1P3OC

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3oC00
4H9PA 5GXQB 3W99B 3MVDC 3WKJD 1M18B 3AFAC 4YS3C 1U35C 5B2JC 2RVQC 3WA9D 1TZYC 3WA9A 5B1LC 4DRBA 5B1MD 1P3PB 2HIOD 5JA4B 5B0ZD 2HIOA 3VH6W 5AV6B 3C1CD 3C1CA 3UT9D 3UT9A 3WAAC 5B32B 1S32D 5GSUC 3WTPC 1S32A 2PYOB 1ID3D 4XUJB 1ID3A 4G92B 3LELA 3REJB 5CPKB 3B6GB 4XZQB 4WNNB 5AV8A 4NFTA 4CSRB 4QLCD 4J8XA 4QLCA 2JSSA 4J8WD 4J8WA 5AY8A 4H9PB 4E44A 4Z2MH 4AWLB 3AZMD 5AV9B 4CAYA 3AZED 5F99C 4EO5B 3KWQC 3MGQC 1M1AD 2BYKA 1M1AA 3REKA 5B33D 5B33A 3REHB 3VH5W 4WV4B 1HQ3D 5AVCC 3X1SC 1H3OB 5B24D 2HIOB 3WTPE 4WU9D 1KX3D 3C1CB 4WU9A 5AVCB 3LZ0D 3MGPD 3AZJC 3MGPA 2FJ7D 1S32B 2FJ7A 4UUZB 3UTBD 4R8PC 3LELB 3UTBA 3W97D 5AV8B 3W97A 5BS7C 5C3IB 3AZHC 3X1TC 3VH6A 3TU4A 3AZNC 4J8XB 2NQBB 5G49A 5B40D 2CV5D 4KGCC 5B40A 1BH9A 2CV5A 5B2ID 5AY8B 3MNND 4J8WB 5B0YD 2NZDC 1EQZC 1P3AD 2BYKB 3REKB 4Z5TB 3B0CT 3MGRD 1P3OC 3MGRA 1N1JA 3W96C 3AV2C 1KX5D 4ZBJC 1BH8A 1KX5A 5DNMC 5E5AA 5JRGB 1AOIA 4WU9B 3C1BC 5CPJC 1A7WA 1P3LC 3B6FC 5BNVA 4YM6B 4X23A 3A6ND 3A6NA 4H9RB 2BYMA 3LJAC 4ZUXD 1P3IA 5BNXB 4ZUXA 3TU4B 4Z2MG 5G49B 4J8UD 2CV5B 1BH9B 4G91C 5GXQD 3W99D 4J8UA 5GXQA 3AZKC 1M18D 4H9SC 3W98B 3W99A 4H9QA 1KX4C 1F66C 3AN2A 3AZLC 4LD9C 3MGRB 3AFAD 1N1JB 3AFAA 4YS3D 1KX5B 4YS3A 1P3PD 5E5AB 1P3PA 1JFIA 4NE5A 5JA4A 5GT0C 1AOIB 2RVQD 5KDMA 5AV6D 5B2JA 1TZYA 3O62C 3KUYC 5B1LD 5B1LA 4KUDB 4XUJD 4XUJA 3REJD 3UTAC 3AZGB 4X23B 4XZQD 3REJA 3B6GD 3A6NB 4XZQA 1P3GC 2BYMB 3WAAA 5GSUA 2YFWA 4CSRA 1P3IB 1M19C 3AV1C 3X1VC 3KXBC 4J8UB 5AV9D 2AROC 5AV9A 4H9QB 1P3FC 3REHD 3AN2B 3REHA 1P34C 3MVDB 5F99D 3AFAB 3MGQD 5F99A 3MGQA 3LZ1C 1H3OA 4YS3B 1JFIB 5KDMB 3RELC 1U35B 5B2JB 3NQJB 1TZYB 5AVCD 5B1LB 5AVCA 3LZ1B 3X1SA 4UUZA 3LELD 3AZFC 5AV8D 3AZIC 3WAAB 2F8NH 5GT3C 5GSUB 2YFWB 3WTPB 4J8XD 2NQBD 2NQBA 4R8PA 5AY8D 5BO0B 3X1TA 5AV5C 3AZND 3REKD 4J8VC 3AZNA 4Z5TD 4Z5TA 1WWIA 3B0CW 2NZDA 1EQZD 1EQZA 5F99B 3KWQB 3MGQB 5JRGD 5JRGA 3WKJC 1P3OA 3W96D 3W96A 3AV2A 5B31C 3X1SB 5DNMA 1P3BC 4YM6D 3WA9C 4YM6A 4H9RA 3C1BD 4Z66C 3C1BA 5B1MC 3AZJB 5B0ZC 5CP6C 5BNXA 3TU4D 1P3LA 3B0DC 3B6FD 3B6FA 4R8PB 3REIC 3UT9C 3W98D 5B31G 3W98A 3AZHB 3X1TB 3LJAA 1ID3C 3AZNB 5AVBC 3R45B 2HUEC 4KGCB 4H9OA 4KHAB 2NZDB 4H9SA 1EQZB 1KX4D 1HTAA 4QLCC 1KX4A 5E5AD 3AZLD 1AOID 3AZLA 3AZMC 5CPIC 4LD9A 1P3OB 3AZEC 1M1AC 3AV2B 3W96B 4ZBJB 4KUDD 4KUDA 3VH5A 5DNMB 4HGAC 5B33C 5GT0D 5GT0A 3AZGD 4X23D 3AZGA 2F8NG 1HQ3C 3KUYD 3O62A 3KUYA 3C1BB 5CPJB 3B0BA 5B24C 1P3ID 1P3LB 4WZSB 3B6FB 3UTAA 1P3GD 1KX3C 5BT1C 1P3GA 3LZ0C 1ZLAC 2FJ7C 3LJAB 1M19A 3NQUB 3UTBC 3AN2D 3X1VA 3KXBA 4G91B 5DNNC 4H9OB 3MVDD 3AZKB 3MVDA 4WU8C 2F8NK 1KX4B 1F66B 5B40C 5B2IC 3MNNC 1U35D 5B2JD 3AZLB 5DNNB 5B0YC 2IO5C 1U35A 3NQJA 1TZYD 1P34A 4LD9B 3AYWC 1P3AC 3LZ1D 3LZ1A 1R4VA 5GT0B 3RELD 3RELA 3O62B 3KUYB 3WAAD 5GSUD 3WTPD 4E45A 3WTPA 4JJNC 3UTAB 3AZFA 1F1EA 1P3GB 3KSYA 5BO0A 2CWEA 3X1UC 1M19B 1Q9CA 3AV1B 3X1VB 1P3KC 3KXBB 1P3MC 4ZUXC 2AROB 1KU5A 5FUGA 3KWQD 5AV5D 3KWQA 5AV5A 3X1UB 1BFMA 1P3FB 3W99C 5GXQC 1M18C 3V9RB 1P34B 1WWSA 3X1SD 3RELB 3WKJA 4NE3A 3AZJD 5B31D 3AZJA 1P3PC 5B31A 4M6BA 1P3BD 1P3BA 2LY8A 5AV6C 4R8PD 3AZFB 5B32C 5BS7A 4Z66D 3AZHD 3AZIB 4Z66A 3AZHA 3X1TD 5B1MA 2PYOC 5GT3B 5CP6D 4XUJC 5CP6A 5B0ZA 4G92C 3REJC 5CPKC 4KGCD 3B6GC 3R45A 4XZQC 3REID 3MGSC 3REIA 4KGCA 2NZDD 4KHAA 5FUGB 5AV5B 5AVBD 4J8VB 5AVBA 5B32G 3MGSB 4AWLC 5AV9C 1P3OD 2F8ND 4EO5C 3AV2D 1B67A 2F8NA 5DNMD 3REHC 3AZMA 5CPID 3WKJB 5CPIA 3AZEA 5CPJD 5CPJA 5B31B 1P3LD 2HIOC 1P3BB 2YFVA 3C1CC 3WA9B 1HQ3A 4Z66B 5B1MB 3LJAD 1S32C 4NE6A 5B24A 5B0ZB 5CP6B 3NQUA 3B0DB 3VH6T 3LELC 4DRAA 5C3IC 5AV8C 5BT1D 3REIB 3AZKD 1KX3A 3UT9B 3AZKA 1ZLAD 3LZ0A 1ZLAA 4J8XC 1F66D 1ID3B 2NQBC 1F66A 5AVBB 4J8WC 5AY8C 2HUEB 5DNND 5DNNA 4LD9D 4WU8D 4WU8A 2F8NB 4QLCB 3REKC 4Z5TC 5B2IA 3MNNA 5B0YA 3AZMB 5CPIB 4CAYB 3O62D 2L5AA 3AYWD 3AZEB 3AYWA 1P3AA 1M1AB 5JRGC 5B33B 4H9NA 4HGAB 3VH5T 3UTAD 2YFVB 1HQ3B 4WU9C 3MGPC 1M19D 5B24B 4JJND 4JJNA 3AV1D 4YM6C 3X1VD 3AV1A 3KXBD 3W97C 1KX3B 3LZ0B 2AROD 3MGPB 1ZLAB 2AROA 3TU4C 2FJ7B 3X1UD 3X1UA 1P3FD 1P3FA 1ULYA 3UTBB 2CV5C 1P3KD 3W97B 1P3KA 3W98C 1P3MD 3V9RA 1P34D 1P3MA 5CHLB 4WU8B 1TAFA 5B40B 5B2IB 3MNNB 5B0YB 3MGRC 2IO5B 1M18A 1KX5C 1B6WA 3AYWB 1P3AB 5E5AC 4H9NB 1AOIC 3AZFD 3AZID 1BH8B 4KUDC 3AZIA 5GT3D 5GT3A 4JJNB 3AZGC 4X23C 5AV6A 3A6NC 5B32D 5B32A 2PYOD 1P3IC 2PYOA 5BNVB 4J8VD 5CPKD 4J8VA 5CPKA 3MGSD 4J8UC 3B6GA 4WNNA 3MGSA 1P3KB 1P3MB 4ZUXB 1TAFB 3AN2C
chains in the Genus database with same CATH superfamily
4H9PA 5GXQB 3W99B 3MVDC 3WKJD 1M18B 3AFAC 4YS3C 1U35C 5B2JC 2RVQC 3WA9D 1TZYC 2J8PA 3WA9A 5B1LC 4DRBA 5B1MD 1P3PB 2HIOD 5JA4B 5B0ZD 2HIOA 3VH6W 5AV6B 3C1CD 3C1CA 3UT9D 3UT9A 2Y2HA 3WAAC 5B32B 1S32D 5GSUC 3WTPC 2Y2NA 1S32A 2PYOB 1ID3D 3KFUG 4XUJB 1ID3A 4G92B 3LELA 3REJB 5CPKB 3B6GB 4XZQB 4WNNB 5AV8A 3AL0C 4NFTA 4CSRB 4QLCD 4J8XA 4QLCA 2JSSA 4J8WD 4J8WA 5AY8A 4H9PB 4E44A 4Z2MH 4AWLB 3AZMD 5AV9B 4CAYA 3AZED 5F99C 4EO5B 3KWQC 3MGQC 1M1AD 2BYKA 1M1AA 3REKA 5B33D 5B33A 3REHB 3VH5W 4WV4B 1HQ3D 5AVCC 3X1SC 1H3OB 5B24D 2HIOB 3WTPE 4WU9D 1KX3D 3C1CB 4WU9A 5AVCB 3LZ0D 3MGPD 3AZJC 3MGPA 2FJ7D 1S32B 2FJ7A 4UUZB 3UTBD 4R8PC 3LELB 3UTBA 3W97D 5AV8B 3W97A 5BS7C 5C3IB 3AZHC 3X1TC 3VH6A 3TU4A 3AZNC 4J8XB 2ZM5A 2NQBB 5G49A 5B40D 2CV5D 4KGCC 5B40A 1BH9A 2CV5A 5B2ID 5AY8B 3MNND 4J8WB 5B0YD 2NZDC 3EPKA 1EQZC 1P3AD 2BYKB 3REKB 4Z5TB 3B0CT 3MGRD 1P3OC 3MGRA 1N1JA 3W96C 3AV2C 1KX5D 4ZBJC 1BH8A 1KX5A 5DNMC 5E5AA 5JRGB 1Z2CB 1AOIA 4WU9B 3C1BC 5CPJC 3IP4C 1A7WA 1P3LC 3B6FC 2ZY5A 5BNVA 4YM6B 4X23A 3A6ND 3A6NA 4H9RB 2BYMA 3LJAC 4ZUXD 1P3IA 5BNXB 4ZUXA 3TU4B 4Z2MG 5G49B 4J8UD 2CV5B 3W99D 1BH9B 4G91C 5GXQD 4J8UA 5GXQA 3AZKC 1M18D 4H9SC 3W98B 3W99A 4H9QA 1KX4C 1F66C 3A1KA 3AN2A 3AZLC 4LD9C 3MGRB 3AFAD 1N1JB 3AFAA 4YS3D 1KX5B 4YS3A 1P3PD 5E5AB 1P3PA 1JFIA 4NE5A 5JA4A 5GT0C 1AOIB 2RVQD 5KDMA 5AV6D 5B2JA 1TZYA 3O62C 3KUYC 5B1LD 5B1LA 4KUDB 1PZRA 4XUJD 4XUJA 3REJD 3UTAC 3AZGB 4X23B 4XZQD 3REJA 3B6GD 3A6NB 4XZQA 1P3GC 2BYMB 3WAAA 5GSUA 2YFWA 4CSRA 1P3IB 1M19C 3AV1C 2FFFB 3X1VC 3KXBC 4J8UB 5AV9D 2AROC 5AV9A 4H9QB 1P3FC 3REHD 3AN2B 3REHA 1P34C 3MVDB 5F99D 3AFAB 3MGQD 5F99A 3MGQA 3LZ1C 1H3OA 4YS3B 1JFIB 5KDMB 3RELC 1U35B 5B2JB 3NQJB 1TZYB 5AVCD 5B1LB 5AVCA 3LZ1B 3X1SA 4UUZA 3LELD 3AZFC 5AV8D 3AZIC 3WAAB 2F8NH 5GT3C 5GSUB 2YFWB 3WTPB 4J8XD 2Y2KA 2NQBD 3A1IA 2NQBA 4R8PA 5AY8D 5BO0B 3X1TA 3F6TA 5AV5C 3AZND 3REKD 4J8VC 3AZNA 4Z5TD 4Z5TA 1WWIA 3B0CW 2NZDA 1EQZD 1EQZA 2ZY2A 5F99B 3KWQB 3MGQB 5JRGD 5JRGA 3WKJC 1P3OA 3W96D 3W96A 3AV2A 4WJ3C 5B31C 3X1SB 5DNMA 1P3BC 4YM6D 3WA9C 4YM6A 3EPJA 4H9RA 3C1BD 4Z66C 3C1BA 5B1MC 3AZJB 5B0ZC 5CP6C 5BNXA 3TU4D 1P3LA 3B0DC 3B6FD 3B6FA 4R8PB 3REIC 3UT9C 3W98D 5B31G 3W98A 3AZHB 3X1TB 2G5HC 3EG5B 3LJAA 4DQYB 1ID3C 3AZNB 2ZY3A 5AVBC 3R45B 2HUEC 2UWXA 4KGCB 4H9OA 4KHAB 3P5JB 2NZDB 4H9SA 1EQZB 2Y2IA 1KX4D 1HTAA 4QLCC 1KX4A 5E5AD 2BG1A 3AZLD 1AOID 3AZLA 3AZMC 5CPIC 2Y2JA 4LD9A 1P3OB 3AZEC 2Y2OA 1M1AC 3AV2B 3W96B 4ZBJB 4KUDD 4KUDA 3VH5A 2Y2MA 5DNMB 4HGAC 5B33C 5GT0D 5GT0A 3AZGD 4X23D 2XD5A 2ZY4A 3AZGA 2F8NG 1HQ3C 3EPLA 3KUYD 3O62A 3KUYA 3C1BB 5CPJB 3B0BA 5B24C 1P3ID 1P3LB 4WZSB 3B6FB 3UTAA 1P3GD 1KX3C 5BT1C 1P3GA 3FDDA 3LZ0C 1ZLAC 2FJ7C 3LJAB 1M19A 2G5IC 3NQUB 3UTBC 3AN2D 3X1VA 3KXBA 4G91B 5DNNC 4H9OB 3MVDD 3AZKB 3MVDA 4WU8C 2F8NK 1KX4B 1F66B 5B40C 5B2IC 3MNNC 1U35D 5B2JD 3AZLB 5DNNB 5B0YC 2IO5C 1U35A 3NQJA 1TZYD 1P34A 4LD9B 3AYWC 1P3AC 3LZ1D 3LZ1A 1R4VA 5GT0B 3RELD 3RELA 2XD1A 3O62B 3KUYB 3WAAD 5GSUD 3WTPD 4E45A 3WTPA 1T3UA 4JJNC 3UTAB 3AZFA 1F1EA 4UPKA 1P3GB 3KSYA 5BO0A 2CWEA 3X1UC 1M19B 1Q9CA 3AV1B 3X1VB 1P3KC 3KXBB 1P3MC 4ZUXC 2AROB 1KU5A 5FUGA 3KWQD 5AV5D 3KWQA 5AV5A 3X1UB 1BFMA 1P3FB 2Y2LA 3W99C 5GXQC 2Y2QA 1M18C 3V9RB 1P34B 1WWSA 2W8SA 2F2AC 3X1SD 3H0MC 3RELB 3WKJA 4NE3A 3AZJD 5B31D 3AZJA 1P3PC 5B31A 4M6BA 2DQNC 1P3BD 2JCHA 1P3BA 2LY8A 5AV6C 4R8PD 3AZFB 5B32C 5BS7A 4Z66D 3AZHD 3AZIB 4Z66A 3AZHA 5B1MA 3X1TD 2PYOC 5GT3B 5CP6D 4XUJC 5CP6A 5B0ZA 4G92C 1W2EA 3REJC 5CPKC 4KGCD 3B6GC 3R45A 4XZQC 3REID 3MGSC 3REIA 4KGCA 2NZDD 4KHAA 5FUGB 5AV5B 3EPHA 5AVBD 4J8VB 5AVBA 5B32G 3MGSB 4AWLC 5AV9C 1P3OD 2F8ND 4EO5C 3AV2D 1B67A 2F8NA 5DNMD 3REHC 3AZMA 5CPID 3WKJB 5CPIA 3AZEA 2Y2GA 5CPJD 5CPJA 5B31B 1P3LD 2HIOC 1P3BB 2JE5A 2YFVA 3C1CC 3WA9B 1HQ3A 4Z66B 5B1MB 3LJAD 1S32C 4NE6A 5B24A 5B0ZB 5CP6B 3NQUA 3B0DB 3VH6T 3LELC 4DRAA 5C3IC 5AV8C 5BT1D 3REIB 3AZKD 1KX3A 3UT9B 3AZKA 1ZLAD 3LZ0A 1ZLAA 4J8XC 1F66D 1ID3B 2NQBC 1F66A 5AVBB 4J8WC 5AY8C 2HUEB 5DNND 5DNNA 4LD9D 4WU8D 4WU8A 2F8NB 4QLCB 3REKC 4Z5TC 5B2IA 3MNNA 5B0YA 3AZMB 5CPIB 4CAYB 3O62D 2L5AA 3AYWD 3AZEB 3AYWA 1P3AA 1M1AB 5JRGC 5B33B 4H9NA 4HGAB 3VH5T 3UTAD 2YFVB 1HQ3B 4WU9C 3H0LC 3MGPC 1M19D 5B24B 4JJND 2DF4C 4JJNA 3AV1D 4YM6C 3X1VD 3AV1A 2RIQA 3KXBD 3W97C 1KX3B 3LZ0B 2AROD 3MGPB 1ZLAB 2AROA 3TU4C 2FJ7B 3X1UD 3X1UA 1P3FD 1P3FA 1ULYA 3UTBB 2CV5C 1P3KD 3W97B 1P3KA 3W98C 1P3MD 3V9RA 1P34D 1P3MA 5CHLB 4WU8B 1TAFA 5B40B 5B2IB 3MNNB 5B0YB 3MGRC 2IO5B 1M18A 1KX5C 1B6WA 3AYWB 1P3AB 5E5AC 4H9NB 1AOIC 3AZFD 3AZID 1BH8B 4KUDC 3AZIA 5GT3D 5GT3A 4JJNB 3AZGC 4X23C 5AV6A 3A6NC 5B32D 5B32A 2PYOD 1P3IC 2PYOA 5BNVB 4J8VD 5CPKD 4J8VA 5CPKA 3MGSD 4J8UC 2Y2PA 4WNNA 3MGSA 3B6GA 1P3KB 2VQRA 1P3MB 3H0RC 4ZUXB 1TAFB 3AN2C
chains in the Genus database with same CATH topology
4H9PA 5GXQB 3W99B 3MVDC 3WKJD 1M18B 3AFAC 4YS3C 1U35C 5B2JC 2RVQC 3WA9D 1TZYC 2J8PA 3WA9A 5B1LC 4DRBA 5B1MD 1P3PB 2HIOD 5JA4B 5B0ZD 2HIOA 3VH6W 5AV6B 3C1CD 3C1CA 3UT9D 3UT9A 2Y2HA 3WAAC 5B32B 1S32D 5GSUC 3WTPC 2Y2NA 1S32A 2PYOB 1ID3D 3KFUG 4XUJB 1ID3A 4G92B 3LELA 3REJB 5CPKB 3B6GB 4XZQB 4WNNB 5AV8A 3AL0C 4NFTA 4CSRB 4QLCD 4J8XA 4QLCA 2JSSA 4J8WD 4J8WA 5AY8A 4H9PB 4E44A 4Z2MH 4AWLB 3AZMD 5AV9B 4CAYA 3AZED 5F99C 4EO5B 3KWQC 3MGQC 1M1AD 2BYKA 1M1AA 3REKA 5B33D 5B33A 3REHB 3VH5W 4WV4B 1HQ3D 5AVCC 3X1SC 1H3OB 5B24D 2HIOB 3WTPE 4WU9D 1KX3D 3C1CB 4WU9A 5AVCB 3LZ0D 3MGPD 3AZJC 3MGPA 2FJ7D 1S32B 2FJ7A 4UUZB 3UTBD 4R8PC 3LELB 3UTBA 3W97D 5AV8B 3W97A 5BS7C 5C3IB 3AZHC 3X1TC 3VH6A 3TU4A 3AZNC 4J8XB 2ZM5A 2NQBB 5G49A 5B40D 2CV5D 4KGCC 5B40A 1BH9A 2CV5A 5B2ID 5AY8B 3MNND 4J8WB 5B0YD 2NZDC 3EPKA 1EQZC 1P3AD 2BYKB 3REKB 4Z5TB 3B0CT 3MGRD 1P3OC 3MGRA 1N1JA 3W96C 3AV2C 1KX5D 4ZBJC 1BH8A 1KX5A 5DNMC 5E5AA 5JRGB 1Z2CB 1AOIA 4WU9B 3C1BC 5CPJC 3IP4C 1A7WA 1P3LC 3B6FC 2ZY5A 5BNVA 4YM6B 4X23A 3A6ND 3A6NA 4H9RB 2BYMA 3LJAC 4ZUXD 1P3IA 5BNXB 4ZUXA 3TU4B 4Z2MG 5G49B 4J8UD 2CV5B 3W99D 1BH9B 4G91C 5GXQD 4J8UA 5GXQA 3AZKC 1M18D 4H9SC 3W98B 3W99A 4H9QA 1KX4C 1F66C 3A1KA 3AN2A 3AZLC 4LD9C 3MGRB 3AFAD 1N1JB 3AFAA 4YS3D 1KX5B 4YS3A 1P3PD 5E5AB 1P3PA 1JFIA 4NE5A 5JA4A 5GT0C 1AOIB 2RVQD 5KDMA 5AV6D 5B2JA 1TZYA 3O62C 3KUYC 5B1LD 5B1LA 4KUDB 1PZRA 4XUJD 4XUJA 3REJD 3UTAC 3AZGB 4X23B 4XZQD 3REJA 3B6GD 3A6NB 4XZQA 1P3GC 2BYMB 3WAAA 5GSUA 2YFWA 4CSRA 1P3IB 1M19C 3AV1C 2FFFB 3X1VC 3KXBC 4J8UB 5AV9D 2AROC 5AV9A 4H9QB 1P3FC 3REHD 3AN2B 3REHA 1P34C 3MVDB 5F99D 3AFAB 3MGQD 5F99A 3MGQA 3LZ1C 1H3OA 4YS3B 1JFIB 5KDMB 3RELC 1U35B 5B2JB 3NQJB 1TZYB 5AVCD 5B1LB 5AVCA 3LZ1B 3X1SA 4UUZA 3LELD 3AZFC 5AV8D 3AZIC 3WAAB 2F8NH 5GT3C 5GSUB 2YFWB 3WTPB 4J8XD 2Y2KA 2NQBD 3A1IA 2NQBA 4R8PA 5AY8D 5BO0B 3X1TA 3F6TA 5AV5C 3AZND 3REKD 4J8VC 3AZNA 4Z5TD 4Z5TA 1WWIA 3B0CW 2NZDA 1EQZD 1EQZA 2ZY2A 5F99B 3KWQB 3MGQB 5JRGD 5JRGA 3WKJC 1P3OA 3W96D 3W96A 3AV2A 4WJ3C 5B31C 3X1SB 5DNMA 1P3BC 4YM6D 3WA9C 4YM6A 3EPJA 4H9RA 3C1BD 4Z66C 3C1BA 5B1MC 3AZJB 5B0ZC 5CP6C 5BNXA 3TU4D 1P3LA 3B0DC 3B6FD 3B6FA 4R8PB 3REIC 3UT9C 3W98D 5B31G 3W98A 3AZHB 3X1TB 2G5HC 3EG5B 3LJAA 4DQYB 1ID3C 3AZNB 2ZY3A 5AVBC 3R45B 2HUEC 2UWXA 4KGCB 4H9OA 4KHAB 3P5JB 2NZDB 4H9SA 1EQZB 2Y2IA 1KX4D 1HTAA 4QLCC 1KX4A 5E5AD 2BG1A 3AZLD 1AOID 3AZLA 3AZMC 5CPIC 2Y2JA 4LD9A 1P3OB 3AZEC 2Y2OA 1M1AC 3AV2B 3W96B 4ZBJB 4KUDD 4KUDA 3VH5A 2Y2MA 5DNMB 4HGAC 5B33C 5GT0D 5GT0A 3AZGD 4X23D 2XD5A 2ZY4A 3AZGA 2F8NG 1HQ3C 3EPLA 3KUYD 3O62A 3KUYA 3C1BB 5CPJB 3B0BA 5B24C 1P3ID 1P3LB 4WZSB 3B6FB 3UTAA 1P3GD 1KX3C 5BT1C 1P3GA 3FDDA 3LZ0C 1ZLAC 2FJ7C 3LJAB 1M19A 2G5IC 3NQUB 3UTBC 3AN2D 3X1VA 3KXBA 4G91B 5DNNC 4H9OB 3MVDD 3AZKB 3MVDA 4WU8C 2F8NK 1KX4B 1F66B 5B40C 5B2IC 3MNNC 1U35D 5B2JD 3AZLB 5DNNB 5B0YC 2IO5C 1U35A 3NQJA 1TZYD 1P34A 4LD9B 3AYWC 1P3AC 3LZ1D 3LZ1A 1R4VA 5GT0B 3RELD 3RELA 2XD1A 3O62B 3KUYB 3WAAD 5GSUD 3WTPD 4E45A 3WTPA 1T3UA 4JJNC 3UTAB 3AZFA 1F1EA 4UPKA 1P3GB 3KSYA 5BO0A 2CWEA 3X1UC 1M19B 1Q9CA 3AV1B 3X1VB 1P3KC 3KXBB 1P3MC 4ZUXC 2AROB 1KU5A 5FUGA 3KWQD 5AV5D 3KWQA 5AV5A 3X1UB 1BFMA 1P3FB 2Y2LA 3W99C 5GXQC 2Y2QA 1M18C 3V9RB 1P34B 1WWSA 2W8SA 2F2AC 3X1SD 3H0MC 3RELB 3WKJA 4NE3A 3AZJD 5B31D 3AZJA 1P3PC 5B31A 4M6BA 2DQNC 1P3BD 2JCHA 1P3BA 2LY8A 5AV6C 4R8PD 3AZFB 5B32C 5BS7A 4Z66D 3AZHD 3AZIB 4Z66A 3AZHA 5B1MA 3X1TD 2PYOC 5GT3B 5CP6D 4XUJC 5CP6A 5B0ZA 4G92C 1W2EA 3REJC 5CPKC 4KGCD 3B6GC 3R45A 4XZQC 3REID 3MGSC 3REIA 4KGCA 2NZDD 4KHAA 5FUGB 5AV5B 3EPHA 5AVBD 4J8VB 5AVBA 5B32G 3MGSB 4AWLC 5AV9C 1P3OD 2F8ND 4EO5C 3AV2D 1B67A 2F8NA 5DNMD 3REHC 3AZMA 5CPID 3WKJB 5CPIA 3AZEA 2Y2GA 5CPJD 5CPJA 5B31B 1P3LD 2HIOC 1P3BB 2JE5A 2YFVA 3C1CC 3WA9B 1HQ3A 4Z66B 5B1MB 3LJAD 1S32C 4NE6A 5B24A 5B0ZB 5CP6B 3NQUA 3B0DB 3VH6T 3LELC 4DRAA 5C3IC 5AV8C 5BT1D 3REIB 3AZKD 1KX3A 3UT9B 3AZKA 1ZLAD 3LZ0A 1ZLAA 4J8XC 1F66D 1ID3B 2NQBC 1F66A 5AVBB 4J8WC 5AY8C 2HUEB 5DNND 5DNNA 4LD9D 4WU8D 4WU8A 2F8NB 4QLCB 3REKC 4Z5TC 5B2IA 3MNNA 5B0YA 3AZMB 5CPIB 4CAYB 3O62D 2L5AA 3AYWD 3AZEB 3AYWA 1P3AA 1M1AB 5JRGC 5B33B 4H9NA 4HGAB 3VH5T 3UTAD 2YFVB 1HQ3B 4WU9C 3H0LC 3MGPC 1M19D 5B24B 4JJND 2DF4C 4JJNA 3AV1D 4YM6C 3X1VD 3AV1A 2RIQA 3KXBD 3W97C 1KX3B 3LZ0B 2AROD 3MGPB 1ZLAB 2AROA 3TU4C 2FJ7B 3X1UD 3X1UA 1P3FD 1P3FA 1ULYA 3UTBB 2CV5C 1P3KD 3W97B 1P3KA 3W98C 1P3MD 3V9RA 1P34D 1P3MA 5CHLB 4WU8B 1TAFA 5B40B 5B2IB 3MNNB 5B0YB 3MGRC 2IO5B 1M18A 1KX5C 1B6WA 3AYWB 1P3AB 5E5AC 4H9NB 1AOIC 3AZFD 3AZID 1BH8B 4KUDC 3AZIA 5GT3D 5GT3A 4JJNB 3AZGC 4X23C 5AV6A 3A6NC 5B32D 5B32A 2PYOD 1P3IC 2PYOA 5BNVB 4J8VD 5CPKD 4J8VA 5CPKA 3MGSD 4J8UC 2Y2PA 4WNNA 3MGSA 3B6GA 1P3KB 2VQRA 1P3MB 3H0RC 4ZUXB 1TAFB 3AN2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H9P A;  5GXQ B;  3W99 B;  3MVD C;  3WKJ D;  1M18 B;  3AFA C;  4YS3 C;  1U35 C;  5B2J C;  2RVQ C;  3WA9 D;  1TZY C;  3WA9 A;  5B1L C;  4DRB A;  5B1M D;  1P3P B;  2HIO D;  5JA4 B;  5B0Z D;  2HIO A;  3VH6 W;  5AV6 B;  3C1C D;  3C1C A;  3UT9 D;  3UT9 A;  3WAA C;  5B32 B;  1S32 D;  5GSU C;  3WTP C;  1S32 A;  2PYO B;  1ID3 D;  4XUJ B;  1ID3 A;  4G92 B;  3LEL A;  3REJ B;  5CPK B;  3B6G B;  4XZQ B;  4WNN B;  5AV8 A;  4NFT A;  4CSR B;  4QLC D;  4J8X A;  4QLC A;  2JSS A;  4J8W D;  4J8W A;  5AY8 A;  4H9P B;  4E44 A;  4Z2M H;  4AWL B;  3AZM D;  5AV9 B;  4CAY A;  3AZE D;  5F99 C;  4EO5 B;  3KWQ C;  3MGQ C;  1M1A D;  2BYK A;  1M1A A;  3REK A;  5B33 D;  5B33 A;  3REH B;  3VH5 W;  4WV4 B;  1HQ3 D;  5AVC C;  3X1S C;  1H3O B;  5B24 D;  2HIO B;  3WTP E;  4WU9 D;  1KX3 D;  3C1C B;  4WU9 A;  5AVC B;  3LZ0 D;  3MGP D;  3AZJ C;  3MGP A;  2FJ7 D;  1S32 B;  2FJ7 A;  4UUZ B;  3UTB D;  4R8P C;  3LEL B;  3UTB A;  3W97 D;  5AV8 B;  3W97 A;  5BS7 C;  5C3I B;  3AZH C;  3X1T C;  3VH6 A;  3TU4 A;  3AZN C;  4J8X B;  2NQB B;  5G49 A;  5B40 D;  2CV5 D;  4KGC C;  5B40 A;  1BH9 A;  2CV5 A;  5B2I D;  5AY8 B;  3MNN D;  4J8W B;  5B0Y D;  2NZD C;  1EQZ C;  1P3A D;  2BYK B;  3REK B;  4Z5T B;  3B0C T;  3MGR D;  1P3O C;  3MGR A;  1N1J A;  3W96 C;  3AV2 C;  1KX5 D;  4ZBJ C;  1BH8 A;  1KX5 A;  5DNM C;  5E5A A;  5JRG B;  1AOI A;  4WU9 B;  3C1B C;  5CPJ C;  1A7W A;  1P3L C;  3B6F C;  5BNV A;  4YM6 B;  4X23 A;  3A6N D;  3A6N A;  4H9R B;  2BYM A;  3LJA C;  4ZUX D;  1P3I A;  5BNX B;  4ZUX A;  3TU4 B;  4Z2M G;  5G49 B;  4J8U D;  2CV5 B;  1BH9 B;  4G91 C;  5GXQ D;  3W99 D;  4J8U A;  5GXQ A;  3AZK C;  1M18 D;  4H9S C;  3W98 B;  3W99 A;  4H9Q A;  1KX4 C;  1F66 C;  3AN2 A;  3AZL C;  4LD9 C;  3MGR B;  3AFA D;  1N1J B;  3AFA A;  4YS3 D;  1KX5 B;  4YS3 A;  1P3P D;  5E5A B;  1P3P A;  1JFI A;  4NE5 A;  5JA4 A;  5GT0 C;  1AOI B;  2RVQ D;  5KDM A;  5AV6 D;  5B2J A;  1TZY A;  3O62 C;  3KUY C;  5B1L D;  5B1L A;  4KUD B;  4XUJ D;  4XUJ A;  3REJ D;  3UTA C;  3AZG B;  4X23 B;  4XZQ D;  3REJ A;  3B6G D;  3A6N B;  4XZQ A;  1P3G C;  2BYM B;  3WAA A;  5GSU A;  2YFW A;  4CSR A;  1P3I B;  1M19 C;  3AV1 C;  3X1V C;  3KXB C;  4J8U B;  5AV9 D;  2ARO C;  5AV9 A;  4H9Q B;  1P3F C;  3REH D;  3AN2 B;  3REH A;  1P34 C;  3MVD B;  5F99 D;  3AFA B;  3MGQ D;  5F99 A;  3MGQ A;  3LZ1 C;  1H3O A;  4YS3 B;  1JFI B;  5KDM B;  3REL C;  1U35 B;  5B2J B;  3NQJ B;  1TZY B;  5AVC D;  5B1L B;  5AVC A;  3LZ1 B;  3X1S A;  4UUZ A;  3LEL D;  3AZF C;  5AV8 D;  3AZI C;  3WAA B;  2F8N H;  5GT3 C;  5GSU B;  2YFW B;  3WTP B;  4J8X D;  2NQB D;  2NQB A;  4R8P A;  5AY8 D;  5BO0 B;  3X1T A;  5AV5 C;  3AZN D;  3REK D;  4J8V C;  3AZN A;  4Z5T D;  4Z5T A;  1WWI A;  3B0C W;  2NZD A;  1EQZ D;  1EQZ A;  5F99 B;  3KWQ B;  3MGQ B;  5JRG D;  5JRG A;  3WKJ C;  1P3O A;  3W96 D;  3W96 A;  3AV2 A;  5B31 C;  3X1S B;  5DNM A;  1P3B C;  4YM6 D;  3WA9 C;  4YM6 A;  4H9R A;  3C1B D;  4Z66 C;  3C1B A;  5B1M C;  3AZJ B;  5B0Z C;  5CP6 C;  5BNX A;  3TU4 D;  1P3L A;  3B0D C;  3B6F D;  3B6F A;  4R8P B;  3REI C;  3UT9 C;  3W98 D;  5B31 G;  3W98 A;  3AZH B;  3X1T B;  3LJA A;  1ID3 C;  3AZN B;  5AVB C;  3R45 B;  2HUE C;  4KGC B;  4H9O A;  4KHA B;  2NZD B;  4H9S A;  1EQZ B;  1KX4 D;  1HTA A;  4QLC C;  1KX4 A;  5E5A D;  3AZL D;  1AOI D;  3AZL A;  3AZM C;  5CPI C;  4LD9 A;  1P3O B;  3AZE C;  1M1A C;  3AV2 B;  3W96 B;  4ZBJ B;  4KUD D;  4KUD A;  3VH5 A;  5DNM B;  4HGA C;  5B33 C;  5GT0 D;  5GT0 A;  3AZG D;  4X23 D;  3AZG A;  2F8N G;  1HQ3 C;  3KUY D;  3O62 A;  3KUY A;  3C1B B;  5CPJ B;  3B0B A;  5B24 C;  1P3I D;  1P3L B;  4WZS B;  3B6F B;  3UTA A;  1P3G D;  1KX3 C;  5BT1 C;  1P3G A;  3LZ0 C;  1ZLA C;  2FJ7 C;  3LJA B;  1M19 A;  3NQU B;  3UTB C;  3AN2 D;  3X1V A;  3KXB A;  4G91 B;  5DNN C;  4H9O B;  3MVD D;  3AZK B;  3MVD A;  4WU8 C;  2F8N K;  1KX4 B;  1F66 B;  5B40 C;  5B2I C;  3MNN C;  1U35 D;  5B2J D;  3AZL B;  5DNN B;  5B0Y C;  2IO5 C;  1U35 A;  3NQJ A;  1TZY D;  1P34 A;  4LD9 B;  3AYW C;  1P3A C;  3LZ1 D;  3LZ1 A;  1R4V A;  5GT0 B;  3REL D;  3REL A;  3O62 B;  3KUY B;  3WAA D;  5GSU D;  3WTP D;  4E45 A;  3WTP A;  4JJN C;  3UTA B;  3AZF A;  1F1E A;  1P3G B;  3KSY A;  5BO0 A;  2CWE A;  3X1U C;  1M19 B;  1Q9C A;  3AV1 B;  3X1V B;  1P3K C;  3KXB B;  1P3M C;  4ZUX C;  2ARO B;  1KU5 A;  5FUG A;  3KWQ D;  5AV5 D;  3KWQ A;  5AV5 A;  3X1U B;  1BFM A;  1P3F B;  3W99 C;  5GXQ C;  1M18 C;  3V9R B;  1P34 B;  1WWS A;  3X1S D;  3REL B;  3WKJ A;  4NE3 A;  3AZJ D;  5B31 D;  3AZJ A;  1P3P C;  5B31 A;  4M6B A;  1P3B D;  1P3B A;  2LY8 A;  5AV6 C;  4R8P D;  3AZF B;  5B32 C;  5BS7 A;  4Z66 D;  3AZH D;  3AZI B;  4Z66 A;  3AZH A;  3X1T D;  5B1M A;  2PYO C;  5GT3 B;  5CP6 D;  4XUJ C;  5CP6 A;  5B0Z A;  4G92 C;  3REJ C;  5CPK C;  4KGC D;  3B6G C;  3R45 A;  4XZQ C;  3REI D;  3MGS C;  3REI A;  4KGC A;  2NZD D;  4KHA A;  5FUG B;  5AV5 B;  5AVB D;  4J8V B;  5AVB A;  5B32 G;  3MGS B;  4AWL C;  5AV9 C;  1P3O D;  2F8N D;  4EO5 C;  3AV2 D;  1B67 A;  2F8N A;  5DNM D;  3REH C;  3AZM A;  5CPI D;  3WKJ B;  5CPI A;  3AZE A;  5CPJ D;  5CPJ A;  5B31 B;  1P3L D;  2HIO C;  1P3B B;  2YFV A;  3C1C C;  3WA9 B;  1HQ3 A;  4Z66 B;  5B1M B;  3LJA D;  1S32 C;  4NE6 A;  5B24 A;  5B0Z B;  5CP6 B;  3NQU A;  3B0D B;  3VH6 T;  3LEL C;  4DRA A;  5C3I C;  5AV8 C;  5BT1 D;  3REI B;  3AZK D;  1KX3 A;  3UT9 B;  3AZK A;  1ZLA D;  3LZ0 A;  1ZLA A;  4J8X C;  1F66 D;  1ID3 B;  2NQB C;  1F66 A;  5AVB B;  4J8W C;  5AY8 C;  2HUE B;  5DNN D;  5DNN A;  4LD9 D;  4WU8 D;  4WU8 A;  2F8N B;  4QLC B;  3REK C;  4Z5T C;  5B2I A;  3MNN A;  5B0Y A;  3AZM B;  5CPI B;  4CAY B;  3O62 D;  2L5A A;  3AYW D;  3AZE B;  3AYW A;  1P3A A;  1M1A B;  5JRG C;  5B33 B;  4H9N A;  4HGA B;  3VH5 T;  3UTA D;  2YFV B;  1HQ3 B;  4WU9 C;  3MGP C;  1M19 D;  5B24 B;  4JJN D;  4JJN A;  3AV1 D;  4YM6 C;  3X1V D;  3AV1 A;  3KXB D;  3W97 C;  1KX3 B;  3LZ0 B;  2ARO D;  3MGP B;  1ZLA B;  2ARO A;  3TU4 C;  2FJ7 B;  3X1U D;  3X1U A;  1P3F D;  1P3F A;  1ULY A;  3UTB B;  2CV5 C;  1P3K D;  3W97 B;  1P3K A;  3W98 C;  1P3M D;  3V9R A;  1P34 D;  1P3M A;  5CHL B;  4WU8 B;  1TAF A;  5B40 B;  5B2I B;  3MNN B;  5B0Y B;  3MGR C;  2IO5 B;  1M18 A;  1KX5 C;  1B6W A;  3AYW B;  1P3A B;  5E5A C;  4H9N B;  1AOI C;  3AZF D;  3AZI D;  1BH8 B;  4KUD C;  3AZI A;  5GT3 D;  5GT3 A;  4JJN B;  3AZG C;  4X23 C;  5AV6 A;  3A6N C;  5B32 D;  5B32 A;  2PYO D;  1P3I C;  2PYO A;  5BNV B;  4J8V D;  5CPK D;  4J8V A;  5CPK A;  3MGS D;  4J8U C;  3B6G A;  4WNN A;  3MGS A;  1P3K B;  1P3M B;  4ZUX B;  1TAF B;  3AN2 C; 
#chains in the Genus database with same CATH topology
 4H9P A;  5GXQ B;  3W99 B;  3MVD C;  3WKJ D;  1M18 B;  3AFA C;  4YS3 C;  1U35 C;  5B2J C;  2RVQ C;  3WA9 D;  1TZY C;  2J8P A;  3WA9 A;  5B1L C;  4DRB A;  5B1M D;  1P3P B;  2HIO D;  5JA4 B;  5B0Z D;  2HIO A;  3VH6 W;  5AV6 B;  3C1C D;  3C1C A;  3UT9 D;  3UT9 A;  2Y2H A;  3WAA C;  5B32 B;  1S32 D;  5GSU C;  3WTP C;  2Y2N A;  1S32 A;  2PYO B;  1ID3 D;  3KFU G;  4XUJ B;  1ID3 A;  4G92 B;  3LEL A;  3REJ B;  5CPK B;  3B6G B;  4XZQ B;  4WNN B;  5AV8 A;  3AL0 C;  4NFT A;  4CSR B;  4QLC D;  4J8X A;  4QLC A;  2JSS A;  4J8W D;  4J8W A;  5AY8 A;  4H9P B;  4E44 A;  4Z2M H;  4AWL B;  3AZM D;  5AV9 B;  4CAY A;  3AZE D;  5F99 C;  4EO5 B;  3KWQ C;  3MGQ C;  1M1A D;  2BYK A;  1M1A A;  3REK A;  5B33 D;  5B33 A;  3REH B;  3VH5 W;  4WV4 B;  1HQ3 D;  5AVC C;  3X1S C;  1H3O B;  5B24 D;  2HIO B;  3WTP E;  4WU9 D;  1KX3 D;  3C1C B;  4WU9 A;  5AVC B;  3LZ0 D;  3MGP D;  3AZJ C;  3MGP A;  2FJ7 D;  1S32 B;  2FJ7 A;  4UUZ B;  3UTB D;  4R8P C;  3LEL B;  3UTB A;  3W97 D;  5AV8 B;  3W97 A;  5BS7 C;  5C3I B;  3AZH C;  3X1T C;  3VH6 A;  3TU4 A;  3AZN C;  4J8X B;  2ZM5 A;  2NQB B;  5G49 A;  5B40 D;  2CV5 D;  4KGC C;  5B40 A;  1BH9 A;  2CV5 A;  5B2I D;  5AY8 B;  3MNN D;  4J8W B;  5B0Y D;  2NZD C;  3EPK A;  1EQZ C;  1P3A D;  2BYK B;  3REK B;  4Z5T B;  3B0C T;  3MGR D;  1P3O C;  3MGR A;  1N1J A;  3W96 C;  3AV2 C;  1KX5 D;  4ZBJ C;  1BH8 A;  1KX5 A;  5DNM C;  5E5A A;  5JRG B;  1Z2C B;  1AOI A;  4WU9 B;  3C1B C;  5CPJ C;  3IP4 C;  1A7W A;  1P3L C;  3B6F C;  2ZY5 A;  5BNV A;  4YM6 B;  4X23 A;  3A6N D;  3A6N A;  4H9R B;  2BYM A;  3LJA C;  4ZUX D;  1P3I A;  5BNX B;  4ZUX A;  3TU4 B;  4Z2M G;  5G49 B;  4J8U D;  2CV5 B;  3W99 D;  1BH9 B;  4G91 C;  5GXQ D;  4J8U A;  5GXQ A;  3AZK C;  1M18 D;  4H9S C;  3W98 B;  3W99 A;  4H9Q A;  1KX4 C;  1F66 C;  3A1K A;  3AN2 A;  3AZL C;  4LD9 C;  3MGR B;  3AFA D;  1N1J B;  3AFA A;  4YS3 D;  1KX5 B;  4YS3 A;  1P3P D;  5E5A B;  1P3P A;  1JFI A;  4NE5 A;  5JA4 A;  5GT0 C;  1AOI B;  2RVQ D;  5KDM A;  5AV6 D;  5B2J A;  1TZY A;  3O62 C;  3KUY C;  5B1L D;  5B1L A;  4KUD B;  1PZR A;  4XUJ D;  4XUJ A;  3REJ D;  3UTA C;  3AZG B;  4X23 B;  4XZQ D;  3REJ A;  3B6G D;  3A6N B;  4XZQ A;  1P3G C;  2BYM B;  3WAA A;  5GSU A;  2YFW A;  4CSR A;  1P3I B;  1M19 C;  3AV1 C;  2FFF B;  3X1V C;  3KXB C;  4J8U B;  5AV9 D;  2ARO C;  5AV9 A;  4H9Q B;  1P3F C;  3REH D;  3AN2 B;  3REH A;  1P34 C;  3MVD B;  5F99 D;  3AFA B;  3MGQ D;  5F99 A;  3MGQ A;  3LZ1 C;  1H3O A;  4YS3 B;  1JFI B;  5KDM B;  3REL C;  1U35 B;  5B2J B;  3NQJ B;  1TZY B;  5AVC D;  5B1L B;  5AVC A;  3LZ1 B;  3X1S A;  4UUZ A;  3LEL D;  3AZF C;  5AV8 D;  3AZI C;  3WAA B;  2F8N H;  5GT3 C;  5GSU B;  2YFW B;  3WTP B;  4J8X D;  2Y2K A;  2NQB D;  3A1I A;  2NQB A;  4R8P A;  5AY8 D;  5BO0 B;  3X1T A;  3F6T A;  5AV5 C;  3AZN D;  3REK D;  4J8V C;  3AZN A;  4Z5T D;  4Z5T A;  1WWI A;  3B0C W;  2NZD A;  1EQZ D;  1EQZ A;  2ZY2 A;  5F99 B;  3KWQ B;  3MGQ B;  5JRG D;  5JRG A;  3WKJ C;  1P3O A;  3W96 D;  3W96 A;  3AV2 A;  4WJ3 C;  5B31 C;  3X1S B;  5DNM A;  1P3B C;  4YM6 D;  3WA9 C;  4YM6 A;  3EPJ A;  4H9R A;  3C1B D;  4Z66 C;  3C1B A;  5B1M C;  3AZJ B;  5B0Z C;  5CP6 C;  5BNX A;  3TU4 D;  1P3L A;  3B0D C;  3B6F D;  3B6F A;  4R8P B;  3REI C;  3UT9 C;  3W98 D;  5B31 G;  3W98 A;  3AZH B;  3X1T B;  2G5H C;  3EG5 B;  3LJA A;  4DQY B;  1ID3 C;  3AZN B;  2ZY3 A;  5AVB C;  3R45 B;  2HUE C;  2UWX A;  4KGC B;  4H9O A;  4KHA B;  3P5J B;  2NZD B;  4H9S A;  1EQZ B;  2Y2I A;  1KX4 D;  1HTA A;  4QLC C;  1KX4 A;  5E5A D;  2BG1 A;  3AZL D;  1AOI D;  3AZL A;  3AZM C;  5CPI C;  2Y2J A;  4LD9 A;  1P3O B;  3AZE C;  2Y2O A;  1M1A C;  3AV2 B;  3W96 B;  4ZBJ B;  4KUD D;  4KUD A;  3VH5 A;  2Y2M A;  5DNM B;  4HGA C;  5B33 C;  5GT0 D;  5GT0 A;  3AZG D;  4X23 D;  2XD5 A;  2ZY4 A;  3AZG A;  2F8N G;  1HQ3 C;  3EPL A;  3KUY D;  3O62 A;  3KUY A;  3C1B B;  5CPJ B;  3B0B A;  5B24 C;  1P3I D;  1P3L B;  4WZS B;  3B6F B;  3UTA A;  1P3G D;  1KX3 C;  5BT1 C;  1P3G A;  3FDD A;  3LZ0 C;  1ZLA C;  2FJ7 C;  3LJA B;  1M19 A;  2G5I C;  3NQU B;  3UTB C;  3AN2 D;  3X1V A;  3KXB A;  4G91 B;  5DNN C;  4H9O B;  3MVD D;  3AZK B;  3MVD A;  4WU8 C;  2F8N K;  1KX4 B;  1F66 B;  5B40 C;  5B2I C;  3MNN C;  1U35 D;  5B2J D;  3AZL B;  5DNN B;  5B0Y C;  2IO5 C;  1U35 A;  3NQJ A;  1TZY D;  1P34 A;  4LD9 B;  3AYW C;  1P3A C;  3LZ1 D;  3LZ1 A;  1R4V A;  5GT0 B;  3REL D;  3REL A;  2XD1 A;  3O62 B;  3KUY B;  3WAA D;  5GSU D;  3WTP D;  4E45 A;  3WTP A;  1T3U A;  4JJN C;  3UTA B;  3AZF A;  1F1E A;  4UPK A;  1P3G B;  3KSY A;  5BO0 A;  2CWE A;  3X1U C;  1M19 B;  1Q9C A;  3AV1 B;  3X1V B;  1P3K C;  3KXB B;  1P3M C;  4ZUX C;  2ARO B;  1KU5 A;  5FUG A;  3KWQ D;  5AV5 D;  3KWQ A;  5AV5 A;  3X1U B;  1BFM A;  1P3F B;  2Y2L A;  3W99 C;  5GXQ C;  2Y2Q A;  1M18 C;  3V9R B;  1P34 B;  1WWS A;  2W8S A;  2F2A C;  3X1S D;  3H0M C;  3REL B;  3WKJ A;  4NE3 A;  3AZJ D;  5B31 D;  3AZJ A;  1P3P C;  5B31 A;  4M6B A;  2DQN C;  1P3B D;  2JCH A;  1P3B A;  2LY8 A;  5AV6 C;  4R8P D;  3AZF B;  5B32 C;  5BS7 A;  4Z66 D;  3AZH D;  3AZI B;  4Z66 A;  3AZH A;  5B1M A;  3X1T D;  2PYO C;  5GT3 B;  5CP6 D;  4XUJ C;  5CP6 A;  5B0Z A;  4G92 C;  1W2E A;  3REJ C;  5CPK C;  4KGC D;  3B6G C;  3R45 A;  4XZQ C;  3REI D;  3MGS C;  3REI A;  4KGC A;  2NZD D;  4KHA A;  5FUG B;  5AV5 B;  3EPH A;  5AVB D;  4J8V B;  5AVB A;  5B32 G;  3MGS B;  4AWL C;  5AV9 C;  1P3O D;  2F8N D;  4EO5 C;  3AV2 D;  1B67 A;  2F8N A;  5DNM D;  3REH C;  3AZM A;  5CPI D;  3WKJ B;  5CPI A;  3AZE A;  2Y2G A;  5CPJ D;  5CPJ A;  5B31 B;  1P3L D;  2HIO C;  1P3B B;  2JE5 A;  2YFV A;  3C1C C;  3WA9 B;  1HQ3 A;  4Z66 B;  5B1M B;  3LJA D;  1S32 C;  4NE6 A;  5B24 A;  5B0Z B;  5CP6 B;  3NQU A;  3B0D B;  3VH6 T;  3LEL C;  4DRA A;  5C3I C;  5AV8 C;  5BT1 D;  3REI B;  3AZK D;  1KX3 A;  3UT9 B;  3AZK A;  1ZLA D;  3LZ0 A;  1ZLA A;  4J8X C;  1F66 D;  1ID3 B;  2NQB C;  1F66 A;  5AVB B;  4J8W C;  5AY8 C;  2HUE B;  5DNN D;  5DNN A;  4LD9 D;  4WU8 D;  4WU8 A;  2F8N B;  4QLC B;  3REK C;  4Z5T C;  5B2I A;  3MNN A;  5B0Y A;  3AZM B;  5CPI B;  4CAY B;  3O62 D;  2L5A A;  3AYW D;  3AZE B;  3AYW A;  1P3A A;  1M1A B;  5JRG C;  5B33 B;  4H9N A;  4HGA B;  3VH5 T;  3UTA D;  2YFV B;  1HQ3 B;  4WU9 C;  3H0L C;  3MGP C;  1M19 D;  5B24 B;  4JJN D;  2DF4 C;  4JJN A;  3AV1 D;  4YM6 C;  3X1V D;  3AV1 A;  2RIQ A;  3KXB D;  3W97 C;  1KX3 B;  3LZ0 B;  2ARO D;  3MGP B;  1ZLA B;  2ARO A;  3TU4 C;  2FJ7 B;  3X1U D;  3X1U A;  1P3F D;  1P3F A;  1ULY A;  3UTB B;  2CV5 C;  1P3K D;  3W97 B;  1P3K A;  3W98 C;  1P3M D;  3V9R A;  1P34 D;  1P3M A;  5CHL B;  4WU8 B;  1TAF A;  5B40 B;  5B2I B;  3MNN B;  5B0Y B;  3MGR C;  2IO5 B;  1M18 A;  1KX5 C;  1B6W A;  3AYW B;  1P3A B;  5E5A C;  4H9N B;  1AOI C;  3AZF D;  3AZI D;  1BH8 B;  4KUD C;  3AZI A;  5GT3 D;  5GT3 A;  4JJN B;  3AZG C;  4X23 C;  5AV6 A;  3A6N C;  5B32 D;  5B32 A;  2PYO D;  1P3I C;  2PYO A;  5BNV B;  4J8V D;  5CPK D;  4J8V A;  5CPK A;  3MGS D;  4J8U C;  2Y2P A;  4WNN A;  3MGS A;  3B6G A;  1P3K B;  2VQR A;  1P3M B;  3H0R C;  4ZUX B;  1TAF B;  3AN2 C; 
#chains in the Genus database with same CATH homology
 4H9P A;  5GXQ B;  3W99 B;  3MVD C;  3WKJ D;  1M18 B;  3AFA C;  4YS3 C;  1U35 C;  5B2J C;  2RVQ C;  3WA9 D;  1TZY C;  2J8P A;  3WA9 A;  5B1L C;  4DRB A;  5B1M D;  1P3P B;  2HIO D;  5JA4 B;  5B0Z D;  2HIO A;  3VH6 W;  5AV6 B;  3C1C D;  3C1C A;  3UT9 D;  3UT9 A;  2Y2H A;  3WAA C;  5B32 B;  1S32 D;  5GSU C;  3WTP C;  2Y2N A;  1S32 A;  2PYO B;  1ID3 D;  3KFU G;  4XUJ B;  1ID3 A;  4G92 B;  3LEL A;  3REJ B;  5CPK B;  3B6G B;  4XZQ B;  4WNN B;  5AV8 A;  3AL0 C;  4NFT A;  4CSR B;  4QLC D;  4J8X A;  4QLC A;  2JSS A;  4J8W D;  4J8W A;  5AY8 A;  4H9P B;  4E44 A;  4Z2M H;  4AWL B;  3AZM D;  5AV9 B;  4CAY A;  3AZE D;  5F99 C;  4EO5 B;  3KWQ C;  3MGQ C;  1M1A D;  2BYK A;  1M1A A;  3REK A;  5B33 D;  5B33 A;  3REH B;  3VH5 W;  4WV4 B;  1HQ3 D;  5AVC C;  3X1S C;  1H3O B;  5B24 D;  2HIO B;  3WTP E;  4WU9 D;  1KX3 D;  3C1C B;  4WU9 A;  5AVC B;  3LZ0 D;  3MGP D;  3AZJ C;  3MGP A;  2FJ7 D;  1S32 B;  2FJ7 A;  4UUZ B;  3UTB D;  4R8P C;  3LEL B;  3UTB A;  3W97 D;  5AV8 B;  3W97 A;  5BS7 C;  5C3I B;  3AZH C;  3X1T C;  3VH6 A;  3TU4 A;  3AZN C;  4J8X B;  2ZM5 A;  2NQB B;  5G49 A;  5B40 D;  2CV5 D;  4KGC C;  5B40 A;  1BH9 A;  2CV5 A;  5B2I D;  5AY8 B;  3MNN D;  4J8W B;  5B0Y D;  2NZD C;  3EPK A;  1EQZ C;  1P3A D;  2BYK B;  3REK B;  4Z5T B;  3B0C T;  3MGR D;  1P3O C;  3MGR A;  1N1J A;  3W96 C;  3AV2 C;  1KX5 D;  4ZBJ C;  1BH8 A;  1KX5 A;  5DNM C;  5E5A A;  5JRG B;  1Z2C B;  1AOI A;  4WU9 B;  3C1B C;  5CPJ C;  3IP4 C;  1A7W A;  1P3L C;  3B6F C;  2ZY5 A;  5BNV A;  4YM6 B;  4X23 A;  3A6N D;  3A6N A;  4H9R B;  2BYM A;  3LJA C;  4ZUX D;  1P3I A;  5BNX B;  4ZUX A;  3TU4 B;  4Z2M G;  5G49 B;  4J8U D;  2CV5 B;  3W99 D;  1BH9 B;  4G91 C;  5GXQ D;  4J8U A;  5GXQ A;  3AZK C;  1M18 D;  4H9S C;  3W98 B;  3W99 A;  4H9Q A;  1KX4 C;  1F66 C;  3A1K A;  3AN2 A;  3AZL C;  4LD9 C;  3MGR B;  3AFA D;  1N1J B;  3AFA A;  4YS3 D;  1KX5 B;  4YS3 A;  1P3P D;  5E5A B;  1P3P A;  1JFI A;  4NE5 A;  5JA4 A;  5GT0 C;  1AOI B;  2RVQ D;  5KDM A;  5AV6 D;  5B2J A;  1TZY A;  3O62 C;  3KUY C;  5B1L D;  5B1L A;  4KUD B;  1PZR A;  4XUJ D;  4XUJ A;  3REJ D;  3UTA C;  3AZG B;  4X23 B;  4XZQ D;  3REJ A;  3B6G D;  3A6N B;  4XZQ A;  1P3G C;  2BYM B;  3WAA A;  5GSU A;  2YFW A;  4CSR A;  1P3I B;  1M19 C;  3AV1 C;  2FFF B;  3X1V C;  3KXB C;  4J8U B;  5AV9 D;  2ARO C;  5AV9 A;  4H9Q B;  1P3F C;  3REH D;  3AN2 B;  3REH A;  1P34 C;  3MVD B;  5F99 D;  3AFA B;  3MGQ D;  5F99 A;  3MGQ A;  3LZ1 C;  1H3O A;  4YS3 B;  1JFI B;  5KDM B;  3REL C;  1U35 B;  5B2J B;  3NQJ B;  1TZY B;  5AVC D;  5B1L B;  5AVC A;  3LZ1 B;  3X1S A;  4UUZ A;  3LEL D;  3AZF C;  5AV8 D;  3AZI C;  3WAA B;  2F8N H;  5GT3 C;  5GSU B;  2YFW B;  3WTP B;  4J8X D;  2Y2K A;  2NQB D;  3A1I A;  2NQB A;  4R8P A;  5AY8 D;  5BO0 B;  3X1T A;  3F6T A;  5AV5 C;  3AZN D;  3REK D;  4J8V C;  3AZN A;  4Z5T D;  4Z5T A;  1WWI A;  3B0C W;  2NZD A;  1EQZ D;  1EQZ A;  2ZY2 A;  5F99 B;  3KWQ B;  3MGQ B;  5JRG D;  5JRG A;  3WKJ C;  1P3O A;  3W96 D;  3W96 A;  3AV2 A;  4WJ3 C;  5B31 C;  3X1S B;  5DNM A;  1P3B C;  4YM6 D;  3WA9 C;  4YM6 A;  3EPJ A;  4H9R A;  3C1B D;  4Z66 C;  3C1B A;  5B1M C;  3AZJ B;  5B0Z C;  5CP6 C;  5BNX A;  3TU4 D;  1P3L A;  3B0D C;  3B6F D;  3B6F A;  4R8P B;  3REI C;  3UT9 C;  3W98 D;  5B31 G;  3W98 A;  3AZH B;  3X1T B;  2G5H C;  3EG5 B;  3LJA A;  4DQY B;  1ID3 C;  3AZN B;  2ZY3 A;  5AVB C;  3R45 B;  2HUE C;  2UWX A;  4KGC B;  4H9O A;  4KHA B;  3P5J B;  2NZD B;  4H9S A;  1EQZ B;  2Y2I A;  1KX4 D;  1HTA A;  4QLC C;  1KX4 A;  5E5A D;  2BG1 A;  3AZL D;  1AOI D;  3AZL A;  3AZM C;  5CPI C;  2Y2J A;  4LD9 A;  1P3O B;  3AZE C;  2Y2O A;  1M1A C;  3AV2 B;  3W96 B;  4ZBJ B;  4KUD D;  4KUD A;  3VH5 A;  2Y2M A;  5DNM B;  4HGA C;  5B33 C;  5GT0 D;  5GT0 A;  3AZG D;  4X23 D;  2XD5 A;  2ZY4 A;  3AZG A;  2F8N G;  1HQ3 C;  3EPL A;  3KUY D;  3O62 A;  3KUY A;  3C1B B;  5CPJ B;  3B0B A;  5B24 C;  1P3I D;  1P3L B;  4WZS B;  3B6F B;  3UTA A;  1P3G D;  1KX3 C;  5BT1 C;  1P3G A;  3FDD A;  3LZ0 C;  1ZLA C;  2FJ7 C;  3LJA B;  1M19 A;  2G5I C;  3NQU B;  3UTB C;  3AN2 D;  3X1V A;  3KXB A;  4G91 B;  5DNN C;  4H9O B;  3MVD D;  3AZK B;  3MVD A;  4WU8 C;  2F8N K;  1KX4 B;  1F66 B;  5B40 C;  5B2I C;  3MNN C;  1U35 D;  5B2J D;  3AZL B;  5DNN B;  5B0Y C;  2IO5 C;  1U35 A;  3NQJ A;  1TZY D;  1P34 A;  4LD9 B;  3AYW C;  1P3A C;  3LZ1 D;  3LZ1 A;  1R4V A;  5GT0 B;  3REL D;  3REL A;  2XD1 A;  3O62 B;  3KUY B;  3WAA D;  5GSU D;  3WTP D;  4E45 A;  3WTP A;  1T3U A;  4JJN C;  3UTA B;  3AZF A;  1F1E A;  4UPK A;  1P3G B;  3KSY A;  5BO0 A;  2CWE A;  3X1U C;  1M19 B;  1Q9C A;  3AV1 B;  3X1V B;  1P3K C;  3KXB B;  1P3M C;  4ZUX C;  2ARO B;  1KU5 A;  5FUG A;  3KWQ D;  5AV5 D;  3KWQ A;  5AV5 A;  3X1U B;  1BFM A;  1P3F B;  2Y2L A;  3W99 C;  5GXQ C;  2Y2Q A;  1M18 C;  3V9R B;  1P34 B;  1WWS A;  2W8S A;  2F2A C;  3X1S D;  3H0M C;  3REL B;  3WKJ A;  4NE3 A;  3AZJ D;  5B31 D;  3AZJ A;  1P3P C;  5B31 A;  4M6B A;  2DQN C;  1P3B D;  2JCH A;  1P3B A;  2LY8 A;  5AV6 C;  4R8P D;  3AZF B;  5B32 C;  5BS7 A;  4Z66 D;  3AZH D;  3AZI B;  4Z66 A;  3AZH A;  5B1M A;  3X1T D;  2PYO C;  5GT3 B;  5CP6 D;  4XUJ C;  5CP6 A;  5B0Z A;  4G92 C;  1W2E A;  3REJ C;  5CPK C;  4KGC D;  3B6G C;  3R45 A;  4XZQ C;  3REI D;  3MGS C;  3REI A;  4KGC A;  2NZD D;  4KHA A;  5FUG B;  5AV5 B;  3EPH A;  5AVB D;  4J8V B;  5AVB A;  5B32 G;  3MGS B;  4AWL C;  5AV9 C;  1P3O D;  2F8N D;  4EO5 C;  3AV2 D;  1B67 A;  2F8N A;  5DNM D;  3REH C;  3AZM A;  5CPI D;  3WKJ B;  5CPI A;  3AZE A;  2Y2G A;  5CPJ D;  5CPJ A;  5B31 B;  1P3L D;  2HIO C;  1P3B B;  2JE5 A;  2YFV A;  3C1C C;  3WA9 B;  1HQ3 A;  4Z66 B;  5B1M B;  3LJA D;  1S32 C;  4NE6 A;  5B24 A;  5B0Z B;  5CP6 B;  3NQU A;  3B0D B;  3VH6 T;  3LEL C;  4DRA A;  5C3I C;  5AV8 C;  5BT1 D;  3REI B;  3AZK D;  1KX3 A;  3UT9 B;  3AZK A;  1ZLA D;  3LZ0 A;  1ZLA A;  4J8X C;  1F66 D;  1ID3 B;  2NQB C;  1F66 A;  5AVB B;  4J8W C;  5AY8 C;  2HUE B;  5DNN D;  5DNN A;  4LD9 D;  4WU8 D;  4WU8 A;  2F8N B;  4QLC B;  3REK C;  4Z5T C;  5B2I A;  3MNN A;  5B0Y A;  3AZM B;  5CPI B;  4CAY B;  3O62 D;  2L5A A;  3AYW D;  3AZE B;  3AYW A;  1P3A A;  1M1A B;  5JRG C;  5B33 B;  4H9N A;  4HGA B;  3VH5 T;  3UTA D;  2YFV B;  1HQ3 B;  4WU9 C;  3H0L C;  3MGP C;  1M19 D;  5B24 B;  4JJN D;  2DF4 C;  4JJN A;  3AV1 D;  4YM6 C;  3X1V D;  3AV1 A;  2RIQ A;  3KXB D;  3W97 C;  1KX3 B;  3LZ0 B;  2ARO D;  3MGP B;  1ZLA B;  2ARO A;  3TU4 C;  2FJ7 B;  3X1U D;  3X1U A;  1P3F D;  1P3F A;  1ULY A;  3UTB B;  2CV5 C;  1P3K D;  3W97 B;  1P3K A;  3W98 C;  1P3M D;  3V9R A;  1P34 D;  1P3M A;  5CHL B;  4WU8 B;  1TAF A;  5B40 B;  5B2I B;  3MNN B;  5B0Y B;  3MGR C;  2IO5 B;  1M18 A;  1KX5 C;  1B6W A;  3AYW B;  1P3A B;  5E5A C;  4H9N B;  1AOI C;  3AZF D;  3AZI D;  1BH8 B;  4KUD C;  3AZI A;  5GT3 D;  5GT3 A;  4JJN B;  3AZG C;  4X23 C;  5AV6 A;  3A6N C;  5B32 D;  5B32 A;  2PYO D;  1P3I C;  2PYO A;  5BNV B;  4J8V D;  5CPK D;  4J8V A;  5CPK A;  3MGS D;  4J8U C;  2Y2P A;  4WNN A;  3MGS A;  3B6G A;  1P3K B;  2VQR A;  1P3M B;  3H0R C;  4ZUX B;  1TAF B;  3AN2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...