI D;  3AZH A;  4AWL B;  4YM6 A;  1P3O C;  5DNN A;  3F6T A;  3UTA B;  5B0Z D;  5B24 B;  3LJA B;  4J8W C;  5B1L B;  4Z2M H;  5B33 D;  3LEL D;  1P3O B;  3KSY A;  4H9P B;  5AVC B;  3AZN C;  2FJ7 C;  5CPJ A;  3AZJ A;  5BNX A;  4H9N A;  4KGC C;  2YFV B;  3X1T C;  3AZK A;  1TZY C;  1KX5 B;  1HQ3 C;  1P3M D;  4KHA B;  3AN2 B;  1P3L A;  3AZL C;  2NQB B;  3B6F C;  4WU8 B;  3WA9 B;  1TZY B;  5DNM A;  1P3K A;  1P34 A;  3X1S C;  2JCH A;  2Y2Q A;  3X1U D;  5CPK D;  3AZG C;  4X23 C;  1ZLA B;  4Z5T D;  3EPL A;  1U35 D;  4ZUX C;  3AZE D;  1R4V A;  1P3I C;  2Y2P A;  4G92 C;  3AZH C;  3C1C D;  5BNV B;  4YM6 C;  2CWE A;  5DNN C;  4ZBJ B;  3WTP B;  3FDD A;  3W98 D;  3H0R C;  3EPK A;  2NZD A;  1H3O B;  5B31 B;  5GXQ B;  2ZY5 A;  4E45 A;  4XZQ A;  2ARO A;  3AZF D;  3V9R A;  2ZY2 A;  1P3G A;  5CPJ C;  3AZJ C;  3REJ B;  4EO5 C;  3AZI A;  3UTA D;  2G5I C;  1P3P B;  5B24 D;  3LJA D;  1P3O D;  5AVC D;  5B2J A;  3AV2 A;  1F66 A;  5DNM C;  3KWQ C;  3KXB C;  4J8W D;  2XD1 A;  1P34 C;  1P3K C;  5G49 B;  1M18 A;  1KX5 D;  3AN2 D;  3REH A;  3H0M C;  3KXB B;  3KWQ B;  3MGR A;  5B32 B;  3WA9 D;  1TZY D;  1ID3 A;  5B40 A;  3W96 A;  3VH5 W;  5F99 B;  3VH5 T;  2YFW A;  3IP4 C;  3MNN A;  5KDM A;  5AY8 A;  2Y2K A;  3X1S D;  3EPH A;  2NZD C;  3AYW B;  3KUY B;  4XZQ C;  2ARO C;  4JJN A;  4H9Q B;  3REL B;  3UTB A;  4H9O B;  1P3G C;  3REK A;  2JE5 A;  3EPJ A;  4KUD B;  3AZI C;  2JSS A;  5AVB B;  5GXQ D;  4XUJ A;  5AV5 A;  5B31 D;  3LZ0 B;  5B2J C;  3AV2 C;  1F66 C;  4J8U B;  3MGS B;  1EQZ B;  3R45 A;  1JFI B;  3UT9 B;  1KX4 B;  1M18 C;  1P3P D;  3AZJ D;  3REH C;  3MGR C;  4H9S A;  4WU9 B;  1ID3 C;  1Z2C B;  3MVD A;  5B40 C;  4H9R A;  1S32 A;  3W96 C;  3REH B;  3TU4 C;  3NQU B;  1B67 A;  3MNN C;  5B31 G;  5DNM D;  3KWQ D;  3KXB D;  5AY8 C;  5B32 D;  3TU4 B;  1BH9 B;  5E5A C;  5F99 D;  4JJN C;  1P3M B;  5AV9 A;  3C1B A;  4G91 B;  3REK C;  2F8N B;  1P3B B;  2HUE B;  1P3A A;  5E5A B;  2RVQ D;  4XUJ C;  5AV5 C;  3MGP B;  3MGQ B;  3KUY D;  3AYW D;  3REL D;  5B1M C;  5CP6 B;  1U35 B;  2PYO A;  4KUD D;  5B32 G;  3AFA A;  5B1M B;  1P3G D;  4H9S C;  5FUG B;  4J8U D;  3MGS D;  3W97 C;  1KX3 A;  5CPI A;  5GSU A;  3AZM B;  3MVD C;  3WKJ A;  1S32 C;  3W98 B;  1KX4 D;  4QLC B;  2CV5 A;  3W97 B;  1PZR A;  4J8X B;  1M18 D;  4WU9 D;  1Q9C A;  3REH D;  3W99 A;  3MGR D;  5AV9 C;  3C1B C;  5B40 D;  1P3A C;  3W96 D;  3TU4 D;  4J8W B;  5AV6 A;  1TAF A;  2BYK B;  5C3I C;  3A1I A;  3AZN B;  3B0D C;  3NQJ B;  4J8V A;  1N1J B;  5AY8 D;  4YS3 A;  2FJ7 B;  4KGC B;  2F8N D;  2IO5 C;  3X1T B;  1P3B D;  2PYO C;  5E5A D;  3AFA C;  1HQ3 B;  3MGQ D;  3MGP D;  3AZL B;  3B6F B;  3WKJ C;  1KX3 C;  5CPI C;  5GSU C;  4WNN A;  3VH5 A;  3X1S B;  3VH6 T;  5CP6 D;  1M19 A;  2CV5 C;  3AZG B;  1HTA A;  4X23 B;  5B1M D;  5B0Y A;  4ZUX B;  3AZM D;  2F8N G;  5JA4 A;  1F1E A;  1P3I B;  3W99 C;  4G92 B;  4Z66 A;  4QLC D;  3AZH B;  3W97 D;  4YM6 B;  3MVD D;  5DNN B;  5B2I A;  4J8X D;  4R8P A;  3O62 A;  5AV6 C;  3AZK C;  2HIO A;  5CHL B;  4J8V C;  3WAA A;  4YS3 C;  1M1A A;  5CPJ B;  3AZJ B;  5BNX B;  4H9N B;  1BH8 A;  1P3L C;  4M6B A;  4EO5 B;  3AZK B;  4DRA A;  3LZ1 A;  1P3L B;  3AZN D;  4LD9 A;  1P3A D;  2FJ7 D;  5DNM B;  4KGC D;  1T3U A;  1P3K B;  1P34 B;  1AOI A;  3X1T D;  2F8N H;  2Y2N A;  1M19 C;  4WJ3 C;  5AV8 A;  1HQ3 D;  5B0Y C;  3AZL D;  3B6F D;  3AFA D;  2LY8 A;  5B0Y B;  4Z66 C;  4CSR A;  3X1V A;  3AZG D;  4X23 D;  5B2I C;  3A6N A;  4R8P C;  4ZUX D;  3REI A;  3O62 C;  2CV5 D;  2NZD B;  2HIO C;  1P3I D;  4XZQ B;  2ARO B;  3WAA C;  3V9R B;  1M1A C;  1P3G B;  3AZH D;  5B0Z A;  4YM6 D;  2BYM A;  5B33 A;  3LEL A;  1P3F A;  5DNN D;  3AZI B;  4UPK A;  3B0B A;  3LZ1 C;  4DQY B;  4CAY A;  5B2J B;  3AV2 B;  1F66 B;  4LD9 C;  5CPJ D;  4HGA C;  1AOI C;  5BT1 C;  3AZK D;  1M18 B;  4HGA B;  4DRB A;  1P3L D;  3MGR B;  5JRG A;  3X1U A;  5CPK A;  1WWS A;  4NFT A;  1ID3 B;  5B40 B;  1P3K D;  2ZY3 A;  1P34 D;  4Z5T A;  3W96 B;  2YFW B;  3X1V C;  1BFM A;  3MNN B;  5KDM B;  3B6G A;  3AZE A;  3A6N C;  5AY8 B;  3UTB C;  1M19 D;  3REI C;  3C1C A;  2Y2H A;  4UUZ A;  5B0Y D;  5BO0 A;  4JJN B;  3A6N B;  3UTB B;  2BG1 A;  5B0Z C;  3REK B;  3LEL C;  1P3F C;  5GT0 A;  5GT3 A;  3AZF A;  4Z66 D;  2NZD D;  4XUJ B;  5AV5 B;  4XZQ D;  2ARO D;  1A7W A;  5B2I D;  3UTA A;  3R45 B;  5B24 A;  5B1L A;  3O62 D;  2DF4 C;  1P3O A;  4CAY B;  4H9P A;  5AVC A;  3AZI D;  2YFV A;  5JRG C;  5B2J D;  3AV2 D;  1F66 D;  3X1U C;  5CPK C;  1KX5 A;  3KFU G;  3MVD B;  4H9R B;  4KHA A;  4Z5T C;  3AN2 A;  1S32 B;  2NQB A;  4WU8 A;  3WA9 A;  1TZY A;  2F8N K;  3B6G C;  3AZE C;  2VQR A;  5BS7 A;  5BT1 D;  2Y2L A;  1ID3 D;  1ZLA A;  2ZM5 A;  2Y2J A;  5AV9 B;  3C1B B;  3MNN D;  5GT3 C;  5GT0 C;  1P3A B;  3AZF C;  5BNV A;  5C3I B;  2J8P A;  3B0D B;  5GT0 B;  5GT3 B;  3WTP A;  3A6N D;  4JJN D;  3UTA C;  3UTB D;  5B24 C;  3REK D;  2F2A C;  5B1L C;  2IO5 B;  3EG5 B;  1H3O A;  5B31 A;  5GXQ A;  2PYO B;  5AVC C;  4WZS B;  3AFA B;  3VH6 W;  1W2E A;  4XUJ D;  5AV5 D;  1P3F D;  2FFF B;  3REJ A;  3WKJ B;  1KX3 B;  5CPI B;  5GSU B;  1KX5 C;  1P3P A;  3AN2 C;  3P5J B;  2NQB C;  2DQN C;  2Y2M A;  2CV5 B;  1ULY A;  4WU8 C;  3WA9 C;  5BS7 C;  5G49 A;  1ZLA C;  1S32 D;  3W99 B;  3KWQ A;  3KXB A;  5JRG D;  5B32 A;  5F99 A;  1TAF B;  5AV6 B;  3B6G D;  4J8V B;  4ZBJ C;  3WTP C;  4YS3 B;  5AV9 D;  3C1B D;  5GXQ C;  5B31 C;  3KUY A;  3AYW A;  2ZY4 A;  4H9Q A;  3REL A;  4H9O A;  2L5A A;  3REJ C;  5GT3 D;  5GT0 D;  4KUD A;  3AL0 C;  1P3P C;  4WNN B;  5AVB A;  4NE3 A;  3LZ0 A;  2Y2G A;  1M19 B;  2PYO D;  4J8U A;  3MGS A;  3AV1 A;  1EQZ A;  1JFI A;  3UT9 A;  5B1L D;  1KX4 A;  3WKJ D;  1KX3 D;  5CPI D;  5GSU D;  5JA4 B;  2Y2I A;  4NE5 A;  4Z66 B;  5B32 C;  4WU9 A;  5B2I B;  5F99 C;  4R8P B;  2NQB D;  3NQU A;  3O62 B;  4WU8 D;  2HIO B;  3W99 D;  3WAA B;  1M1A B;  1WWI A;  3TU4 A;  2RVQ C;  1BH8 B;  3AYW C;  3KUY C;  1BH9 A;  1ZLA D;  3REL C;  3LZ1 B;  1P3M A;  5AV6 D;  2F8N A;  4WV4 B;  4J8V D;  1P3B A;  1KU5 A;  5AV8 C;  4YS3 D;  5E5A A;  4KUD C;  4LD9 B;  1AOI B;  5AVB C;  3MGQ A;  3LZ0 C;  3MGP A;  4J8U C;  2Y2O A;  5AV8 B;  4NE6 A;  3WTP D;  3MGS C;  3AV1 C;  1EQZ C;  3UT9 C;  3B0C W;  5CP6 A;  1U35 A;  3B0C T;  1KX4 C;  3AV1 B;  5B1M A;  3WTP E;  2G5H C;  3X1V B;  4CSR B;  3REJ D;  5FUG A;  4WU9 C;  3AZM A;  3W98 A;  4QLC A;  3REI B;  3W97 A;  5B33 C;  4J8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...