4Z66C

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
107
structure length
107
Chain Sequence
b'AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 32
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4z66C00
3KXBB 3AZEB 5CPJD 5DNND 5AV8C 5F99B 1P34D 5AY8B 1ID3A 4NE5A 5CP6C 5CPJB 3A6ND 3NQJA 3O62A 1ID3D 3TU4A 1ZLAA 5AVBC 5B0YC 1ID3B 1P3PC 3W98A 4YM6C 3NQJB 3O62B 3TU4B 3UTBD 1P3AD 1ZLAB 4H9OB 5CPID 3VH6T 3W98D 4Z66C 4KGCD 5DNMA 3AZHC 3W98B 3AYWC 4WU9A 1BH8A 4CAYA 4KGCB 4J8XC 1KX3C 5DNMD 5B31G 5DNMB 4XUJA 5AV8D 5C3IC 5E5AA 4WU9B 1BH8B 4CAYB 5CP6D 5GXQA 1HQ3C 4JJNA 5AV9C 3AFAC 1P3FC 4XUJB 3B6FC 5B0YD 5E5AB 1Q9CA 1P3PD 5GXQB 4YM6D 3LJAA 2HUEB 3AZKA 3B0CW 4Z66D 1KX3A 3AZHD 1P3OA 3WA9C 5JA4A 3AYWD 3WKJA 4J8UC 3LJAB 4J8XD 1KX3D 5B1LA 4J8XB 4UUZA 1KX3B 1TZYC 1P3OB 2CV5A 5JA4B 1M1AC 3WKJB 4WNNB 5GSUC 5B1LB 3X1VC 1P3GA 5C3IB 5BNXA 5JRGC 5AV9D 4YS3A 3AFAD 1P3FD 3B6FD 5B32G 3MVDC 2CV5B 3RELA 3X1SC 3AV1C 3REIC 3W99A 1KX4C 5BNXB 3RELD 1P3IC 3UTAC 4YS3B 3WA9A 3AZIC 2NQBC 1BH9A 1M18A 3RELB 1KU5A 3W99B 4G91C 4G92B 3B6GC 3WA9D 2AROA 4J8UD 3REHC 3WA9B 4Z5TC 4Z2MH 1BH9B 3AN2C 1M18B 1TZYD 2AROB 5JRGA 1M1AD 5CPKA 4J8WC 3AZNA 1S32C 5GSUD 4XZQA 5B0ZA 4ZUXC 1P3KC 3X1VD 5JRGD 5CPKD 1KX4A 3MVDD 4NFTA 3KUYA 5JRGB 1M19A 3X1SD 3REKC 3AV1D 5CPKB 4J8VA 3REID 3AZNB 2PYOA 4XZQB 5B0ZB 1KX4D 5B33C 3AV2C 1EQZC 4WU8A 5B2IC 1P3ID 3UTAD 1KX4B 3AZID 2F8NK 3KUYB 2NQBD 4R8PC 1M19B 1P3IB 5DNNA 1P34A 4J8VB 1JFIA 2PYOB 3B6GD 1AOIC 4X23C 3A6NA 4WU8B 5B40C 4WV4B 3LZ0C 3REHD 4Z5TD 3AZMC 3AZLC 2JSSA 1KX5C 5DNNB 1P34B 1JFIB 4Z5TB 5B24C 3MGPC 3A6NB 4J8WD 4H9OA 4EO5B 4AWLB 1S32D 4ZUXD 5BT1C 1P3KD 4H9RB 3UTBA 1P3AA 5CPIA 4KGCA 1P3BC 3B0CT 3AZFC 3UT9C 5B1MC 4DRAA 3AZJC 5B33D 3AV2D 5AV5C 3UTBB 1EQZD 1P3AB 5B2ID 5CPIB 3X1UC 4H9QA 4HGAB 4R8PD 5AV8A 3B0DB 3C1CC 3AZLA 1BFMA 3WTPE 1AOID 5CP6A 4X23D 5B40D 2BYMA 3LZ0D 3AZMD 3AZLD 4H9QB 5B0YA 5AV8B 5AVBA 3C1BC 2L5AA 4Z2MG 3AZLB 1P3PA 5B24D 3MGPD 5CP6B 5AVBD 2F8NH 2BYMB 4YM6A 4KUDC 5BT1D 3VH5A 3AZFA 4LD9C 5AVBB 5B0YB 3B0BA 4Z66A 3KWQC 5B2JC 1P3BD 3AZHA 3X1TC 1P3PB 5B32C 3AZFD 4NE6A 3UT9D 5B1MD 3AYWA 4QLCC 5GT0C 4YM6B 3AZJD 4J8XA 3AZFB 3MNNC 4Z66B 3W97C 3X1UD 4WNNA 3AZHB 3AYWB 4H9NA 5BS7C 3C1CD 3C1BA 1U35C 2NZDC 1HQ3A 5AV9A 3AFAA 1P3FA 3B6FA 3C1BD 4H9NB 1HQ3D 4KHAA 5GT3C 3W96C 3C1BB 1HQ3B 3LZ1C 5AV9B 3AFAB 1P3FB 3B6FB 4LD9D 3MGRC 1P3LC 3KWQD 2IO5C 3X1TD 4KHAB 5B32D 4QLCD 4J8UA 4E45A 3MGSC 4NE3A 3MNND 2FJ7C 4CSRA 1TZYA 2NZDA 4ZBJC 1M1AA 2F8NA 3AZGC 4J8UB 5GSUA 3X1VA 1U35D 2NZDD 2F8ND 4CSRB 3MGQC 1TZYB 2NZDB 2HIOC 3MVDA 3X1SA 1M1AB 3AV1A 2F8NB 3REIA 3KXBC 5GT3D 5GSUB 3AZEC 3W96D 3X1VB 2CWEA 5F99C 5AY8C 1P3IA 3LELC 3UTAA 5GT3B 3LZ1D 3AZIA 3MVDB 3MGRD 2NQBA 5CHLB 3X1SB 3AV1B 1P3LD 3REIB 5G49A 3B6GA 3UTAB 3VH5W 3MGSD 3REHA 4H9PB 4Z5TA 3AZIB 2NQBB 3AZGA 3AN2A 3O62C 5G49B 4G91B 3B6GB 3TU4C 3VH6A 4H9RA 1ZLAC 3AZGD 3AN2D 5B31C 4J8WA 1S32A 4ZUXA 3REHB 1P3KA 3AZGB 3AN2B 3MGQD 2HIOD 3LELA 3REKA 4J8WB 3KXBD 1S32B 5DNMC 1WWSA 3AZED 4ZUXB 1P3KB 5F99D 5B33A 3AV2A 1EQZA 5AY8D 5B2IA 3LELD 3REKD 4WU9C 4R8PA 1B6WA 3LELB 3REKB 4XUJC 1AOIA 5B33B 3AV2B 4X23A 1EQZB 5B40A 5E5AC 5B2IB 3LZ0A 2YFWA 3AZMA 5AVCC 1TAFA 5B31A 4R8PB 5GXQC 1KX5A 3O62D 4JJNC 2HUEC 3TU4D 1WWIA 1AOIB 5B24A 3MGPA 1ZLAD 4X23B 5B31D 5B40B 1KX5D 3LZ0B 2YFWB 3WAAC 3AZMB 1TAFB 5B31B 1KX5B 3LJAC 1P3BA 1A7WA 5B24B 3MGPB 3AZKC 3UT9A 5B1MA 2LY8A 3AZJA 1P3OC 2RVQC 5AV5A 3WKJC 4WU9D 3X1UA 1P3BB 5B1LC 3REJC 5AV5D 1F66C 3UT9B 5B1MB 3C1CA 3AZJB 4XUJD 5AVCA 4H9SC 2CV5C 1P3MC 5AV5B 5E5AD 1N1JA 3X1UB 1P3GC 5AVCD 5GXQD 3KSYA 4JJND 3WAAA 4YS3C 3C1CB 5AVCB 2BYKA 3RELC 4JJNB 1N1JB 4KUDA 3WAAD 3W99C 4G92C 4LD9A 5AV6C 3LJAD 3WAAB 3KWQA 5B2JA 4KUDD 3NQUA 3WTPC 3VH6W 2BYKB 5B32A 3X1TA 3AZKD 1M18C 4QLCA 5GT0A 4KUDB 5BNVA 1P3OD 5B2JD 3REJA 2RVQD 3AZKB 2AROC 3VH5T 3MNNA 4LD9B 3WKJD 1F66A 3W97A 4M6BA 5GT0D 5B2JB 5B1LD 4H9SA 3NQUB 3KWQB 3X1TB 3REJD 5B32B 1P3MA 1B67A 4E44A 1F66D 4QLCB 5GT0B 5BS7A 3W97D 5BNVB 3REJB 2CV5D 1P3MD 1U35A 3MNNB 5CPKC 1F66B 4UUZB 3AZNC 3W97B 4XZQC 1HTAA 5B0ZC 1P3GD 1P3MB 4YS3D 5FUGA 1P3GB 5GT3A 3W96A 5AV6A 3KUYC 1M19C 1ULYA 1U35B 4J8VC 2PYOC 5KDMA 3W99D 3WTPA 3LZ1A 2YFVA 4WZSB 5AV6D 3MGRA 4WU8C 3V9RA 1P3LA 1R4VA 5FUGB 3WTPD 1H3OA 3W96B 4H9PA 5AV6B 1M18D 5CPJC 5DNNC 2F8NG 1P34C 5KDMB 3WTPB 3MGSA 3LZ1B 2YFVB 2AROD 3A6NC 3MGRB 5BO0A 4AWLC 2FJ7A 4EO5C 3V9RB 1P3LB 2IO5B 1ID3C 1H3OB 2FJ7D 4DRBA 3MGSB 3R45A 5BO0B 3AZND 2FJ7B 3MGQA 4XZQD 5B0ZD 1F1EA 2HIOA 3UTBC 1P3AC 4ZBJB 5CPIC 3W98C 3KXBA 4KGCC 3AZEA 3KUYD 4HGAC 1M19D 3R45B 5F99A 3B0DC 5AY8A 4J8VD 2PYOD 3MGQB 5CPJA 2HIOB 4WU8D
chains in the Genus database with same CATH superfamily
3KXBB 3AZEB 2JE5A 5CPJD 5DNND 5AV8C 5F99B 1P34D 5AY8B 1ID3A 4NE5A 5CP6C 5CPJB 3A6ND 3NQJA 3O62A 1ID3D 3TU4A 1ZLAA 5AVBC 5B0YC 1ID3B 1P3PC 3W98A 4YM6C 3NQJB 3O62B 3TU4B 3UTBD 1P3AD 1ZLAB 4H9OB 5CPID 2XD5A 3VH6T 4Z66C 3W98D 4KGCD 5DNMA 3AZHC 3W98B 3AYWC 4WU9A 1BH8A 3IP4C 4CAYA 4KGCB 4J8XC 1KX3C 5DNMD 5B31G 5DNMB 2Y2IA 4XUJA 5AV8D 5C3IC 5E5AA 4WU9B 1BH8B 4CAYB 5CP6D 5GXQA 1HQ3C 4JJNA 5AV9C 3AFAC 1P3FC 4XUJB 3B6FC 5B0YD 5E5AB 1Q9CA 1P3PD 5GXQB 4YM6D 3LJAA 2HUEB 2DQNC 3AZKA 3B0CW 4Z66D 1KX3A 3AZHD 1P3OA 3WA9C 5JA4A 1Z2CB 3AYWD 3WKJA 4J8UC 3LJAB 4J8XD 1KX3D 5B1LA 4J8XB 4UUZA 1KX3B 1TZYC 1P3OB 2CV5A 5JA4B 1M1AC 3WKJB 4WNNB 5GSUC 2Y2LA 5B1LB 3X1VC 1P3GA 5C3IB 5BNXA 5JRGC 5AV9D 4YS3A 3AFAD 1P3FD 3B6FD 5B32G 3MVDC 2CV5B 3RELA 3X1SC 3AV1C 3REIC 3W99A 1KX4C 2W8SA 5BNXB 3RELD 1P3IC 3UTAC 4YS3B 3WA9A 3AZIC 2NQBC 1BH9A 1M18A 3RELB 1KU5A 3W99B 4G91C 4G92B 3B6GC 3WA9D 2AROA 2G5IC 4J8UD 3REHC 3WA9B 4Z5TC 4Z2MH 1BH9B 3AN2C 1M18B 1TZYD 2Y2OA 2AROB 5JRGA 1M1AD 5CPKA 4J8WC 3AZNA 1S32C 5GSUD 4XZQA 5B0ZA 4ZUXC 1P3KC 3X1VD 2JCHA 5JRGD 5CPKD 1KX4A 3MVDD 4NFTA 3KUYA 5JRGB 1M19A 3X1SD 3REKC 3AV1D 5CPKB 4J8VA 3REID 3AZNB 2PYOA 4XZQB 5B0ZB 1KX4D 5B33C 3AV2C 1EQZC 4WU8A 5B2IC 1P3ID 3UTAD 1KX4B 3AZID 2F8NK 3KUYB 2NQBD 4R8PC 1M19B 1P3IB 5DNNA 1P34A 4J8VB 2FFFB 3F6TA 1JFIA 2PYOB 3B6GD 1AOIC 4X23C 3A6NA 4WU8B 5B40C 4WV4B 3LZ0C 3REHD 4Z5TD 3AZMC 3AZLC 2JSSA 1KX5C 5DNNB 1P34B 1JFIB 4Z5TB 5B24C 3MGPC 2ZY3A 3A6NB 2Y2NA 4J8WD 4H9OA 4EO5B 4AWLB 1S32D 4ZUXD 5BT1C 1P3KD 4H9RB 3UTBA 1PZRA 1P3AA 3EPKA 5CPIA 4KGCA 1P3BC 3B0CT 3AZFC 3UT9C 5B1MC 4DRAA 3AZJC 5B33D 3AV2D 5AV5C 3UTBB 1EQZD 1P3AB 5B2ID 5CPIB 3X1UC 4H9QA 4HGAB 4R8PD 2ZY4A 2F2AC 5AV8A 3B0DB 3C1CC 3AZLA 1BFMA 3WTPE 1AOID 5CP6A 4X23D 5B40D 2BYMA 3LZ0D 3AZMD 3AZLD 4H9QB 5AVBA 5AV8B 5B0YA 3C1BC 2L5AA 4Z2MG 3AZLB 3EPHA 1P3PA 5B24D 3MGPD 5CP6B 5AVBD 2F8NH 2BYMB 4YM6A 4KUDC 5BT1D 3VH5A 3AZFA 4LD9C 5AVBB 5B0YB 3B0BA 4Z66A 3KWQC 5B2JC 1P3BD 3AZHA 3X1TC 1P3PB 5B32C 3AZFD 4NE6A 3UT9D 5B1MD 3AYWA 4QLCC 5GT0C 4YM6B 3AZJD 4J8XA 3AZFB 3MNNC 4Z66B 3W97C 3X1UD 4WNNA 3AZHB 3AYWB 2DF4C 4H9NA 5BS7C 3C1CD 3C1BA 1U35C 2NZDC 1HQ3A 5AV9A 3AFAA 1P3FA 3B6FA 3C1BD 4H9NB 1HQ3D 4KHAA 5GT3C 3W96C 3C1BB 1HQ3B 2VQRA 3LZ1C 5AV9B 3AFAB 1P3FB 3B6FB 4LD9D 3MGRC 1P3LC 3KWQD 2IO5C 3X1TD 4KHAB 5B32D 4QLCD 4J8UA 4E45A 3MGSC 4NE3A 3MNND 2FJ7C 4CSRA 1TZYA 2NZDA 4ZBJC 1M1AA 2F8NA 3AZGC 4J8UB 5GSUA 3X1VA 1U35D 2NZDD 1W2EA 2ZM5A 2F8ND 2Y2QA 4CSRB 3MGQC 1TZYB 2NZDB 2HIOC 3MVDA 3X1SA 1M1AB 3AV1A 2F8NB 3REIA 3KXBC 5GT3D 5GSUB 3AZEC 3W96D 3X1VB 2CWEA 5F99C 5AY8C 1P3IA 3LELC 3UTAA 5GT3B 3LZ1D 3AZIA 3MVDB 3MGRD 2NQBA 5CHLB 3X1SB 3AV1B 1P3LD 3REIB 5G49A 3B6GA 3KFUG 3UTAB 3VH5W 3A1IA 3MGSD 3REHA 4H9PB 4Z5TA 3AZIB 2NQBB 3AZGA 3AN2A 3O62C 5G49B 4G91B 3B6GB 3TU4C 3VH6A 4H9RA 1ZLAC 3AZGD 3AN2D 5B31C 4J8WA 1S32A 4ZUXA 3REHB 1P3KA 3AZGB 3AN2B 3MGQD 3H0LC 2HIOD 3LELA 3REKA 4J8WB 3KXBD 1S32B 5DNMC 1WWSA 3AZED 4ZUXB 1P3KB 5F99D 5B33A 3AV2A 1EQZA 5AY8D 5B2IA 3LELD 3REKD 4WU9C 2Y2KA 2BG1A 4R8PA 1B6WA 2G5HC 3LELB 3REKB 3P5JB 4XUJC 1AOIA 5B33B 3AV2B 4X23A 1EQZB 5B40A 5E5AC 5B2IB 3LZ0A 2YFWA 3AZMA 5AVCC 1TAFA 5B31A 4R8PB 2Y2MA 5GXQC 1KX5A 3O62D 4JJNC 2HUEC 3TU4D 1WWIA 1AOIB 5B24A 3MGPA 1ZLAD 4X23B 5B31D 5B40B 1KX5D 3LZ0B 2YFWB 3WAAC 3AZMB 1TAFB 5B31B 1KX5B 4DQYB 3LJAC 1P3BA 1A7WA 5B24B 3MGPB 3AZKC 2RIQA 3UT9A 5B1MA 2LY8A 3AZJA 1P3OC 2RVQC 5AV5A 3WKJC 4WU9D 3X1UA 1P3BB 5B1LC 3EG5B 3REJC 5AV5D 1F66C 3UT9B 5B1MB 2ZY5A 3C1CA 3AZJB 3EPLA 4XUJD 5AVCA 2UWXA 4H9SC 2CV5C 1P3MC 5AV5B 5E5AD 1N1JA 3X1UB 1P3GC 5AVCD 5GXQD 3KSYA 4JJND 3WAAA 4YS3C 3C1CB 5AVCB 2BYKA 3RELC 4JJNB 1N1JB 4KUDA 3WAAD 3W99C 4G92C 1T3UA 4LD9A 5AV6C 3LJAD 3WAAB 3KWQA 5B2JA 4KUDD 3NQUA 3WTPC 3VH6W 2BYKB 4UPKA 5B32A 3AZKD 3X1TA 1M18C 4QLCA 5GT0A 4KUDB 5BNVA 1P3OD 5B2JD 3REJA 2RVQD 3AZKB 2AROC 3VH5T 3MNNA 4LD9B 3WKJD 1F66A 3W97A 4M6BA 5GT0D 5B2JB 5B1LD 4H9SA 3NQUB 3KWQB 3EPJA 3REJD 5B32B 3X1TB 1P3MA 1B67A 4E44A 1F66D 4QLCB 2Y2JA 5BS7A 5GT0B 5BNVB 3W97D 3REJB 2CV5D 1P3MD 1U35A 3MNNB 5CPKC 1F66B 4UUZB 3AZNC 3W97B 4XZQC 1HTAA 5B0ZC 1P3GD 1P3MB 4YS3D 3AL0C 5FUGA 3A1KA 5GT3A 1P3GB 2ZY2A 3W96A 5AV6A 3KUYC 1M19C 1ULYA 1U35B 4WJ3C 4J8VC 2PYOC 5KDMA 3W99D 3WTPA 3LZ1A 2YFVA 4WZSB 5AV6D 3MGRA 4WU8C 2Y2PA 3V9RA 1P3LA 1R4VA 5FUGB 3WTPD 1H3OA 3W96B 4H9PA 5AV6B 1M18D 5CPJC 5DNNC 2F8NG 1P34C 5KDMB 3WTPB 3MGSA 3LZ1B 2YFVB 2AROD 3A6NC 3MGRB 5BO0A 4AWLC 2FJ7A 4EO5C 3V9RB 1P3LB 2IO5B 1ID3C 1H3OB 2J8PA 2FJ7D 2XD1A 2Y2GA 2Y2HA 4DRBA 3MGSB 3R45A 5BO0B 3AZND 2FJ7B 3MGQA 4XZQD 5B0ZD 1F1EA 2HIOA 3UTBC 3H0RC 1P3AC 4ZBJB 5CPIC 3W98C 3KXBA 4KGCC 3AZEA 3KUYD 4HGAC 1M19D 3R45B 5F99A 3B0DC 5AY8A 4J8VD 2PYOD 3MGQB 3H0MC 5CPJA 2HIOB 3FDDA 4WU8D
chains in the Genus database with same CATH topology
3KXBB 3AZEB 2JE5A 5CPJD 5DNND 5AV8C 5F99B 1P34D 5AY8B 1ID3A 4NE5A 5CP6C 5CPJB 3A6ND 3NQJA 3O62A 1ID3D 3TU4A 1ZLAA 5AVBC 5B0YC 1ID3B 1P3PC 3W98A 4YM6C 3NQJB 3O62B 3TU4B 3UTBD 1P3AD 1ZLAB 4H9OB 5CPID 2XD5A 3VH6T 4Z66C 3W98D 4KGCD 5DNMA 3AZHC 3W98B 3AYWC 4WU9A 1BH8A 3IP4C 4CAYA 4KGCB 4J8XC 1KX3C 5DNMD 5B31G 5DNMB 2Y2IA 4XUJA 5AV8D 5C3IC 5E5AA 4WU9B 1BH8B 4CAYB 5CP6D 5GXQA 1HQ3C 4JJNA 5AV9C 3AFAC 1P3FC 4XUJB 3B6FC 5B0YD 5E5AB 1Q9CA 1P3PD 5GXQB 4YM6D 3LJAA 2HUEB 2DQNC 3AZKA 3B0CW 4Z66D 1KX3A 3AZHD 1P3OA 3WA9C 5JA4A 1Z2CB 3AYWD 3WKJA 4J8UC 3LJAB 4J8XD 1KX3D 5B1LA 4J8XB 4UUZA 1KX3B 1TZYC 1P3OB 2CV5A 5JA4B 1M1AC 3WKJB 4WNNB 5GSUC 2Y2LA 5B1LB 3X1VC 1P3GA 5C3IB 5BNXA 5JRGC 5AV9D 4YS3A 3AFAD 1P3FD 3B6FD 5B32G 3MVDC 2CV5B 3RELA 3X1SC 3AV1C 3REIC 3W99A 1KX4C 2W8SA 5BNXB 3RELD 1P3IC 3UTAC 4YS3B 3WA9A 3AZIC 2NQBC 1BH9A 1M18A 3RELB 1KU5A 3W99B 4G91C 4G92B 3B6GC 3WA9D 2AROA 2G5IC 4J8UD 3REHC 3WA9B 4Z5TC 4Z2MH 1BH9B 3AN2C 1M18B 1TZYD 2Y2OA 2AROB 5JRGA 1M1AD 5CPKA 4J8WC 3AZNA 1S32C 5GSUD 4XZQA 5B0ZA 4ZUXC 1P3KC 3X1VD 2JCHA 5JRGD 5CPKD 1KX4A 3MVDD 4NFTA 3KUYA 5JRGB 1M19A 3X1SD 3REKC 3AV1D 5CPKB 4J8VA 3REID 3AZNB 2PYOA 4XZQB 5B0ZB 1KX4D 5B33C 3AV2C 1EQZC 4WU8A 5B2IC 1P3ID 3UTAD 1KX4B 3AZID 2F8NK 3KUYB 2NQBD 4R8PC 1M19B 1P3IB 5DNNA 1P34A 4J8VB 2FFFB 3F6TA 1JFIA 2PYOB 3B6GD 1AOIC 4X23C 3A6NA 4WU8B 5B40C 4WV4B 3LZ0C 3REHD 4Z5TD 3AZMC 3AZLC 2JSSA 1KX5C 5DNNB 1P34B 1JFIB 4Z5TB 5B24C 3MGPC 2ZY3A 3A6NB 2Y2NA 4J8WD 4H9OA 4EO5B 4AWLB 1S32D 4ZUXD 5BT1C 1P3KD 4H9RB 3UTBA 1PZRA 1P3AA 3EPKA 5CPIA 4KGCA 1P3BC 3B0CT 3AZFC 3UT9C 5B1MC 4DRAA 3AZJC 5B33D 3AV2D 5AV5C 3UTBB 1EQZD 1P3AB 5B2ID 5CPIB 3X1UC 4H9QA 4HGAB 4R8PD 2ZY4A 2F2AC 5AV8A 3B0DB 3C1CC 3AZLA 1BFMA 3WTPE 1AOID 5CP6A 4X23D 5B40D 2BYMA 3LZ0D 3AZMD 3AZLD 4H9QB 5AVBA 5AV8B 5B0YA 3C1BC 2L5AA 4Z2MG 3AZLB 3EPHA 1P3PA 5B24D 3MGPD 5CP6B 5AVBD 2F8NH 2BYMB 4YM6A 4KUDC 5BT1D 3VH5A 3AZFA 4LD9C 5AVBB 5B0YB 3B0BA 4Z66A 3KWQC 5B2JC 1P3BD 3AZHA 3X1TC 1P3PB 5B32C 3AZFD 4NE6A 3UT9D 5B1MD 3AYWA 4QLCC 5GT0C 4YM6B 3AZJD 4J8XA 3AZFB 3MNNC 4Z66B 3W97C 3X1UD 4WNNA 3AZHB 3AYWB 2DF4C 4H9NA 5BS7C 3C1CD 3C1BA 1U35C 2NZDC 1HQ3A 5AV9A 3AFAA 1P3FA 3B6FA 3C1BD 4H9NB 1HQ3D 4KHAA 5GT3C 3W96C 3C1BB 1HQ3B 2VQRA 3LZ1C 5AV9B 3AFAB 1P3FB 3B6FB 4LD9D 3MGRC 1P3LC 3KWQD 2IO5C 3X1TD 4KHAB 5B32D 4QLCD 4J8UA 4E45A 3MGSC 4NE3A 3MNND 2FJ7C 4CSRA 1TZYA 2NZDA 4ZBJC 1M1AA 2F8NA 3AZGC 4J8UB 5GSUA 3X1VA 1U35D 2NZDD 1W2EA 2ZM5A 2F8ND 2Y2QA 4CSRB 3MGQC 1TZYB 2NZDB 2HIOC 3MVDA 3X1SA 1M1AB 3AV1A 2F8NB 3REIA 3KXBC 5GT3D 5GSUB 3AZEC 3W96D 3X1VB 2CWEA 5F99C 5AY8C 1P3IA 3LELC 3UTAA 5GT3B 3LZ1D 3AZIA 3MVDB 3MGRD 2NQBA 5CHLB 3X1SB 3AV1B 1P3LD 3REIB 5G49A 3B6GA 3KFUG 3UTAB 3VH5W 3A1IA 3MGSD 3REHA 4H9PB 4Z5TA 3AZIB 2NQBB 3AZGA 3AN2A 3O62C 5G49B 4G91B 3B6GB 3TU4C 3VH6A 4H9RA 1ZLAC 3AZGD 3AN2D 5B31C 4J8WA 1S32A 4ZUXA 3REHB 1P3KA 3AZGB 3AN2B 3MGQD 3H0LC 2HIOD 3LELA 3REKA 4J8WB 3KXBD 1S32B 5DNMC 1WWSA 3AZED 4ZUXB 1P3KB 5F99D 5B33A 3AV2A 1EQZA 5AY8D 5B2IA 3LELD 3REKD 4WU9C 2Y2KA 2BG1A 4R8PA 1B6WA 2G5HC 3LELB 3REKB 3P5JB 4XUJC 1AOIA 5B33B 3AV2B 4X23A 1EQZB 5B40A 5E5AC 5B2IB 3LZ0A 2YFWA 3AZMA 5AVCC 1TAFA 5B31A 4R8PB 2Y2MA 5GXQC 1KX5A 3O62D 4JJNC 2HUEC 3TU4D 1WWIA 1AOIB 5B24A 3MGPA 1ZLAD 4X23B 5B31D 5B40B 1KX5D 3LZ0B 2YFWB 3WAAC 3AZMB 1TAFB 5B31B 1KX5B 4DQYB 3LJAC 1P3BA 1A7WA 5B24B 3MGPB 3AZKC 2RIQA 3UT9A 5B1MA 2LY8A 3AZJA 1P3OC 2RVQC 5AV5A 3WKJC 4WU9D 3X1UA 1P3BB 5B1LC 3EG5B 3REJC 5AV5D 1F66C 3UT9B 5B1MB 2ZY5A 3C1CA 3AZJB 3EPLA 4XUJD 5AVCA 2UWXA 4H9SC 2CV5C 1P3MC 5AV5B 5E5AD 1N1JA 3X1UB 1P3GC 5AVCD 5GXQD 3KSYA 4JJND 3WAAA 4YS3C 3C1CB 5AVCB 2BYKA 3RELC 4JJNB 1N1JB 4KUDA 3WAAD 3W99C 4G92C 1T3UA 4LD9A 5AV6C 3LJAD 3WAAB 3KWQA 5B2JA 4KUDD 3NQUA 3WTPC 3VH6W 2BYKB 4UPKA 5B32A 3AZKD 3X1TA 1M18C 4QLCA 5GT0A 4KUDB 5BNVA 1P3OD 5B2JD 3REJA 2RVQD 3AZKB 2AROC 3VH5T 3MNNA 4LD9B 3WKJD 1F66A 3W97A 4M6BA 5GT0D 5B2JB 5B1LD 4H9SA 3NQUB 3KWQB 3EPJA 3REJD 5B32B 3X1TB 1P3MA 1B67A 4E44A 1F66D 4QLCB 2Y2JA 5BS7A 5GT0B 5BNVB 3W97D 3REJB 2CV5D 1P3MD 1U35A 3MNNB 5CPKC 1F66B 4UUZB 3AZNC 3W97B 4XZQC 1HTAA 5B0ZC 1P3GD 1P3MB 4YS3D 3AL0C 5FUGA 3A1KA 5GT3A 1P3GB 2ZY2A 3W96A 5AV6A 3KUYC 1M19C 1ULYA 1U35B 4WJ3C 4J8VC 2PYOC 5KDMA 3W99D 3WTPA 3LZ1A 2YFVA 4WZSB 5AV6D 3MGRA 4WU8C 2Y2PA 3V9RA 1P3LA 1R4VA 5FUGB 3WTPD 1H3OA 3W96B 4H9PA 5AV6B 1M18D 5CPJC 5DNNC 2F8NG 1P34C 5KDMB 3WTPB 3MGSA 3LZ1B 2YFVB 2AROD 3A6NC 3MGRB 5BO0A 4AWLC 2FJ7A 4EO5C 3V9RB 1P3LB 2IO5B 1ID3C 1H3OB 2J8PA 2FJ7D 2XD1A 2Y2GA 2Y2HA 4DRBA 3MGSB 3R45A 5BO0B 3AZND 2FJ7B 3MGQA 4XZQD 5B0ZD 1F1EA 2HIOA 3UTBC 3H0RC 1P3AC 4ZBJB 5CPIC 3W98C 3KXBA 4KGCC 3AZEA 3KUYD 4HGAC 1M19D 3R45B 5F99A 3B0DC 5AY8A 4J8VD 2PYOD 3MGQB 3H0MC 5CPJA 2HIOB 3FDDA 4WU8D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KXB B;  3AZE B;  5CPJ D;  5DNN D;  5AV8 C;  5F99 B;  1P34 D;  5AY8 B;  1ID3 A;  4NE5 A;  5CP6 C;  5CPJ B;  3A6N D;  3NQJ A;  3O62 A;  1ID3 D;  3TU4 A;  1ZLA A;  5AVB C;  5B0Y C;  1ID3 B;  1P3P C;  3W98 A;  4YM6 C;  3NQJ B;  3O62 B;  3TU4 B;  3UTB D;  1P3A D;  1ZLA B;  4H9O B;  5CPI D;  3VH6 T;  3W98 D;  4Z66 C;  4KGC D;  5DNM A;  3AZH C;  3W98 B;  3AYW C;  4WU9 A;  1BH8 A;  4CAY A;  4KGC B;  4J8X C;  1KX3 C;  5DNM D;  5B31 G;  5DNM B;  4XUJ A;  5AV8 D;  5C3I C;  5E5A A;  4WU9 B;  1BH8 B;  4CAY B;  5CP6 D;  5GXQ A;  1HQ3 C;  4JJN A;  5AV9 C;  3AFA C;  1P3F C;  4XUJ B;  3B6F C;  5B0Y D;  5E5A B;  1Q9C A;  1P3P D;  5GXQ B;  4YM6 D;  3LJA A;  2HUE B;  3AZK A;  3B0C W;  4Z66 D;  1KX3 A;  3AZH D;  1P3O A;  3WA9 C;  5JA4 A;  3AYW D;  3WKJ A;  4J8U C;  3LJA B;  4J8X D;  1KX3 D;  5B1L A;  4J8X B;  4UUZ A;  1KX3 B;  1TZY C;  1P3O B;  2CV5 A;  5JA4 B;  1M1A C;  3WKJ B;  4WNN B;  5GSU C;  5B1L B;  3X1V C;  1P3G A;  5C3I B;  5BNX A;  5JRG C;  5AV9 D;  4YS3 A;  3AFA D;  1P3F D;  3B6F D;  5B32 G;  3MVD C;  2CV5 B;  3REL A;  3X1S C;  3AV1 C;  3REI C;  3W99 A;  1KX4 C;  5BNX B;  3REL D;  1P3I C;  3UTA C;  4YS3 B;  3WA9 A;  3AZI C;  2NQB C;  1BH9 A;  1M18 A;  3REL B;  1KU5 A;  3W99 B;  4G91 C;  4G92 B;  3B6G C;  3WA9 D;  2ARO A;  4J8U D;  3REH C;  3WA9 B;  4Z5T C;  4Z2M H;  1BH9 B;  3AN2 C;  1M18 B;  1TZY D;  2ARO B;  5JRG A;  1M1A D;  5CPK A;  4J8W C;  3AZN A;  1S32 C;  5GSU D;  4XZQ A;  5B0Z A;  4ZUX C;  1P3K C;  3X1V D;  5JRG D;  5CPK D;  1KX4 A;  3MVD D;  4NFT A;  3KUY A;  5JRG B;  1M19 A;  3X1S D;  3REK C;  3AV1 D;  5CPK B;  4J8V A;  3REI D;  3AZN B;  2PYO A;  4XZQ B;  5B0Z B;  1KX4 D;  5B33 C;  3AV2 C;  1EQZ C;  4WU8 A;  5B2I C;  1P3I D;  3UTA D;  1KX4 B;  3AZI D;  2F8N K;  3KUY B;  2NQB D;  4R8P C;  1M19 B;  1P3I B;  5DNN A;  1P34 A;  4J8V B;  1JFI A;  2PYO B;  3B6G D;  1AOI C;  4X23 C;  3A6N A;  4WU8 B;  5B40 C;  4WV4 B;  3LZ0 C;  3REH D;  4Z5T D;  3AZM C;  3AZL C;  2JSS A;  1KX5 C;  5DNN B;  1P34 B;  1JFI B;  4Z5T B;  5B24 C;  3MGP C;  3A6N B;  4J8W D;  4H9O A;  4EO5 B;  4AWL B;  1S32 D;  4ZUX D;  5BT1 C;  1P3K D;  4H9R B;  3UTB A;  1P3A A;  5CPI A;  4KGC A;  1P3B C;  3B0C T;  3AZF C;  3UT9 C;  5B1M C;  4DRA A;  3AZJ C;  5B33 D;  3AV2 D;  5AV5 C;  3UTB B;  1EQZ D;  1P3A B;  5B2I D;  5CPI B;  3X1U C;  4H9Q A;  4HGA B;  4R8P D;  5AV8 A;  3B0D B;  3C1C C;  3AZL A;  1BFM A;  3WTP E;  1AOI D;  5CP6 A;  4X23 D;  5B40 D;  2BYM A;  3LZ0 D;  3AZM D;  3AZL D;  4H9Q B;  5B0Y A;  5AV8 B;  5AVB A;  3C1B C;  2L5A A;  4Z2M G;  3AZL B;  1P3P A;  5B24 D;  3MGP D;  5CP6 B;  5AVB D;  2F8N H;  2BYM B;  4YM6 A;  4KUD C;  5BT1 D;  3VH5 A;  3AZF A;  4LD9 C;  5AVB B;  5B0Y B;  3B0B A;  4Z66 A;  3KWQ C;  5B2J C;  1P3B D;  3AZH A;  3X1T C;  1P3P B;  5B32 C;  3AZF D;  4NE6 A;  3UT9 D;  5B1M D;  3AYW A;  4QLC C;  5GT0 C;  4YM6 B;  3AZJ D;  4J8X A;  3AZF B;  3MNN C;  4Z66 B;  3W97 C;  3X1U D;  4WNN A;  3AZH B;  3AYW B;  4H9N A;  5BS7 C;  3C1C D;  3C1B A;  1U35 C;  2NZD C;  1HQ3 A;  5AV9 A;  3AFA A;  1P3F A;  3B6F A;  3C1B D;  4H9N B;  1HQ3 D;  4KHA A;  5GT3 C;  3W96 C;  3C1B B;  1HQ3 B;  3LZ1 C;  5AV9 B;  3AFA B;  1P3F B;  3B6F B;  4LD9 D;  3MGR C;  1P3L C;  3KWQ D;  2IO5 C;  3X1T D;  4KHA B;  5B32 D;  4QLC D;  4J8U A;  4E45 A;  3MGS C;  4NE3 A;  3MNN D;  2FJ7 C;  4CSR A;  1TZY A;  2NZD A;  4ZBJ C;  1M1A A;  2F8N A;  3AZG C;  4J8U B;  5GSU A;  3X1V A;  1U35 D;  2NZD D;  2F8N D;  4CSR B;  3MGQ C;  1TZY B;  2NZD B;  2HIO C;  3MVD A;  3X1S A;  1M1A B;  3AV1 A;  2F8N B;  3REI A;  3KXB C;  5GT3 D;  5GSU B;  3AZE C;  3W96 D;  3X1V B;  2CWE A;  5F99 C;  5AY8 C;  1P3I A;  3LEL C;  3UTA A;  5GT3 B;  3LZ1 D;  3AZI A;  3MVD B;  3MGR D;  2NQB A;  5CHL B;  3X1S B;  3AV1 B;  1P3L D;  3REI B;  5G49 A;  3B6G A;  3UTA B;  3VH5 W;  3MGS D;  3REH A;  4H9P B;  4Z5T A;  3AZI B;  2NQB B;  3AZG A;  3AN2 A;  3O62 C;  5G49 B;  4G91 B;  3B6G B;  3TU4 C;  3VH6 A;  4H9R A;  1ZLA C;  3AZG D;  3AN2 D;  5B31 C;  4J8W A;  1S32 A;  4ZUX A;  3REH B;  1P3K A;  3AZG B;  3AN2 B;  3MGQ D;  2HIO D;  3LEL A;  3REK A;  4J8W B;  3KXB D;  1S32 B;  5DNM C;  1WWS A;  3AZE D;  4ZUX B;  1P3K B;  5F99 D;  5B33 A;  3AV2 A;  1EQZ A;  5AY8 D;  5B2I A;  3LEL D;  3REK D;  4WU9 C;  4R8P A;  1B6W A;  3LEL B;  3REK B;  4XUJ C;  1AOI A;  5B33 B;  3AV2 B;  4X23 A;  1EQZ B;  5B40 A;  5E5A C;  5B2I B;  3LZ0 A;  2YFW A;  3AZM A;  5AVC C;  1TAF A;  5B31 A;  4R8P B;  5GXQ C;  1KX5 A;  3O62 D;  4JJN C;  2HUE C;  3TU4 D;  1WWI A;  1AOI B;  5B24 A;  3MGP A;  1ZLA D;  4X23 B;  5B31 D;  5B40 B;  1KX5 D;  3LZ0 B;  2YFW B;  3WAA C;  3AZM B;  1TAF B;  5B31 B;  1KX5 B;  3LJA C;  1P3B A;  1A7W A;  5B24 B;  3MGP B;  3AZK C;  3UT9 A;  5B1M A;  2LY8 A;  3AZJ A;  1P3O C;  2RVQ C;  5AV5 A;  3WKJ C;  4WU9 D;  3X1U A;  1P3B B;  5B1L C;  3REJ C;  5AV5 D;  1F66 C;  3UT9 B;  5B1M B;  3C1C A;  3AZJ B;  4XUJ D;  5AVC A;  4H9S C;  2CV5 C;  1P3M C;  5AV5 B;  5E5A D;  1N1J A;  3X1U B;  1P3G C;  5AVC D;  5GXQ D;  3KSY A;  4JJN D;  3WAA A;  4YS3 C;  3C1C B;  5AVC B;  2BYK A;  3REL C;  4JJN B;  1N1J B;  4KUD A;  3WAA D;  3W99 C;  4G92 C;  4LD9 A;  5AV6 C;  3LJA D;  3WAA B;  3KWQ A;  5B2J A;  4KUD D;  3NQU A;  3WTP C;  3VH6 W;  2BYK B;  5B32 A;  3X1T A;  3AZK D;  1M18 C;  4QLC A;  5GT0 A;  4KUD B;  5BNV A;  1P3O D;  5B2J D;  3REJ A;  2RVQ D;  3AZK B;  2ARO C;  3VH5 T;  3MNN A;  4LD9 B;  3WKJ D;  1F66 A;  3W97 A;  4M6B A;  5GT0 D;  5B2J B;  5B1L D;  4H9S A;  3NQU B;  3KWQ B;  3X1T B;  3REJ D;  5B32 B;  1P3M A;  1B67 A;  4E44 A;  1F66 D;  4QLC B;  5GT0 B;  5BS7 A;  3W97 D;  5BNV B;  3REJ B;  2CV5 D;  1P3M D;  1U35 A;  3MNN B;  5CPK C;  1F66 B;  4UUZ B;  3AZN C;  3W97 B;  4XZQ C;  1HTA A;  5B0Z C;  1P3G D;  1P3M B;  4YS3 D;  5FUG A;  1P3G B;  5GT3 A;  3W96 A;  5AV6 A;  3KUY C;  1M19 C;  1ULY A;  1U35 B;  4J8V C;  2PYO C;  5KDM A;  3W99 D;  3WTP A;  3LZ1 A;  2YFV A;  4WZS B;  5AV6 D;  3MGR A;  4WU8 C;  3V9R A;  1P3L A;  1R4V A;  5FUG B;  3WTP D;  1H3O A;  3W96 B;  4H9P A;  5AV6 B;  1M18 D;  5CPJ C;  5DNN C;  2F8N G;  1P34 C;  5KDM B;  3WTP B;  3MGS A;  3LZ1 B;  2YFV B;  2ARO D;  3A6N C;  3MGR B;  5BO0 A;  4AWL C;  2FJ7 A;  4EO5 C;  3V9R B;  1P3L B;  2IO5 B;  1ID3 C;  1H3O B;  2FJ7 D;  4DRB A;  3MGS B;  3R45 A;  5BO0 B;  3AZN D;  2FJ7 B;  3MGQ A;  4XZQ D;  5B0Z D;  1F1E A;  2HIO A;  3UTB C;  1P3A C;  4ZBJ B;  5CPI C;  3W98 C;  3KXB A;  4KGC C;  3AZE A;  3KUY D;  4HGA C;  1M19 D;  3R45 B;  5F99 A;  3B0D C;  5AY8 A;  4J8V D;  2PYO D;  3MGQ B;  5CPJ A;  2HIO B;  4WU8 D; 
#chains in the Genus database with same CATH topology
 3KXB B;  3AZE B;  2JE5 A;  5CPJ D;  5DNN D;  5AV8 C;  5F99 B;  1P34 D;  5AY8 B;  1ID3 A;  4NE5 A;  5CP6 C;  5CPJ B;  3A6N D;  3NQJ A;  3O62 A;  1ID3 D;  3TU4 A;  1ZLA A;  5AVB C;  5B0Y C;  1ID3 B;  1P3P C;  3W98 A;  4YM6 C;  3NQJ B;  3O62 B;  3TU4 B;  3UTB D;  1P3A D;  1ZLA B;  4H9O B;  5CPI D;  2XD5 A;  3VH6 T;  4Z66 C;  3W98 D;  4KGC D;  5DNM A;  3AZH C;  3W98 B;  3AYW C;  4WU9 A;  1BH8 A;  3IP4 C;  4CAY A;  4KGC B;  4J8X C;  1KX3 C;  5DNM D;  5B31 G;  5DNM B;  2Y2I A;  4XUJ A;  5AV8 D;  5C3I C;  5E5A A;  4WU9 B;  1BH8 B;  4CAY B;  5CP6 D;  5GXQ A;  1HQ3 C;  4JJN A;  5AV9 C;  3AFA C;  1P3F C;  4XUJ B;  3B6F C;  5B0Y D;  5E5A B;  1Q9C A;  1P3P D;  5GXQ B;  4YM6 D;  3LJA A;  2HUE B;  2DQN C;  3AZK A;  3B0C W;  4Z66 D;  1KX3 A;  3AZH D;  1P3O A;  3WA9 C;  5JA4 A;  1Z2C B;  3AYW D;  3WKJ A;  4J8U C;  3LJA B;  4J8X D;  1KX3 D;  5B1L A;  4J8X B;  4UUZ A;  1KX3 B;  1TZY C;  1P3O B;  2CV5 A;  5JA4 B;  1M1A C;  3WKJ B;  4WNN B;  5GSU C;  2Y2L A;  5B1L B;  3X1V C;  1P3G A;  5C3I B;  5BNX A;  5JRG C;  5AV9 D;  4YS3 A;  3AFA D;  1P3F D;  3B6F D;  5B32 G;  3MVD C;  2CV5 B;  3REL A;  3X1S C;  3AV1 C;  3REI C;  3W99 A;  1KX4 C;  2W8S A;  5BNX B;  3REL D;  1P3I C;  3UTA C;  4YS3 B;  3WA9 A;  3AZI C;  2NQB C;  1BH9 A;  1M18 A;  3REL B;  1KU5 A;  3W99 B;  4G91 C;  4G92 B;  3B6G C;  3WA9 D;  2ARO A;  2G5I C;  4J8U D;  3REH C;  3WA9 B;  4Z5T C;  4Z2M H;  1BH9 B;  3AN2 C;  1M18 B;  1TZY D;  2Y2O A;  2ARO B;  5JRG A;  1M1A D;  5CPK A;  4J8W C;  3AZN A;  1S32 C;  5GSU D;  4XZQ A;  5B0Z A;  4ZUX C;  1P3K C;  3X1V D;  2JCH A;  5JRG D;  5CPK D;  1KX4 A;  3MVD D;  4NFT A;  3KUY A;  5JRG B;  1M19 A;  3X1S D;  3REK C;  3AV1 D;  5CPK B;  4J8V A;  3REI D;  3AZN B;  2PYO A;  4XZQ B;  5B0Z B;  1KX4 D;  5B33 C;  3AV2 C;  1EQZ C;  4WU8 A;  5B2I C;  1P3I D;  3UTA D;  1KX4 B;  3AZI D;  2F8N K;  3KUY B;  2NQB D;  4R8P C;  1M19 B;  1P3I B;  5DNN A;  1P34 A;  4J8V B;  2FFF B;  3F6T A;  1JFI A;  2PYO B;  3B6G D;  1AOI C;  4X23 C;  3A6N A;  4WU8 B;  5B40 C;  4WV4 B;  3LZ0 C;  3REH D;  4Z5T D;  3AZM C;  3AZL C;  2JSS A;  1KX5 C;  5DNN B;  1P34 B;  1JFI B;  4Z5T B;  5B24 C;  3MGP C;  2ZY3 A;  3A6N B;  2Y2N A;  4J8W D;  4H9O A;  4EO5 B;  4AWL B;  1S32 D;  4ZUX D;  5BT1 C;  1P3K D;  4H9R B;  3UTB A;  1PZR A;  1P3A A;  3EPK A;  5CPI A;  4KGC A;  1P3B C;  3B0C T;  3AZF C;  3UT9 C;  5B1M C;  4DRA A;  3AZJ C;  5B33 D;  3AV2 D;  5AV5 C;  3UTB B;  1EQZ D;  1P3A B;  5B2I D;  5CPI B;  3X1U C;  4H9Q A;  4HGA B;  4R8P D;  2ZY4 A;  2F2A C;  5AV8 A;  3B0D B;  3C1C C;  3AZL A;  1BFM A;  3WTP E;  1AOI D;  5CP6 A;  4X23 D;  5B40 D;  2BYM A;  3LZ0 D;  3AZM D;  3AZL D;  4H9Q B;  5AVB A;  5AV8 B;  5B0Y A;  3C1B C;  2L5A A;  4Z2M G;  3AZL B;  3EPH A;  1P3P A;  5B24 D;  3MGP D;  5CP6 B;  5AVB D;  2F8N H;  2BYM B;  4YM6 A;  4KUD C;  5BT1 D;  3VH5 A;  3AZF A;  4LD9 C;  5AVB B;  5B0Y B;  3B0B A;  4Z66 A;  3KWQ C;  5B2J C;  1P3B D;  3AZH A;  3X1T C;  1P3P B;  5B32 C;  3AZF D;  4NE6 A;  3UT9 D;  5B1M D;  3AYW A;  4QLC C;  5GT0 C;  4YM6 B;  3AZJ D;  4J8X A;  3AZF B;  3MNN C;  4Z66 B;  3W97 C;  3X1U D;  4WNN A;  3AZH B;  3AYW B;  2DF4 C;  4H9N A;  5BS7 C;  3C1C D;  3C1B A;  1U35 C;  2NZD C;  1HQ3 A;  5AV9 A;  3AFA A;  1P3F A;  3B6F A;  3C1B D;  4H9N B;  1HQ3 D;  4KHA A;  5GT3 C;  3W96 C;  3C1B B;  1HQ3 B;  2VQR A;  3LZ1 C;  5AV9 B;  3AFA B;  1P3F B;  3B6F B;  4LD9 D;  3MGR C;  1P3L C;  3KWQ D;  2IO5 C;  3X1T D;  4KHA B;  5B32 D;  4QLC D;  4J8U A;  4E45 A;  3MGS C;  4NE3 A;  3MNN D;  2FJ7 C;  4CSR A;  1TZY A;  2NZD A;  4ZBJ C;  1M1A A;  2F8N A;  3AZG C;  4J8U B;  5GSU A;  3X1V A;  1U35 D;  2NZD D;  1W2E A;  2ZM5 A;  2F8N D;  2Y2Q A;  4CSR B;  3MGQ C;  1TZY B;  2NZD B;  2HIO C;  3MVD A;  3X1S A;  1M1A B;  3AV1 A;  2F8N B;  3REI A;  3KXB C;  5GT3 D;  5GSU B;  3AZE C;  3W96 D;  3X1V B;  2CWE A;  5F99 C;  5AY8 C;  1P3I A;  3LEL C;  3UTA A;  5GT3 B;  3LZ1 D;  3AZI A;  3MVD B;  3MGR D;  2NQB A;  5CHL B;  3X1S B;  3AV1 B;  1P3L D;  3REI B;  5G49 A;  3B6G A;  3KFU G;  3UTA B;  3VH5 W;  3A1I A;  3MGS D;  3REH A;  4H9P B;  4Z5T A;  3AZI B;  2NQB B;  3AZG A;  3AN2 A;  3O62 C;  5G49 B;  4G91 B;  3B6G B;  3TU4 C;  3VH6 A;  4H9R A;  1ZLA C;  3AZG D;  3AN2 D;  5B31 C;  4J8W A;  1S32 A;  4ZUX A;  3REH B;  1P3K A;  3AZG B;  3AN2 B;  3MGQ D;  3H0L C;  2HIO D;  3LEL A;  3REK A;  4J8W B;  3KXB D;  1S32 B;  5DNM C;  1WWS A;  3AZE D;  4ZUX B;  1P3K B;  5F99 D;  5B33 A;  3AV2 A;  1EQZ A;  5AY8 D;  5B2I A;  3LEL D;  3REK D;  4WU9 C;  2Y2K A;  2BG1 A;  4R8P A;  1B6W A;  2G5H C;  3LEL B;  3REK B;  3P5J B;  4XUJ C;  1AOI A;  5B33 B;  3AV2 B;  4X23 A;  1EQZ B;  5B40 A;  5E5A C;  5B2I B;  3LZ0 A;  2YFW A;  3AZM A;  5AVC C;  1TAF A;  5B31 A;  4R8P B;  2Y2M A;  5GXQ C;  1KX5 A;  3O62 D;  4JJN C;  2HUE C;  3TU4 D;  1WWI A;  1AOI B;  5B24 A;  3MGP A;  1ZLA D;  4X23 B;  5B31 D;  5B40 B;  1KX5 D;  3LZ0 B;  2YFW B;  3WAA C;  3AZM B;  1TAF B;  5B31 B;  1KX5 B;  4DQY B;  3LJA C;  1P3B A;  1A7W A;  5B24 B;  3MGP B;  3AZK C;  2RIQ A;  3UT9 A;  5B1M A;  2LY8 A;  3AZJ A;  1P3O C;  2RVQ C;  5AV5 A;  3WKJ C;  4WU9 D;  3X1U A;  1P3B B;  5B1L C;  3EG5 B;  3REJ C;  5AV5 D;  1F66 C;  3UT9 B;  5B1M B;  2ZY5 A;  3C1C A;  3AZJ B;  3EPL A;  4XUJ D;  5AVC A;  2UWX A;  4H9S C;  2CV5 C;  1P3M C;  5AV5 B;  5E5A D;  1N1J A;  3X1U B;  1P3G C;  5AVC D;  5GXQ D;  3KSY A;  4JJN D;  3WAA A;  4YS3 C;  3C1C B;  5AVC B;  2BYK A;  3REL C;  4JJN B;  1N1J B;  4KUD A;  3WAA D;  3W99 C;  4G92 C;  1T3U A;  4LD9 A;  5AV6 C;  3LJA D;  3WAA B;  3KWQ A;  5B2J A;  4KUD D;  3NQU A;  3WTP C;  3VH6 W;  2BYK B;  4UPK A;  5B32 A;  3AZK D;  3X1T A;  1M18 C;  4QLC A;  5GT0 A;  4KUD B;  5BNV A;  1P3O D;  5B2J D;  3REJ A;  2RVQ D;  3AZK B;  2ARO C;  3VH5 T;  3MNN A;  4LD9 B;  3WKJ D;  1F66 A;  3W97 A;  4M6B A;  5GT0 D;  5B2J B;  5B1L D;  4H9S A;  3NQU B;  3KWQ B;  3EPJ A;  3REJ D;  5B32 B;  3X1T B;  1P3M A;  1B67 A;  4E44 A;  1F66 D;  4QLC B;  2Y2J A;  5BS7 A;  5GT0 B;  5BNV B;  3W97 D;  3REJ B;  2CV5 D;  1P3M D;  1U35 A;  3MNN B;  5CPK C;  1F66 B;  4UUZ B;  3AZN C;  3W97 B;  4XZQ C;  1HTA A;  5B0Z C;  1P3G D;  1P3M B;  4YS3 D;  3AL0 C;  5FUG A;  3A1K A;  5GT3 A;  1P3G B;  2ZY2 A;  3W96 A;  5AV6 A;  3KUY C;  1M19 C;  1ULY A;  1U35 B;  4WJ3 C;  4J8V C;  2PYO C;  5KDM A;  3W99 D;  3WTP A;  3LZ1 A;  2YFV A;  4WZS B;  5AV6 D;  3MGR A;  4WU8 C;  2Y2P A;  3V9R A;  1P3L A;  1R4V A;  5FUG B;  3WTP D;  1H3O A;  3W96 B;  4H9P A;  5AV6 B;  1M18 D;  5CPJ C;  5DNN C;  2F8N G;  1P34 C;  5KDM B;  3WTP B;  3MGS A;  3LZ1 B;  2YFV B;  2ARO D;  3A6N C;  3MGR B;  5BO0 A;  4AWL C;  2FJ7 A;  4EO5 C;  3V9R B;  1P3L B;  2IO5 B;  1ID3 C;  1H3O B;  2J8P A;  2FJ7 D;  2XD1 A;  2Y2G A;  2Y2H A;  4DRB A;  3MGS B;  3R45 A;  5BO0 B;  3AZN D;  2FJ7 B;  3MGQ A;  4XZQ D;  5B0Z D;  1F1E A;  2HIO A;  3UTB C;  3H0R C;  1P3A C;  4ZBJ B;  5CPI C;  3W98 C;  3KXB A;  4KGC C;  3AZE A;  3KUY D;  4HGA C;  1M19 D;  3R45 B;  5F99 A;  3B0D C;  5AY8 A;  4J8V D;  2PYO D;  3MGQ B;  3H0M C;  5CPJ A;  2HIO B;  3FDD A;  4WU8 D; 
#chains in the Genus database with same CATH homology
 3KXB B;  3AZE B;  2JE5 A;  5CPJ D;  5DNN D;  5AV8 C;  5F99 B;  1P34 D;  5AY8 B;  1ID3 A;  4NE5 A;  5CP6 C;  5CPJ B;  3A6N D;  3NQJ A;  3O62 A;  1ID3 D;  3TU4 A;  1ZLA A;  5AVB C;  5B0Y C;  1ID3 B;  1P3P C;  3W98 A;  4YM6 C;  3NQJ B;  3O62 B;  3TU4 B;  3UTB D;  1P3A D;  1ZLA B;  4H9O B;  5CPI D;  2XD5 A;  3VH6 T;  4Z66 C;  3W98 D;  4KGC D;  5DNM A;  3AZH C;  3W98 B;  3AYW C;  4WU9 A;  1BH8 A;  3IP4 C;  4CAY A;  4KGC B;  4J8X C;  1KX3 C;  5DNM D;  5B31 G;  5DNM B;  2Y2I A;  4XUJ A;  5AV8 D;  5C3I C;  5E5A A;  4WU9 B;  1BH8 B;  4CAY B;  5CP6 D;  5GXQ A;  1HQ3 C;  4JJN A;  5AV9 C;  3AFA C;  1P3F C;  4XUJ B;  3B6F C;  5B0Y D;  5E5A B;  1Q9C A;  1P3P D;  5GXQ B;  4YM6 D;  3LJA A;  2HUE B;  2DQN C;  3AZK A;  3B0C W;  4Z66 D;  1KX3 A;  3AZH D;  1P3O A;  3WA9 C;  5JA4 A;  1Z2C B;  3AYW D;  3WKJ A;  4J8U C;  3LJA B;  4J8X D;  1KX3 D;  5B1L A;  4J8X B;  4UUZ A;  1KX3 B;  1TZY C;  1P3O B;  2CV5 A;  5JA4 B;  1M1A C;  3WKJ B;  4WNN B;  5GSU C;  2Y2L A;  5B1L B;  3X1V C;  1P3G A;  5C3I B;  5BNX A;  5JRG C;  5AV9 D;  4YS3 A;  3AFA D;  1P3F D;  3B6F D;  5B32 G;  3MVD C;  2CV5 B;  3REL A;  3X1S C;  3AV1 C;  3REI C;  3W99 A;  1KX4 C;  2W8S A;  5BNX B;  3REL D;  1P3I C;  3UTA C;  4YS3 B;  3WA9 A;  3AZI C;  2NQB C;  1BH9 A;  1M18 A;  3REL B;  1KU5 A;  3W99 B;  4G91 C;  4G92 B;  3B6G C;  3WA9 D;  2ARO A;  2G5I C;  4J8U D;  3REH C;  3WA9 B;  4Z5T C;  4Z2M H;  1BH9 B;  3AN2 C;  1M18 B;  1TZY D;  2Y2O A;  2ARO B;  5JRG A;  1M1A D;  5CPK A;  4J8W C;  3AZN A;  1S32 C;  5GSU D;  4XZQ A;  5B0Z A;  4ZUX C;  1P3K C;  3X1V D;  2JCH A;  5JRG D;  5CPK D;  1KX4 A;  3MVD D;  4NFT A;  3KUY A;  5JRG B;  1M19 A;  3X1S D;  3REK C;  3AV1 D;  5CPK B;  4J8V A;  3REI D;  3AZN B;  2PYO A;  4XZQ B;  5B0Z B;  1KX4 D;  5B33 C;  3AV2 C;  1EQZ C;  4WU8 A;  5B2I C;  1P3I D;  3UTA D;  1KX4 B;  3AZI D;  2F8N K;  3KUY B;  2NQB D;  4R8P C;  1M19 B;  1P3I B;  5DNN A;  1P34 A;  4J8V B;  2FFF B;  3F6T A;  1JFI A;  2PYO B;  3B6G D;  1AOI C;  4X23 C;  3A6N A;  4WU8 B;  5B40 C;  4WV4 B;  3LZ0 C;  3REH D;  4Z5T D;  3AZM C;  3AZL C;  2JSS A;  1KX5 C;  5DNN B;  1P34 B;  1JFI B;  4Z5T B;  5B24 C;  3MGP C;  2ZY3 A;  3A6N B;  2Y2N A;  4J8W D;  4H9O A;  4EO5 B;  4AWL B;  1S32 D;  4ZUX D;  5BT1 C;  1P3K D;  4H9R B;  3UTB A;  1PZR A;  1P3A A;  3EPK A;  5CPI A;  4KGC A;  1P3B C;  3B0C T;  3AZF C;  3UT9 C;  5B1M C;  4DRA A;  3AZJ C;  5B33 D;  3AV2 D;  5AV5 C;  3UTB B;  1EQZ D;  1P3A B;  5B2I D;  5CPI B;  3X1U C;  4H9Q A;  4HGA B;  4R8P D;  2ZY4 A;  2F2A C;  5AV8 A;  3B0D B;  3C1C C;  3AZL A;  1BFM A;  3WTP E;  1AOI D;  5CP6 A;  4X23 D;  5B40 D;  2BYM A;  3LZ0 D;  3AZM D;  3AZL D;  4H9Q B;  5AVB A;  5AV8 B;  5B0Y A;  3C1B C;  2L5A A;  4Z2M G;  3AZL B;  3EPH A;  1P3P A;  5B24 D;  3MGP D;  5CP6 B;  5AVB D;  2F8N H;  2BYM B;  4YM6 A;  4KUD C;  5BT1 D;  3VH5 A;  3AZF A;  4LD9 C;  5AVB B;  5B0Y B;  3B0B A;  4Z66 A;  3KWQ C;  5B2J C;  1P3B D;  3AZH A;  3X1T C;  1P3P B;  5B32 C;  3AZF D;  4NE6 A;  3UT9 D;  5B1M D;  3AYW A;  4QLC C;  5GT0 C;  4YM6 B;  3AZJ D;  4J8X A;  3AZF B;  3MNN C;  4Z66 B;  3W97 C;  3X1U D;  4WNN A;  3AZH B;  3AYW B;  2DF4 C;  4H9N A;  5BS7 C;  3C1C D;  3C1B A;  1U35 C;  2NZD C;  1HQ3 A;  5AV9 A;  3AFA A;  1P3F A;  3B6F A;  3C1B D;  4H9N B;  1HQ3 D;  4KHA A;  5GT3 C;  3W96 C;  3C1B B;  1HQ3 B;  2VQR A;  3LZ1 C;  5AV9 B;  3AFA B;  1P3F B;  3B6F B;  4LD9 D;  3MGR C;  1P3L C;  3KWQ D;  2IO5 C;  3X1T D;  4KHA B;  5B32 D;  4QLC D;  4J8U A;  4E45 A;  3MGS C;  4NE3 A;  3MNN D;  2FJ7 C;  4CSR A;  1TZY A;  2NZD A;  4ZBJ C;  1M1A A;  2F8N A;  3AZG C;  4J8U B;  5GSU A;  3X1V A;  1U35 D;  2NZD D;  1W2E A;  2ZM5 A;  2F8N D;  2Y2Q A;  4CSR B;  3MGQ C;  1TZY B;  2NZD B;  2HIO C;  3MVD A;  3X1S A;  1M1A B;  3AV1 A;  2F8N B;  3REI A;  3KXB C;  5GT3 D;  5GSU B;  3AZE C;  3W96 D;  3X1V B;  2CWE A;  5F99 C;  5AY8 C;  1P3I A;  3LEL C;  3UTA A;  5GT3 B;  3LZ1 D;  3AZI A;  3MVD B;  3MGR D;  2NQB A;  5CHL B;  3X1S B;  3AV1 B;  1P3L D;  3REI B;  5G49 A;  3B6G A;  3KFU G;  3UTA B;  3VH5 W;  3A1I A;  3MGS D;  3REH A;  4H9P B;  4Z5T A;  3AZI B;  2NQB B;  3AZG A;  3AN2 A;  3O62 C;  5G49 B;  4G91 B;  3B6G B;  3TU4 C;  3VH6 A;  4H9R A;  1ZLA C;  3AZG D;  3AN2 D;  5B31 C;  4J8W A;  1S32 A;  4ZUX A;  3REH B;  1P3K A;  3AZG B;  3AN2 B;  3MGQ D;  3H0L C;  2HIO D;  3LEL A;  3REK A;  4J8W B;  3KXB D;  1S32 B;  5DNM C;  1WWS A;  3AZE D;  4ZUX B;  1P3K B;  5F99 D;  5B33 A;  3AV2 A;  1EQZ A;  5AY8 D;  5B2I A;  3LEL D;  3REK D;  4WU9 C;  2Y2K A;  2BG1 A;  4R8P A;  1B6W A;  2G5H C;  3LEL B;  3REK B;  3P5J B;  4XUJ C;  1AOI A;  5B33 B;  3AV2 B;  4X23 A;  1EQZ B;  5B40 A;  5E5A C;  5B2I B;  3LZ0 A;  2YFW A;  3AZM A;  5AVC C;  1TAF A;  5B31 A;  4R8P B;  2Y2M A;  5GXQ C;  1KX5 A;  3O62 D;  4JJN C;  2HUE C;  3TU4 D;  1WWI A;  1AOI B;  5B24 A;  3MGP A;  1ZLA D;  4X23 B;  5B31 D;  5B40 B;  1KX5 D;  3LZ0 B;  2YFW B;  3WAA C;  3AZM B;  1TAF B;  5B31 B;  1KX5 B;  4DQY B;  3LJA C;  1P3B A;  1A7W A;  5B24 B;  3MGP B;  3AZK C;  2RIQ A;  3UT9 A;  5B1M A;  2LY8 A;  3AZJ A;  1P3O C;  2RVQ C;  5AV5 A;  3WKJ C;  4WU9 D;  3X1U A;  1P3B B;  5B1L C;  3EG5 B;  3REJ C;  5AV5 D;  1F66 C;  3UT9 B;  5B1M B;  2ZY5 A;  3C1C A;  3AZJ B;  3EPL A;  4XUJ D;  5AVC A;  2UWX A;  4H9S C;  2CV5 C;  1P3M C;  5AV5 B;  5E5A D;  1N1J A;  3X1U B;  1P3G C;  5AVC D;  5GXQ D;  3KSY A;  4JJN D;  3WAA A;  4YS3 C;  3C1C B;  5AVC B;  2BYK A;  3REL C;  4JJN B;  1N1J B;  4KUD A;  3WAA D;  3W99 C;  4G92 C;  1T3U A;  4LD9 A;  5AV6 C;  3LJA D;  3WAA B;  3KWQ A;  5B2J A;  4KUD D;  3NQU A;  3WTP C;  3VH6 W;  2BYK B;  4UPK A;  5B32 A;  3AZK D;  3X1T A;  1M18 C;  4QLC A;  5GT0 A;  4KUD B;  5BNV A;  1P3O D;  5B2J D;  3REJ A;  2RVQ D;  3AZK B;  2ARO C;  3VH5 T;  3MNN A;  4LD9 B;  3WKJ D;  1F66 A;  3W97 A;  4M6B A;  5GT0 D;  5B2J B;  5B1L D;  4H9S A;  3NQU B;  3KWQ B;  3EPJ A;  3REJ D;  5B32 B;  3X1T B;  1P3M A;  1B67 A;  4E44 A;  1F66 D;  4QLC B;  2Y2J A;  5BS7 A;  5GT0 B;  5BNV B;  3W97 D;  3REJ B;  2CV5 D;  1P3M D;  1U35 A;  3MNN B;  5CPK C;  1F66 B;  4UUZ B;  3AZN C;  3W97 B;  4XZQ C;  1HTA A;  5B0Z C;  1P3G D;  1P3M B;  4YS3 D;  3AL0 C;  5FUG A;  3A1K A;  5GT3 A;  1P3G B;  2ZY2 A;  3W96 A;  5AV6 A;  3KUY C;  1M19 C;  1ULY A;  1U35 B;  4WJ3 C;  4J8V C;  2PYO C;  5KDM A;  3W99 D;  3WTP A;  3LZ1 A;  2YFV A;  4WZS B;  5AV6 D;  3MGR A;  4WU8 C;  2Y2P A;  3V9R A;  1P3L A;  1R4V A;  5FUG B;  3WTP D;  1H3O A;  3W96 B;  4H9P A;  5AV6 B;  1M18 D;  5CPJ C;  5DNN C;  2F8N G;  1P34 C;  5KDM B;  3WTP B;  3MGS A;  3LZ1 B;  2YFV B;  2ARO D;  3A6N C;  3MGR B;  5BO0 A;  4AWL C;  2FJ7 A;  4EO5 C;  3V9R B;  1P3L B;  2IO5 B;  1ID3 C;  1H3O B;  2J8P A;  2FJ7 D;  2XD1 A;  2Y2G A;  2Y2H A;  4DRB A;  3MGS B;  3R45 A;  5BO0 B;  3AZN D;  2FJ7 B;  3MGQ A;  4XZQ D;  5B0Z D;  1F1E A;  2HIO A;  3UTB C;  3H0R C;  1P3A C;  4ZBJ B;  5CPI C;  3W98 C;  3KXB A;  4KGC C;  3AZE A;  3KUY D;  4HGA C;  1M19 D;  3R45 B;  5F99 A;  3B0D C;  5AY8 A;  4J8V D;  2PYO D;  3MGQ B;  3H0M C;  5CPJ A;  2HIO B;  3FDD A;  4WU8 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...