3W98B

Crystal structure of human nucleosome core particle lacking h3.1 n-terminal region
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
76
structure length
76
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 76
sequence length 76
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w98B00
1N1JB 3REKA 3AV2B 4KHAA 2NZDB 3UTBD 3LJAB 3B6FA 3LZ0A 4Z66C 5CP6A 4WU9C 4CSRB 1TZYC 3O62D 3R45A 1M18A 1KX5C 4J8WD 3AV1A 3MNNB 4G92C 5GT0C 4DRBA 3REJD 4YM6C 5GT3C 5CPKA 3W98C 5AY8A 3WTPD 3AZJC 5B31C 5B2JB 3KUYA 3WAAC 5B33C 4QLCB 3REHD 4R8PD 5AV8B 3MGQD 2FJ7B 3B6GA 2PYOB 1KX4B 1U35C 3NQJB 5B0YB 4Z2MH 5B2IB 3REKC 4J8XB 3LELD 1P3BC 3WA9A 4WNNB 5C3IC 5B24A 5AVBD 2BYMB 5JRGA 3B6FC 4JJNB 1JFIA 5CPIB 3UTBB 1M18C 3AYWC 3AZIA 4NE6A 3UT9B 3O62B 1F1EA 5G49B 3AZND 4J8WB 3AZFC 5B40A 4X23D 5AV6B 5CPKC 3MVDA 3WKJA 4H9QA 3MGRD 5AY8C 3B0BA 1P3FA 3X1SD 5BT1C 1KU5A 4E44A 3WTPB 3MGSD 3B6GC 5AV9D 3C1BD 3C1CB 1BFMA 4R8PB 3MGQB 3AZHC 2F8NG 4LD9D 5GXQA 3AZED 1HQ3D 1TAFB 3B0DC 5AV5A 3AZGB 1BH8B 4KGCD 5JRGC 1KX3D 4EO5C 1A7WA 3LELB 3A6NA 4KUDB 5B32G 5AVBB 1P3MC 2CV5A 3WTPE 3AZMB 3AZIC 3V9RB 3LZ1A 5B40C 2L5AA 2LY8A 3KXBA 1P3PD 3AZNB 3MVDC 3WKJC 4H9PB 4XZQA 1P3FC 3B0CT 3UTAD 4WU8B 1P3OD 1M1AA 3MGRB 3AZKD 4H9NB 4J8UA 3X1SB 4XUJA 5GSUA 1P3AA 5BNXA 5DNNA 4HGAC 5AV9B 2HIOD 1M19B 5B1LA 4Z5TB 5B1MD 5CPJD 5AVCA 3AV2D 4DRAA 5AV5C 1HQ3B 3A6NC 4KGCB 1ZLAD 2HUEC 1KX3B 2CV5C 1Q9CA 1P3ID 5JA4B 1P3KA 4Z66A 3LZ1C 2AROA 4WV4B 4ZBJC 4WU9A 3REHC 5E5AD 2YFWA 1P3GB 5BS7A 4YS3B 3X1UB 5GT0A 1P3PB 1F66D 3W96D 4YM6A 2IO5C 5BNVA 4QLCD 4H9RB 4J8UC 5AV8D 5KDMB 2FJ7D 5F99A 5B31A 3KWQA 3WAAA 3AZKB 5GSUC 1KX4D 5DNNC 5B0YD 5B1LC 2YFVB 5B2ID 4ZUXA 3AZLD 5AVCC 4J8VA 3W97D 5B1MB 5CPJB 3TU4A 4JJND 1P3BA 4X23C 5CPID 4KHAB 3VH5A 3REID 3AN2D 3VH6A 1ID3A 1P3KC 1ZLAB 2AROC 5C3IB 3UT9D 3B6FB 3LZ0B 1P3IB 2JSSA 1P3OA 5CP6B 3AYWA 5BS7C 2NQBD 3R45B 3W99D 5E5AB 5AV6D 5B0ZA 3AV1B 3AZFA 4LD9C 3AZEC 3MGPD 3VH5T 4G91C 3VH6T 3X1VA 1F66B 3W96B 2RVQC 5F99C 5CPKB 3KWQC 2NZDA 5DNMD 3LJAA 3C1CD 2F8ND 3KUYB 3NQUB 4ZUXC 5FUGB 3AZHA 4J8VC 3AZLB 3AFAA 3AZGD 2F8NH 3MNNA 3TU4C 5B32D 4KUDD 3W97B 1ID3C 3WA9B 3B0DB 3AZMD 5B24B 3REIB 1P34D 3AN2B 3UTAC 1B67A 1BH9B 5B2JA 1P3OC 1AOID 1P3MA 3X1TD 5BO0B 2PYOA 5B0ZC 3NQJA 2NQBB 2HIOC 4AWLB 3W99B 5B2IA 3AV2C 4J8XA 4WU8D 3X1VC 1P3LD 1EQZA 2NZDC 4H9QB 3LJAC 3MGPB 1P3FB 5DNMB 3UTBA 1M19D 4Z5TD 2F8NB 3AFAC 1S32D 3RELB 3MNNC 3O62A 4J8WA 5GXQB 5B32B 4NE3A 3REJA 5B2JC 3A6NB 4QLCC 3KSYA 1P3GD 4M6BA 5AV8C 3WTPA 5CHLB 1P34B 1AOIB 2FJ7C 2PYOC 1TZYD 4YS3D 3REHA 3X1UD 4R8PA 1KX5D 2BYKA 3MGQA 3X1TB 5B2IC 4J8XC 3KXBB 1EQZC 1TAFA 1BH8A 5GT3D 4XZQB 3LELA 4JJNC 1P3LB 5CPIC 3AZJD 1M1AB 3UTBC 5B33D 5AVBA 4J8UB 4XUJB 5GSUB 3O62C 1P3AB 1U35D 1R4VA 4CAYB 4J8WC 1H3OB 1S32B 3REKD 3AZNA 3REJC 4H9PA 4NFTA 4H9OA 4X23A 3B6FD 4WU8A 3LZ0D 3MGRA 4H9NA 5CP6D 3WTPC 3X1SA 4R8PC 4Z66B 3MGQC 3AV1D 3MGSA 4WU9B 5AV9A 2YFWB 1TZYB 3C1BA 1KX5B 4LD9A 4G92B 5GT0B 5CPKD 3AZEA 1HQ3A 3LELC 5AY8D 4KUDC 3KUYD 4YM6B 4KGCA 5GT3B 5BNVB 5AVBC 3W98B 5BT1D 1KX3A 4G91B 3AZMC 3AZJB 5JA4A 5B31B 3KWQB 3B6GD 5B33B 3WAAB 5B31G 1P3GA 3AZNC 4YS3A 1U35B 4E45A 4J8VB 3WA9D 1ULYA 3REKB 5B24D 1P3PA 5JRGD 4WU8C 3MGRC 1P3BB 4H9RA 4UUZA 5KDMA 3X1SC 3UTAA 3AZKA 2F8NK 3AZID 3MGSC 5AV9C 3C1BC 1M19C 4Z5TC 1M18B 3AYWB 5B40D 2HIOA 3MVDD 1N1JA 1HQ3C 5B1MA 3AZFB 3AV2A 4WZSB 5CPJA 1P3FD 4KGCC 1KX3C 5AY8B 3X1VB 1ZLAA 3RELD 4CSRA 1P3IA 1P3GC 3B6GB 4YS3C 5GXQD 5E5AA 3X1UC 3AZHB 3AFAB 5AV5D 1P3PC 3A6ND 3W96A 1F66A 5JRGB 4EO5B 2CV5D 1JFIB 4QLCA 3AZKC 3LZ1D 5AV8A 3NQUA 2FJ7A 1P3MB 5FUGA 3AZIB 1KX4A 2CWEA 3KXBD 5B0YA 1HTAA 3AZLA 5B1MC 5CPJC 5B40B 4XZQD 4NE5A 3MVDB 3W97A 4WNNA 1M1AD 3WKJB 2BYMA 1EQZB 4J8UD 4JJNA 1ZLAC 5CPIA 4XUJD 3REIA 3AN2A 1BH9A 3B0CW 5GSUD 3LZ0C 1P3IC 1P3AD 5CP6C 5DNND 5B1LD 5BO0A 3UT9A 5E5AC 1WWSA 5AVCD 1B6WA 5G49A 4HGAB 3AV1C 2NQBA 3W99A 5AV6A 5AV5B 3W96C 1F66C 3REJB 3MGPA 1P3KD 4Z66D 2AROD 2HUEB 3KUYC 4WU9D 2CV5B 5DNMA 3C1CA 1KX4C 2F8NA 3LZ1B 4ZBJB 5B0YC 3REHB 3AZLC 3RELA 5GT0D 2BYKB 4Z2MG 3W97C 1WWIA 4YM6D 3AZGA 3W98D 5B32A 3WA9C 4KUDA 2RVQD 5F99D 5B31D 5B24C 3KWQD 2IO5B 3REIC 3AN2C 3WAAD 3AZMA 3V9RA 4ZUXD 3UT9C 1P34A 1AOIA 5BNXB 5DNNB 4H9SA 4J8VD 5B1LB 3X1TA 2NQBC 4AWLC 3W99C 5AV6C 5AVCB 3TU4D 1P3BD 3MGPC 1ID3D 4H9OB 4X23B 1P3LA 5DNMC 3C1CC 1M18D 1P3KB 3AYWD 2AROB 3RELC 1M19A 5B0ZD 4Z5TA 3MGSB 3AZFD 4CAYA 3C1BB 1H3OA 5GXQC 3AZGC 1S32A 5B32C 3X1VD 4LD9B 2NZDD 3LJAD 3AZEB 3VH5W 5F99B 1P34C 3VH6W 1AOIC 4H9SC 3AZHD 3X1TC 4ZUXB 3AFAD 3MNND 1TZYA 3X1UA 1KX5A 3KXBC 3TU4B 4XZQC 1P3LC 1M1AC 5B2JD 5GT3A 1ID3B 1P3MD 3W98A 4UUZB 3AZJA 4XUJC 3UTAB 1P3OB 5B33A 2PYOD 2YFVA 1P3AC 1S32C 5B0ZB 3WKJD 4J8XD 1U35A 2HIOB 1EQZD
chains in the Genus database with same CATH superfamily
1N1JB 3REKA 3AV2B 4KHAA 2NZDB 3UTBD 3LJAB 3B6FA 3LZ0A 4Z66C 2J8PA 5CP6A 4WU9C 4CSRB 1TZYC 3O62D 3R45A 1M18A 4WJ3C 1KX5C 4J8WD 3AV1A 3MNNB 4G92C 5GT0C 4DRBA 3REJD 1Z2CB 4YM6C 5GT3C 5CPKA 3W98C 5AY8A 3WTPD 3AZJC 5B31C 5B2JB 3KUYA 3WAAC 5B33C 4QLCB 3REHD 4R8PD 5AV8B 3MGQD 2FJ7B 3B6GA 2PYOB 1KX4B 1U35C 3NQJB 5B0YB 4Z2MH 5B2IB 3REKC 4J8XB 2DF4C 3LELD 1P3BC 3WA9A 4WNNB 5C3IC 5B24A 5AVBD 2BYMB 5JRGA 3B6FC 4JJNB 1JFIA 5CPIB 3UTBB 1M18C 3AYWC 3A1IA 3AZIA 4NE6A 3UT9B 3O62B 1F1EA 5G49B 3AZND 4J8WB 3EPKA 3AZFC 5B40A 4X23D 5AV6B 5CPKC 3MVDA 3WKJA 4H9QA 3MGRD 5AY8C 3B0BA 2Y2HA 1P3FA 3X1SD 5BT1C 1KU5A 4E44A 3WTPB 3MGSD 3B6GC 5AV9D 3C1BD 3C1CB 1BFMA 4R8PB 3MGQB 3AZHC 2F8NG 4LD9D 5GXQA 3AZED 1HQ3D 1TAFB 3B0DC 5AV5A 3AZGB 1BH8B 4KGCD 5JRGC 1KX3D 4EO5C 1A7WA 3LELB 3A6NA 4KUDB 5B32G 2BG1A 5AVBB 1P3MC 2CV5A 3WTPE 2JCHA 3AZMB 3AZIC 3V9RB 3LZ1A 5B40C 2L5AA 2LY8A 3KXBA 1P3PD 3AZNB 3MVDC 3WKJC 4H9PB 4XZQA 1P3FC 3B0CT 3UTAD 4WU8B 1P3OD 1M1AA 3MGRB 3AZKD 4H9NB 4J8UA 3X1SB 4XUJA 5GSUA 1P3AA 5BNXA 5DNNA 4HGAC 5AV9B 2HIOD 3EPJA 1M19B 5B1LA 4Z5TB 5B1MD 5CPJD 5AVCA 3AV2D 4DRAA 5AV5C 3P5JB 1HQ3B 3A6NC 4KGCB 1ZLAD 2HUEC 1KX3B 2CV5C 1Q9CA 1P3ID 5JA4B 1P3KA 4Z66A 3LZ1C 2AROA 4WV4B 4ZBJC 4WU9A 3REHC 5E5AD 2YFWA 1P3GB 5BS7A 4YS3B 2Y2NA 3X1UB 5GT0A 1P3PB 1F66D 3W96D 2Y2JA 4YM6A 2IO5C 5BNVA 4QLCD 4H9RB 4J8UC 5AV8D 5KDMB 2FJ7D 5F99A 5B31A 3KWQA 3WAAA 3AZKB 5GSUC 1KX4D 5DNNC 5B0YD 5B1LC 2FFFB 2YFVB 1PZRA 5B2ID 4ZUXA 3AZLD 5AVCC 4J8VA 3W97D 5B1MB 5CPJB 3TU4A 4JJND 1P3BA 4X23C 5CPID 4KHAB 3VH5A 3REID 3AN2D 3VH6A 1ID3A 1P3KC 1ZLAB 2AROC 5C3IB 3UT9D 3B6FB 3LZ0B 1P3IB 2JSSA 1P3OA 5CP6B 3AYWA 5BS7C 2NQBD 3H0RC 3R45B 3W99D 5E5AB 5AV6D 3A1KA 3F6TA 5B0ZA 3AV1B 3AZFA 4LD9C 2JE5A 3AZEC 3MGPD 2ZY3A 3VH5T 4G91C 3VH6T 3X1VA 1F66B 3W96B 2RVQC 5F99C 5CPKB 3KWQC 2NZDA 5DNMD 3LJAA 3C1CD 2F8ND 3KUYB 3NQUB 4ZUXC 5FUGB 3AZHA 4J8VC 1T3UA 3AZLB 3AFAA 3AZGD 2F8NH 3MNNA 3TU4C 5B32D 4KUDD 2ZY4A 3W97B 1ID3C 3WA9B 3B0DB 3AZMD 5B24B 3REIB 1P34D 3AN2B 3UTAC 1B67A 1BH9B 5B2JA 1P3OC 1AOID 1P3MA 2Y2GA 3X1TD 4UPKA 5BO0B 2PYOA 5B0ZC 3NQJA 2NQBB 2Y2PA 2HIOC 4AWLB 3W99B 5B2IA 3AV2C 4J8XA 4WU8D 3X1VC 1P3LD 1EQZA 2NZDC 4H9QB 3LJAC 3MGPB 2G5IC 3H0MC 1P3FB 5DNMB 3UTBA 1M19D 4Z5TD 2F8NB 2Y2IA 1W2EA 3AFAC 3RELB 1S32D 3MNNC 3O62A 4J8WA 5GXQB 3EG5B 5B32B 4NE3A 3EPLA 3REJA 5B2JC 2G5HC 3A6NB 4QLCC 3KSYA 1P3GD 4M6BA 5AV8C 5CHLB 3WTPA 1P34B 1AOIB 2FJ7C 2PYOC 1TZYD 4YS3D 3REHA 3X1UD 2W8SA 4R8PA 1KX5D 2BYKA 3MGQA 3X1TB 5B2IC 4J8XC 3KXBB 1EQZC 3EPHA 1TAFA 2Y2QA 1BH8A 5GT3D 4XZQB 3LELA 4JJNC 1P3LB 5CPIC 3AZJD 1M1AB 2UWXA 3UTBC 5B33D 5AVBA 4J8UB 4XUJB 5GSUB 3O62C 1P3AB 1U35D 1R4VA 4CAYB 4J8WC 1H3OB 1S32B 3REKD 3AZNA 3REJC 4H9PA 4NFTA 4H9OA 4X23A 3B6FD 4WU8A 3LZ0D 3MGRA 4H9NA 5CP6D 3WTPC 3KFUG 3X1SA 4R8PC 4Z66B 3MGQC 3AV1D 3MGSA 4WU9B 5AV9A 2YFWB 1TZYB 3C1BA 1KX5B 4LD9A 4G92B 5GT0B 5CPKD 3AZEA 1HQ3A 3LELC 5AY8D 4KUDC 3KUYD 4YM6B 4KGCA 5GT3B 5BNVB 5AVBC 3W98B 5BT1D 2Y2MA 4G91B 3AZMC 1KX3A 3AZJB 5JA4A 5B31B 3KWQB 3B6GD 5B33B 3WAAB 2ZY5A 5B31G 1P3GA 3AZNC 4YS3A 1U35B 4E45A 4J8VB 3WA9D 1ULYA 3REKB 5B24D 1P3PA 5JRGD 4WU8C 3MGRC 1P3BB 2Y2LA 4H9RA 4UUZA 5KDMA 3X1SC 3UTAA 3AZKA 2DQNC 3AZID 2F8NK 3MGSC 5AV9C 3C1BC 1M19C 4Z5TC 1M18B 3AYWB 5B40D 2HIOA 3MVDD 1N1JA 1HQ3C 5B1MA 3AZFB 3AV2A 4WZSB 5CPJA 1P3FD 4KGCC 1KX3C 5AY8B 3X1VB 1ZLAA 3FDDA 3RELD 4CSRA 1P3IA 1P3GC 3B6GB 4YS3C 5GXQD 5E5AA 3X1UC 3AZHB 3AFAB 5AV5D 1P3PC 3IP4C 3A6ND 3W96A 1F66A 5JRGB 4EO5B 2CV5D 1JFIB 4QLCA 3AZKC 3LZ1D 5AV8A 2ZY2A 3NQUA 2FJ7A 1P3MB 5FUGA 3AZIB 1KX4A 2CWEA 3KXBD 5B0YA 1HTAA 3AZLA 5B1MC 5CPJC 5B40B 4XZQD 4NE5A 3MVDB 3W97A 4WNNA 1M1AD 3WKJB 3H0LC 3AL0C 2BYMA 2XD1A 1EQZB 4J8UD 4JJNA 1ZLAC 5CPIA 4XUJD 3REIA 3AN2A 1BH9A 3B0CW 5GSUD 3LZ0C 1P3IC 1P3AD 5CP6C 5DNND 5B1LD 2F2AC 2XD5A 5E5AC 5BO0A 1WWSA 5AVCD 1B6WA 5G49A 3UT9A 4DQYB 4HGAB 3AV1C 2NQBA 3W99A 5AV6A 5AV5B 3W96C 1F66C 3REJB 3MGPA 1P3KD 4Z66D 2AROD 2HUEB 3KUYC 4WU9D 2CV5B 5DNMA 3C1CA 1KX4C 2F8NA 3LZ1B 4ZBJB 5B0YC 3REHB 3AZLC 3RELA 5GT0D 2BYKB 4Z2MG 3W97C 1WWIA 4YM6D 3AZGA 3W98D 2Y2KA 5B32A 3WA9C 4KUDA 2RVQD 5B24C 5F99D 5B31D 3KWQD 2IO5B 3REIC 3AN2C 3WAAD 3AZMA 3V9RA 4ZUXD 3UT9C 1P34A 1AOIA 5BNXB 5DNNB 4H9SA 4J8VD 5B1LB 3X1TA 2NQBC 4AWLC 3W99C 5AV6C 5AVCB 3TU4D 1P3BD 2RIQA 3MGPC 1ID3D 4H9OB 4X23B 1P3LA 5DNMC 3C1CC 1M18D 1P3KB 3AYWD 2AROB 3RELC 1M19A 5B0ZD 4Z5TA 3MGSB 2Y2OA 3AZFD 4CAYA 3C1BB 1H3OA 5GXQC 3AZGC 1S32A 5B32C 3X1VD 4LD9B 2ZM5A 2NZDD 3LJAD 3AZEB 3VH5W 5F99B 1P34C 3VH6W 1AOIC 4H9SC 3AZHD 3X1TC 4ZUXB 3AFAD 3MNND 1TZYA 3X1UA 1KX5A 3KXBC 3TU4B 4XZQC 1P3LC 1M1AC 5B2JD 5GT3A 1ID3B 1P3MD 3W98A 4UUZB 2VQRA 3AZJA 4XUJC 3UTAB 1P3OB 5B33A 2PYOD 2YFVA 1P3AC 1S32C 5B0ZB 3WKJD 4J8XD 1U35A 2HIOB 1EQZD
chains in the Genus database with same CATH topology
1N1JB 3REKA 3AV2B 4KHAA 2NZDB 3UTBD 3LJAB 3B6FA 3LZ0A 4Z66C 2J8PA 5CP6A 4WU9C 4CSRB 1TZYC 3O62D 3R45A 1M18A 4WJ3C 1KX5C 4J8WD 3AV1A 3MNNB 4G92C 5GT0C 4DRBA 3REJD 1Z2CB 4YM6C 5GT3C 5CPKA 3W98C 5AY8A 3WTPD 3AZJC 5B31C 5B2JB 3KUYA 3WAAC 5B33C 4QLCB 3REHD 4R8PD 5AV8B 3MGQD 2FJ7B 3B6GA 2PYOB 1KX4B 1U35C 3NQJB 5B0YB 4Z2MH 5B2IB 3REKC 4J8XB 2DF4C 3LELD 1P3BC 3WA9A 4WNNB 5C3IC 5B24A 5AVBD 2BYMB 5JRGA 3B6FC 4JJNB 1JFIA 5CPIB 3UTBB 1M18C 3AYWC 3A1IA 3AZIA 4NE6A 3UT9B 3O62B 1F1EA 5G49B 3AZND 4J8WB 3EPKA 3AZFC 5B40A 4X23D 5AV6B 5CPKC 3MVDA 3WKJA 4H9QA 3MGRD 5AY8C 3B0BA 2Y2HA 1P3FA 3X1SD 5BT1C 1KU5A 4E44A 3WTPB 3MGSD 3B6GC 5AV9D 3C1BD 3C1CB 1BFMA 4R8PB 3MGQB 3AZHC 2F8NG 4LD9D 5GXQA 3AZED 1HQ3D 1TAFB 3B0DC 5AV5A 3AZGB 1BH8B 4KGCD 5JRGC 1KX3D 4EO5C 1A7WA 3LELB 3A6NA 4KUDB 5B32G 2BG1A 5AVBB 1P3MC 2CV5A 3WTPE 2JCHA 3AZMB 3AZIC 3V9RB 3LZ1A 5B40C 2L5AA 2LY8A 3KXBA 1P3PD 3AZNB 3MVDC 3WKJC 4H9PB 4XZQA 1P3FC 3B0CT 3UTAD 4WU8B 1P3OD 1M1AA 3MGRB 3AZKD 4H9NB 4J8UA 3X1SB 4XUJA 5GSUA 1P3AA 5BNXA 5DNNA 4HGAC 5AV9B 2HIOD 3EPJA 1M19B 5B1LA 4Z5TB 5B1MD 5CPJD 5AVCA 3AV2D 4DRAA 5AV5C 3P5JB 1HQ3B 3A6NC 4KGCB 1ZLAD 2HUEC 1KX3B 2CV5C 1Q9CA 1P3ID 5JA4B 1P3KA 4Z66A 3LZ1C 2AROA 4WV4B 4ZBJC 4WU9A 3REHC 5E5AD 2YFWA 1P3GB 5BS7A 4YS3B 2Y2NA 3X1UB 5GT0A 1P3PB 1F66D 3W96D 2Y2JA 4YM6A 2IO5C 5BNVA 4QLCD 4H9RB 4J8UC 5AV8D 5KDMB 2FJ7D 5F99A 5B31A 3KWQA 3WAAA 3AZKB 5GSUC 1KX4D 5DNNC 5B0YD 5B1LC 2FFFB 2YFVB 1PZRA 5B2ID 4ZUXA 3AZLD 5AVCC 4J8VA 3W97D 5B1MB 5CPJB 3TU4A 4JJND 1P3BA 4X23C 5CPID 4KHAB 3VH5A 3REID 3AN2D 3VH6A 1ID3A 1P3KC 1ZLAB 2AROC 5C3IB 3UT9D 3B6FB 3LZ0B 1P3IB 2JSSA 1P3OA 5CP6B 3AYWA 5BS7C 2NQBD 3H0RC 3R45B 3W99D 5E5AB 5AV6D 3A1KA 3F6TA 5B0ZA 3AV1B 3AZFA 4LD9C 2JE5A 3AZEC 3MGPD 2ZY3A 3VH5T 4G91C 3VH6T 3X1VA 1F66B 3W96B 2RVQC 5F99C 5CPKB 3KWQC 2NZDA 5DNMD 3LJAA 3C1CD 2F8ND 3KUYB 3NQUB 4ZUXC 5FUGB 3AZHA 4J8VC 1T3UA 3AZLB 3AFAA 3AZGD 2F8NH 3MNNA 3TU4C 5B32D 4KUDD 2ZY4A 3W97B 1ID3C 3WA9B 3B0DB 3AZMD 5B24B 3REIB 1P34D 3AN2B 3UTAC 1B67A 1BH9B 5B2JA 1P3OC 1AOID 1P3MA 2Y2GA 3X1TD 4UPKA 5BO0B 2PYOA 5B0ZC 3NQJA 2NQBB 2Y2PA 2HIOC 4AWLB 3W99B 5B2IA 3AV2C 4J8XA 4WU8D 3X1VC 1P3LD 1EQZA 2NZDC 4H9QB 3LJAC 3MGPB 2G5IC 3H0MC 1P3FB 5DNMB 3UTBA 1M19D 4Z5TD 2F8NB 2Y2IA 1W2EA 3AFAC 3RELB 1S32D 3MNNC 3O62A 4J8WA 5GXQB 3EG5B 5B32B 4NE3A 3EPLA 3REJA 5B2JC 2G5HC 3A6NB 4QLCC 3KSYA 1P3GD 4M6BA 5AV8C 5CHLB 3WTPA 1P34B 1AOIB 2FJ7C 2PYOC 1TZYD 4YS3D 3REHA 3X1UD 2W8SA 4R8PA 1KX5D 2BYKA 3MGQA 3X1TB 5B2IC 4J8XC 3KXBB 1EQZC 3EPHA 1TAFA 2Y2QA 1BH8A 5GT3D 4XZQB 3LELA 4JJNC 1P3LB 5CPIC 3AZJD 1M1AB 2UWXA 3UTBC 5B33D 5AVBA 4J8UB 4XUJB 5GSUB 3O62C 1P3AB 1U35D 1R4VA 4CAYB 4J8WC 1H3OB 1S32B 3REKD 3AZNA 3REJC 4H9PA 4NFTA 4H9OA 4X23A 3B6FD 4WU8A 3LZ0D 3MGRA 4H9NA 5CP6D 3WTPC 3KFUG 3X1SA 4R8PC 4Z66B 3MGQC 3AV1D 3MGSA 4WU9B 5AV9A 2YFWB 1TZYB 3C1BA 1KX5B 4LD9A 4G92B 5GT0B 5CPKD 3AZEA 1HQ3A 3LELC 5AY8D 4KUDC 3KUYD 4YM6B 4KGCA 5GT3B 5BNVB 5AVBC 3W98B 5BT1D 2Y2MA 4G91B 3AZMC 1KX3A 3AZJB 5JA4A 5B31B 3KWQB 3B6GD 5B33B 3WAAB 2ZY5A 5B31G 1P3GA 3AZNC 4YS3A 1U35B 4E45A 4J8VB 3WA9D 1ULYA 3REKB 5B24D 1P3PA 5JRGD 4WU8C 3MGRC 1P3BB 2Y2LA 4H9RA 4UUZA 5KDMA 3X1SC 3UTAA 3AZKA 2DQNC 3AZID 2F8NK 3MGSC 5AV9C 3C1BC 1M19C 4Z5TC 1M18B 3AYWB 5B40D 2HIOA 3MVDD 1N1JA 1HQ3C 5B1MA 3AZFB 3AV2A 4WZSB 5CPJA 1P3FD 4KGCC 1KX3C 5AY8B 3X1VB 1ZLAA 3FDDA 3RELD 4CSRA 1P3IA 1P3GC 3B6GB 4YS3C 5GXQD 5E5AA 3X1UC 3AZHB 3AFAB 5AV5D 1P3PC 3IP4C 3A6ND 3W96A 1F66A 5JRGB 4EO5B 2CV5D 1JFIB 4QLCA 3AZKC 3LZ1D 5AV8A 2ZY2A 3NQUA 2FJ7A 1P3MB 5FUGA 3AZIB 1KX4A 2CWEA 3KXBD 5B0YA 1HTAA 3AZLA 5B1MC 5CPJC 5B40B 4XZQD 4NE5A 3MVDB 3W97A 4WNNA 1M1AD 3WKJB 3H0LC 3AL0C 2BYMA 2XD1A 1EQZB 4J8UD 4JJNA 1ZLAC 5CPIA 4XUJD 3REIA 3AN2A 1BH9A 3B0CW 5GSUD 3LZ0C 1P3IC 1P3AD 5CP6C 5DNND 5B1LD 2F2AC 2XD5A 5E5AC 5BO0A 1WWSA 5AVCD 1B6WA 5G49A 3UT9A 4DQYB 4HGAB 3AV1C 2NQBA 3W99A 5AV6A 5AV5B 3W96C 1F66C 3REJB 3MGPA 1P3KD 4Z66D 2AROD 2HUEB 3KUYC 4WU9D 2CV5B 5DNMA 3C1CA 1KX4C 2F8NA 3LZ1B 4ZBJB 5B0YC 3REHB 3AZLC 3RELA 5GT0D 2BYKB 4Z2MG 3W97C 1WWIA 4YM6D 3AZGA 3W98D 2Y2KA 5B32A 3WA9C 4KUDA 2RVQD 5B24C 5F99D 5B31D 3KWQD 2IO5B 3REIC 3AN2C 3WAAD 3AZMA 3V9RA 4ZUXD 3UT9C 1P34A 1AOIA 5BNXB 5DNNB 4H9SA 4J8VD 5B1LB 3X1TA 2NQBC 4AWLC 3W99C 5AV6C 5AVCB 3TU4D 1P3BD 2RIQA 3MGPC 1ID3D 4H9OB 4X23B 1P3LA 5DNMC 3C1CC 1M18D 1P3KB 3AYWD 2AROB 3RELC 1M19A 5B0ZD 4Z5TA 3MGSB 2Y2OA 3AZFD 4CAYA 3C1BB 1H3OA 5GXQC 3AZGC 1S32A 5B32C 3X1VD 4LD9B 2ZM5A 2NZDD 3LJAD 3AZEB 3VH5W 5F99B 1P34C 3VH6W 1AOIC 4H9SC 3AZHD 3X1TC 4ZUXB 3AFAD 3MNND 1TZYA 3X1UA 1KX5A 3KXBC 3TU4B 4XZQC 1P3LC 1M1AC 5B2JD 5GT3A 1ID3B 1P3MD 3W98A 4UUZB 2VQRA 3AZJA 4XUJC 3UTAB 1P3OB 5B33A 2PYOD 2YFVA 1P3AC 1S32C 5B0ZB 3WKJD 4J8XD 1U35A 2HIOB 1EQZD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N1J B;  3REK A;  3AV2 B;  4KHA A;  2NZD B;  3UTB D;  3LJA B;  3B6F A;  3LZ0 A;  4Z66 C;  5CP6 A;  4WU9 C;  4CSR B;  1TZY C;  3O62 D;  3R45 A;  1M18 A;  1KX5 C;  4J8W D;  3AV1 A;  3MNN B;  4G92 C;  5GT0 C;  4DRB A;  3REJ D;  4YM6 C;  5GT3 C;  5CPK A;  3W98 C;  5AY8 A;  3WTP D;  3AZJ C;  5B31 C;  5B2J B;  3KUY A;  3WAA C;  5B33 C;  4QLC B;  3REH D;  4R8P D;  5AV8 B;  3MGQ D;  2FJ7 B;  3B6G A;  2PYO B;  1KX4 B;  1U35 C;  3NQJ B;  5B0Y B;  4Z2M H;  5B2I B;  3REK C;  4J8X B;  3LEL D;  1P3B C;  3WA9 A;  4WNN B;  5C3I C;  5B24 A;  5AVB D;  2BYM B;  5JRG A;  3B6F C;  4JJN B;  1JFI A;  5CPI B;  3UTB B;  1M18 C;  3AYW C;  3AZI A;  4NE6 A;  3UT9 B;  3O62 B;  1F1E A;  5G49 B;  3AZN D;  4J8W B;  3AZF C;  5B40 A;  4X23 D;  5AV6 B;  5CPK C;  3MVD A;  3WKJ A;  4H9Q A;  3MGR D;  5AY8 C;  3B0B A;  1P3F A;  3X1S D;  5BT1 C;  1KU5 A;  4E44 A;  3WTP B;  3MGS D;  3B6G C;  5AV9 D;  3C1B D;  3C1C B;  1BFM A;  4R8P B;  3MGQ B;  3AZH C;  2F8N G;  4LD9 D;  5GXQ A;  3AZE D;  1HQ3 D;  1TAF B;  3B0D C;  5AV5 A;  3AZG B;  1BH8 B;  4KGC D;  5JRG C;  1KX3 D;  4EO5 C;  1A7W A;  3LEL B;  3A6N A;  4KUD B;  5B32 G;  5AVB B;  1P3M C;  2CV5 A;  3WTP E;  3AZM B;  3AZI C;  3V9R B;  3LZ1 A;  5B40 C;  2L5A A;  2LY8 A;  3KXB A;  1P3P D;  3AZN B;  3MVD C;  3WKJ C;  4H9P B;  4XZQ A;  1P3F C;  3B0C T;  3UTA D;  4WU8 B;  1P3O D;  1M1A A;  3MGR B;  3AZK D;  4H9N B;  4J8U A;  3X1S B;  4XUJ A;  5GSU A;  1P3A A;  5BNX A;  5DNN A;  4HGA C;  5AV9 B;  2HIO D;  1M19 B;  5B1L A;  4Z5T B;  5B1M D;  5CPJ D;  5AVC A;  3AV2 D;  4DRA A;  5AV5 C;  1HQ3 B;  3A6N C;  4KGC B;  1ZLA D;  2HUE C;  1KX3 B;  2CV5 C;  1Q9C A;  1P3I D;  5JA4 B;  1P3K A;  4Z66 A;  3LZ1 C;  2ARO A;  4WV4 B;  4ZBJ C;  4WU9 A;  3REH C;  5E5A D;  2YFW A;  1P3G B;  5BS7 A;  4YS3 B;  3X1U B;  5GT0 A;  1P3P B;  1F66 D;  3W96 D;  4YM6 A;  2IO5 C;  5BNV A;  4QLC D;  4H9R B;  4J8U C;  5AV8 D;  5KDM B;  2FJ7 D;  5F99 A;  5B31 A;  3KWQ A;  3WAA A;  3AZK B;  5GSU C;  1KX4 D;  5DNN C;  5B0Y D;  5B1L C;  2YFV B;  5B2I D;  4ZUX A;  3AZL D;  5AVC C;  4J8V A;  3W97 D;  5B1M B;  5CPJ B;  3TU4 A;  4JJN D;  1P3B A;  4X23 C;  5CPI D;  4KHA B;  3VH5 A;  3REI D;  3AN2 D;  3VH6 A;  1ID3 A;  1P3K C;  1ZLA B;  2ARO C;  5C3I B;  3UT9 D;  3B6F B;  3LZ0 B;  1P3I B;  2JSS A;  1P3O A;  5CP6 B;  3AYW A;  5BS7 C;  2NQB D;  3R45 B;  3W99 D;  5E5A B;  5AV6 D;  5B0Z A;  3AV1 B;  3AZF A;  4LD9 C;  3AZE C;  3MGP D;  3VH5 T;  4G91 C;  3VH6 T;  3X1V A;  1F66 B;  3W96 B;  2RVQ C;  5F99 C;  5CPK B;  3KWQ C;  2NZD A;  5DNM D;  3LJA A;  3C1C D;  2F8N D;  3KUY B;  3NQU B;  4ZUX C;  5FUG B;  3AZH A;  4J8V C;  3AZL B;  3AFA A;  3AZG D;  2F8N H;  3MNN A;  3TU4 C;  5B32 D;  4KUD D;  3W97 B;  1ID3 C;  3WA9 B;  3B0D B;  3AZM D;  5B24 B;  3REI B;  1P34 D;  3AN2 B;  3UTA C;  1B67 A;  1BH9 B;  5B2J A;  1P3O C;  1AOI D;  1P3M A;  3X1T D;  5BO0 B;  2PYO A;  5B0Z C;  3NQJ A;  2NQB B;  2HIO C;  4AWL B;  3W99 B;  5B2I A;  3AV2 C;  4J8X A;  4WU8 D;  3X1V C;  1P3L D;  1EQZ A;  2NZD C;  4H9Q B;  3LJA C;  3MGP B;  1P3F B;  5DNM B;  3UTB A;  1M19 D;  4Z5T D;  2F8N B;  3AFA C;  1S32 D;  3REL B;  3MNN C;  3O62 A;  4J8W A;  5GXQ B;  5B32 B;  4NE3 A;  3REJ A;  5B2J C;  3A6N B;  4QLC C;  3KSY A;  1P3G D;  4M6B A;  5AV8 C;  3WTP A;  5CHL B;  1P34 B;  1AOI B;  2FJ7 C;  2PYO C;  1TZY D;  4YS3 D;  3REH A;  3X1U D;  4R8P A;  1KX5 D;  2BYK A;  3MGQ A;  3X1T B;  5B2I C;  4J8X C;  3KXB B;  1EQZ C;  1TAF A;  1BH8 A;  5GT3 D;  4XZQ B;  3LEL A;  4JJN C;  1P3L B;  5CPI C;  3AZJ D;  1M1A B;  3UTB C;  5B33 D;  5AVB A;  4J8U B;  4XUJ B;  5GSU B;  3O62 C;  1P3A B;  1U35 D;  1R4V A;  4CAY B;  4J8W C;  1H3O B;  1S32 B;  3REK D;  3AZN A;  3REJ C;  4H9P A;  4NFT A;  4H9O A;  4X23 A;  3B6F D;  4WU8 A;  3LZ0 D;  3MGR A;  4H9N A;  5CP6 D;  3WTP C;  3X1S A;  4R8P C;  4Z66 B;  3MGQ C;  3AV1 D;  3MGS A;  4WU9 B;  5AV9 A;  2YFW B;  1TZY B;  3C1B A;  1KX5 B;  4LD9 A;  4G92 B;  5GT0 B;  5CPK D;  3AZE A;  1HQ3 A;  3LEL C;  5AY8 D;  4KUD C;  3KUY D;  4YM6 B;  4KGC A;  5GT3 B;  5BNV B;  5AVB C;  3W98 B;  5BT1 D;  1KX3 A;  4G91 B;  3AZM C;  3AZJ B;  5JA4 A;  5B31 B;  3KWQ B;  3B6G D;  5B33 B;  3WAA B;  5B31 G;  1P3G A;  3AZN C;  4YS3 A;  1U35 B;  4E45 A;  4J8V B;  3WA9 D;  1ULY A;  3REK B;  5B24 D;  1P3P A;  5JRG D;  4WU8 C;  3MGR C;  1P3B B;  4H9R A;  4UUZ A;  5KDM A;  3X1S C;  3UTA A;  3AZK A;  2F8N K;  3AZI D;  3MGS C;  5AV9 C;  3C1B C;  1M19 C;  4Z5T C;  1M18 B;  3AYW B;  5B40 D;  2HIO A;  3MVD D;  1N1J A;  1HQ3 C;  5B1M A;  3AZF B;  3AV2 A;  4WZS B;  5CPJ A;  1P3F D;  4KGC C;  1KX3 C;  5AY8 B;  3X1V B;  1ZLA A;  3REL D;  4CSR A;  1P3I A;  1P3G C;  3B6G B;  4YS3 C;  5GXQ D;  5E5A A;  3X1U C;  3AZH B;  3AFA B;  5AV5 D;  1P3P C;  3A6N D;  3W96 A;  1F66 A;  5JRG B;  4EO5 B;  2CV5 D;  1JFI B;  4QLC A;  3AZK C;  3LZ1 D;  5AV8 A;  3NQU A;  2FJ7 A;  1P3M B;  5FUG A;  3AZI B;  1KX4 A;  2CWE A;  3KXB D;  5B0Y A;  1HTA A;  3AZL A;  5B1M C;  5CPJ C;  5B40 B;  4XZQ D;  4NE5 A;  3MVD B;  3W97 A;  4WNN A;  1M1A D;  3WKJ B;  2BYM A;  1EQZ B;  4J8U D;  4JJN A;  1ZLA C;  5CPI A;  4XUJ D;  3REI A;  3AN2 A;  1BH9 A;  3B0C W;  5GSU D;  3LZ0 C;  1P3I C;  1P3A D;  5CP6 C;  5DNN D;  5B1L D;  5BO0 A;  3UT9 A;  5E5A C;  1WWS A;  5AVC D;  1B6W A;  5G49 A;  4HGA B;  3AV1 C;  2NQB A;  3W99 A;  5AV6 A;  5AV5 B;  3W96 C;  1F66 C;  3REJ B;  3MGP A;  1P3K D;  4Z66 D;  2ARO D;  2HUE B;  3KUY C;  4WU9 D;  2CV5 B;  5DNM A;  3C1C A;  1KX4 C;  2F8N A;  3LZ1 B;  4ZBJ B;  5B0Y C;  3REH B;  3AZL C;  3REL A;  5GT0 D;  2BYK B;  4Z2M G;  3W97 C;  1WWI A;  4YM6 D;  3AZG A;  3W98 D;  5B32 A;  3WA9 C;  4KUD A;  2RVQ D;  5F99 D;  5B31 D;  5B24 C;  3KWQ D;  2IO5 B;  3REI C;  3AN2 C;  3WAA D;  3AZM A;  3V9R A;  4ZUX D;  3UT9 C;  1P34 A;  1AOI A;  5BNX B;  5DNN B;  4H9S A;  4J8V D;  5B1L B;  3X1T A;  2NQB C;  4AWL C;  3W99 C;  5AV6 C;  5AVC B;  3TU4 D;  1P3B D;  3MGP C;  1ID3 D;  4H9O B;  4X23 B;  1P3L A;  5DNM C;  3C1C C;  1M18 D;  1P3K B;  3AYW D;  2ARO B;  3REL C;  1M19 A;  5B0Z D;  4Z5T A;  3MGS B;  3AZF D;  4CAY A;  3C1B B;  1H3O A;  5GXQ C;  3AZG C;  1S32 A;  5B32 C;  3X1V D;  4LD9 B;  2NZD D;  3LJA D;  3AZE B;  3VH5 W;  5F99 B;  1P34 C;  3VH6 W;  1AOI C;  4H9S C;  3AZH D;  3X1T C;  4ZUX B;  3AFA D;  3MNN D;  1TZY A;  3X1U A;  1KX5 A;  3KXB C;  3TU4 B;  4XZQ C;  1P3L C;  1M1A C;  5B2J D;  5GT3 A;  1ID3 B;  1P3M D;  3W98 A;  4UUZ B;  3AZJ A;  4XUJ C;  3UTA B;  1P3O B;  5B33 A;  2PYO D;  2YFV A;  1P3A C;  1S32 C;  5B0Z B;  3WKJ D;  4J8X D;  1U35 A;  2HIO B;  1EQZ D; 
#chains in the Genus database with same CATH topology
 1N1J B;  3REK A;  3AV2 B;  4KHA A;  2NZD B;  3UTB D;  3LJA B;  3B6F A;  3LZ0 A;  4Z66 C;  2J8P A;  5CP6 A;  4WU9 C;  4CSR B;  1TZY C;  3O62 D;  3R45 A;  1M18 A;  4WJ3 C;  1KX5 C;  4J8W D;  3AV1 A;  3MNN B;  4G92 C;  5GT0 C;  4DRB A;  3REJ D;  1Z2C B;  4YM6 C;  5GT3 C;  5CPK A;  3W98 C;  5AY8 A;  3WTP D;  3AZJ C;  5B31 C;  5B2J B;  3KUY A;  3WAA C;  5B33 C;  4QLC B;  3REH D;  4R8P D;  5AV8 B;  3MGQ D;  2FJ7 B;  3B6G A;  2PYO B;  1KX4 B;  1U35 C;  3NQJ B;  5B0Y B;  4Z2M H;  5B2I B;  3REK C;  4J8X B;  2DF4 C;  3LEL D;  1P3B C;  3WA9 A;  4WNN B;  5C3I C;  5B24 A;  5AVB D;  2BYM B;  5JRG A;  3B6F C;  4JJN B;  1JFI A;  5CPI B;  3UTB B;  1M18 C;  3AYW C;  3A1I A;  3AZI A;  4NE6 A;  3UT9 B;  3O62 B;  1F1E A;  5G49 B;  3AZN D;  4J8W B;  3EPK A;  3AZF C;  5B40 A;  4X23 D;  5AV6 B;  5CPK C;  3MVD A;  3WKJ A;  4H9Q A;  3MGR D;  5AY8 C;  3B0B A;  2Y2H A;  1P3F A;  3X1S D;  5BT1 C;  1KU5 A;  4E44 A;  3WTP B;  3MGS D;  3B6G C;  5AV9 D;  3C1B D;  3C1C B;  1BFM A;  4R8P B;  3MGQ B;  3AZH C;  2F8N G;  4LD9 D;  5GXQ A;  3AZE D;  1HQ3 D;  1TAF B;  3B0D C;  5AV5 A;  3AZG B;  1BH8 B;  4KGC D;  5JRG C;  1KX3 D;  4EO5 C;  1A7W A;  3LEL B;  3A6N A;  4KUD B;  5B32 G;  2BG1 A;  5AVB B;  1P3M C;  2CV5 A;  3WTP E;  2JCH A;  3AZM B;  3AZI C;  3V9R B;  3LZ1 A;  5B40 C;  2L5A A;  2LY8 A;  3KXB A;  1P3P D;  3AZN B;  3MVD C;  3WKJ C;  4H9P B;  4XZQ A;  1P3F C;  3B0C T;  3UTA D;  4WU8 B;  1P3O D;  1M1A A;  3MGR B;  3AZK D;  4H9N B;  4J8U A;  3X1S B;  4XUJ A;  5GSU A;  1P3A A;  5BNX A;  5DNN A;  4HGA C;  5AV9 B;  2HIO D;  3EPJ A;  1M19 B;  5B1L A;  4Z5T B;  5B1M D;  5CPJ D;  5AVC A;  3AV2 D;  4DRA A;  5AV5 C;  3P5J B;  1HQ3 B;  3A6N C;  4KGC B;  1ZLA D;  2HUE C;  1KX3 B;  2CV5 C;  1Q9C A;  1P3I D;  5JA4 B;  1P3K A;  4Z66 A;  3LZ1 C;  2ARO A;  4WV4 B;  4ZBJ C;  4WU9 A;  3REH C;  5E5A D;  2YFW A;  1P3G B;  5BS7 A;  4YS3 B;  2Y2N A;  3X1U B;  5GT0 A;  1P3P B;  1F66 D;  3W96 D;  2Y2J A;  4YM6 A;  2IO5 C;  5BNV A;  4QLC D;  4H9R B;  4J8U C;  5AV8 D;  5KDM B;  2FJ7 D;  5F99 A;  5B31 A;  3KWQ A;  3WAA A;  3AZK B;  5GSU C;  1KX4 D;  5DNN C;  5B0Y D;  5B1L C;  2FFF B;  2YFV B;  1PZR A;  5B2I D;  4ZUX A;  3AZL D;  5AVC C;  4J8V A;  3W97 D;  5B1M B;  5CPJ B;  3TU4 A;  4JJN D;  1P3B A;  4X23 C;  5CPI D;  4KHA B;  3VH5 A;  3REI D;  3AN2 D;  3VH6 A;  1ID3 A;  1P3K C;  1ZLA B;  2ARO C;  5C3I B;  3UT9 D;  3B6F B;  3LZ0 B;  1P3I B;  2JSS A;  1P3O A;  5CP6 B;  3AYW A;  5BS7 C;  2NQB D;  3H0R C;  3R45 B;  3W99 D;  5E5A B;  5AV6 D;  3A1K A;  3F6T A;  5B0Z A;  3AV1 B;  3AZF A;  4LD9 C;  2JE5 A;  3AZE C;  3MGP D;  2ZY3 A;  3VH5 T;  4G91 C;  3VH6 T;  3X1V A;  1F66 B;  3W96 B;  2RVQ C;  5F99 C;  5CPK B;  3KWQ C;  2NZD A;  5DNM D;  3LJA A;  3C1C D;  2F8N D;  3KUY B;  3NQU B;  4ZUX C;  5FUG B;  3AZH A;  4J8V C;  1T3U A;  3AZL B;  3AFA A;  3AZG D;  2F8N H;  3MNN A;  3TU4 C;  5B32 D;  4KUD D;  2ZY4 A;  3W97 B;  1ID3 C;  3WA9 B;  3B0D B;  3AZM D;  5B24 B;  3REI B;  1P34 D;  3AN2 B;  3UTA C;  1B67 A;  1BH9 B;  5B2J A;  1P3O C;  1AOI D;  1P3M A;  2Y2G A;  3X1T D;  4UPK A;  5BO0 B;  2PYO A;  5B0Z C;  3NQJ A;  2NQB B;  2Y2P A;  2HIO C;  4AWL B;  3W99 B;  5B2I A;  3AV2 C;  4J8X A;  4WU8 D;  3X1V C;  1P3L D;  1EQZ A;  2NZD C;  4H9Q B;  3LJA C;  3MGP B;  2G5I C;  3H0M C;  1P3F B;  5DNM B;  3UTB A;  1M19 D;  4Z5T D;  2F8N B;  2Y2I A;  1W2E A;  3AFA C;  3REL B;  1S32 D;  3MNN C;  3O62 A;  4J8W A;  5GXQ B;  3EG5 B;  5B32 B;  4NE3 A;  3EPL A;  3REJ A;  5B2J C;  2G5H C;  3A6N B;  4QLC C;  3KSY A;  1P3G D;  4M6B A;  5AV8 C;  5CHL B;  3WTP A;  1P34 B;  1AOI B;  2FJ7 C;  2PYO C;  1TZY D;  4YS3 D;  3REH A;  3X1U D;  2W8S A;  4R8P A;  1KX5 D;  2BYK A;  3MGQ A;  3X1T B;  5B2I C;  4J8X C;  3KXB B;  1EQZ C;  3EPH A;  1TAF A;  2Y2Q A;  1BH8 A;  5GT3 D;  4XZQ B;  3LEL A;  4JJN C;  1P3L B;  5CPI C;  3AZJ D;  1M1A B;  2UWX A;  3UTB C;  5B33 D;  5AVB A;  4J8U B;  4XUJ B;  5GSU B;  3O62 C;  1P3A B;  1U35 D;  1R4V A;  4CAY B;  4J8W C;  1H3O B;  1S32 B;  3REK D;  3AZN A;  3REJ C;  4H9P A;  4NFT A;  4H9O A;  4X23 A;  3B6F D;  4WU8 A;  3LZ0 D;  3MGR A;  4H9N A;  5CP6 D;  3WTP C;  3KFU G;  3X1S A;  4R8P C;  4Z66 B;  3MGQ C;  3AV1 D;  3MGS A;  4WU9 B;  5AV9 A;  2YFW B;  1TZY B;  3C1B A;  1KX5 B;  4LD9 A;  4G92 B;  5GT0 B;  5CPK D;  3AZE A;  1HQ3 A;  3LEL C;  5AY8 D;  4KUD C;  3KUY D;  4YM6 B;  4KGC A;  5GT3 B;  5BNV B;  5AVB C;  3W98 B;  5BT1 D;  2Y2M A;  4G91 B;  3AZM C;  1KX3 A;  3AZJ B;  5JA4 A;  5B31 B;  3KWQ B;  3B6G D;  5B33 B;  3WAA B;  2ZY5 A;  5B31 G;  1P3G A;  3AZN C;  4YS3 A;  1U35 B;  4E45 A;  4J8V B;  3WA9 D;  1ULY A;  3REK B;  5B24 D;  1P3P A;  5JRG D;  4WU8 C;  3MGR C;  1P3B B;  2Y2L A;  4H9R A;  4UUZ A;  5KDM A;  3X1S C;  3UTA A;  3AZK A;  2DQN C;  3AZI D;  2F8N K;  3MGS C;  5AV9 C;  3C1B C;  1M19 C;  4Z5T C;  1M18 B;  3AYW B;  5B40 D;  2HIO A;  3MVD D;  1N1J A;  1HQ3 C;  5B1M A;  3AZF B;  3AV2 A;  4WZS B;  5CPJ A;  1P3F D;  4KGC C;  1KX3 C;  5AY8 B;  3X1V B;  1ZLA A;  3FDD A;  3REL D;  4CSR A;  1P3I A;  1P3G C;  3B6G B;  4YS3 C;  5GXQ D;  5E5A A;  3X1U C;  3AZH B;  3AFA B;  5AV5 D;  1P3P C;  3IP4 C;  3A6N D;  3W96 A;  1F66 A;  5JRG B;  4EO5 B;  2CV5 D;  1JFI B;  4QLC A;  3AZK C;  3LZ1 D;  5AV8 A;  2ZY2 A;  3NQU A;  2FJ7 A;  1P3M B;  5FUG A;  3AZI B;  1KX4 A;  2CWE A;  3KXB D;  5B0Y A;  1HTA A;  3AZL A;  5B1M C;  5CPJ C;  5B40 B;  4XZQ D;  4NE5 A;  3MVD B;  3W97 A;  4WNN A;  1M1A D;  3WKJ B;  3H0L C;  3AL0 C;  2BYM A;  2XD1 A;  1EQZ B;  4J8U D;  4JJN A;  1ZLA C;  5CPI A;  4XUJ D;  3REI A;  3AN2 A;  1BH9 A;  3B0C W;  5GSU D;  3LZ0 C;  1P3I C;  1P3A D;  5CP6 C;  5DNN D;  5B1L D;  2F2A C;  2XD5 A;  5E5A C;  5BO0 A;  1WWS A;  5AVC D;  1B6W A;  5G49 A;  3UT9 A;  4DQY B;  4HGA B;  3AV1 C;  2NQB A;  3W99 A;  5AV6 A;  5AV5 B;  3W96 C;  1F66 C;  3REJ B;  3MGP A;  1P3K D;  4Z66 D;  2ARO D;  2HUE B;  3KUY C;  4WU9 D;  2CV5 B;  5DNM A;  3C1C A;  1KX4 C;  2F8N A;  3LZ1 B;  4ZBJ B;  5B0Y C;  3REH B;  3AZL C;  3REL A;  5GT0 D;  2BYK B;  4Z2M G;  3W97 C;  1WWI A;  4YM6 D;  3AZG A;  3W98 D;  2Y2K A;  5B32 A;  3WA9 C;  4KUD A;  2RVQ D;  5B24 C;  5F99 D;  5B31 D;  3KWQ D;  2IO5 B;  3REI C;  3AN2 C;  3WAA D;  3AZM A;  3V9R A;  4ZUX D;  3UT9 C;  1P34 A;  1AOI A;  5BNX B;  5DNN B;  4H9S A;  4J8V D;  5B1L B;  3X1T A;  2NQB C;  4AWL C;  3W99 C;  5AV6 C;  5AVC B;  3TU4 D;  1P3B D;  2RIQ A;  3MGP C;  1ID3 D;  4H9O B;  4X23 B;  1P3L A;  5DNM C;  3C1C C;  1M18 D;  1P3K B;  3AYW D;  2ARO B;  3REL C;  1M19 A;  5B0Z D;  4Z5T A;  3MGS B;  2Y2O A;  3AZF D;  4CAY A;  3C1B B;  1H3O A;  5GXQ C;  3AZG C;  1S32 A;  5B32 C;  3X1V D;  4LD9 B;  2ZM5 A;  2NZD D;  3LJA D;  3AZE B;  3VH5 W;  5F99 B;  1P34 C;  3VH6 W;  1AOI C;  4H9S C;  3AZH D;  3X1T C;  4ZUX B;  3AFA D;  3MNN D;  1TZY A;  3X1U A;  1KX5 A;  3KXB C;  3TU4 B;  4XZQ C;  1P3L C;  1M1A C;  5B2J D;  5GT3 A;  1ID3 B;  1P3M D;  3W98 A;  4UUZ B;  2VQR A;  3AZJ A;  4XUJ C;  3UTA B;  1P3O B;  5B33 A;  2PYO D;  2YFV A;  1P3A C;  1S32 C;  5B0Z B;  3WKJ D;  4J8X D;  1U35 A;  2HIO B;  1EQZ D; 
#chains in the Genus database with same CATH homology
 1N1J B;  3REK A;  3AV2 B;  4KHA A;  2NZD B;  3UTB D;  3LJA B;  3B6F A;  3LZ0 A;  4Z66 C;  2J8P A;  5CP6 A;  4WU9 C;  4CSR B;  1TZY C;  3O62 D;  3R45 A;  1M18 A;  4WJ3 C;  1KX5 C;  4J8W D;  3AV1 A;  3MNN B;  4G92 C;  5GT0 C;  4DRB A;  3REJ D;  1Z2C B;  4YM6 C;  5GT3 C;  5CPK A;  3W98 C;  5AY8 A;  3WTP D;  3AZJ C;  5B31 C;  5B2J B;  3KUY A;  3WAA C;  5B33 C;  4QLC B;  3REH D;  4R8P D;  5AV8 B;  3MGQ D;  2FJ7 B;  3B6G A;  2PYO B;  1KX4 B;  1U35 C;  3NQJ B;  5B0Y B;  4Z2M H;  5B2I B;  3REK C;  4J8X B;  2DF4 C;  3LEL D;  1P3B C;  3WA9 A;  4WNN B;  5C3I C;  5B24 A;  5AVB D;  2BYM B;  5JRG A;  3B6F C;  4JJN B;  1JFI A;  5CPI B;  3UTB B;  1M18 C;  3AYW C;  3A1I A;  3AZI A;  4NE6 A;  3UT9 B;  3O62 B;  1F1E A;  5G49 B;  3AZN D;  4J8W B;  3EPK A;  3AZF C;  5B40 A;  4X23 D;  5AV6 B;  5CPK C;  3MVD A;  3WKJ A;  4H9Q A;  3MGR D;  5AY8 C;  3B0B A;  2Y2H A;  1P3F A;  3X1S D;  5BT1 C;  1KU5 A;  4E44 A;  3WTP B;  3MGS D;  3B6G C;  5AV9 D;  3C1B D;  3C1C B;  1BFM A;  4R8P B;  3MGQ B;  3AZH C;  2F8N G;  4LD9 D;  5GXQ A;  3AZE D;  1HQ3 D;  1TAF B;  3B0D C;  5AV5 A;  3AZG B;  1BH8 B;  4KGC D;  5JRG C;  1KX3 D;  4EO5 C;  1A7W A;  3LEL B;  3A6N A;  4KUD B;  5B32 G;  2BG1 A;  5AVB B;  1P3M C;  2CV5 A;  3WTP E;  2JCH A;  3AZM B;  3AZI C;  3V9R B;  3LZ1 A;  5B40 C;  2L5A A;  2LY8 A;  3KXB A;  1P3P D;  3AZN B;  3MVD C;  3WKJ C;  4H9P B;  4XZQ A;  1P3F C;  3B0C T;  3UTA D;  4WU8 B;  1P3O D;  1M1A A;  3MGR B;  3AZK D;  4H9N B;  4J8U A;  3X1S B;  4XUJ A;  5GSU A;  1P3A A;  5BNX A;  5DNN A;  4HGA C;  5AV9 B;  2HIO D;  3EPJ A;  1M19 B;  5B1L A;  4Z5T B;  5B1M D;  5CPJ D;  5AVC A;  3AV2 D;  4DRA A;  5AV5 C;  3P5J B;  1HQ3 B;  3A6N C;  4KGC B;  1ZLA D;  2HUE C;  1KX3 B;  2CV5 C;  1Q9C A;  1P3I D;  5JA4 B;  1P3K A;  4Z66 A;  3LZ1 C;  2ARO A;  4WV4 B;  4ZBJ C;  4WU9 A;  3REH C;  5E5A D;  2YFW A;  1P3G B;  5BS7 A;  4YS3 B;  2Y2N A;  3X1U B;  5GT0 A;  1P3P B;  1F66 D;  3W96 D;  2Y2J A;  4YM6 A;  2IO5 C;  5BNV A;  4QLC D;  4H9R B;  4J8U C;  5AV8 D;  5KDM B;  2FJ7 D;  5F99 A;  5B31 A;  3KWQ A;  3WAA A;  3AZK B;  5GSU C;  1KX4 D;  5DNN C;  5B0Y D;  5B1L C;  2FFF B;  2YFV B;  1PZR A;  5B2I D;  4ZUX A;  3AZL D;  5AVC C;  4J8V A;  3W97 D;  5B1M B;  5CPJ B;  3TU4 A;  4JJN D;  1P3B A;  4X23 C;  5CPI D;  4KHA B;  3VH5 A;  3REI D;  3AN2 D;  3VH6 A;  1ID3 A;  1P3K C;  1ZLA B;  2ARO C;  5C3I B;  3UT9 D;  3B6F B;  3LZ0 B;  1P3I B;  2JSS A;  1P3O A;  5CP6 B;  3AYW A;  5BS7 C;  2NQB D;  3H0R C;  3R45 B;  3W99 D;  5E5A B;  5AV6 D;  3A1K A;  3F6T A;  5B0Z A;  3AV1 B;  3AZF A;  4LD9 C;  2JE5 A;  3AZE C;  3MGP D;  2ZY3 A;  3VH5 T;  4G91 C;  3VH6 T;  3X1V A;  1F66 B;  3W96 B;  2RVQ C;  5F99 C;  5CPK B;  3KWQ C;  2NZD A;  5DNM D;  3LJA A;  3C1C D;  2F8N D;  3KUY B;  3NQU B;  4ZUX C;  5FUG B;  3AZH A;  4J8V C;  1T3U A;  3AZL B;  3AFA A;  3AZG D;  2F8N H;  3MNN A;  3TU4 C;  5B32 D;  4KUD D;  2ZY4 A;  3W97 B;  1ID3 C;  3WA9 B;  3B0D B;  3AZM D;  5B24 B;  3REI B;  1P34 D;  3AN2 B;  3UTA C;  1B67 A;  1BH9 B;  5B2J A;  1P3O C;  1AOI D;  1P3M A;  2Y2G A;  3X1T D;  4UPK A;  5BO0 B;  2PYO A;  5B0Z C;  3NQJ A;  2NQB B;  2Y2P A;  2HIO C;  4AWL B;  3W99 B;  5B2I A;  3AV2 C;  4J8X A;  4WU8 D;  3X1V C;  1P3L D;  1EQZ A;  2NZD C;  4H9Q B;  3LJA C;  3MGP B;  2G5I C;  3H0M C;  1P3F B;  5DNM B;  3UTB A;  1M19 D;  4Z5T D;  2F8N B;  2Y2I A;  1W2E A;  3AFA C;  3REL B;  1S32 D;  3MNN C;  3O62 A;  4J8W A;  5GXQ B;  3EG5 B;  5B32 B;  4NE3 A;  3EPL A;  3REJ A;  5B2J C;  2G5H C;  3A6N B;  4QLC C;  3KSY A;  1P3G D;  4M6B A;  5AV8 C;  5CHL B;  3WTP A;  1P34 B;  1AOI B;  2FJ7 C;  2PYO C;  1TZY D;  4YS3 D;  3REH A;  3X1U D;  2W8S A;  4R8P A;  1KX5 D;  2BYK A;  3MGQ A;  3X1T B;  5B2I C;  4J8X C;  3KXB B;  1EQZ C;  3EPH A;  1TAF A;  2Y2Q A;  1BH8 A;  5GT3 D;  4XZQ B;  3LEL A;  4JJN C;  1P3L B;  5CPI C;  3AZJ D;  1M1A B;  2UWX A;  3UTB C;  5B33 D;  5AVB A;  4J8U B;  4XUJ B;  5GSU B;  3O62 C;  1P3A B;  1U35 D;  1R4V A;  4CAY B;  4J8W C;  1H3O B;  1S32 B;  3REK D;  3AZN A;  3REJ C;  4H9P A;  4NFT A;  4H9O A;  4X23 A;  3B6F D;  4WU8 A;  3LZ0 D;  3MGR A;  4H9N A;  5CP6 D;  3WTP C;  3KFU G;  3X1S A;  4R8P C;  4Z66 B;  3MGQ C;  3AV1 D;  3MGS A;  4WU9 B;  5AV9 A;  2YFW B;  1TZY B;  3C1B A;  1KX5 B;  4LD9 A;  4G92 B;  5GT0 B;  5CPK D;  3AZE A;  1HQ3 A;  3LEL C;  5AY8 D;  4KUD C;  3KUY D;  4YM6 B;  4KGC A;  5GT3 B;  5BNV B;  5AVB C;  3W98 B;  5BT1 D;  2Y2M A;  4G91 B;  3AZM C;  1KX3 A;  3AZJ B;  5JA4 A;  5B31 B;  3KWQ B;  3B6G D;  5B33 B;  3WAA B;  2ZY5 A;  5B31 G;  1P3G A;  3AZN C;  4YS3 A;  1U35 B;  4E45 A;  4J8V B;  3WA9 D;  1ULY A;  3REK B;  5B24 D;  1P3P A;  5JRG D;  4WU8 C;  3MGR C;  1P3B B;  2Y2L A;  4H9R A;  4UUZ A;  5KDM A;  3X1S C;  3UTA A;  3AZK A;  2DQN C;  3AZI D;  2F8N K;  3MGS C;  5AV9 C;  3C1B C;  1M19 C;  4Z5T C;  1M18 B;  3AYW B;  5B40 D;  2HIO A;  3MVD D;  1N1J A;  1HQ3 C;  5B1M A;  3AZF B;  3AV2 A;  4WZS B;  5CPJ A;  1P3F D;  4KGC C;  1KX3 C;  5AY8 B;  3X1V B;  1ZLA A;  3FDD A;  3REL D;  4CSR A;  1P3I A;  1P3G C;  3B6G B;  4YS3 C;  5GXQ D;  5E5A A;  3X1U C;  3AZH B;  3AFA B;  5AV5 D;  1P3P C;  3IP4 C;  3A6N D;  3W96 A;  1F66 A;  5JRG B;  4EO5 B;  2CV5 D;  1JFI B;  4QLC A;  3AZK C;  3LZ1 D;  5AV8 A;  2ZY2 A;  3NQU A;  2FJ7 A;  1P3M B;  5FUG A;  3AZI B;  1KX4 A;  2CWE A;  3KXB D;  5B0Y A;  1HTA A;  3AZL A;  5B1M C;  5CPJ C;  5B40 B;  4XZQ D;  4NE5 A;  3MVD B;  3W97 A;  4WNN A;  1M1A D;  3WKJ B;  3H0L C;  3AL0 C;  2BYM A;  2XD1 A;  1EQZ B;  4J8U D;  4JJN A;  1ZLA C;  5CPI A;  4XUJ D;  3REI A;  3AN2 A;  1BH9 A;  3B0C W;  5GSU D;  3LZ0 C;  1P3I C;  1P3A D;  5CP6 C;  5DNN D;  5B1L D;  2F2A C;  2XD5 A;  5E5A C;  5BO0 A;  1WWS A;  5AVC D;  1B6W A;  5G49 A;  3UT9 A;  4DQY B;  4HGA B;  3AV1 C;  2NQB A;  3W99 A;  5AV6 A;  5AV5 B;  3W96 C;  1F66 C;  3REJ B;  3MGP A;  1P3K D;  4Z66 D;  2ARO D;  2HUE B;  3KUY C;  4WU9 D;  2CV5 B;  5DNM A;  3C1C A;  1KX4 C;  2F8N A;  3LZ1 B;  4ZBJ B;  5B0Y C;  3REH B;  3AZL C;  3REL A;  5GT0 D;  2BYK B;  4Z2M G;  3W97 C;  1WWI A;  4YM6 D;  3AZG A;  3W98 D;  2Y2K A;  5B32 A;  3WA9 C;  4KUD A;  2RVQ D;  5B24 C;  5F99 D;  5B31 D;  3KWQ D;  2IO5 B;  3REI C;  3AN2 C;  3WAA D;  3AZM A;  3V9R A;  4ZUX D;  3UT9 C;  1P34 A;  1AOI A;  5BNX B;  5DNN B;  4H9S A;  4J8V D;  5B1L B;  3X1T A;  2NQB C;  4AWL C;  3W99 C;  5AV6 C;  5AVC B;  3TU4 D;  1P3B D;  2RIQ A;  3MGP C;  1ID3 D;  4H9O B;  4X23 B;  1P3L A;  5DNM C;  3C1C C;  1M18 D;  1P3K B;  3AYW D;  2ARO B;  3REL C;  1M19 A;  5B0Z D;  4Z5T A;  3MGS B;  2Y2O A;  3AZF D;  4CAY A;  3C1B B;  1H3O A;  5GXQ C;  3AZG C;  1S32 A;  5B32 C;  3X1V D;  4LD9 B;  2ZM5 A;  2NZD D;  3LJA D;  3AZE B;  3VH5 W;  5F99 B;  1P34 C;  3VH6 W;  1AOI C;  4H9S C;  3AZH D;  3X1T C;  4ZUX B;  3AFA D;  3MNN D;  1TZY A;  3X1U A;  1KX5 A;  3KXB C;  3TU4 B;  4XZQ C;  1P3L C;  1M1A C;  5B2J D;  5GT3 A;  1ID3 B;  1P3M D;  3W98 A;  4UUZ B;  2VQR A;  3AZJ A;  4XUJ C;  3UTA B;  1P3O B;  5B33 A;  2PYO D;  2YFV A;  1P3A C;  1S32 C;  5B0Z B;  3WKJ D;  4J8X D;  1U35 A;  2HIO B;  1EQZ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...