4Z66C

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
total genus 32
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4z66C00
3B6FC 3MNNB 5BNVA 5GT3D 3AZKB 5GT3A 3REJD 3O62B 3REJA 4YM6D 4YM6A 1HQ3B 4J8WC 1P3AC 1KU5A 3UTBB 5AV5C 5AV9C 5BT1D 3MVDB 3C1CB 5AVCB 4ZUXC 3AZNC 2NZDD 2F8ND 1P3FB 1F66B 4XUJB 2F8NG 3C1BC 2F8NA 2NZDA 2YFWB 1P3PC 4J8UB 5JA4B 4WNNA 1P3MB 3MGQB 3B0DC 4DRAA 3AFAB 3B6FD 3R45B 3W97D 3W97A 3KWQB 5CPKA 4ZBJC 1R4VA 4J8WD 3LZ1D 3A6NC 3LZ1A 4J8WA 4KUDB 5AV5D 2YFVB 2AROA 4JJND 5AV9D 1H3OA 4JJNA 1KX5B 3LELB 4ZUXD 3AZGC 5AVBD 5AVBA 2NQBC 1P3OC 3C1BD 5CPIC 3C1BA 1P3GC 1P3KC 2BYKA 1BH9B 5AV8B 5B2ID 5B2IA 5GT0D 1F1EA 1U35B 5GT0A 2CV5B 1P3BB 1KX3C 5B32B 1TZYB 1EQZA 4H9NB 3KSYA 1N1JB 3AN2B 1ID3A 4YS3C 4J8XC 1P3AB 2FJ7C 4H9PA 5CP6D 5CP6A 4G92B 3VH5W 1P3LB 5F99A 4HGAB 3REHB 1M19D 1M19A 3AZGD 3AZNB 4H9SC 3AZGA 4Z66B 5B2JA 1HQ3C 5B1LC 1P3OD 3WKJB 1P3GD 1P3KD 1P3KA 1P3PB 5DNNC 3MVDC 5E5AA 3C1CC 3X1TB 4WU9D 4WU9A 1BH8A 5B31C 1KX3D 1P3FC 1F66C 4M6BA 1ZLAC 5G49B 3NQUB 3W99B 4J8VC 1KX4C 3WTPD 4NE5A 3WTPA 1M18B 2BYMB 3W98B 4J8XD 1JFIA 4J8XA 3A6NB 5B40C 3AFAC 5B0YB 1EQZD 3MNND 3MNNA 3AZKD 3AZKA 3O62D 3AZEC 3O62A 3V9RB 4H9SA 2NQBB 1HQ3D 5CPIB 1HQ3A 3UTBD 4KUDC 3UTBA 5JRGC 4CSRB 1HTAA 3MVDD 1KX5C 3C1CD 5BS7C 5AVCD 3MVDA 3AYWB 5AVCA 1P3FD 1F66D 4XUJD 1P3FA 4XUJA 3MGPB 3WAAB 4NE3A 1S32A 4J8UD 4J8UA 4YS3B 5JA4A 1P3MD 1P3MA 2FJ7B 4CAYA 4WU8B 3MGQD 3MGQA 1U35C 1P3BC 2CV5C 4QLCB 3AZHC 3LJAB 3AFAD 3AFAA 3REKB 3RELB 3R45A 3AN2C 2IO5C 3KWQD 3KWQA 5CPJC 4XZQC 5B24C 4X23B 5B1LB 4KUDD 4G92C 4KUDA 1P3LC 4H9RB 2YFVA 5DNNB 4HGAC 3REHC 5FUGB 5B0ZB 1KX5D 3LELD 5B31B 4G91C 3LELA 4Z66C 3B6GB 1ZLAB 4H9QB 3MGRB 3WKJC 4J8VB 3AZLB 1KX4B 2PYOB 5AV8D 5AV8A 3X1TC 5B40B 1U35D 1P3BD 1U35A 2CV5D 5B32D 1TZYD 5B32A 1TZYA 3W99C 5B32G 3AZMB 4H9NA 3B6FA 3AN2D 1N1JA 4R8PB 1M18C 3AZEB 3W98C 4E44A 4WZSB 1P3AD 1P3AA 5JRGB 5AV5A 3AV1C 1P3LD 4KGCB 5B0YC 3REIC 5AV9A 3LZ0C 3AZFB 3REHD 3REHA 1A7WA 4ZUXA 3AZND 3AZNA 4Z66D 3AZJB 3WKJD 4E45A 1P3PD 1P3PA 5C3IB 3X1TD 3AYWC 4NFTA 3AZHB 3MGSC 3W99D 5G49A 3NQUA 3WAAC 3MGPC 3W99A 2IO5B 1M18D 5CPJB 3W98D 4XZQB 5B24B 4WU8C 3A6ND 3A6NA 4QLCC 3LJAC 4AWLC 3UTAC 5B0YD 3REKC 3RELC 5B0YA 4G91B 5BNXA 4X23C 3V9RA 2NQBD 1WWIA 2NQBA 1P3OA 5CPID 3W96B 5CPIA 1P3GA 4DRBA 4CSRA 2JSSA 3X1UC 1P3IC 5CPKB 1B6WA 5B0ZC 3AYWD 3B6GC 1KX3A 2RVQC 3MGRC 3MGPD 3WAAD 5AV6C 3MGPA 3TU4C 2AROB 3AZLC 2PYOC 4YS3D 4YS3A 2FJ7D 4WU8D 2FJ7A 5B33C 4WU8A 4EO5B 4QLCD 3AZMC 3AV1B 4QLCA 3LJAD 5B1MB 3WA9C 4LD9B 3REIB 3LZ0B 3REKD 3RELD 3RELA 4R8PC 4X23D 5B1LD 4X23A 5B1LA 3KXBC 4KGCC 4H9RA 1ID3B 3AZFC 5DNND 5DNNA 3C1CA 5B0ZD 5FUGA 3B0CT 5B31D 1AOIC 5B31A 4H9PB 5B31G 3KUYC 5DNMB 1ZLAD 1F66A 1ZLAA 3AZJC 3B6GA 3MGSB 3B6GD 2RVQD 3MGRD 4H9QA 4J8VD 4J8VA 2YFWA 3AZLD 3AZIB 5F99B 3AZLA 1KX4A 1KX4D 2PYOD 5C3IC 2L5AA 3REJC 1ULYA 5B2JB 4YM6C 5B40D 5B40A 3X1SB 1M1AB 3AZMD 4AWLB 3UTAB 1TAFB 5E5AB 5GXQB 4R8PD 4R8PA 3AZED 3AZEA 5CHLB 5JRGD 5JRGA 4KGCD 3X1UB 1P3IB 3AZFD 3AZFA 1KX5A 1JFIB 5BS7A 3VH5T 4UUZB 3W96C 3AZJD 3UT9B 3NQJB 5AV6B 3TU4B 3X1VB 1BH9A 4H9OB 3W97C 2HIOB 5CPKC 5B33B 1P3BA 3LZ1C 2CV5A 5BO0B 5AY8B 3AZHD 3AZHA 1P34B 2HUEC 3WA9B 2AROC 4JJNC 3AN2A 4Z5TB 5CPJD 5CPJA 4XZQD 5AVBC 5B24D 4XZQA 5KDMB 5B24A 4Z2MG 4EO5C 3KXBB 5B1MC 4LD9C 4KHAB 1S32B 5GSUB 1P3LA 3AV2B 5B2IC 2F8NK 1AOIB 4WV4B 4CAYB 3KUYB 4Z66A 5GT0C 1EQZC 3WKJA 3W96D 3W96A 5BNVB 2CWEA 5GT3B 1ID3C 3REJB 5CPKD 3X1TA 4YM6B 5DNMC 3VH6T 5CP6C 3B0CW 2AROD 3AZIC 5F99C 1M19C 1M18A 2BYMA 3W98A 1BFMA 2NZDB 2F8NB 5B2JC 3X1SC 1M1AC 3B0BA 3AV1D 3AV1A 5B1MD 4LD9D 5B1MA 1B67A 3LZ0D 3REIA 3REID 3LZ0A 4LD9A 4WNNB 5E5AC 5GXQC 4WU9C 3B6FB 3WTPC 1ID3D 3W97B 3AYWA 4J8WB 3LZ1B 5DNMD 5DNMA 3VH5A 5AV5B 3MGSD 3UT9C 2HUEB 3MGSA 3WAAA 3X1VC 4JJNB 1H3OB 5AV9B 3AZID 5F99D 3AZIA 3MNNC 2LY8A 2HIOC 4ZUXB 3AZKC 3O62C 5AVBB 5B2JD 3C1BB 3X1SD 2BYKB 3X1SA 5AY8C 3UTBC 1M1AD 3LJAA 1P34C 1M1AA 1WWSA 3UTAD 3UTAA 3REKA 5B2IB 4Z5TC 5E5AD 1TAFA 3WTPE 5GXQD 4Z2MH 5AVCC 5GXQA 2F8NH 5GT0B 3B0DB 1EQZB 4XUJC 1S32C 5GSUC 3X1UD 1P3ID 3X1UA 4J8UC 1P3IA 3AV2C 5B0ZA 4ZBJB 1P3MC 3MGQC 5CP6B 4NE6A 1Q9CA 4UUZA 3MGRA 3UT9D 5AV6D 3UT9A 3TU4D 3NQJA 5AV6A 3TU4A 3X1VA 3X1VD 4H9OA 5GT3C 1M19B 2PYOA 2HIOD 5BNXB 2HIOA 3KWQC 3AZGB 5B33D 5B33A 1P3OB 1P3GB 3VH6A 1P3KB 5AY8D 3AZMA 5AY8A 5BO0A 3WA9D 1P34D 3VH6W 1P34A 3WA9A 5BT1C 4Z5TD 4WU9B 4Z5TA 1BH8B 3LELC 2NZDC 1KX3B 5KDMA 3KXBD 3KXBA 3WTPB 1S32D 5GSUD 4KHAA 4KGCA 5GSUA 5AV8C 3AV2D 4J8XB 3AV2A 1AOID 1AOIA 3KUYD 3KUYA 3AZJA 5B32C 1TZYC
chains in the Genus database with same CATH superfamily
3B6FC 3MNNB 5BNVA 5GT3D 3AZKB 5GT3A 3REJD 3O62B 3REJA 4YM6D 4YM6A 1HQ3B 4J8WC 1P3AC 1KU5A 3UTBB 5AV5C 5AV9C 5BT1D 2ZM5A 3MVDB 3C1CB 2UWXA 5AVCB 4ZUXC 3AZNC 2NZDD 2F8ND 1P3FB 1F66B 4XUJB 2F8NG 3C1BC 2F8NA 2NZDA 2YFWB 1P3PC 4J8UB 5JA4B 4WNNA 3H0MC 1P3MB 3MGQB 3B0DC 4DRAA 3AFAB 3B6FD 3R45B 3W97D 3W97A 3KWQB 2Y2MA 5CPKA 4ZBJC 1R4VA 4J8WD 3LZ1D 3A6NC 3LZ1A 4J8WA 4DQYB 4KUDB 5AV5D 2YFVB 2AROA 4JJND 5AV9D 1H3OA 4JJNA 1KX5B 3LELB 4ZUXD 3AZGC 5AVBD 5AVBA 2NQBC 1P3OC 3C1BD 5CPIC 3C1BA 1P3GC 1P3KC 2BYKA 1BH9B 5AV8B 5B2ID 5B2IA 5GT0D 1F1EA 1U35B 5GT0A 2CV5B 1P3BB 1KX3C 5B32B 1TZYB 1EQZA 4H9NB 3KSYA 1N1JB 3AN2B 1ID3A 4YS3C 4J8XC 1P3AB 2FJ7C 4H9PA 5CP6D 5CP6A 2RIQA 4G92B 2F2AC 3VH5W 1P3LB 5F99A 4HGAB 3REHB 1M19D 1M19A 3AZGD 3AZNB 4H9SC 3AZGA 4Z66B 5B2JA 1HQ3C 5B1LC 1P3OD 3WKJB 1P3GD 1P3KD 1P3KA 1P3PB 2DF4C 5DNNC 3MVDC 5E5AA 3C1CC 3X1TB 4WU9D 4WU9A 1BH8A 5B31C 1KX3D 1P3FC 3H0LC 4M6BA 1F66C 1ZLAC 5G49B 3NQUB 3W99B 4J8VC 1KX4C 3WTPD 4NE5A 3WTPA 1M18B 2BYMB 3W98B 4J8XD 1JFIA 4WJ3C 4J8XA 3A6NB 5B40C 3AFAC 4UPKA 5B0YB 1EQZD 3MNND 3MNNA 3AZKD 1W2EA 3AZKA 3O62D 3AZEC 3O62A 3V9RB 4H9SA 2NQBB 1HQ3D 5CPIB 1HQ3A 2G5IC 3UTBD 4KUDC 3UTBA 5JRGC 4CSRB 1HTAA 3MVDD 1KX5C 3C1CD 5BS7C 5AVCD 3MVDA 3AYWB 5AVCA 2XD1A 1P3FD 1F66D 4XUJD 1P3FA 4XUJA 3MGPB 3WAAB 4NE3A 1S32A 4J8UD 4J8UA 4YS3B 3AL0C 5JA4A 1P3MD 1P3MA 2FJ7B 4CAYA 4WU8B 3MGQD 3MGQA 1U35C 1P3BC 2CV5C 4QLCB 2JE5A 3AZHC 3LJAB 3AFAD 3AFAA 3REKB 3RELB 3R45A 3AN2C 2IO5C 3KWQD 3KWQA 2VQRA 5CPJC 4XZQC 5B24C 4X23B 5B1LB 3EPJA 2Y2QA 4KUDD 4G92C 4KUDA 1P3LC 4H9RB 2YFVA 5DNNB 4HGAC 3EPKA 3REHC 5FUGB 5B0ZB 1KX5D 3LELD 5B31B 4G91C 3LELA 4Z66C 3B6GB 1ZLAB 4H9QB 3MGRB 3WKJC 4J8VB 3AZLB 2W8SA 1KX4B 2PYOB 5AV8D 5AV8A 3X1TC 2XD5A 5B40B 1U35D 1P3BD 1U35A 2CV5D 5B32D 1TZYD 5B32A 1TZYA 3W99C 5B32G 3AZMB 4H9NA 3B6FA 3AN2D 1N1JA 4R8PB 1M18C 3AZEB 3W98C 4E44A 4WZSB 1P3AD 1P3AA 3P5JB 5JRGB 5AV5A 3AV1C 1P3LD 4KGCB 5B0YC 3REIC 5AV9A 2J8PA 3LZ0C 3AZFB 3REHD 3REHA 1A7WA 4ZUXA 3AZND 3AZNA 4Z66D 3AZJB 3WKJD 4E45A 1P3PD 1P3PA 5C3IB 3X1TD 3AYWC 4NFTA 3AZHB 3MGSC 3W99D 2Y2NA 3NQUA 5G49A 3WAAC 3MGPC 3W99A 2IO5B 1M18D 5CPJB 3W98D 4XZQB 5B24B 4WU8C 3A6ND 3A6NA 4QLCC 2FFFB 3LJAC 4AWLC 3UTAC 5B0YD 3REKC 3RELC 5B0YA 4G91B 5BNXA 4X23C 3V9RA 2NQBD 1WWIA 2NQBA 1P3OA 5CPID 3W96B 5CPIA 1P3GA 4DRBA 4CSRA 2JSSA 3X1UC 1P3IC 5CPKB 1B6WA 5B0ZC 3AYWD 3B6GC 1KX3A 2RVQC 3MGRC 3MGPD 3WAAD 5AV6C 3MGPA 3TU4C 2AROB 3AZLC 2PYOC 2Y2LA 4YS3D 4YS3A 2FJ7D 4WU8D 2FJ7A 5B33C 4WU8A 2ZY4A 4EO5B 4QLCD 3AZMC 3AV1B 4QLCA 3LJAD 5B1MB 3WA9C 4LD9B 3REIB 3LZ0B 3REKD 3RELD 3RELA 4R8PC 4X23D 5B1LD 4X23A 5B1LA 3KXBC 4KGCC 4H9RA 1ID3B 3AZFC 5DNND 5DNNA 3C1CA 5B0ZD 2Y2OA 5FUGA 3B0CT 5B31D 1AOIC 5B31A 4H9PB 5B31G 3KUYC 5DNMB 1ZLAD 1F66A 1ZLAA 3AZJC 3B6GA 3MGSB 3B6GD 2RVQD 3MGRD 4H9QA 4J8VD 4J8VA 2YFWA 3AZLD 3AZIB 5F99B 3AZLA 1KX4A 1KX4D 2PYOD 5C3IC 2L5AA 3REJC 1ULYA 5B2JB 4YM6C 2JCHA 5B40D 5B40A 3X1SB 1M1AB 3AZMD 4AWLB 3UTAB 1TAFB 5E5AB 5GXQB 4R8PD 4R8PA 3AZED 3AZEA 5CHLB 5JRGD 5JRGA 4KGCD 3X1UB 1P3IB 3AZFD 2Y2JA 3AZFA 1KX5A 1JFIB 5BS7A 3VH5T 4UUZB 3W96C 3AZJD 3UT9B 3NQJB 5AV6B 3TU4B 3X1VB 1BH9A 4H9OB 3W97C 2HIOB 5CPKC 5B33B 1P3BA 3LZ1C 2CV5A 5BO0B 5AY8B 3AZHD 3AZHA 3A1KA 2HUEC 1P34B 3WA9B 2AROC 4JJNC 3AN2A 4Z5TB 5CPJD 5CPJA 4XZQD 5AVBC 5B24D 4XZQA 5KDMB 5B24A 4Z2MG 4EO5C 3KXBB 5B1MC 4LD9C 4KHAB 1S32B 5GSUB 1P3LA 3EG5B 3AV2B 5B2IC 2F8NK 1AOIB 4WV4B 4CAYB 3KUYB 5GT0C 4Z66A 1EQZC 3WKJA 3W96D 3W96A 5BNVB 2CWEA 5GT3B 1ID3C 3EPLA 3REJB 5CPKD 3X1TA 4YM6B 2ZY5A 5DNMC 3VH6T 5CP6C 3B0CW 2AROD 3AZIC 5F99C 1M19C 3EPHA 1M18A 2BYMA 3H0RC 3W98A 1BFMA 2NZDB 2F8NB 5B2JC 2Y2KA 3X1SC 1Z2CB 2BG1A 1M1AC 3B0BA 3AV1D 3AV1A 5B1MD 4LD9D 5B1MA 1B67A 3LZ0D 3REIA 3REID 3LZ0A 4LD9A 4WNNB 5E5AC 5GXQC 4WU9C 3B6FB 3WTPC 1ID3D 3W97B 2DQNC 3AYWA 4J8WB 3LZ1B 5DNMD 5DNMA 3VH5A 5AV5B 3MGSD 3UT9C 2HUEB 3MGSA 3WAAA 3X1VC 4JJNB 1H3OB 5AV9B 3AZID 5F99D 3AZIA 3MNNC 2LY8A 4KGCA 2HIOC 4ZUXB 3AZKC 3O62C 5AVBB 5B2JD 1T3UA 3C1BB 2Y2IA 3X1SD 2BYKB 3X1SA 5AY8C 3UTBC 1M1AD 3LJAA 1P34C 1M1AA 1WWSA 3UTAD 3UTAA 3REKA 5B2IB 4Z5TC 5E5AD 1TAFA 3WTPE 5GXQD 4Z2MH 5AVCC 5GXQA 2F8NH 5GT0B 3B0DB 1EQZB 2Y2PA 4XUJC 1S32C 5GSUC 3X1UD 2G5HC 1P3ID 3X1UA 4J8UC 1P3IA 3AV2C 5B0ZA 4ZBJB 1P3MC 3MGQC 5CP6B 4NE6A 3A1IA 1Q9CA 4UUZA 3MGRA 3UT9D 5AV6D 3UT9A 3TU4D 3NQJA 5AV6A 3TU4A 3X1VA 3X1VD 1PZRA 4H9OA 5GT3C 1M19B 2PYOA 2HIOD 5BNXB 2HIOA 3KWQC 3AZGB 5B33D 5B33A 1P3OB 1P3GB 3VH6A 1P3KB 3F6TA 5AY8D 3AZMA 5AY8A 5BO0A 3WA9D 1P34D 3VH6W 1P34A 3WA9A 5BT1C 4Z5TD 4WU9B 4Z5TA 1BH8B 3LELC 2NZDC 1KX3B 2Y2HA 3KFUG 5KDMA 3KXBD 3KXBA 3WTPB 1S32D 5GSUD 4KHAA 2ZY3A 5GSUA 2Y2GA 2ZY2A 3IP4C 5AV8C 3AV2D 4J8XB 3AV2A 1AOID 1AOIA 3FDDA 3KUYD 3KUYA 3AZJA 5B32C 1TZYC
chains in the Genus database with same CATH topology
3B6FC 3MNNB 5BNVA 5GT3D 3AZKB 5GT3A 3REJD 3O62B 3REJA 4YM6D 4YM6A 1HQ3B 4J8WC 1P3AC 1KU5A 3UTBB 5AV5C 5AV9C 5BT1D 2ZM5A 3MVDB 3C1CB 2UWXA 5AVCB 4ZUXC 3AZNC 2NZDD 2F8ND 1P3FB 1F66B 4XUJB 2F8NG 3C1BC 2F8NA 2NZDA 2YFWB 1P3PC 4J8UB 5JA4B 4WNNA 3H0MC 1P3MB 3MGQB 3B0DC 4DRAA 3AFAB 3B6FD 3R45B 3W97D 3W97A 3KWQB 2Y2MA 5CPKA 4ZBJC 1R4VA 4J8WD 3LZ1D 3A6NC 3LZ1A 4J8WA 4DQYB 4KUDB 5AV5D 2YFVB 2AROA 4JJND 5AV9D 1H3OA 4JJNA 1KX5B 3LELB 4ZUXD 3AZGC 5AVBD 5AVBA 2NQBC 1P3OC 3C1BD 5CPIC 3C1BA 1P3GC 1P3KC 2BYKA 1BH9B 5AV8B 5B2ID 5B2IA 5GT0D 1F1EA 1U35B 5GT0A 2CV5B 1P3BB 1KX3C 5B32B 1TZYB 1EQZA 4H9NB 3KSYA 1N1JB 3AN2B 1ID3A 4YS3C 4J8XC 1P3AB 2FJ7C 4H9PA 5CP6D 5CP6A 2RIQA 4G92B 2F2AC 3VH5W 1P3LB 5F99A 4HGAB 3REHB 1M19D 1M19A 3AZGD 3AZNB 4H9SC 3AZGA 4Z66B 5B2JA 1HQ3C 5B1LC 1P3OD 3WKJB 1P3GD 1P3KD 1P3KA 1P3PB 2DF4C 5DNNC 3MVDC 5E5AA 3C1CC 3X1TB 4WU9D 4WU9A 1BH8A 5B31C 1KX3D 1P3FC 3H0LC 4M6BA 1F66C 1ZLAC 5G49B 3NQUB 3W99B 4J8VC 1KX4C 3WTPD 4NE5A 3WTPA 1M18B 2BYMB 3W98B 4J8XD 1JFIA 4WJ3C 4J8XA 3A6NB 5B40C 3AFAC 4UPKA 5B0YB 1EQZD 3MNND 3MNNA 3AZKD 1W2EA 3AZKA 3O62D 3AZEC 3O62A 3V9RB 4H9SA 2NQBB 1HQ3D 5CPIB 1HQ3A 2G5IC 3UTBD 4KUDC 3UTBA 5JRGC 4CSRB 1HTAA 3MVDD 1KX5C 3C1CD 5BS7C 5AVCD 3MVDA 3AYWB 5AVCA 2XD1A 1P3FD 1F66D 4XUJD 1P3FA 4XUJA 3MGPB 3WAAB 4NE3A 1S32A 4J8UD 4J8UA 4YS3B 3AL0C 5JA4A 1P3MD 1P3MA 2FJ7B 4CAYA 4WU8B 3MGQD 3MGQA 1U35C 1P3BC 2CV5C 4QLCB 2JE5A 3AZHC 3LJAB 3AFAD 3AFAA 3REKB 3RELB 3R45A 3AN2C 2IO5C 3KWQD 3KWQA 2VQRA 5CPJC 4XZQC 5B24C 4X23B 5B1LB 3EPJA 2Y2QA 4KUDD 4G92C 4KUDA 1P3LC 4H9RB 2YFVA 5DNNB 4HGAC 3EPKA 3REHC 5FUGB 5B0ZB 1KX5D 3LELD 5B31B 4G91C 3LELA 4Z66C 3B6GB 1ZLAB 4H9QB 3MGRB 3WKJC 4J8VB 3AZLB 2W8SA 1KX4B 2PYOB 5AV8D 5AV8A 3X1TC 2XD5A 5B40B 1U35D 1P3BD 1U35A 2CV5D 5B32D 1TZYD 5B32A 1TZYA 3W99C 5B32G 3AZMB 4H9NA 3B6FA 3AN2D 1N1JA 4R8PB 1M18C 3AZEB 3W98C 4E44A 4WZSB 1P3AD 1P3AA 3P5JB 5JRGB 5AV5A 3AV1C 1P3LD 4KGCB 5B0YC 3REIC 5AV9A 2J8PA 3LZ0C 3AZFB 3REHD 3REHA 1A7WA 4ZUXA 3AZND 3AZNA 4Z66D 3AZJB 3WKJD 4E45A 1P3PD 1P3PA 5C3IB 3X1TD 3AYWC 4NFTA 3AZHB 3MGSC 3W99D 2Y2NA 3NQUA 5G49A 3WAAC 3MGPC 3W99A 2IO5B 1M18D 5CPJB 3W98D 4XZQB 5B24B 4WU8C 3A6ND 3A6NA 4QLCC 2FFFB 3LJAC 4AWLC 3UTAC 5B0YD 3REKC 3RELC 5B0YA 4G91B 5BNXA 4X23C 3V9RA 2NQBD 1WWIA 2NQBA 1P3OA 5CPID 3W96B 5CPIA 1P3GA 4DRBA 4CSRA 2JSSA 3X1UC 1P3IC 5CPKB 1B6WA 5B0ZC 3AYWD 3B6GC 1KX3A 2RVQC 3MGRC 3MGPD 3WAAD 5AV6C 3MGPA 3TU4C 2AROB 3AZLC 2PYOC 2Y2LA 4YS3D 4YS3A 2FJ7D 4WU8D 2FJ7A 5B33C 4WU8A 2ZY4A 4EO5B 4QLCD 3AZMC 3AV1B 4QLCA 3LJAD 5B1MB 3WA9C 4LD9B 3REIB 3LZ0B 3REKD 3RELD 3RELA 4R8PC 4X23D 5B1LD 4X23A 5B1LA 3KXBC 4KGCC 4H9RA 1ID3B 3AZFC 5DNND 5DNNA 3C1CA 5B0ZD 2Y2OA 5FUGA 3B0CT 5B31D 1AOIC 5B31A 4H9PB 5B31G 3KUYC 5DNMB 1ZLAD 1F66A 1ZLAA 3AZJC 3B6GA 3MGSB 3B6GD 2RVQD 3MGRD 4H9QA 4J8VD 4J8VA 2YFWA 3AZLD 3AZIB 5F99B 3AZLA 1KX4A 1KX4D 2PYOD 5C3IC 2L5AA 3REJC 1ULYA 5B2JB 4YM6C 2JCHA 5B40D 5B40A 3X1SB 1M1AB 3AZMD 4AWLB 3UTAB 1TAFB 5E5AB 5GXQB 4R8PD 4R8PA 3AZED 3AZEA 5CHLB 5JRGD 5JRGA 4KGCD 3X1UB 1P3IB 3AZFD 2Y2JA 3AZFA 1KX5A 1JFIB 5BS7A 3VH5T 4UUZB 3W96C 3AZJD 3UT9B 3NQJB 5AV6B 3TU4B 3X1VB 1BH9A 4H9OB 3W97C 2HIOB 5CPKC 5B33B 1P3BA 3LZ1C 2CV5A 5BO0B 5AY8B 3AZHD 3AZHA 3A1KA 2HUEC 1P34B 3WA9B 2AROC 4JJNC 3AN2A 4Z5TB 5CPJD 5CPJA 4XZQD 5AVBC 5B24D 4XZQA 5KDMB 5B24A 4Z2MG 4EO5C 3KXBB 5B1MC 4LD9C 4KHAB 1S32B 5GSUB 1P3LA 3EG5B 3AV2B 5B2IC 2F8NK 1AOIB 4WV4B 4CAYB 3KUYB 5GT0C 4Z66A 1EQZC 3WKJA 3W96D 3W96A 5BNVB 2CWEA 5GT3B 1ID3C 3EPLA 3REJB 5CPKD 3X1TA 4YM6B 2ZY5A 5DNMC 3VH6T 5CP6C 3B0CW 2AROD 3AZIC 5F99C 1M19C 3EPHA 1M18A 2BYMA 3H0RC 3W98A 1BFMA 2NZDB 2F8NB 5B2JC 2Y2KA 3X1SC 1Z2CB 2BG1A 1M1AC 3B0BA 3AV1D 3AV1A 5B1MD 4LD9D 5B1MA 1B67A 3LZ0D 3REIA 3REID 3LZ0A 4LD9A 4WNNB 5E5AC 5GXQC 4WU9C 3B6FB 3WTPC 1ID3D 3W97B 2DQNC 3AYWA 4J8WB 3LZ1B 5DNMD 5DNMA 3VH5A 5AV5B 3MGSD 3UT9C 2HUEB 3MGSA 3WAAA 3X1VC 4JJNB 1H3OB 5AV9B 3AZID 5F99D 3AZIA 3MNNC 2LY8A 4KGCA 2HIOC 4ZUXB 3AZKC 3O62C 5AVBB 5B2JD 1T3UA 3C1BB 2Y2IA 3X1SD 2BYKB 3X1SA 5AY8C 3UTBC 1M1AD 3LJAA 1P34C 1M1AA 1WWSA 3UTAD 3UTAA 3REKA 5B2IB 4Z5TC 5E5AD 1TAFA 3WTPE 5GXQD 4Z2MH 5AVCC 5GXQA 2F8NH 5GT0B 3B0DB 1EQZB 2Y2PA 4XUJC 1S32C 5GSUC 3X1UD 2G5HC 1P3ID 3X1UA 4J8UC 1P3IA 3AV2C 5B0ZA 4ZBJB 1P3MC 3MGQC 5CP6B 4NE6A 3A1IA 1Q9CA 4UUZA 3MGRA 3UT9D 5AV6D 3UT9A 3TU4D 3NQJA 5AV6A 3TU4A 3X1VA 3X1VD 1PZRA 4H9OA 5GT3C 1M19B 2PYOA 2HIOD 5BNXB 2HIOA 3KWQC 3AZGB 5B33D 5B33A 1P3OB 1P3GB 3VH6A 1P3KB 3F6TA 5AY8D 3AZMA 5AY8A 5BO0A 3WA9D 1P34D 3VH6W 1P34A 3WA9A 5BT1C 4Z5TD 4WU9B 4Z5TA 1BH8B 3LELC 2NZDC 1KX3B 2Y2HA 3KFUG 5KDMA 3KXBD 3KXBA 3WTPB 1S32D 5GSUD 4KHAA 2ZY3A 5GSUA 2Y2GA 2ZY2A 3IP4C 5AV8C 3AV2D 4J8XB 3AV2A 1AOID 1AOIA 3FDDA 3KUYD 3KUYA 3AZJA 5B32C 1TZYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6F C;  3MNN B;  5BNV A;  5GT3 D;  3AZK B;  5GT3 A;  3REJ D;  3O62 B;  3REJ A;  4YM6 D;  4YM6 A;  1HQ3 B;  4J8W C;  1P3A C;  1KU5 A;  3UTB B;  5AV5 C;  5AV9 C;  5BT1 D;  3MVD B;  3C1C B;  5AVC B;  4ZUX C;  3AZN C;  2NZD D;  2F8N D;  1P3F B;  1F66 B;  4XUJ B;  2F8N G;  3C1B C;  2F8N A;  2NZD A;  2YFW B;  1P3P C;  4J8U B;  5JA4 B;  4WNN A;  1P3M B;  3MGQ B;  3B0D C;  4DRA A;  3AFA B;  3B6F D;  3R45 B;  3W97 D;  3W97 A;  3KWQ B;  5CPK A;  4ZBJ C;  1R4V A;  4J8W D;  3LZ1 D;  3A6N C;  3LZ1 A;  4J8W A;  4KUD B;  5AV5 D;  2YFV B;  2ARO A;  4JJN D;  5AV9 D;  1H3O A;  4JJN A;  1KX5 B;  3LEL B;  4ZUX D;  3AZG C;  5AVB D;  5AVB A;  2NQB C;  1P3O C;  3C1B D;  5CPI C;  3C1B A;  1P3G C;  1P3K C;  2BYK A;  1BH9 B;  5AV8 B;  5B2I D;  5B2I A;  5GT0 D;  1F1E A;  1U35 B;  5GT0 A;  2CV5 B;  1P3B B;  1KX3 C;  5B32 B;  1TZY B;  1EQZ A;  4H9N B;  3KSY A;  1N1J B;  3AN2 B;  1ID3 A;  4YS3 C;  4J8X C;  1P3A B;  2FJ7 C;  4H9P A;  5CP6 D;  5CP6 A;  4G92 B;  3VH5 W;  1P3L B;  5F99 A;  4HGA B;  3REH B;  1M19 D;  1M19 A;  3AZG D;  3AZN B;  4H9S C;  3AZG A;  4Z66 B;  5B2J A;  1HQ3 C;  5B1L C;  1P3O D;  3WKJ B;  1P3G D;  1P3K D;  1P3K A;  1P3P B;  5DNN C;  3MVD C;  5E5A A;  3C1C C;  3X1T B;  4WU9 D;  4WU9 A;  1BH8 A;  5B31 C;  1KX3 D;  1P3F C;  1F66 C;  4M6B A;  1ZLA C;  5G49 B;  3NQU B;  3W99 B;  4J8V C;  1KX4 C;  3WTP D;  4NE5 A;  3WTP A;  1M18 B;  2BYM B;  3W98 B;  4J8X D;  1JFI A;  4J8X A;  3A6N B;  5B40 C;  3AFA C;  5B0Y B;  1EQZ D;  3MNN D;  3MNN A;  3AZK D;  3AZK A;  3O62 D;  3AZE C;  3O62 A;  3V9R B;  4H9S A;  2NQB B;  1HQ3 D;  5CPI B;  1HQ3 A;  3UTB D;  4KUD C;  3UTB A;  5JRG C;  4CSR B;  1HTA A;  3MVD D;  1KX5 C;  3C1C D;  5BS7 C;  5AVC D;  3MVD A;  3AYW B;  5AVC A;  1P3F D;  1F66 D;  4XUJ D;  1P3F A;  4XUJ A;  3MGP B;  3WAA B;  4NE3 A;  1S32 A;  4J8U D;  4J8U A;  4YS3 B;  5JA4 A;  1P3M D;  1P3M A;  2FJ7 B;  4CAY A;  4WU8 B;  3MGQ D;  3MGQ A;  1U35 C;  1P3B C;  2CV5 C;  4QLC B;  3AZH C;  3LJA B;  3AFA D;  3AFA A;  3REK B;  3REL B;  3R45 A;  3AN2 C;  2IO5 C;  3KWQ D;  3KWQ A;  5CPJ C;  4XZQ C;  5B24 C;  4X23 B;  5B1L B;  4KUD D;  4G92 C;  4KUD A;  1P3L C;  4H9R B;  2YFV A;  5DNN B;  4HGA C;  3REH C;  5FUG B;  5B0Z B;  1KX5 D;  3LEL D;  5B31 B;  4G91 C;  3LEL A;  4Z66 C;  3B6G B;  1ZLA B;  4H9Q B;  3MGR B;  3WKJ C;  4J8V B;  3AZL B;  1KX4 B;  2PYO B;  5AV8 D;  5AV8 A;  3X1T C;  5B40 B;  1U35 D;  1P3B D;  1U35 A;  2CV5 D;  5B32 D;  1TZY D;  5B32 A;  1TZY A;  3W99 C;  5B32 G;  3AZM B;  4H9N A;  3B6F A;  3AN2 D;  1N1J A;  4R8P B;  1M18 C;  3AZE B;  3W98 C;  4E44 A;  4WZS B;  1P3A D;  1P3A A;  5JRG B;  5AV5 A;  3AV1 C;  1P3L D;  4KGC B;  5B0Y C;  3REI C;  5AV9 A;  3LZ0 C;  3AZF B;  3REH D;  3REH A;  1A7W A;  4ZUX A;  3AZN D;  3AZN A;  4Z66 D;  3AZJ B;  3WKJ D;  4E45 A;  1P3P D;  1P3P A;  5C3I B;  3X1T D;  3AYW C;  4NFT A;  3AZH B;  3MGS C;  3W99 D;  5G49 A;  3NQU A;  3WAA C;  3MGP C;  3W99 A;  2IO5 B;  1M18 D;  5CPJ B;  3W98 D;  4XZQ B;  5B24 B;  4WU8 C;  3A6N D;  3A6N A;  4QLC C;  3LJA C;  4AWL C;  3UTA C;  5B0Y D;  3REK C;  3REL C;  5B0Y A;  4G91 B;  5BNX A;  4X23 C;  3V9R A;  2NQB D;  1WWI A;  2NQB A;  1P3O A;  5CPI D;  3W96 B;  5CPI A;  1P3G A;  4DRB A;  4CSR A;  2JSS A;  3X1U C;  1P3I C;  5CPK B;  1B6W A;  5B0Z C;  3AYW D;  3B6G C;  1KX3 A;  2RVQ C;  3MGR C;  3MGP D;  3WAA D;  5AV6 C;  3MGP A;  3TU4 C;  2ARO B;  3AZL C;  2PYO C;  4YS3 D;  4YS3 A;  2FJ7 D;  4WU8 D;  2FJ7 A;  5B33 C;  4WU8 A;  4EO5 B;  4QLC D;  3AZM C;  3AV1 B;  4QLC A;  3LJA D;  5B1M B;  3WA9 C;  4LD9 B;  3REI B;  3LZ0 B;  3REK D;  3REL D;  3REL A;  4R8P C;  4X23 D;  5B1L D;  4X23 A;  5B1L A;  3KXB C;  4KGC C;  4H9R A;  1ID3 B;  3AZF C;  5DNN D;  5DNN A;  3C1C A;  5B0Z D;  5FUG A;  3B0C T;  5B31 D;  1AOI C;  5B31 A;  4H9P B;  5B31 G;  3KUY C;  5DNM B;  1ZLA D;  1F66 A;  1ZLA A;  3AZJ C;  3B6G A;  3MGS B;  3B6G D;  2RVQ D;  3MGR D;  4H9Q A;  4J8V D;  4J8V A;  2YFW A;  3AZL D;  3AZI B;  5F99 B;  3AZL A;  1KX4 A;  1KX4 D;  2PYO D;  5C3I C;  2L5A A;  3REJ C;  1ULY A;  5B2J B;  4YM6 C;  5B40 D;  5B40 A;  3X1S B;  1M1A B;  3AZM D;  4AWL B;  3UTA B;  1TAF B;  5E5A B;  5GXQ B;  4R8P D;  4R8P A;  3AZE D;  3AZE A;  5CHL B;  5JRG D;  5JRG A;  4KGC D;  3X1U B;  1P3I B;  3AZF D;  3AZF A;  1KX5 A;  1JFI B;  5BS7 A;  3VH5 T;  4UUZ B;  3W96 C;  3AZJ D;  3UT9 B;  3NQJ B;  5AV6 B;  3TU4 B;  3X1V B;  1BH9 A;  4H9O B;  3W97 C;  2HIO B;  5CPK C;  5B33 B;  1P3B A;  3LZ1 C;  2CV5 A;  5BO0 B;  5AY8 B;  3AZH D;  3AZH A;  1P34 B;  2HUE C;  3WA9 B;  2ARO C;  4JJN C;  3AN2 A;  4Z5T B;  5CPJ D;  5CPJ A;  4XZQ D;  5AVB C;  5B24 D;  4XZQ A;  5KDM B;  5B24 A;  4Z2M G;  4EO5 C;  3KXB B;  5B1M C;  4LD9 C;  4KHA B;  1S32 B;  5GSU B;  1P3L A;  3AV2 B;  5B2I C;  2F8N K;  1AOI B;  4WV4 B;  4CAY B;  3KUY B;  4Z66 A;  5GT0 C;  1EQZ C;  3WKJ A;  3W96 D;  3W96 A;  5BNV B;  2CWE A;  5GT3 B;  1ID3 C;  3REJ B;  5CPK D;  3X1T A;  4YM6 B;  5DNM C;  3VH6 T;  5CP6 C;  3B0C W;  2ARO D;  3AZI C;  5F99 C;  1M19 C;  1M18 A;  2BYM A;  3W98 A;  1BFM A;  2NZD B;  2F8N B;  5B2J C;  3X1S C;  1M1A C;  3B0B A;  3AV1 D;  3AV1 A;  5B1M D;  4LD9 D;  5B1M A;  1B67 A;  3LZ0 D;  3REI A;  3REI D;  3LZ0 A;  4LD9 A;  4WNN B;  5E5A C;  5GXQ C;  4WU9 C;  3B6F B;  3WTP C;  1ID3 D;  3W97 B;  3AYW A;  4J8W B;  3LZ1 B;  5DNM D;  5DNM A;  3VH5 A;  5AV5 B;  3MGS D;  3UT9 C;  2HUE B;  3MGS A;  3WAA A;  3X1V C;  4JJN B;  1H3O B;  5AV9 B;  3AZI D;  5F99 D;  3AZI A;  3MNN C;  2LY8 A;  2HIO C;  4ZUX B;  3AZK C;  3O62 C;  5AVB B;  5B2J D;  3C1B B;  3X1S D;  2BYK B;  3X1S A;  5AY8 C;  3UTB C;  1M1A D;  3LJA A;  1P34 C;  1M1A A;  1WWS A;  3UTA D;  3UTA A;  3REK A;  5B2I B;  4Z5T C;  5E5A D;  1TAF A;  3WTP E;  5GXQ D;  4Z2M H;  5AVC C;  5GXQ A;  2F8N H;  5GT0 B;  3B0D B;  1EQZ B;  4XUJ C;  1S32 C;  5GSU C;  3X1U D;  1P3I D;  3X1U A;  4J8U C;  1P3I A;  3AV2 C;  5B0Z A;  4ZBJ B;  1P3M C;  3MGQ C;  5CP6 B;  4NE6 A;  1Q9C A;  4UUZ A;  3MGR A;  3UT9 D;  5AV6 D;  3UT9 A;  3TU4 D;  3NQJ A;  5AV6 A;  3TU4 A;  3X1V A;  3X1V D;  4H9O A;  5GT3 C;  1M19 B;  2PYO A;  2HIO D;  5BNX B;  2HIO A;  3KWQ C;  3AZG B;  5B33 D;  5B33 A;  1P3O B;  1P3G B;  3VH6 A;  1P3K B;  5AY8 D;  3AZM A;  5AY8 A;  5BO0 A;  3WA9 D;  1P34 D;  3VH6 W;  1P34 A;  3WA9 A;  5BT1 C;  4Z5T D;  4WU9 B;  4Z5T A;  1BH8 B;  3LEL C;  2NZD C;  1KX3 B;  5KDM A;  3KXB D;  3KXB A;  3WTP B;  1S32 D;  5GSU D;  4KHA A;  4KGC A;  5GSU A;  5AV8 C;  3AV2 D;  4J8X B;  3AV2 A;  1AOI D;  1AOI A;  3KUY D;  3KUY A;  3AZJ A;  5B32 C;  1TZY C; 
#chains in the Genus database with same CATH topology
 3B6F C;  3MNN B;  5BNV A;  5GT3 D;  3AZK B;  5GT3 A;  3REJ D;  3O62 B;  3REJ A;  4YM6 D;  4YM6 A;  1HQ3 B;  4J8W C;  1P3A C;  1KU5 A;  3UTB B;  5AV5 C;  5AV9 C;  5BT1 D;  2ZM5 A;  3MVD B;  3C1C B;  2UWX A;  5AVC B;  4ZUX C;  3AZN C;  2NZD D;  2F8N D;  1P3F B;  1F66 B;  4XUJ B;  2F8N G;  3C1B C;  2F8N A;  2NZD A;  2YFW B;  1P3P C;  4J8U B;  5JA4 B;  4WNN A;  3H0M C;  1P3M B;  3MGQ B;  3B0D C;  4DRA A;  3AFA B;  3B6F D;  3R45 B;  3W97 D;  3W97 A;  3KWQ B;  2Y2M A;  5CPK A;  4ZBJ C;  1R4V A;  4J8W D;  3LZ1 D;  3A6N C;  3LZ1 A;  4J8W A;  4DQY B;  4KUD B;  5AV5 D;  2YFV B;  2ARO A;  4JJN D;  5AV9 D;  1H3O A;  4JJN A;  1KX5 B;  3LEL B;  4ZUX D;  3AZG C;  5AVB D;  5AVB A;  2NQB C;  1P3O C;  3C1B D;  5CPI C;  3C1B A;  1P3G C;  1P3K C;  2BYK A;  1BH9 B;  5AV8 B;  5B2I D;  5B2I A;  5GT0 D;  1F1E A;  1U35 B;  5GT0 A;  2CV5 B;  1P3B B;  1KX3 C;  5B32 B;  1TZY B;  1EQZ A;  4H9N B;  3KSY A;  1N1J B;  3AN2 B;  1ID3 A;  4YS3 C;  4J8X C;  1P3A B;  2FJ7 C;  4H9P A;  5CP6 D;  5CP6 A;  2RIQ A;  4G92 B;  2F2A C;  3VH5 W;  1P3L B;  5F99 A;  4HGA B;  3REH B;  1M19 D;  1M19 A;  3AZG D;  3AZN B;  4H9S C;  3AZG A;  4Z66 B;  5B2J A;  1HQ3 C;  5B1L C;  1P3O D;  3WKJ B;  1P3G D;  1P3K D;  1P3K A;  1P3P B;  2DF4 C;  5DNN C;  3MVD C;  5E5A A;  3C1C C;  3X1T B;  4WU9 D;  4WU9 A;  1BH8 A;  5B31 C;  1KX3 D;  1P3F C;  3H0L C;  4M6B A;  1F66 C;  1ZLA C;  5G49 B;  3NQU B;  3W99 B;  4J8V C;  1KX4 C;  3WTP D;  4NE5 A;  3WTP A;  1M18 B;  2BYM B;  3W98 B;  4J8X D;  1JFI A;  4WJ3 C;  4J8X A;  3A6N B;  5B40 C;  3AFA C;  4UPK A;  5B0Y B;  1EQZ D;  3MNN D;  3MNN A;  3AZK D;  1W2E A;  3AZK A;  3O62 D;  3AZE C;  3O62 A;  3V9R B;  4H9S A;  2NQB B;  1HQ3 D;  5CPI B;  1HQ3 A;  2G5I C;  3UTB D;  4KUD C;  3UTB A;  5JRG C;  4CSR B;  1HTA A;  3MVD D;  1KX5 C;  3C1C D;  5BS7 C;  5AVC D;  3MVD A;  3AYW B;  5AVC A;  2XD1 A;  1P3F D;  1F66 D;  4XUJ D;  1P3F A;  4XUJ A;  3MGP B;  3WAA B;  4NE3 A;  1S32 A;  4J8U D;  4J8U A;  4YS3 B;  3AL0 C;  5JA4 A;  1P3M D;  1P3M A;  2FJ7 B;  4CAY A;  4WU8 B;  3MGQ D;  3MGQ A;  1U35 C;  1P3B C;  2CV5 C;  4QLC B;  2JE5 A;  3AZH C;  3LJA B;  3AFA D;  3AFA A;  3REK B;  3REL B;  3R45 A;  3AN2 C;  2IO5 C;  3KWQ D;  3KWQ A;  2VQR A;  5CPJ C;  4XZQ C;  5B24 C;  4X23 B;  5B1L B;  3EPJ A;  2Y2Q A;  4KUD D;  4G92 C;  4KUD A;  1P3L C;  4H9R B;  2YFV A;  5DNN B;  4HGA C;  3EPK A;  3REH C;  5FUG B;  5B0Z B;  1KX5 D;  3LEL D;  5B31 B;  4G91 C;  3LEL A;  4Z66 C;  3B6G B;  1ZLA B;  4H9Q B;  3MGR B;  3WKJ C;  4J8V B;  3AZL B;  2W8S A;  1KX4 B;  2PYO B;  5AV8 D;  5AV8 A;  3X1T C;  2XD5 A;  5B40 B;  1U35 D;  1P3B D;  1U35 A;  2CV5 D;  5B32 D;  1TZY D;  5B32 A;  1TZY A;  3W99 C;  5B32 G;  3AZM B;  4H9N A;  3B6F A;  3AN2 D;  1N1J A;  4R8P B;  1M18 C;  3AZE B;  3W98 C;  4E44 A;  4WZS B;  1P3A D;  1P3A A;  3P5J B;  5JRG B;  5AV5 A;  3AV1 C;  1P3L D;  4KGC B;  5B0Y C;  3REI C;  5AV9 A;  2J8P A;  3LZ0 C;  3AZF B;  3REH D;  3REH A;  1A7W A;  4ZUX A;  3AZN D;  3AZN A;  4Z66 D;  3AZJ B;  3WKJ D;  4E45 A;  1P3P D;  1P3P A;  5C3I B;  3X1T D;  3AYW C;  4NFT A;  3AZH B;  3MGS C;  3W99 D;  2Y2N A;  3NQU A;  5G49 A;  3WAA C;  3MGP C;  3W99 A;  2IO5 B;  1M18 D;  5CPJ B;  3W98 D;  4XZQ B;  5B24 B;  4WU8 C;  3A6N D;  3A6N A;  4QLC C;  2FFF B;  3LJA C;  4AWL C;  3UTA C;  5B0Y D;  3REK C;  3REL C;  5B0Y A;  4G91 B;  5BNX A;  4X23 C;  3V9R A;  2NQB D;  1WWI A;  2NQB A;  1P3O A;  5CPI D;  3W96 B;  5CPI A;  1P3G A;  4DRB A;  4CSR A;  2JSS A;  3X1U C;  1P3I C;  5CPK B;  1B6W A;  5B0Z C;  3AYW D;  3B6G C;  1KX3 A;  2RVQ C;  3MGR C;  3MGP D;  3WAA D;  5AV6 C;  3MGP A;  3TU4 C;  2ARO B;  3AZL C;  2PYO C;  2Y2L A;  4YS3 D;  4YS3 A;  2FJ7 D;  4WU8 D;  2FJ7 A;  5B33 C;  4WU8 A;  2ZY4 A;  4EO5 B;  4QLC D;  3AZM C;  3AV1 B;  4QLC A;  3LJA D;  5B1M B;  3WA9 C;  4LD9 B;  3REI B;  3LZ0 B;  3REK D;  3REL D;  3REL A;  4R8P C;  4X23 D;  5B1L D;  4X23 A;  5B1L A;  3KXB C;  4KGC C;  4H9R A;  1ID3 B;  3AZF C;  5DNN D;  5DNN A;  3C1C A;  5B0Z D;  2Y2O A;  5FUG A;  3B0C T;  5B31 D;  1AOI C;  5B31 A;  4H9P B;  5B31 G;  3KUY C;  5DNM B;  1ZLA D;  1F66 A;  1ZLA A;  3AZJ C;  3B6G A;  3MGS B;  3B6G D;  2RVQ D;  3MGR D;  4H9Q A;  4J8V D;  4J8V A;  2YFW A;  3AZL D;  3AZI B;  5F99 B;  3AZL A;  1KX4 A;  1KX4 D;  2PYO D;  5C3I C;  2L5A A;  3REJ C;  1ULY A;  5B2J B;  4YM6 C;  2JCH A;  5B40 D;  5B40 A;  3X1S B;  1M1A B;  3AZM D;  4AWL B;  3UTA B;  1TAF B;  5E5A B;  5GXQ B;  4R8P D;  4R8P A;  3AZE D;  3AZE A;  5CHL B;  5JRG D;  5JRG A;  4KGC D;  3X1U B;  1P3I B;  3AZF D;  2Y2J A;  3AZF A;  1KX5 A;  1JFI B;  5BS7 A;  3VH5 T;  4UUZ B;  3W96 C;  3AZJ D;  3UT9 B;  3NQJ B;  5AV6 B;  3TU4 B;  3X1V B;  1BH9 A;  4H9O B;  3W97 C;  2HIO B;  5CPK C;  5B33 B;  1P3B A;  3LZ1 C;  2CV5 A;  5BO0 B;  5AY8 B;  3AZH D;  3AZH A;  3A1K A;  2HUE C;  1P34 B;  3WA9 B;  2ARO C;  4JJN C;  3AN2 A;  4Z5T B;  5CPJ D;  5CPJ A;  4XZQ D;  5AVB C;  5B24 D;  4XZQ A;  5KDM B;  5B24 A;  4Z2M G;  4EO5 C;  3KXB B;  5B1M C;  4LD9 C;  4KHA B;  1S32 B;  5GSU B;  1P3L A;  3EG5 B;  3AV2 B;  5B2I C;  2F8N K;  1AOI B;  4WV4 B;  4CAY B;  3KUY B;  5GT0 C;  4Z66 A;  1EQZ C;  3WKJ A;  3W96 D;  3W96 A;  5BNV B;  2CWE A;  5GT3 B;  1ID3 C;  3EPL A;  3REJ B;  5CPK D;  3X1T A;  4YM6 B;  2ZY5 A;  5DNM C;  3VH6 T;  5CP6 C;  3B0C W;  2ARO D;  3AZI C;  5F99 C;  1M19 C;  3EPH A;  1M18 A;  2BYM A;  3H0R C;  3W98 A;  1BFM A;  2NZD B;  2F8N B;  5B2J C;  2Y2K A;  3X1S C;  1Z2C B;  2BG1 A;  1M1A C;  3B0B A;  3AV1 D;  3AV1 A;  5B1M D;  4LD9 D;  5B1M A;  1B67 A;  3LZ0 D;  3REI A;  3REI D;  3LZ0 A;  4LD9 A;  4WNN B;  5E5A C;  5GXQ C;  4WU9 C;  3B6F B;  3WTP C;  1ID3 D;  3W97 B;  2DQN C;  3AYW A;  4J8W B;  3LZ1 B;  5DNM D;  5DNM A;  3VH5 A;  5AV5 B;  3MGS D;  3UT9 C;  2HUE B;  3MGS A;  3WAA A;  3X1V C;  4JJN B;  1H3O B;  5AV9 B;  3AZI D;  5F99 D;  3AZI A;  3MNN C;  2LY8 A;  4KGC A;  2HIO C;  4ZUX B;  3AZK C;  3O62 C;  5AVB B;  5B2J D;  1T3U A;  3C1B B;  2Y2I A;  3X1S D;  2BYK B;  3X1S A;  5AY8 C;  3UTB C;  1M1A D;  3LJA A;  1P34 C;  1M1A A;  1WWS A;  3UTA D;  3UTA A;  3REK A;  5B2I B;  4Z5T C;  5E5A D;  1TAF A;  3WTP E;  5GXQ D;  4Z2M H;  5AVC C;  5GXQ A;  2F8N H;  5GT0 B;  3B0D B;  1EQZ B;  2Y2P A;  4XUJ C;  1S32 C;  5GSU C;  3X1U D;  2G5H C;  1P3I D;  3X1U A;  4J8U C;  1P3I A;  3AV2 C;  5B0Z A;  4ZBJ B;  1P3M C;  3MGQ C;  5CP6 B;  4NE6 A;  3A1I A;  1Q9C A;  4UUZ A;  3MGR A;  3UT9 D;  5AV6 D;  3UT9 A;  3TU4 D;  3NQJ A;  5AV6 A;  3TU4 A;  3X1V A;  3X1V D;  1PZR A;  4H9O A;  5GT3 C;  1M19 B;  2PYO A;  2HIO D;  5BNX B;  2HIO A;  3KWQ C;  3AZG B;  5B33 D;  5B33 A;  1P3O B;  1P3G B;  3VH6 A;  1P3K B;  3F6T A;  5AY8 D;  3AZM A;  5AY8 A;  5BO0 A;  3WA9 D;  1P34 D;  3VH6 W;  1P34 A;  3WA9 A;  5BT1 C;  4Z5T D;  4WU9 B;  4Z5T A;  1BH8 B;  3LEL C;  2NZD C;  1KX3 B;  2Y2H A;  3KFU G;  5KDM A;  3KXB D;  3KXB A;  3WTP B;  1S32 D;  5GSU D;  4KHA A;  2ZY3 A;  5GSU A;  2Y2G A;  2ZY2 A;  3IP4 C;  5AV8 C;  3AV2 D;  4J8X B;  3AV2 A;  1AOI D;  1AOI A;  3FDD A;  3KUY D;  3KUY A;  3AZJ A;  5B32 C;  1TZY C; 
#chains in the Genus database with same CATH homology
 3B6F C;  3MNN B;  5BNV A;  5GT3 D;  3AZK B;  5GT3 A;  3REJ D;  3O62 B;  3REJ A;  4YM6 D;  4YM6 A;  1HQ3 B;  4J8W C;  1P3A C;  1KU5 A;  3UTB B;  5AV5 C;  5AV9 C;  5BT1 D;  2ZM5 A;  3MVD B;  3C1C B;  2UWX A;  5AVC B;  4ZUX C;  3AZN C;  2NZD D;  2F8N D;  1P3F B;  1F66 B;  4XUJ B;  2F8N G;  3C1B C;  2F8N A;  2NZD A;  2YFW B;  1P3P C;  4J8U B;  5JA4 B;  4WNN A;  3H0M C;  1P3M B;  3MGQ B;  3B0D C;  4DRA A;  3AFA B;  3B6F D;  3R45 B;  3W97 D;  3W97 A;  3KWQ B;  2Y2M A;  5CPK A;  4ZBJ C;  1R4V A;  4J8W D;  3LZ1 D;  3A6N C;  3LZ1 A;  4J8W A;  4DQY B;  4KUD B;  5AV5 D;  2YFV B;  2ARO A;  4JJN D;  5AV9 D;  1H3O A;  4JJN A;  1KX5 B;  3LEL B;  4ZUX D;  3AZG C;  5AVB D;  5AVB A;  2NQB C;  1P3O C;  3C1B D;  5CPI C;  3C1B A;  1P3G C;  1P3K C;  2BYK A;  1BH9 B;  5AV8 B;  5B2I D;  5B2I A;  5GT0 D;  1F1E A;  1U35 B;  5GT0 A;  2CV5 B;  1P3B B;  1KX3 C;  5B32 B;  1TZY B;  1EQZ A;  4H9N B;  3KSY A;  1N1J B;  3AN2 B;  1ID3 A;  4YS3 C;  4J8X C;  1P3A B;  2FJ7 C;  4H9P A;  5CP6 D;  5CP6 A;  2RIQ A;  4G92 B;  2F2A C;  3VH5 W;  1P3L B;  5F99 A;  4HGA B;  3REH B;  1M19 D;  1M19 A;  3AZG D;  3AZN B;  4H9S C;  3AZG A;  4Z66 B;  5B2J A;  1HQ3 C;  5B1L C;  1P3O D;  3WKJ B;  1P3G D;  1P3K D;  1P3K A;  1P3P B;  2DF4 C;  5DNN C;  3MVD C;  5E5A A;  3C1C C;  3X1T B;  4WU9 D;  4WU9 A;  1BH8 A;  5B31 C;  1KX3 D;  1P3F C;  3H0L C;  4M6B A;  1F66 C;  1ZLA C;  5G49 B;  3NQU B;  3W99 B;  4J8V C;  1KX4 C;  3WTP D;  4NE5 A;  3WTP A;  1M18 B;  2BYM B;  3W98 B;  4J8X D;  1JFI A;  4WJ3 C;  4J8X A;  3A6N B;  5B40 C;  3AFA C;  4UPK A;  5B0Y B;  1EQZ D;  3MNN D;  3MNN A;  3AZK D;  1W2E A;  3AZK A;  3O62 D;  3AZE C;  3O62 A;  3V9R B;  4H9S A;  2NQB B;  1HQ3 D;  5CPI B;  1HQ3 A;  2G5I C;  3UTB D;  4KUD C;  3UTB A;  5JRG C;  4CSR B;  1HTA A;  3MVD D;  1KX5 C;  3C1C D;  5BS7 C;  5AVC D;  3MVD A;  3AYW B;  5AVC A;  2XD1 A;  1P3F D;  1F66 D;  4XUJ D;  1P3F A;  4XUJ A;  3MGP B;  3WAA B;  4NE3 A;  1S32 A;  4J8U D;  4J8U A;  4YS3 B;  3AL0 C;  5JA4 A;  1P3M D;  1P3M A;  2FJ7 B;  4CAY A;  4WU8 B;  3MGQ D;  3MGQ A;  1U35 C;  1P3B C;  2CV5 C;  4QLC B;  2JE5 A;  3AZH C;  3LJA B;  3AFA D;  3AFA A;  3REK B;  3REL B;  3R45 A;  3AN2 C;  2IO5 C;  3KWQ D;  3KWQ A;  2VQR A;  5CPJ C;  4XZQ C;  5B24 C;  4X23 B;  5B1L B;  3EPJ A;  2Y2Q A;  4KUD D;  4G92 C;  4KUD A;  1P3L C;  4H9R B;  2YFV A;  5DNN B;  4HGA C;  3EPK A;  3REH C;  5FUG B;  5B0Z B;  1KX5 D;  3LEL D;  5B31 B;  4G91 C;  3LEL A;  4Z66 C;  3B6G B;  1ZLA B;  4H9Q B;  3MGR B;  3WKJ C;  4J8V B;  3AZL B;  2W8S A;  1KX4 B;  2PYO B;  5AV8 D;  5AV8 A;  3X1T C;  2XD5 A;  5B40 B;  1U35 D;  1P3B D;  1U35 A;  2CV5 D;  5B32 D;  1TZY D;  5B32 A;  1TZY A;  3W99 C;  5B32 G;  3AZM B;  4H9N A;  3B6F A;  3AN2 D;  1N1J A;  4R8P B;  1M18 C;  3AZE B;  3W98 C;  4E44 A;  4WZS B;  1P3A D;  1P3A A;  3P5J B;  5JRG B;  5AV5 A;  3AV1 C;  1P3L D;  4KGC B;  5B0Y C;  3REI C;  5AV9 A;  2J8P A;  3LZ0 C;  3AZF B;  3REH D;  3REH A;  1A7W A;  4ZUX A;  3AZN D;  3AZN A;  4Z66 D;  3AZJ B;  3WKJ D;  4E45 A;  1P3P D;  1P3P A;  5C3I B;  3X1T D;  3AYW C;  4NFT A;  3AZH B;  3MGS C;  3W99 D;  2Y2N A;  3NQU A;  5G49 A;  3WAA C;  3MGP C;  3W99 A;  2IO5 B;  1M18 D;  5CPJ B;  3W98 D;  4XZQ B;  5B24 B;  4WU8 C;  3A6N D;  3A6N A;  4QLC C;  2FFF B;  3LJA C;  4AWL C;  3UTA C;  5B0Y D;  3REK C;  3REL C;  5B0Y A;  4G91 B;  5BNX A;  4X23 C;  3V9R A;  2NQB D;  1WWI A;  2NQB A;  1P3O A;  5CPI D;  3W96 B;  5CPI A;  1P3G A;  4DRB A;  4CSR A;  2JSS A;  3X1U C;  1P3I C;  5CPK B;  1B6W A;  5B0Z C;  3AYW D;  3B6G C;  1KX3 A;  2RVQ C;  3MGR C;  3MGP D;  3WAA D;  5AV6 C;  3MGP A;  3TU4 C;  2ARO B;  3AZL C;  2PYO C;  2Y2L A;  4YS3 D;  4YS3 A;  2FJ7 D;  4WU8 D;  2FJ7 A;  5B33 C;  4WU8 A;  2ZY4 A;  4EO5 B;  4QLC D;  3AZM C;  3AV1 B;  4QLC A;  3LJA D;  5B1M B;  3WA9 C;  4LD9 B;  3REI B;  3LZ0 B;  3REK D;  3REL D;  3REL A;  4R8P C;  4X23 D;  5B1L D;  4X23 A;  5B1L A;  3KXB C;  4KGC C;  4H9R A;  1ID3 B;  3AZF C;  5DNN D;  5DNN A;  3C1C A;  5B0Z D;  2Y2O A;  5FUG A;  3B0C T;  5B31 D;  1AOI C;  5B31 A;  4H9P B;  5B31 G;  3KUY C;  5DNM B;  1ZLA D;  1F66 A;  1ZLA A;  3AZJ C;  3B6G A;  3MGS B;  3B6G D;  2RVQ D;  3MGR D;  4H9Q A;  4J8V D;  4J8V A;  2YFW A;  3AZL D;  3AZI B;  5F99 B;  3AZL A;  1KX4 A;  1KX4 D;  2PYO D;  5C3I C;  2L5A A;  3REJ C;  1ULY A;  5B2J B;  4YM6 C;  2JCH A;  5B40 D;  5B40 A;  3X1S B;  1M1A B;  3AZM D;  4AWL B;  3UTA B;  1TAF B;  5E5A B;  5GXQ B;  4R8P D;  4R8P A;  3AZE D;  3AZE A;  5CHL B;  5JRG D;  5JRG A;  4KGC D;  3X1U B;  1P3I B;  3AZF D;  2Y2J A;  3AZF A;  1KX5 A;  1JFI B;  5BS7 A;  3VH5 T;  4UUZ B;  3W96 C;  3AZJ D;  3UT9 B;  3NQJ B;  5AV6 B;  3TU4 B;  3X1V B;  1BH9 A;  4H9O B;  3W97 C;  2HIO B;  5CPK C;  5B33 B;  1P3B A;  3LZ1 C;  2CV5 A;  5BO0 B;  5AY8 B;  3AZH D;  3AZH A;  3A1K A;  2HUE C;  1P34 B;  3WA9 B;  2ARO C;  4JJN C;  3AN2 A;  4Z5T B;  5CPJ D;  5CPJ A;  4XZQ D;  5AVB C;  5B24 D;  4XZQ A;  5KDM B;  5B24 A;  4Z2M G;  4EO5 C;  3KXB B;  5B1M C;  4LD9 C;  4KHA B;  1S32 B;  5GSU B;  1P3L A;  3EG5 B;  3AV2 B;  5B2I C;  2F8N K;  1AOI B;  4WV4 B;  4CAY B;  3KUY B;  5GT0 C;  4Z66 A;  1EQZ C;  3WKJ A;  3W96 D;  3W96 A;  5BNV B;  2CWE A;  5GT3 B;  1ID3 C;  3EPL A;  3REJ B;  5CPK D;  3X1T A;  4YM6 B;  2ZY5 A;  5DNM C;  3VH6 T;  5CP6 C;  3B0C W;  2ARO D;  3AZI C;  5F99 C;  1M19 C;  3EPH A;  1M18 A;  2BYM A;  3H0R C;  3W98 A;  1BFM A;  2NZD B;  2F8N B;  5B2J C;  2Y2K A;  3X1S C;  1Z2C B;  2BG1 A;  1M1A C;  3B0B A;  3AV1 D;  3AV1 A;  5B1M D;  4LD9 D;  5B1M A;  1B67 A;  3LZ0 D;  3REI A;  3REI D;  3LZ0 A;  4LD9 A;  4WNN B;  5E5A C;  5GXQ C;  4WU9 C;  3B6F B;  3WTP C;  1ID3 D;  3W97 B;  2DQN C;  3AYW A;  4J8W B;  3LZ1 B;  5DNM D;  5DNM A;  3VH5 A;  5AV5 B;  3MGS D;  3UT9 C;  2HUE B;  3MGS A;  3WAA A;  3X1V C;  4JJN B;  1H3O B;  5AV9 B;  3AZI D;  5F99 D;  3AZI A;  3MNN C;  2LY8 A;  4KGC A;  2HIO C;  4ZUX B;  3AZK C;  3O62 C;  5AVB B;  5B2J D;  1T3U A;  3C1B B;  2Y2I A;  3X1S D;  2BYK B;  3X1S A;  5AY8 C;  3UTB C;  1M1A D;  3LJA A;  1P34 C;  1M1A A;  1WWS A;  3UTA D;  3UTA A;  3REK A;  5B2I B;  4Z5T C;  5E5A D;  1TAF A;  3WTP E;  5GXQ D;  4Z2M H;  5AVC C;  5GXQ A;  2F8N H;  5GT0 B;  3B0D B;  1EQZ B;  2Y2P A;  4XUJ C;  1S32 C;  5GSU C;  3X1U D;  2G5H C;  1P3I D;  3X1U A;  4J8U C;  1P3I A;  3AV2 C;  5B0Z A;  4ZBJ B;  1P3M C;  3MGQ C;  5CP6 B;  4NE6 A;  3A1I A;  1Q9C A;  4UUZ A;  3MGR A;  3UT9 D;  5AV6 D;  3UT9 A;  3TU4 D;  3NQJ A;  5AV6 A;  3TU4 A;  3X1V A;  3X1V D;  1PZR A;  4H9O A;  5GT3 C;  1M19 B;  2PYO A;  2HIO D;  5BNX B;  2HIO A;  3KWQ C;  3AZG B;  5B33 D;  5B33 A;  1P3O B;  1P3G B;  3VH6 A;  1P3K B;  3F6T A;  5AY8 D;  3AZM A;  5AY8 A;  5BO0 A;  3WA9 D;  1P34 D;  3VH6 W;  1P34 A;  3WA9 A;  5BT1 C;  4Z5T D;  4WU9 B;  4Z5T A;  1BH8 B;  3LEL C;  2NZD C;  1KX3 B;  2Y2H A;  3KFU G;  5KDM A;  3KXB D;  3KXB A;  3WTP B;  1S32 D;  5GSU D;  4KHA A;  2ZY3 A;  5GSU A;  2Y2G A;  2ZY2 A;  3IP4 C;  5AV8 C;  3AV2 D;  4J8X B;  3AV2 A;  1AOI D;  1AOI A;  3FDD A;  3KUY D;  3KUY A;  3AZJ A;  5B32 C;  1TZY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...