1KX3A

X-ray structure of the nucleosome core particle, ncp146, at 2.0 a resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
98
structure length
98
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'(ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCAT
publication title Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 33
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1kx3A00
3AZNB 4WU9D 1P3IA 5F99B 4JJNB 3NQUB 4Z5TB 3W96A 1M18B 4CAYB 3AV1D 3MGPD 1M19C 3REKC 5CPKB 2NQBA 3C1CA 3AV2C 1U35D 5AVCD 3LZ1B 3C1BD 4J8VB 3AZEC 2CV5D 1P3KA 1P3PA 3TU4A 3AZLA 3MGPC 3AV1C 3LZ0D 2FJ7B 1P34A 1ID3B 1U35C 1KX5C 1H3OA 3C1BC 2HIOB 2F8NG 3REIA 2AROB 4R8PD 4H9SA 1JFIA 3WKJD 3O62A 3W99A 3LZ0C 3WTPA 1F66B 3W98A 5B2IA 3AZMC 5B0ZD 1P3FD 5B31A 3B6FA 5AV5B 1N1JB 3AZNC 3LJAB 4WU8A 3X1SB 1KX3D 4JJNC 1P3OD 4Z5TC 4R8PC 1M18C 3KUYA 1S32B 3WKJC 5JRGD 4H9PA 3KWQA 5CPKC 4KUDD 3X1UB 3LZ1C 3AZJB 5B2JA 2HIOD 4J8WA 3B6GA 4LD9A 4ZBJB 5DNMD 4DRAA 4E44A 1KU5A 3MNNA 1ZLAA 4NE5A 4Z66B 1TAFA 5B1MB 2BYKB 1F66D 4KUDC 5B33D 5C3IC 5AV6D 4H9OA 1KX4B 3MVDB 5AY8D 2HIOC 2AROC 5CPJB 1TZYD 4X23B 4UUZB 3LELA 5AV8A 5B0YD 4CSRB 3MGRD 3AZGB 1AOIB 1F66C 1WWSA 3A6NA 2NZDD 5B33C 5AV6C 3WAAB 5AV5C 4J8XA 4QLCD 5AVBB 5AY8C 5DNNA 3X1SC 4WNNA 1TZYC 1S32C 1P3BA 1P3LB 5B40D 5B1MD 5B24A 1EQZD 3RELD 5AV9D 3MVDD 3AZJC 3X1TB 5B1LD 3REJA 1P3MA 5G49B 4Z66C 5B1MC 3AZGD 5B31G 4AWLB 5B32B 5BNVB 4ZUXB 3AZFB 3KXBA 4H9NB 5CP6D 1KX4C 5AVBD 3MVDC 5E5AD 4WV4B 5GT3B 4X23C 1B6WA 3VH5W 2YFWB 3UT9B 3AZGC 1P3GD 2IO5B 5CPIA 4WZSB 2CWEA 3UTBD 5GXQD 3AFAA 1F1EA 3WAAC 3AYWB 3REHA 5CP6C 5AVBC 5GSUA 3W97B 5BS7C 4KGCB 4H9RB 1P3LC 3X1VA 4ZUXD 3UTAD 4Z2MG 4WU9B 3AZKD 3AN2A 3X1TC 4YS3A 3AV1B 5BT1C 1U35B 4AWLC 1M19A 5B32C 4ZUXC 3UTAC 3VH6W 5AVCB 3REKA 3C1BB 3AZFC 3AYWD 3AV2A 1BH8A 2CV5B 3AZHA 4H9QA 4M6BA 3W97D 5GT3C 2RVQC 3UT9C 3LZ0B 4YM6D 3AZEA 2IO5C 3B0BA 2F8ND 5BNXA 3AYWC 5BO0A 4R8PB 2F8NH 1KX5A 3MGQB 3WKJB 3W97C 1M1AD 4KGCC 5B0ZB 1P3FB 4WU9C 4G92B 1KX3B 2YFVA 3R45A 3AZMA 1P3OB 2PYOD 4DRBA 4XZQD 3AZNA 5JRGB 1HQ3D 3WTPE 5F99A 4JJNA 3V9RB 4Z5TA 5JA4B 1M18A 3MGSD 4KUDB 4CAYA 2HUEB 5C3IB 1P3KB 5AVCC 5CPKA 5DNMB 2CV5C 3AZID 1Q9CA 1P34B 3LZ1A 1HQ3C 3MGQD 4J8VA 1P3ID 2F8NK 5B33B 5AV6B 1P3AA 2FJ7A 5AY8B 3NQJB 3W99B 1ID3A 5KDMB 1TZYB 3C1CD 3MGQC 3B6FB 5B0YB 3MGRB 4WU8B 2AROA 2NZDB 5B0ZC 1P3FC 1P3KD 3KUYB 1P3PD 3AZLD 4QLCB 4G92C 1KX3C 1P3OC 5AV5A 1N1JA 1P34D 3LJAA 5JRGC 3X1SA 2BYMB 5B40B 4LD9B 1BFMA 3REID 1S32A 2HUEC 3MNNB 2LY8A 1P3KC 3RELB 1EQZB 5AV9B 3W99D 3O62D 5B1LB 5DNMC 3X1UA 3WTPD 1P34C 3W98D 4NE6A 5B2ID 5B31D 3AZJA 3B6FD 4WU8D 4Z66A 3KUYD 5B1MA 5CP6B 2BYKA 3W99C 5E5AB 3KWQD 5B2IC 1KX4A 3B6FC 5B0YC 3MGRC 1P3GB 4WU8C 5B2JD 5CPJA 4J8WD 3UTBB 3B6GD 4LD9D 5GXQB 4X23A 4UUZA 2NZDC 1ZLAD 4KHAB 3MNND 4CSRA 3KUYC 1AOIA 4QLCC 3KWQC 5B24B 3WAAA 4J8UA 5AVBA 5B40C 3VH5T 4LD9C 3UTAB 1ZLAC 1BH9B 3MNNC 1EQZC 3RELC 3AZKB 1P3LA 5AV9C 4Z2MH 3LELD 5AV8D 5GT0A 5B1LC 3A6ND 4NE3A 3X1TA 4J8XD 5DNND 4NFTA 5G49A 1P3BD 5E5AC 5B32A 4ZUXA 3AZFA 5B24D 4XUJB 4YM6B 1P3GC 3UTBC 5GT3A 5GXQC 3UT9A 2F8NB 2YFWA 1P3MD 3VH5A 3VH6T 5FUGB 5B24C 1M1AB 3KXBD 4KGCA 4H9RA 3AZKC 2PYOB 4XZQB 5CPID 3KSYA 1HQ3B 4WU9A 4XUJD 3AFAD 4G91B 1R4VA 3KXBC 3MGSB 3REHD 3AV1A 3MGPA 2L5AA 5GSUD 1U35A 3WA9B 3AZIB 5AVCA 3C1BA 3X1VD 4XUJC 4YM6C 2CV5A 1P3IB 3AN2D 4YS3D 3W96B 3LZ0A 5GSUC 2NQBB 3C1CB 1M19D 1M1AC 3NQUA 4R8PA 3R45B 3AV2D 3WKJA 3AZHD 1P3PB 3TU4B 3AZLB 1HTAA 5B32G 2PYOC 5B0ZA 3AZED 1P3FA 3WA9D 4XZQC 1KX3A 4G91C 1P3OA 1H3OB 3MGSC 3REIB 5JRGA 3AZHC 3W96D 1JFIB 1KX5D 3V9RA 4EO5B 5JA4A 3O62B 4KUDA 3WTPB 3AZIC 2NQBD 3W98B 3WA9C 5B2IB 5B31B 2HIOA 1P3AB 5DNMA 1P3IC 3AZMD 3W96C 3AZND 3TU4D 4E45A 5F99D 4JJND 4H9PB 1F66A 5B33A 4Z5TD 5AV6A 3KWQB 1M18D 2NQBC 3C1CC 5AY8A 1B67A 3NQJA 5KDMA 5B2JB 4J8WB 5CPKD 3B6GB 1TZYA 1ZLAB 5B0YA 1P3PC 3MGRA 3TU4C 3AZLC 3LZ1D 5F99C 2NZDA 4J8VD 1TAFB 1WWIA 4QLCA 4H9OB 1P3AD 2FJ7D 1ID3D 2JSSA 3REIC 4H9SC 2BYMA 5B40A 3LELB 5AV8B 4EO5C 3O62C 1ULYA 4J8VC 2AROD 1EQZA 3WTPC 5CHLB 3A6NB 3RELA 3W98C 5AV9A 5B31C 3MVDA 4J8XB 1P3AC 5B1LA 2FJ7C 5DNNB 1ID3C 3B0DB 4WNNB 5AV5D 3LJAD 3AZGA 1P3BB 3X1SD 1S32D 5CP6A 5E5AA 5B2JC 4J8WC 3B6GC 5BS7A 3B0CT 3X1UD 4J8UB 3REJB 1P3MB 3LJAC 1P3GA 3AZJD 3UTBA 5GXQA 4KHAA 4HGAB 3KXBB 4Z66D 3B0CW 5GT0B 3X1UC 1KX4D 3LELC 5AV8C 4ZBJC 5BNVA 3UTAA 5CPIB 1BH9A 5CPJD 4H9NA 3A6NC 4X23D 3AFAB 3AZKA 4J8XC 3REHB 1AOID 5DNNC 3B0DC 5GSUB 3WAAD 4J8UD 3REJD 1P3BC 5CPJC 3X1VB 3AYWA 1AOIC 1P3LD 3AN2B 5GT0D 4YS3B 3W97A 4XUJA 4YM6A 4J8UC 3REJC 1P3MC 3X1TD 2F8NA 4HGAC 1M19B 3REKB 5BT1D 3AV2B 5FUGA 1BH8B 5GT0C 3AZHB 5B32D 1M1AA 4H9QB 3AZFD 3AN2C 3AZEB 5CPIC 3MGPB 5GT3D 2RVQD 3AFAC 3UT9D 3VH6A 2PYOA 5BNXB 3REHC 4XZQA 1A7WA 5BO0B 1HQ3A 1KX5B 3MGSA 3X1VC 4KGCD 3REKD 3WA9A 3AZIA 2YFVB 3AZMB 3MGQA 4YS3C
chains in the Genus database with same CATH superfamily
3AZNB 4WU9D 1P3IA 5F99B 4JJNB 3NQUB 4Z5TB 3W96A 1M18B 4CAYB 3AV1D 3MGPD 1M19C 3REKC 5CPKB 2NQBA 3C1CA 3AV2C 1U35D 5AVCD 3LZ1B 3C1BD 4J8VB 3AZEC 2CV5D 1P3KA 1P3PA 3TU4A 3AZLA 3MGPC 3AV1C 3LZ0D 2FJ7B 1P34A 1ID3B 1U35C 1KX5C 1H3OA 3C1BC 2HIOB 2F8NG 3REIA 2AROB 4R8PD 4H9SA 1JFIA 3WKJD 3O62A 3W99A 3LZ0C 3WTPA 1F66B 3AL0C 3W98A 5B2IA 3AZMC 5B0ZD 1P3FD 5B31A 3B6FA 5AV5B 1N1JB 3AZNC 3LJAB 4WU8A 3X1SB 3EPHA 1KX3D 4JJNC 1P3OD 4Z5TC 4R8PC 1M18C 3KUYA 1S32B 3WKJC 5JRGD 4H9PA 2Y2JA 3KWQA 5CPKC 4KUDD 3X1UB 2UWXA 3LZ1C 3AZJB 5B2JA 2HIOD 4J8WA 3B6GA 4LD9A 4ZBJB 5DNMD 4DRAA 4E44A 1KU5A 3MNNA 1ZLAA 3H0MC 4NE5A 4Z66B 1TAFA 2ZY4A 2BYKB 5B1MB 1F66D 4KUDC 5B33D 5C3IC 5AV6D 4H9OA 1KX4B 3MVDB 5AY8D 2HIOC 2AROC 5CPJB 1TZYD 3A1KA 4X23B 4UUZB 3LELA 5AV8A 5B0YD 4CSRB 3MGRD 3AZGB 1AOIB 1F66C 1WWSA 3A6NA 2NZDD 5B33C 5AV6C 4DQYB 5AV5C 4J8XA 2G5HC 3WAAB 4QLCD 5AVBB 5AY8C 5DNNA 3X1SC 4WNNA 1TZYC 1S32C 1P3BA 1P3LB 5B40D 5B1MD 5B24A 1EQZD 3RELD 5AV9D 3MVDD 3AZJC 3X1TB 5B1LD 2XD1A 3REJA 1P3MA 5G49B 2DQNC 4Z66C 5B1MC 3AZGD 5B31G 4AWLB 5B32B 5BNVB 4ZUXB 3AZFB 3KXBA 4H9NB 5CP6D 1KX4C 5AVBD 3MVDC 5E5AD 2ZY3A 4WV4B 5GT3B 4X23C 1B6WA 3VH5W 2YFWB 3UT9B 2ZY5A 3AZGC 1P3GD 2IO5B 5CPIA 4WZSB 2CWEA 3UTBD 5GXQD 3AFAA 1F1EA 3WAAC 3AYWB 3REHA 5CP6C 5AVBC 5GSUA 3W97B 5BS7C 3P5JB 4KGCB 4H9RB 1P3LC 3X1VA 4ZUXD 3UTAD 4Z2MG 4WU9B 3AZKD 3AN2A 2Y2LA 3X1TC 4YS3A 3AV1B 2J8PA 5BT1C 1U35B 4AWLC 1M19A 5B32C 4ZUXC 3UTAC 3VH6W 5AVCB 3REKA 3C1BB 3AZFC 3AYWD 3AV2A 2BG1A 1BH8A 2CV5B 3AZHA 4H9QA 4M6BA 3W97D 5GT3C 2RVQC 3EPJA 3LZ0B 3UT9C 4YM6D 3AZEA 3FDDA 2IO5C 3B0BA 2F8ND 5BNXA 3AYWC 5BO0A 4R8PB 2F8NH 1KX5A 3MGQB 3WKJB 2JE5A 3W97C 1M1AD 4KGCC 5B0ZB 1P3FB 2Y2MA 2RIQA 4WU9C 4G92B 1KX3B 2YFVA 3R45A 3AZMA 1P3OB 2PYOD 4DRBA 2Y2GA 4XZQD 3AZNA 5JRGB 1HQ3D 3WTPE 5F99A 4JJNA 3V9RB 4Z5TA 2ZY2A 5JA4B 1M18A 3MGSD 4KUDB 4CAYA 2HUEB 5C3IB 1P3KB 5AVCC 5CPKA 5DNMB 2CV5C 2Y2HA 1Q9CA 3AZID 1P34B 2Y2QA 3LZ1A 1HQ3C 3MGQD 4J8VA 1P3ID 2F8NK 3IP4C 5B33B 5AV6B 1P3AA 2FJ7A 5AY8B 3NQJB 3W99B 1ID3A 5KDMB 1TZYB 3C1CD 3MGQC 3B6FB 5B0YB 3MGRB 4WU8B 2AROA 2NZDB 5B0ZC 1P3FC 1P3KD 3KUYB 1P3PD 3AZLD 4QLCB 1PZRA 4G92C 1KX3C 1W2EA 1P3OC 5AV5A 1N1JA 1P34D 3LJAA 5JRGC 3X1SA 2BYMB 5B40B 4LD9B 1BFMA 3REID 1S32A 2HUEC 3MNNB 2LY8A 1P3KC 3RELB 1EQZB 5AV9B 3W99D 3O62D 5B1LB 5DNMC 3X1UA 3WTPD 1P34C 3W98D 4NE6A 5B2ID 5B31D 3AZJA 3B6FD 4WU8D 4Z66A 3KUYD 5B1MA 5CP6B 2BYKA 3W99C 5E5AB 3KWQD 2XD5A 5B2IC 1KX4A 3B6FC 5B0YC 3MGRC 1P3GB 4WU8C 5B2JD 5CPJA 4J8WD 3UTBB 3B6GD 4LD9D 5GXQB 4X23A 4UUZA 2NZDC 1ZLAD 4KHAB 3MNND 4CSRA 3KUYC 1AOIA 4QLCC 3KFUG 3KWQC 5B24B 3WAAA 4J8UA 5AVBA 5B40C 3VH5T 4LD9C 3UTAB 1ZLAC 1BH9B 3MNNC 1EQZC 3RELC 3AZKB 2JCHA 1P3LA 5AV9C 4Z2MH 3LELD 5AV8D 5GT0A 5B1LC 3A6ND 2Y2IA 4NE3A 3X1TA 4J8XD 5DNND 4NFTA 5G49A 1P3BD 5E5AC 5B32A 4ZUXA 3AZFA 5B24D 4XUJB 4YM6B 2F2AC 1P3GC 1T3UA 3UTBC 5GT3A 5GXQC 3UT9A 2F8NB 2YFWA 1P3MD 3VH5A 3VH6T 3A1IA 5FUGB 5B24C 1M1AB 2Y2OA 3KXBD 4KGCA 4H9RA 3AZKC 2PYOB 3EPKA 4XZQB 5CPID 3KSYA 1HQ3B 2DF4C 4WU9A 4XUJD 3AFAD 4WJ3C 4G91B 1R4VA 3KXBC 3MGSB 3REHD 3AV1A 3MGPA 2L5AA 5GSUD 1U35A 3WA9B 3AZIB 5AVCA 3C1BA 3X1VD 4XUJC 4YM6C 2CV5A 1P3IB 3AN2D 4YS3D 3W96B 3LZ0A 5GSUC 2NQBB 3C1CB 1M19D 1M1AC 2VQRA 3NQUA 4R8PA 3R45B 3AV2D 3WKJA 3AZHD 1P3PB 3TU4B 3AZLB 1HTAA 5B32G 2PYOC 5B0ZA 3AZED 1P3FA 3H0RC 3WA9D 4XZQC 2G5IC 1KX3A 4G91C 1P3OA 1H3OB 3MGSC 3REIB 5JRGA 3AZHC 3W96D 1JFIB 1KX5D 3V9RA 4EO5B 5JA4A 3O62B 4KUDA 3WTPB 3AZIC 2NQBD 3W98B 3WA9C 5B2IB 5B31B 2HIOA 1P3AB 5DNMA 1P3IC 3AZMD 3W96C 3AZND 3TU4D 4E45A 5F99D 4JJND 4H9PB 1F66A 5B33A 4Z5TD 5AV6A 3KWQB 1M18D 2NQBC 3C1CC 5AY8A 1B67A 3NQJA 5KDMA 5B2JB 4J8WB 5CPKD 3B6GB 1TZYA 1ZLAB 5B0YA 1P3PC 3MGRA 3TU4C 2FFFB 3LZ1D 3AZLC 5F99C 2NZDA 4J8VD 1TAFB 1WWIA 4QLCA 4H9OB 1P3AD 2FJ7D 1ID3D 2JSSA 3REIC 4H9SC 2BYMA 5B40A 3LELB 5AV8B 4EO5C 3O62C 1ULYA 4J8VC 2AROD 1EQZA 3EG5B 5CHLB 3WTPC 3A6NB 3RELA 3W98C 5AV9A 5B31C 3MVDA 4J8XB 2Y2KA 1P3AC 5B1LA 2FJ7C 5DNNB 1ID3C 3B0DB 4WNNB 5AV5D 3LJAD 3AZGA 1P3BB 3X1SD 3F6TA 1S32D 5CP6A 5E5AA 5B2JC 4J8WC 3B6GC 5BS7A 3B0CT 1Z2CB 3X1UD 4J8UB 3REJB 1P3MB 3LJAC 1P3GA 2W8SA 3AZJD 3UTBA 5GXQA 4KHAA 4HGAB 3KXBB 4Z66D 3B0CW 5GT0B 3X1UC 4UPKA 1KX4D 3LELC 5AV8C 4ZBJC 5BNVA 3UTAA 5CPIB 1BH9A 5CPJD 4H9NA 3A6NC 4X23D 3AFAB 3AZKA 4J8XC 3REHB 1AOID 5DNNC 3B0DC 5GSUB 3WAAD 4J8UD 3REJD 1P3BC 5CPJC 3X1VB 3AYWA 1AOIC 1P3LD 3AN2B 5GT0D 4YS3B 3W97A 4XUJA 4YM6A 4J8UC 3REJC 1P3MC 3X1TD 2F8NA 4HGAC 1M19B 3EPLA 3REKB 5BT1D 3AV2B 5FUGA 1BH8B 5GT0C 3AZHB 5B32D 1M1AA 4H9QB 3AZFD 3AN2C 3AZEB 5CPIC 3MGPB 5GT3D 2RVQD 3AFAC 3UT9D 3VH6A 2PYOA 5BNXB 3REHC 4XZQA 1A7WA 5BO0B 3H0LC 1HQ3A 2Y2NA 2ZM5A 1KX5B 2Y2PA 3MGSA 3X1VC 4KGCD 3REKD 3WA9A 3AZIA 2YFVB 3AZMB 3MGQA 4YS3C
chains in the Genus database with same CATH topology
3AZNB 4WU9D 1P3IA 5F99B 4JJNB 3NQUB 4Z5TB 3W96A 1M18B 4CAYB 3AV1D 3MGPD 1M19C 3REKC 5CPKB 2NQBA 3C1CA 3AV2C 1U35D 5AVCD 3LZ1B 3C1BD 4J8VB 3AZEC 2CV5D 1P3KA 1P3PA 3TU4A 3AZLA 3MGPC 3AV1C 3LZ0D 2FJ7B 1P34A 1ID3B 1U35C 1KX5C 1H3OA 3C1BC 2HIOB 2F8NG 3REIA 2AROB 4R8PD 4H9SA 1JFIA 3WKJD 3O62A 3W99A 3LZ0C 3WTPA 1F66B 3AL0C 3W98A 5B2IA 3AZMC 5B0ZD 1P3FD 5B31A 3B6FA 5AV5B 1N1JB 3AZNC 3LJAB 4WU8A 3X1SB 3EPHA 1KX3D 4JJNC 1P3OD 4Z5TC 4R8PC 1M18C 3KUYA 1S32B 3WKJC 5JRGD 4H9PA 2Y2JA 3KWQA 5CPKC 4KUDD 3X1UB 2UWXA 3LZ1C 3AZJB 5B2JA 2HIOD 4J8WA 3B6GA 4LD9A 4ZBJB 5DNMD 4DRAA 4E44A 1KU5A 3MNNA 1ZLAA 3H0MC 4NE5A 4Z66B 1TAFA 2ZY4A 2BYKB 5B1MB 1F66D 4KUDC 5B33D 5C3IC 5AV6D 4H9OA 1KX4B 3MVDB 5AY8D 2HIOC 2AROC 5CPJB 1TZYD 3A1KA 4X23B 4UUZB 3LELA 5AV8A 5B0YD 4CSRB 3MGRD 3AZGB 1AOIB 1F66C 1WWSA 3A6NA 2NZDD 5B33C 5AV6C 4DQYB 5AV5C 4J8XA 2G5HC 3WAAB 4QLCD 5AVBB 5AY8C 5DNNA 3X1SC 4WNNA 1TZYC 1S32C 1P3BA 1P3LB 5B40D 5B1MD 5B24A 1EQZD 3RELD 5AV9D 3MVDD 3AZJC 3X1TB 5B1LD 2XD1A 3REJA 1P3MA 5G49B 2DQNC 4Z66C 5B1MC 3AZGD 5B31G 4AWLB 5B32B 5BNVB 4ZUXB 3AZFB 3KXBA 4H9NB 5CP6D 1KX4C 5AVBD 3MVDC 5E5AD 2ZY3A 4WV4B 5GT3B 4X23C 1B6WA 3VH5W 2YFWB 3UT9B 2ZY5A 3AZGC 1P3GD 2IO5B 5CPIA 4WZSB 2CWEA 3UTBD 5GXQD 3AFAA 1F1EA 3WAAC 3AYWB 3REHA 5CP6C 5AVBC 5GSUA 3W97B 5BS7C 3P5JB 4KGCB 4H9RB 1P3LC 3X1VA 4ZUXD 3UTAD 4Z2MG 4WU9B 3AZKD 3AN2A 2Y2LA 3X1TC 4YS3A 3AV1B 2J8PA 5BT1C 1U35B 4AWLC 1M19A 5B32C 4ZUXC 3UTAC 3VH6W 5AVCB 3REKA 3C1BB 3AZFC 3AYWD 3AV2A 2BG1A 1BH8A 2CV5B 3AZHA 4H9QA 4M6BA 3W97D 5GT3C 2RVQC 3EPJA 3LZ0B 3UT9C 4YM6D 3AZEA 3FDDA 2IO5C 3B0BA 2F8ND 5BNXA 3AYWC 5BO0A 4R8PB 2F8NH 1KX5A 3MGQB 3WKJB 2JE5A 3W97C 1M1AD 4KGCC 5B0ZB 1P3FB 2Y2MA 2RIQA 4WU9C 4G92B 1KX3B 2YFVA 3R45A 3AZMA 1P3OB 2PYOD 4DRBA 2Y2GA 4XZQD 3AZNA 5JRGB 1HQ3D 3WTPE 5F99A 4JJNA 3V9RB 4Z5TA 2ZY2A 5JA4B 1M18A 3MGSD 4KUDB 4CAYA 2HUEB 5C3IB 1P3KB 5AVCC 5CPKA 5DNMB 2CV5C 2Y2HA 1Q9CA 3AZID 1P34B 2Y2QA 3LZ1A 1HQ3C 3MGQD 4J8VA 1P3ID 2F8NK 3IP4C 5B33B 5AV6B 1P3AA 2FJ7A 5AY8B 3NQJB 3W99B 1ID3A 5KDMB 1TZYB 3C1CD 3MGQC 3B6FB 5B0YB 3MGRB 4WU8B 2AROA 2NZDB 5B0ZC 1P3FC 1P3KD 3KUYB 1P3PD 3AZLD 4QLCB 1PZRA 4G92C 1KX3C 1W2EA 1P3OC 5AV5A 1N1JA 1P34D 3LJAA 5JRGC 3X1SA 2BYMB 5B40B 4LD9B 1BFMA 3REID 1S32A 2HUEC 3MNNB 2LY8A 1P3KC 3RELB 1EQZB 5AV9B 3W99D 3O62D 5B1LB 5DNMC 3X1UA 3WTPD 1P34C 3W98D 4NE6A 5B2ID 5B31D 3AZJA 3B6FD 4WU8D 4Z66A 3KUYD 5B1MA 5CP6B 2BYKA 3W99C 5E5AB 3KWQD 2XD5A 5B2IC 1KX4A 3B6FC 5B0YC 3MGRC 1P3GB 4WU8C 5B2JD 5CPJA 4J8WD 3UTBB 3B6GD 4LD9D 5GXQB 4X23A 4UUZA 2NZDC 1ZLAD 4KHAB 3MNND 4CSRA 3KUYC 1AOIA 4QLCC 3KFUG 3KWQC 5B24B 3WAAA 4J8UA 5AVBA 5B40C 3VH5T 4LD9C 3UTAB 1ZLAC 1BH9B 3MNNC 1EQZC 3RELC 3AZKB 2JCHA 1P3LA 5AV9C 4Z2MH 3LELD 5AV8D 5GT0A 5B1LC 3A6ND 2Y2IA 4NE3A 3X1TA 4J8XD 5DNND 4NFTA 5G49A 1P3BD 5E5AC 5B32A 4ZUXA 3AZFA 5B24D 4XUJB 4YM6B 2F2AC 1P3GC 1T3UA 3UTBC 5GT3A 5GXQC 3UT9A 2F8NB 2YFWA 1P3MD 3VH5A 3VH6T 3A1IA 5FUGB 5B24C 1M1AB 2Y2OA 3KXBD 4KGCA 4H9RA 3AZKC 2PYOB 3EPKA 4XZQB 5CPID 3KSYA 1HQ3B 2DF4C 4WU9A 4XUJD 3AFAD 4WJ3C 4G91B 1R4VA 3KXBC 3MGSB 3REHD 3AV1A 3MGPA 2L5AA 5GSUD 1U35A 3WA9B 3AZIB 5AVCA 3C1BA 3X1VD 4XUJC 4YM6C 2CV5A 1P3IB 3AN2D 4YS3D 3W96B 3LZ0A 5GSUC 2NQBB 3C1CB 1M19D 1M1AC 2VQRA 3NQUA 4R8PA 3R45B 3AV2D 3WKJA 3AZHD 1P3PB 3TU4B 3AZLB 1HTAA 5B32G 2PYOC 5B0ZA 3AZED 1P3FA 3H0RC 3WA9D 4XZQC 2G5IC 1KX3A 4G91C 1P3OA 1H3OB 3MGSC 3REIB 5JRGA 3AZHC 3W96D 1JFIB 1KX5D 3V9RA 4EO5B 5JA4A 3O62B 4KUDA 3WTPB 3AZIC 2NQBD 3W98B 3WA9C 5B2IB 5B31B 2HIOA 1P3AB 5DNMA 1P3IC 3AZMD 3W96C 3AZND 3TU4D 4E45A 5F99D 4JJND 4H9PB 1F66A 5B33A 4Z5TD 5AV6A 3KWQB 1M18D 2NQBC 3C1CC 5AY8A 1B67A 3NQJA 5KDMA 5B2JB 4J8WB 5CPKD 3B6GB 1TZYA 1ZLAB 5B0YA 1P3PC 3MGRA 3TU4C 2FFFB 3LZ1D 3AZLC 5F99C 2NZDA 4J8VD 1TAFB 1WWIA 4QLCA 4H9OB 1P3AD 2FJ7D 1ID3D 2JSSA 3REIC 4H9SC 2BYMA 5B40A 3LELB 5AV8B 4EO5C 3O62C 1ULYA 4J8VC 2AROD 1EQZA 3EG5B 5CHLB 3WTPC 3A6NB 3RELA 3W98C 5AV9A 5B31C 3MVDA 4J8XB 2Y2KA 1P3AC 5B1LA 2FJ7C 5DNNB 1ID3C 3B0DB 4WNNB 5AV5D 3LJAD 3AZGA 1P3BB 3X1SD 3F6TA 1S32D 5CP6A 5E5AA 5B2JC 4J8WC 3B6GC 5BS7A 3B0CT 1Z2CB 3X1UD 4J8UB 3REJB 1P3MB 3LJAC 1P3GA 2W8SA 3AZJD 3UTBA 5GXQA 4KHAA 4HGAB 3KXBB 4Z66D 3B0CW 5GT0B 3X1UC 4UPKA 1KX4D 3LELC 5AV8C 4ZBJC 5BNVA 3UTAA 5CPIB 1BH9A 5CPJD 4H9NA 3A6NC 4X23D 3AFAB 3AZKA 4J8XC 3REHB 1AOID 5DNNC 3B0DC 5GSUB 3WAAD 4J8UD 3REJD 1P3BC 5CPJC 3X1VB 3AYWA 1AOIC 1P3LD 3AN2B 5GT0D 4YS3B 3W97A 4XUJA 4YM6A 4J8UC 3REJC 1P3MC 3X1TD 2F8NA 4HGAC 1M19B 3EPLA 3REKB 5BT1D 3AV2B 5FUGA 1BH8B 5GT0C 3AZHB 5B32D 1M1AA 4H9QB 3AZFD 3AN2C 3AZEB 5CPIC 3MGPB 5GT3D 2RVQD 3AFAC 3UT9D 3VH6A 2PYOA 5BNXB 3REHC 4XZQA 1A7WA 5BO0B 3H0LC 1HQ3A 2Y2NA 2ZM5A 1KX5B 2Y2PA 3MGSA 3X1VC 4KGCD 3REKD 3WA9A 3AZIA 2YFVB 3AZMB 3MGQA 4YS3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZN B;  4WU9 D;  1P3I A;  5F99 B;  4JJN B;  3NQU B;  4Z5T B;  3W96 A;  1M18 B;  4CAY B;  3AV1 D;  3MGP D;  1M19 C;  3REK C;  5CPK B;  2NQB A;  3C1C A;  3AV2 C;  1U35 D;  5AVC D;  3LZ1 B;  3C1B D;  4J8V B;  3AZE C;  2CV5 D;  1P3K A;  1P3P A;  3TU4 A;  3AZL A;  3MGP C;  3AV1 C;  3LZ0 D;  2FJ7 B;  1P34 A;  1ID3 B;  1U35 C;  1KX5 C;  1H3O A;  3C1B C;  2HIO B;  2F8N G;  3REI A;  2ARO B;  4R8P D;  4H9S A;  1JFI A;  3WKJ D;  3O62 A;  3W99 A;  3LZ0 C;  3WTP A;  1F66 B;  3W98 A;  5B2I A;  3AZM C;  5B0Z D;  1P3F D;  5B31 A;  3B6F A;  5AV5 B;  1N1J B;  3AZN C;  3LJA B;  4WU8 A;  3X1S B;  1KX3 D;  4JJN C;  1P3O D;  4Z5T C;  4R8P C;  1M18 C;  3KUY A;  1S32 B;  3WKJ C;  5JRG D;  4H9P A;  3KWQ A;  5CPK C;  4KUD D;  3X1U B;  3LZ1 C;  3AZJ B;  5B2J A;  2HIO D;  4J8W A;  3B6G A;  4LD9 A;  4ZBJ B;  5DNM D;  4DRA A;  4E44 A;  1KU5 A;  3MNN A;  1ZLA A;  4NE5 A;  4Z66 B;  1TAF A;  5B1M B;  2BYK B;  1F66 D;  4KUD C;  5B33 D;  5C3I C;  5AV6 D;  4H9O A;  1KX4 B;  3MVD B;  5AY8 D;  2HIO C;  2ARO C;  5CPJ B;  1TZY D;  4X23 B;  4UUZ B;  3LEL A;  5AV8 A;  5B0Y D;  4CSR B;  3MGR D;  3AZG B;  1AOI B;  1F66 C;  1WWS A;  3A6N A;  2NZD D;  5B33 C;  5AV6 C;  3WAA B;  5AV5 C;  4J8X A;  4QLC D;  5AVB B;  5AY8 C;  5DNN A;  3X1S C;  4WNN A;  1TZY C;  1S32 C;  1P3B A;  1P3L B;  5B40 D;  5B1M D;  5B24 A;  1EQZ D;  3REL D;  5AV9 D;  3MVD D;  3AZJ C;  3X1T B;  5B1L D;  3REJ A;  1P3M A;  5G49 B;  4Z66 C;  5B1M C;  3AZG D;  5B31 G;  4AWL B;  5B32 B;  5BNV B;  4ZUX B;  3AZF B;  3KXB A;  4H9N B;  5CP6 D;  1KX4 C;  5AVB D;  3MVD C;  5E5A D;  4WV4 B;  5GT3 B;  4X23 C;  1B6W A;  3VH5 W;  2YFW B;  3UT9 B;  3AZG C;  1P3G D;  2IO5 B;  5CPI A;  4WZS B;  2CWE A;  3UTB D;  5GXQ D;  3AFA A;  1F1E A;  3WAA C;  3AYW B;  3REH A;  5CP6 C;  5AVB C;  5GSU A;  3W97 B;  5BS7 C;  4KGC B;  4H9R B;  1P3L C;  3X1V A;  4ZUX D;  3UTA D;  4Z2M G;  4WU9 B;  3AZK D;  3AN2 A;  3X1T C;  4YS3 A;  3AV1 B;  5BT1 C;  1U35 B;  4AWL C;  1M19 A;  5B32 C;  4ZUX C;  3UTA C;  3VH6 W;  5AVC B;  3REK A;  3C1B B;  3AZF C;  3AYW D;  3AV2 A;  1BH8 A;  2CV5 B;  3AZH A;  4H9Q A;  4M6B A;  3W97 D;  5GT3 C;  2RVQ C;  3UT9 C;  3LZ0 B;  4YM6 D;  3AZE A;  2IO5 C;  3B0B A;  2F8N D;  5BNX A;  3AYW C;  5BO0 A;  4R8P B;  2F8N H;  1KX5 A;  3MGQ B;  3WKJ B;  3W97 C;  1M1A D;  4KGC C;  5B0Z B;  1P3F B;  4WU9 C;  4G92 B;  1KX3 B;  2YFV A;  3R45 A;  3AZM A;  1P3O B;  2PYO D;  4DRB A;  4XZQ D;  3AZN A;  5JRG B;  1HQ3 D;  3WTP E;  5F99 A;  4JJN A;  3V9R B;  4Z5T A;  5JA4 B;  1M18 A;  3MGS D;  4KUD B;  4CAY A;  2HUE B;  5C3I B;  1P3K B;  5AVC C;  5CPK A;  5DNM B;  2CV5 C;  3AZI D;  1Q9C A;  1P34 B;  3LZ1 A;  1HQ3 C;  3MGQ D;  4J8V A;  1P3I D;  2F8N K;  5B33 B;  5AV6 B;  1P3A A;  2FJ7 A;  5AY8 B;  3NQJ B;  3W99 B;  1ID3 A;  5KDM B;  1TZY B;  3C1C D;  3MGQ C;  3B6F B;  5B0Y B;  3MGR B;  4WU8 B;  2ARO A;  2NZD B;  5B0Z C;  1P3F C;  1P3K D;  3KUY B;  1P3P D;  3AZL D;  4QLC B;  4G92 C;  1KX3 C;  1P3O C;  5AV5 A;  1N1J A;  1P34 D;  3LJA A;  5JRG C;  3X1S A;  2BYM B;  5B40 B;  4LD9 B;  1BFM A;  3REI D;  1S32 A;  2HUE C;  3MNN B;  2LY8 A;  1P3K C;  3REL B;  1EQZ B;  5AV9 B;  3W99 D;  3O62 D;  5B1L B;  5DNM C;  3X1U A;  3WTP D;  1P34 C;  3W98 D;  4NE6 A;  5B2I D;  5B31 D;  3AZJ A;  3B6F D;  4WU8 D;  4Z66 A;  3KUY D;  5B1M A;  5CP6 B;  2BYK A;  3W99 C;  5E5A B;  3KWQ D;  5B2I C;  1KX4 A;  3B6F C;  5B0Y C;  3MGR C;  1P3G B;  4WU8 C;  5B2J D;  5CPJ A;  4J8W D;  3UTB B;  3B6G D;  4LD9 D;  5GXQ B;  4X23 A;  4UUZ A;  2NZD C;  1ZLA D;  4KHA B;  3MNN D;  4CSR A;  3KUY C;  1AOI A;  4QLC C;  3KWQ C;  5B24 B;  3WAA A;  4J8U A;  5AVB A;  5B40 C;  3VH5 T;  4LD9 C;  3UTA B;  1ZLA C;  1BH9 B;  3MNN C;  1EQZ C;  3REL C;  3AZK B;  1P3L A;  5AV9 C;  4Z2M H;  3LEL D;  5AV8 D;  5GT0 A;  5B1L C;  3A6N D;  4NE3 A;  3X1T A;  4J8X D;  5DNN D;  4NFT A;  5G49 A;  1P3B D;  5E5A C;  5B32 A;  4ZUX A;  3AZF A;  5B24 D;  4XUJ B;  4YM6 B;  1P3G C;  3UTB C;  5GT3 A;  5GXQ C;  3UT9 A;  2F8N B;  2YFW A;  1P3M D;  3VH5 A;  3VH6 T;  5FUG B;  5B24 C;  1M1A B;  3KXB D;  4KGC A;  4H9R A;  3AZK C;  2PYO B;  4XZQ B;  5CPI D;  3KSY A;  1HQ3 B;  4WU9 A;  4XUJ D;  3AFA D;  4G91 B;  1R4V A;  3KXB C;  3MGS B;  3REH D;  3AV1 A;  3MGP A;  2L5A A;  5GSU D;  1U35 A;  3WA9 B;  3AZI B;  5AVC A;  3C1B A;  3X1V D;  4XUJ C;  4YM6 C;  2CV5 A;  1P3I B;  3AN2 D;  4YS3 D;  3W96 B;  3LZ0 A;  5GSU C;  2NQB B;  3C1C B;  1M19 D;  1M1A C;  3NQU A;  4R8P A;  3R45 B;  3AV2 D;  3WKJ A;  3AZH D;  1P3P B;  3TU4 B;  3AZL B;  1HTA A;  5B32 G;  2PYO C;  5B0Z A;  3AZE D;  1P3F A;  3WA9 D;  4XZQ C;  1KX3 A;  4G91 C;  1P3O A;  1H3O B;  3MGS C;  3REI B;  5JRG A;  3AZH C;  3W96 D;  1JFI B;  1KX5 D;  3V9R A;  4EO5 B;  5JA4 A;  3O62 B;  4KUD A;  3WTP B;  3AZI C;  2NQB D;  3W98 B;  3WA9 C;  5B2I B;  5B31 B;  2HIO A;  1P3A B;  5DNM A;  1P3I C;  3AZM D;  3W96 C;  3AZN D;  3TU4 D;  4E45 A;  5F99 D;  4JJN D;  4H9P B;  1F66 A;  5B33 A;  4Z5T D;  5AV6 A;  3KWQ B;  1M18 D;  2NQB C;  3C1C C;  5AY8 A;  1B67 A;  3NQJ A;  5KDM A;  5B2J B;  4J8W B;  5CPK D;  3B6G B;  1TZY A;  1ZLA B;  5B0Y A;  1P3P C;  3MGR A;  3TU4 C;  3AZL C;  3LZ1 D;  5F99 C;  2NZD A;  4J8V D;  1TAF B;  1WWI A;  4QLC A;  4H9O B;  1P3A D;  2FJ7 D;  1ID3 D;  2JSS A;  3REI C;  4H9S C;  2BYM A;  5B40 A;  3LEL B;  5AV8 B;  4EO5 C;  3O62 C;  1ULY A;  4J8V C;  2ARO D;  1EQZ A;  3WTP C;  5CHL B;  3A6N B;  3REL A;  3W98 C;  5AV9 A;  5B31 C;  3MVD A;  4J8X B;  1P3A C;  5B1L A;  2FJ7 C;  5DNN B;  1ID3 C;  3B0D B;  4WNN B;  5AV5 D;  3LJA D;  3AZG A;  1P3B B;  3X1S D;  1S32 D;  5CP6 A;  5E5A A;  5B2J C;  4J8W C;  3B6G C;  5BS7 A;  3B0C T;  3X1U D;  4J8U B;  3REJ B;  1P3M B;  3LJA C;  1P3G A;  3AZJ D;  3UTB A;  5GXQ A;  4KHA A;  4HGA B;  3KXB B;  4Z66 D;  3B0C W;  5GT0 B;  3X1U C;  1KX4 D;  3LEL C;  5AV8 C;  4ZBJ C;  5BNV A;  3UTA A;  5CPI B;  1BH9 A;  5CPJ D;  4H9N A;  3A6N C;  4X23 D;  3AFA B;  3AZK A;  4J8X C;  3REH B;  1AOI D;  5DNN C;  3B0D C;  5GSU B;  3WAA D;  4J8U D;  3REJ D;  1P3B C;  5CPJ C;  3X1V B;  3AYW A;  1AOI C;  1P3L D;  3AN2 B;  5GT0 D;  4YS3 B;  3W97 A;  4XUJ A;  4YM6 A;  4J8U C;  3REJ C;  1P3M C;  3X1T D;  2F8N A;  4HGA C;  1M19 B;  3REK B;  5BT1 D;  3AV2 B;  5FUG A;  1BH8 B;  5GT0 C;  3AZH B;  5B32 D;  1M1A A;  4H9Q B;  3AZF D;  3AN2 C;  3AZE B;  5CPI C;  3MGP B;  5GT3 D;  2RVQ D;  3AFA C;  3UT9 D;  3VH6 A;  2PYO A;  5BNX B;  3REH C;  4XZQ A;  1A7W A;  5BO0 B;  1HQ3 A;  1KX5 B;  3MGS A;  3X1V C;  4KGC D;  3REK D;  3WA9 A;  3AZI A;  2YFV B;  3AZM B;  3MGQ A;  4YS3 C; 
#chains in the Genus database with same CATH topology
 3AZN B;  4WU9 D;  1P3I A;  5F99 B;  4JJN B;  3NQU B;  4Z5T B;  3W96 A;  1M18 B;  4CAY B;  3AV1 D;  3MGP D;  1M19 C;  3REK C;  5CPK B;  2NQB A;  3C1C A;  3AV2 C;  1U35 D;  5AVC D;  3LZ1 B;  3C1B D;  4J8V B;  3AZE C;  2CV5 D;  1P3K A;  1P3P A;  3TU4 A;  3AZL A;  3MGP C;  3AV1 C;  3LZ0 D;  2FJ7 B;  1P34 A;  1ID3 B;  1U35 C;  1KX5 C;  1H3O A;  3C1B C;  2HIO B;  2F8N G;  3REI A;  2ARO B;  4R8P D;  4H9S A;  1JFI A;  3WKJ D;  3O62 A;  3W99 A;  3LZ0 C;  3WTP A;  1F66 B;  3AL0 C;  3W98 A;  5B2I A;  3AZM C;  5B0Z D;  1P3F D;  5B31 A;  3B6F A;  5AV5 B;  1N1J B;  3AZN C;  3LJA B;  4WU8 A;  3X1S B;  3EPH A;  1KX3 D;  4JJN C;  1P3O D;  4Z5T C;  4R8P C;  1M18 C;  3KUY A;  1S32 B;  3WKJ C;  5JRG D;  4H9P A;  2Y2J A;  3KWQ A;  5CPK C;  4KUD D;  3X1U B;  2UWX A;  3LZ1 C;  3AZJ B;  5B2J A;  2HIO D;  4J8W A;  3B6G A;  4LD9 A;  4ZBJ B;  5DNM D;  4DRA A;  4E44 A;  1KU5 A;  3MNN A;  1ZLA A;  3H0M C;  4NE5 A;  4Z66 B;  1TAF A;  2ZY4 A;  2BYK B;  5B1M B;  1F66 D;  4KUD C;  5B33 D;  5C3I C;  5AV6 D;  4H9O A;  1KX4 B;  3MVD B;  5AY8 D;  2HIO C;  2ARO C;  5CPJ B;  1TZY D;  3A1K A;  4X23 B;  4UUZ B;  3LEL A;  5AV8 A;  5B0Y D;  4CSR B;  3MGR D;  3AZG B;  1AOI B;  1F66 C;  1WWS A;  3A6N A;  2NZD D;  5B33 C;  5AV6 C;  4DQY B;  5AV5 C;  4J8X A;  2G5H C;  3WAA B;  4QLC D;  5AVB B;  5AY8 C;  5DNN A;  3X1S C;  4WNN A;  1TZY C;  1S32 C;  1P3B A;  1P3L B;  5B40 D;  5B1M D;  5B24 A;  1EQZ D;  3REL D;  5AV9 D;  3MVD D;  3AZJ C;  3X1T B;  5B1L D;  2XD1 A;  3REJ A;  1P3M A;  5G49 B;  2DQN C;  4Z66 C;  5B1M C;  3AZG D;  5B31 G;  4AWL B;  5B32 B;  5BNV B;  4ZUX B;  3AZF B;  3KXB A;  4H9N B;  5CP6 D;  1KX4 C;  5AVB D;  3MVD C;  5E5A D;  2ZY3 A;  4WV4 B;  5GT3 B;  4X23 C;  1B6W A;  3VH5 W;  2YFW B;  3UT9 B;  2ZY5 A;  3AZG C;  1P3G D;  2IO5 B;  5CPI A;  4WZS B;  2CWE A;  3UTB D;  5GXQ D;  3AFA A;  1F1E A;  3WAA C;  3AYW B;  3REH A;  5CP6 C;  5AVB C;  5GSU A;  3W97 B;  5BS7 C;  3P5J B;  4KGC B;  4H9R B;  1P3L C;  3X1V A;  4ZUX D;  3UTA D;  4Z2M G;  4WU9 B;  3AZK D;  3AN2 A;  2Y2L A;  3X1T C;  4YS3 A;  3AV1 B;  2J8P A;  5BT1 C;  1U35 B;  4AWL C;  1M19 A;  5B32 C;  4ZUX C;  3UTA C;  3VH6 W;  5AVC B;  3REK A;  3C1B B;  3AZF C;  3AYW D;  3AV2 A;  2BG1 A;  1BH8 A;  2CV5 B;  3AZH A;  4H9Q A;  4M6B A;  3W97 D;  5GT3 C;  2RVQ C;  3EPJ A;  3LZ0 B;  3UT9 C;  4YM6 D;  3AZE A;  3FDD A;  2IO5 C;  3B0B A;  2F8N D;  5BNX A;  3AYW C;  5BO0 A;  4R8P B;  2F8N H;  1KX5 A;  3MGQ B;  3WKJ B;  2JE5 A;  3W97 C;  1M1A D;  4KGC C;  5B0Z B;  1P3F B;  2Y2M A;  2RIQ A;  4WU9 C;  4G92 B;  1KX3 B;  2YFV A;  3R45 A;  3AZM A;  1P3O B;  2PYO D;  4DRB A;  2Y2G A;  4XZQ D;  3AZN A;  5JRG B;  1HQ3 D;  3WTP E;  5F99 A;  4JJN A;  3V9R B;  4Z5T A;  2ZY2 A;  5JA4 B;  1M18 A;  3MGS D;  4KUD B;  4CAY A;  2HUE B;  5C3I B;  1P3K B;  5AVC C;  5CPK A;  5DNM B;  2CV5 C;  2Y2H A;  1Q9C A;  3AZI D;  1P34 B;  2Y2Q A;  3LZ1 A;  1HQ3 C;  3MGQ D;  4J8V A;  1P3I D;  2F8N K;  3IP4 C;  5B33 B;  5AV6 B;  1P3A A;  2FJ7 A;  5AY8 B;  3NQJ B;  3W99 B;  1ID3 A;  5KDM B;  1TZY B;  3C1C D;  3MGQ C;  3B6F B;  5B0Y B;  3MGR B;  4WU8 B;  2ARO A;  2NZD B;  5B0Z C;  1P3F C;  1P3K D;  3KUY B;  1P3P D;  3AZL D;  4QLC B;  1PZR A;  4G92 C;  1KX3 C;  1W2E A;  1P3O C;  5AV5 A;  1N1J A;  1P34 D;  3LJA A;  5JRG C;  3X1S A;  2BYM B;  5B40 B;  4LD9 B;  1BFM A;  3REI D;  1S32 A;  2HUE C;  3MNN B;  2LY8 A;  1P3K C;  3REL B;  1EQZ B;  5AV9 B;  3W99 D;  3O62 D;  5B1L B;  5DNM C;  3X1U A;  3WTP D;  1P34 C;  3W98 D;  4NE6 A;  5B2I D;  5B31 D;  3AZJ A;  3B6F D;  4WU8 D;  4Z66 A;  3KUY D;  5B1M A;  5CP6 B;  2BYK A;  3W99 C;  5E5A B;  3KWQ D;  2XD5 A;  5B2I C;  1KX4 A;  3B6F C;  5B0Y C;  3MGR C;  1P3G B;  4WU8 C;  5B2J D;  5CPJ A;  4J8W D;  3UTB B;  3B6G D;  4LD9 D;  5GXQ B;  4X23 A;  4UUZ A;  2NZD C;  1ZLA D;  4KHA B;  3MNN D;  4CSR A;  3KUY C;  1AOI A;  4QLC C;  3KFU G;  3KWQ C;  5B24 B;  3WAA A;  4J8U A;  5AVB A;  5B40 C;  3VH5 T;  4LD9 C;  3UTA B;  1ZLA C;  1BH9 B;  3MNN C;  1EQZ C;  3REL C;  3AZK B;  2JCH A;  1P3L A;  5AV9 C;  4Z2M H;  3LEL D;  5AV8 D;  5GT0 A;  5B1L C;  3A6N D;  2Y2I A;  4NE3 A;  3X1T A;  4J8X D;  5DNN D;  4NFT A;  5G49 A;  1P3B D;  5E5A C;  5B32 A;  4ZUX A;  3AZF A;  5B24 D;  4XUJ B;  4YM6 B;  2F2A C;  1P3G C;  1T3U A;  3UTB C;  5GT3 A;  5GXQ C;  3UT9 A;  2F8N B;  2YFW A;  1P3M D;  3VH5 A;  3VH6 T;  3A1I A;  5FUG B;  5B24 C;  1M1A B;  2Y2O A;  3KXB D;  4KGC A;  4H9R A;  3AZK C;  2PYO B;  3EPK A;  4XZQ B;  5CPI D;  3KSY A;  1HQ3 B;  2DF4 C;  4WU9 A;  4XUJ D;  3AFA D;  4WJ3 C;  4G91 B;  1R4V A;  3KXB C;  3MGS B;  3REH D;  3AV1 A;  3MGP A;  2L5A A;  5GSU D;  1U35 A;  3WA9 B;  3AZI B;  5AVC A;  3C1B A;  3X1V D;  4XUJ C;  4YM6 C;  2CV5 A;  1P3I B;  3AN2 D;  4YS3 D;  3W96 B;  3LZ0 A;  5GSU C;  2NQB B;  3C1C B;  1M19 D;  1M1A C;  2VQR A;  3NQU A;  4R8P A;  3R45 B;  3AV2 D;  3WKJ A;  3AZH D;  1P3P B;  3TU4 B;  3AZL B;  1HTA A;  5B32 G;  2PYO C;  5B0Z A;  3AZE D;  1P3F A;  3H0R C;  3WA9 D;  4XZQ C;  2G5I C;  1KX3 A;  4G91 C;  1P3O A;  1H3O B;  3MGS C;  3REI B;  5JRG A;  3AZH C;  3W96 D;  1JFI B;  1KX5 D;  3V9R A;  4EO5 B;  5JA4 A;  3O62 B;  4KUD A;  3WTP B;  3AZI C;  2NQB D;  3W98 B;  3WA9 C;  5B2I B;  5B31 B;  2HIO A;  1P3A B;  5DNM A;  1P3I C;  3AZM D;  3W96 C;  3AZN D;  3TU4 D;  4E45 A;  5F99 D;  4JJN D;  4H9P B;  1F66 A;  5B33 A;  4Z5T D;  5AV6 A;  3KWQ B;  1M18 D;  2NQB C;  3C1C C;  5AY8 A;  1B67 A;  3NQJ A;  5KDM A;  5B2J B;  4J8W B;  5CPK D;  3B6G B;  1TZY A;  1ZLA B;  5B0Y A;  1P3P C;  3MGR A;  3TU4 C;  2FFF B;  3LZ1 D;  3AZL C;  5F99 C;  2NZD A;  4J8V D;  1TAF B;  1WWI A;  4QLC A;  4H9O B;  1P3A D;  2FJ7 D;  1ID3 D;  2JSS A;  3REI C;  4H9S C;  2BYM A;  5B40 A;  3LEL B;  5AV8 B;  4EO5 C;  3O62 C;  1ULY A;  4J8V C;  2ARO D;  1EQZ A;  3EG5 B;  5CHL B;  3WTP C;  3A6N B;  3REL A;  3W98 C;  5AV9 A;  5B31 C;  3MVD A;  4J8X B;  2Y2K A;  1P3A C;  5B1L A;  2FJ7 C;  5DNN B;  1ID3 C;  3B0D B;  4WNN B;  5AV5 D;  3LJA D;  3AZG A;  1P3B B;  3X1S D;  3F6T A;  1S32 D;  5CP6 A;  5E5A A;  5B2J C;  4J8W C;  3B6G C;  5BS7 A;  3B0C T;  1Z2C B;  3X1U D;  4J8U B;  3REJ B;  1P3M B;  3LJA C;  1P3G A;  2W8S A;  3AZJ D;  3UTB A;  5GXQ A;  4KHA A;  4HGA B;  3KXB B;  4Z66 D;  3B0C W;  5GT0 B;  3X1U C;  4UPK A;  1KX4 D;  3LEL C;  5AV8 C;  4ZBJ C;  5BNV A;  3UTA A;  5CPI B;  1BH9 A;  5CPJ D;  4H9N A;  3A6N C;  4X23 D;  3AFA B;  3AZK A;  4J8X C;  3REH B;  1AOI D;  5DNN C;  3B0D C;  5GSU B;  3WAA D;  4J8U D;  3REJ D;  1P3B C;  5CPJ C;  3X1V B;  3AYW A;  1AOI C;  1P3L D;  3AN2 B;  5GT0 D;  4YS3 B;  3W97 A;  4XUJ A;  4YM6 A;  4J8U C;  3REJ C;  1P3M C;  3X1T D;  2F8N A;  4HGA C;  1M19 B;  3EPL A;  3REK B;  5BT1 D;  3AV2 B;  5FUG A;  1BH8 B;  5GT0 C;  3AZH B;  5B32 D;  1M1A A;  4H9Q B;  3AZF D;  3AN2 C;  3AZE B;  5CPI C;  3MGP B;  5GT3 D;  2RVQ D;  3AFA C;  3UT9 D;  3VH6 A;  2PYO A;  5BNX B;  3REH C;  4XZQ A;  1A7W A;  5BO0 B;  3H0L C;  1HQ3 A;  2Y2N A;  2ZM5 A;  1KX5 B;  2Y2P A;  3MGS A;  3X1V C;  4KGC D;  3REK D;  3WA9 A;  3AZI A;  2YFV B;  3AZM B;  3MGQ A;  4YS3 C; 
#chains in the Genus database with same CATH homology
 3AZN B;  4WU9 D;  1P3I A;  5F99 B;  4JJN B;  3NQU B;  4Z5T B;  3W96 A;  1M18 B;  4CAY B;  3AV1 D;  3MGP D;  1M19 C;  3REK C;  5CPK B;  2NQB A;  3C1C A;  3AV2 C;  1U35 D;  5AVC D;  3LZ1 B;  3C1B D;  4J8V B;  3AZE C;  2CV5 D;  1P3K A;  1P3P A;  3TU4 A;  3AZL A;  3MGP C;  3AV1 C;  3LZ0 D;  2FJ7 B;  1P34 A;  1ID3 B;  1U35 C;  1KX5 C;  1H3O A;  3C1B C;  2HIO B;  2F8N G;  3REI A;  2ARO B;  4R8P D;  4H9S A;  1JFI A;  3WKJ D;  3O62 A;  3W99 A;  3LZ0 C;  3WTP A;  1F66 B;  3AL0 C;  3W98 A;  5B2I A;  3AZM C;  5B0Z D;  1P3F D;  5B31 A;  3B6F A;  5AV5 B;  1N1J B;  3AZN C;  3LJA B;  4WU8 A;  3X1S B;  3EPH A;  1KX3 D;  4JJN C;  1P3O D;  4Z5T C;  4R8P C;  1M18 C;  3KUY A;  1S32 B;  3WKJ C;  5JRG D;  4H9P A;  2Y2J A;  3KWQ A;  5CPK C;  4KUD D;  3X1U B;  2UWX A;  3LZ1 C;  3AZJ B;  5B2J A;  2HIO D;  4J8W A;  3B6G A;  4LD9 A;  4ZBJ B;  5DNM D;  4DRA A;  4E44 A;  1KU5 A;  3MNN A;  1ZLA A;  3H0M C;  4NE5 A;  4Z66 B;  1TAF A;  2ZY4 A;  2BYK B;  5B1M B;  1F66 D;  4KUD C;  5B33 D;  5C3I C;  5AV6 D;  4H9O A;  1KX4 B;  3MVD B;  5AY8 D;  2HIO C;  2ARO C;  5CPJ B;  1TZY D;  3A1K A;  4X23 B;  4UUZ B;  3LEL A;  5AV8 A;  5B0Y D;  4CSR B;  3MGR D;  3AZG B;  1AOI B;  1F66 C;  1WWS A;  3A6N A;  2NZD D;  5B33 C;  5AV6 C;  4DQY B;  5AV5 C;  4J8X A;  2G5H C;  3WAA B;  4QLC D;  5AVB B;  5AY8 C;  5DNN A;  3X1S C;  4WNN A;  1TZY C;  1S32 C;  1P3B A;  1P3L B;  5B40 D;  5B1M D;  5B24 A;  1EQZ D;  3REL D;  5AV9 D;  3MVD D;  3AZJ C;  3X1T B;  5B1L D;  2XD1 A;  3REJ A;  1P3M A;  5G49 B;  2DQN C;  4Z66 C;  5B1M C;  3AZG D;  5B31 G;  4AWL B;  5B32 B;  5BNV B;  4ZUX B;  3AZF B;  3KXB A;  4H9N B;  5CP6 D;  1KX4 C;  5AVB D;  3MVD C;  5E5A D;  2ZY3 A;  4WV4 B;  5GT3 B;  4X23 C;  1B6W A;  3VH5 W;  2YFW B;  3UT9 B;  2ZY5 A;  3AZG C;  1P3G D;  2IO5 B;  5CPI A;  4WZS B;  2CWE A;  3UTB D;  5GXQ D;  3AFA A;  1F1E A;  3WAA C;  3AYW B;  3REH A;  5CP6 C;  5AVB C;  5GSU A;  3W97 B;  5BS7 C;  3P5J B;  4KGC B;  4H9R B;  1P3L C;  3X1V A;  4ZUX D;  3UTA D;  4Z2M G;  4WU9 B;  3AZK D;  3AN2 A;  2Y2L A;  3X1T C;  4YS3 A;  3AV1 B;  2J8P A;  5BT1 C;  1U35 B;  4AWL C;  1M19 A;  5B32 C;  4ZUX C;  3UTA C;  3VH6 W;  5AVC B;  3REK A;  3C1B B;  3AZF C;  3AYW D;  3AV2 A;  2BG1 A;  1BH8 A;  2CV5 B;  3AZH A;  4H9Q A;  4M6B A;  3W97 D;  5GT3 C;  2RVQ C;  3EPJ A;  3LZ0 B;  3UT9 C;  4YM6 D;  3AZE A;  3FDD A;  2IO5 C;  3B0B A;  2F8N D;  5BNX A;  3AYW C;  5BO0 A;  4R8P B;  2F8N H;  1KX5 A;  3MGQ B;  3WKJ B;  2JE5 A;  3W97 C;  1M1A D;  4KGC C;  5B0Z B;  1P3F B;  2Y2M A;  2RIQ A;  4WU9 C;  4G92 B;  1KX3 B;  2YFV A;  3R45 A;  3AZM A;  1P3O B;  2PYO D;  4DRB A;  2Y2G A;  4XZQ D;  3AZN A;  5JRG B;  1HQ3 D;  3WTP E;  5F99 A;  4JJN A;  3V9R B;  4Z5T A;  2ZY2 A;  5JA4 B;  1M18 A;  3MGS D;  4KUD B;  4CAY A;  2HUE B;  5C3I B;  1P3K B;  5AVC C;  5CPK A;  5DNM B;  2CV5 C;  2Y2H A;  1Q9C A;  3AZI D;  1P34 B;  2Y2Q A;  3LZ1 A;  1HQ3 C;  3MGQ D;  4J8V A;  1P3I D;  2F8N K;  3IP4 C;  5B33 B;  5AV6 B;  1P3A A;  2FJ7 A;  5AY8 B;  3NQJ B;  3W99 B;  1ID3 A;  5KDM B;  1TZY B;  3C1C D;  3MGQ C;  3B6F B;  5B0Y B;  3MGR B;  4WU8 B;  2ARO A;  2NZD B;  5B0Z C;  1P3F C;  1P3K D;  3KUY B;  1P3P D;  3AZL D;  4QLC B;  1PZR A;  4G92 C;  1KX3 C;  1W2E A;  1P3O C;  5AV5 A;  1N1J A;  1P34 D;  3LJA A;  5JRG C;  3X1S A;  2BYM B;  5B40 B;  4LD9 B;  1BFM A;  3REI D;  1S32 A;  2HUE C;  3MNN B;  2LY8 A;  1P3K C;  3REL B;  1EQZ B;  5AV9 B;  3W99 D;  3O62 D;  5B1L B;  5DNM C;  3X1U A;  3WTP D;  1P34 C;  3W98 D;  4NE6 A;  5B2I D;  5B31 D;  3AZJ A;  3B6F D;  4WU8 D;  4Z66 A;  3KUY D;  5B1M A;  5CP6 B;  2BYK A;  3W99 C;  5E5A B;  3KWQ D;  2XD5 A;  5B2I C;  1KX4 A;  3B6F C;  5B0Y C;  3MGR C;  1P3G B;  4WU8 C;  5B2J D;  5CPJ A;  4J8W D;  3UTB B;  3B6G D;  4LD9 D;  5GXQ B;  4X23 A;  4UUZ A;  2NZD C;  1ZLA D;  4KHA B;  3MNN D;  4CSR A;  3KUY C;  1AOI A;  4QLC C;  3KFU G;  3KWQ C;  5B24 B;  3WAA A;  4J8U A;  5AVB A;  5B40 C;  3VH5 T;  4LD9 C;  3UTA B;  1ZLA C;  1BH9 B;  3MNN C;  1EQZ C;  3REL C;  3AZK B;  2JCH A;  1P3L A;  5AV9 C;  4Z2M H;  3LEL D;  5AV8 D;  5GT0 A;  5B1L C;  3A6N D;  2Y2I A;  4NE3 A;  3X1T A;  4J8X D;  5DNN D;  4NFT A;  5G49 A;  1P3B D;  5E5A C;  5B32 A;  4ZUX A;  3AZF A;  5B24 D;  4XUJ B;  4YM6 B;  2F2A C;  1P3G C;  1T3U A;  3UTB C;  5GT3 A;  5GXQ C;  3UT9 A;  2F8N B;  2YFW A;  1P3M D;  3VH5 A;  3VH6 T;  3A1I A;  5FUG B;  5B24 C;  1M1A B;  2Y2O A;  3KXB D;  4KGC A;  4H9R A;  3AZK C;  2PYO B;  3EPK A;  4XZQ B;  5CPI D;  3KSY A;  1HQ3 B;  2DF4 C;  4WU9 A;  4XUJ D;  3AFA D;  4WJ3 C;  4G91 B;  1R4V A;  3KXB C;  3MGS B;  3REH D;  3AV1 A;  3MGP A;  2L5A A;  5GSU D;  1U35 A;  3WA9 B;  3AZI B;  5AVC A;  3C1B A;  3X1V D;  4XUJ C;  4YM6 C;  2CV5 A;  1P3I B;  3AN2 D;  4YS3 D;  3W96 B;  3LZ0 A;  5GSU C;  2NQB B;  3C1C B;  1M19 D;  1M1A C;  2VQR A;  3NQU A;  4R8P A;  3R45 B;  3AV2 D;  3WKJ A;  3AZH D;  1P3P B;  3TU4 B;  3AZL B;  1HTA A;  5B32 G;  2PYO C;  5B0Z A;  3AZE D;  1P3F A;  3H0R C;  3WA9 D;  4XZQ C;  2G5I C;  1KX3 A;  4G91 C;  1P3O A;  1H3O B;  3MGS C;  3REI B;  5JRG A;  3AZH C;  3W96 D;  1JFI B;  1KX5 D;  3V9R A;  4EO5 B;  5JA4 A;  3O62 B;  4KUD A;  3WTP B;  3AZI C;  2NQB D;  3W98 B;  3WA9 C;  5B2I B;  5B31 B;  2HIO A;  1P3A B;  5DNM A;  1P3I C;  3AZM D;  3W96 C;  3AZN D;  3TU4 D;  4E45 A;  5F99 D;  4JJN D;  4H9P B;  1F66 A;  5B33 A;  4Z5T D;  5AV6 A;  3KWQ B;  1M18 D;  2NQB C;  3C1C C;  5AY8 A;  1B67 A;  3NQJ A;  5KDM A;  5B2J B;  4J8W B;  5CPK D;  3B6G B;  1TZY A;  1ZLA B;  5B0Y A;  1P3P C;  3MGR A;  3TU4 C;  2FFF B;  3LZ1 D;  3AZL C;  5F99 C;  2NZD A;  4J8V D;  1TAF B;  1WWI A;  4QLC A;  4H9O B;  1P3A D;  2FJ7 D;  1ID3 D;  2JSS A;  3REI C;  4H9S C;  2BYM A;  5B40 A;  3LEL B;  5AV8 B;  4EO5 C;  3O62 C;  1ULY A;  4J8V C;  2ARO D;  1EQZ A;  3EG5 B;  5CHL B;  3WTP C;  3A6N B;  3REL A;  3W98 C;  5AV9 A;  5B31 C;  3MVD A;  4J8X B;  2Y2K A;  1P3A C;  5B1L A;  2FJ7 C;  5DNN B;  1ID3 C;  3B0D B;  4WNN B;  5AV5 D;  3LJA D;  3AZG A;  1P3B B;  3X1S D;  3F6T A;  1S32 D;  5CP6 A;  5E5A A;  5B2J C;  4J8W C;  3B6G C;  5BS7 A;  3B0C T;  1Z2C B;  3X1U D;  4J8U B;  3REJ B;  1P3M B;  3LJA C;  1P3G A;  2W8S A;  3AZJ D;  3UTB A;  5GXQ A;  4KHA A;  4HGA B;  3KXB B;  4Z66 D;  3B0C W;  5GT0 B;  3X1U C;  4UPK A;  1KX4 D;  3LEL C;  5AV8 C;  4ZBJ C;  5BNV A;  3UTA A;  5CPI B;  1BH9 A;  5CPJ D;  4H9N A;  3A6N C;  4X23 D;  3AFA B;  3AZK A;  4J8X C;  3REH B;  1AOI D;  5DNN C;  3B0D C;  5GSU B;  3WAA D;  4J8U D;  3REJ D;  1P3B C;  5CPJ C;  3X1V B;  3AYW A;  1AOI C;  1P3L D;  3AN2 B;  5GT0 D;  4YS3 B;  3W97 A;  4XUJ A;  4YM6 A;  4J8U C;  3REJ C;  1P3M C;  3X1T D;  2F8N A;  4HGA C;  1M19 B;  3EPL A;  3REK B;  5BT1 D;  3AV2 B;  5FUG A;  1BH8 B;  5GT0 C;  3AZH B;  5B32 D;  1M1A A;  4H9Q B;  3AZF D;  3AN2 C;  3AZE B;  5CPI C;  3MGP B;  5GT3 D;  2RVQ D;  3AFA C;  3UT9 D;  3VH6 A;  2PYO A;  5BNX B;  3REH C;  4XZQ A;  1A7W A;  5BO0 B;  3H0L C;  1HQ3 A;  2Y2N A;  2ZM5 A;  1KX5 B;  2Y2P A;  3MGS A;  3X1V C;  4KGC D;  3REK D;  3WA9 A;  3AZI A;  2YFV B;  3AZM B;  3MGQ A;  4YS3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...