3W98D

Crystal structure of human nucleosome core particle lacking h3.1 n-terminal region
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
95
structure length
95
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w98D00
1P3AA 2F8NH 1P3BC 5AV5B 5B0YD 3A6NC 4WV4B 3UTBC 4Z2MH 3C1BB 4J8UB 1EQZC 3MGRA 3AV2D 3NQJA 4X23B 4XZQB 1P3OB 4J8WC 5DNNA 3C1CD 1KX3A 5GT0C 4JJNA 3X1VB 5B31C 1P3AD 1N1JA 5CPJC 2YFWA 3KWQC 3AZFA 5CPIA 3WTPA 5B40C 5BNXA 5CPKA 1M18D 1P3GB 3MGRD 4ZUXC 3REKC 1BH8B 3KXBB 3WKJD 5DNND 4JJND 5GT0B 5B2JA 3AZJC 3AZNB 3REJA 5AY8C 4Z5TA 3AZFD 5CPID 3REIC 3LELC 3WTPD 5B33A 5B40B 3B6GA 1BFMA 5B2IC 3UT9D 1KX5C 3MGSC 2FJ7C 3AN2C 3W97D 1BH9B 1P3LA 4H9RB 3REKB 3V9RA 4CAYB 4WU9B 5B1LC 5B2JD 4WU8A 1KU5A 4Z5TD 1F66C 5AVBD 4WNNA 3REIB 5B33D 3B6GD 4Z66C 3VH5W 3AZKB 3AZLC 5F99B 4AWLC 5GT3B 1P3LD 3AZMC 5BT1C 1P3MA 4NFTA 3WA9A 5E5AA 5B1LB 4WU8D 5BNVA 4YS3C 5B32G 1P3FA 3UTAD 3W98D 3W96C 3NQUB 4G91C 5AVCC 3AFAB 5B1MB 3VH6A 5AV8B 1P3MD 4KGCB 3AZMB 1M19C 1P3KC 1P3PD 4YM6A 3C1BA 4H9SA 3R45A 3AZEB 1P3FD 4HGAC 3WAAC 1KX4A 3VH5A 3LZ0A 4KUDB 3LJAC 1P34A 1M19B 4R8PA 2NZDA 4YM6D 3X1SA 3C1BD 4J8UD 4X23D 1KX3C 3KXBA 1M1AB 1KX4D 5B32B 2NQBA 4HGAB 3LZ0D 5KDMB 3X1VD 1ID3A 3O62A 3AZNA 1AOIA 3W99C 5CPKC 5DNMB 4R8PD 5B24A 3X1SD 3TU4C 4G92B 1P3GD 1P3IA 4EO5B 5JRGC 4H9RA 3KXBD 2NQBD 5AV9A 3REJC 4DRAA 3O62D 3AZND 3B6FB 3KUYA 5CP6C 5FUGA 1TAFB 3W99B 3RELA 1HQ3B 4XUJB 5F99A 1P3ID 2BYMB 4LD9C 5AV9D 4WU9D 3AZIB 5B0ZC 5GXQC 1ZLAB 1EQZB 2PYOB 5BS7A 3REHB 3X1UA 1F1EA 3AZKD 5F99D 1TZYC 3WA9C 5GT3D 5E5AC 4CSRA 5B31G 4LD9B 2IO5B 5B0ZB 5GXQB 3B0DC 2AROB 3KSYA 3X1UD 3MNNA 3AV1C 5JA4B 1U35C 1M18A 4KUDA 3AFAD 3WKJA 1TZYB 5B1MD 3AZGC 5AV8D 4KGCD 3X1TA 3AZHC 1P3BB 3AZED 3A6NB 3UTBB 3B0DB 3LZ1C 3MNND 1M1AA 2HIOC 5B32A 4KHAB 3UT9A 4UUZB 1U35B 4KUDD 1P34C 3W97A 2HUEC 1R4VA 2RVQC 4NE3A 4J8WB 2NZDC 4ZBJC 3X1TD 4J8VC 5B31B 3AZHB 5CPJB 5AVBA 3KWQB 2CV5C 3MGQC 1S32C 1M1AD 5B32D 3LZ1B 1ULYA 1ID3C 5AV6C 1AOIC 4ZUXB 3MGPA 3VH6T 5B24C 1TAFA 5DNMD 3AZJB 4J8VB 5AY8B 2L5AA 4XUJA 3UTAA 3W98A 3LELB 5GSUC 3MGQB 5B2IB 1KX5B 3KUYC 3MGSB 5AV6B 3AZIA 1WWSA 3AN2B 2FJ7B 1ZLAA 3MVDA 4J8XA 3MGPD 3B6FD 3RELC 2PYOA 1P3PA 5G49B 3REHA 1B6WA 1F66B 1HQ3D 4XUJD 1JFIB 3AYWA 4QLCC 1H3OA 2YFVB 4H9PA 2BYKA 4Z66B 5GSUB 3AZLB 2F8NB 5B0YC 3AZID 4AWLB 1ZLAD 5AV5A 3MVDD 4J8XD 1EQZD 5BS7C 3X1UC 2AROA 2PYOD 3AV2C 3REHD 4J8UA 3C1CC 4X23A 4XZQA 3AYWD 4YS3B 1P3OA 4QLCB 1P3AC 3W96B 4G91B 5AVCB 3X1VA 5B0YB 5AV5D 1P3BA 3WTPE 1P3KB 3UTBA 2AROD 1M18C 3MGRC 3AV2B 3WKJC 1P3GA 4UUZA 5DNNC 4XZQD 3C1CB 1BH8A 1P3OD 4JJNC 3WAAB 4J8WA 1P3AB 5GT0A 4H9NB 3AZFC 1HTAA 5CPIC 4H9QB 3LJAB 3WTPC 1P3BD 5CPJA 3A6ND 3UTBD 3UT9C 5B40A 3MGRB 3W97C 3NQJB 1BH9A 1KX3B 3REKA 5B2JC 4CAYA 4J8WD 4WU9A 4Z5TC 5GT0D 3B0CT 5AVBC 1B67A 3AZJA 5B31D 3AZFB 4WZSB 5B33C 3WTPB 5CPJD 3B6GC 5BNXB 3KWQD 5CPKB 3REIA 5B40D 3B0BA 3AZKA 1P3LC 3TU4B 1KX5A 3MGSA 2FJ7A 5GT3A 5JRGB 4ZUXD 3REKD 4WU8C 3REJB 5B1LA 3AZJD 3UTAC 3W98C 5CP6B 1F66A 5B33B 3REID 3LELD 3NQUA 4Z66A 3AZLA 5B2ID 3AFAA 1P3LB 1P3MC 1KX5D 3MGSD 2FJ7D 5B1MA 3AN2D 1WWIA 5AV8A 4KGCA 3AZMA 1P3PC 5B1LD 3AYWC 1P3FC 4WNNB 3AZEA 1F66D 3W96A 4Z66D 3AZLD 3WA9B 5E5AB 3AZMD 5BT1D 4YM6C 3C1BC 1M19A 4H9SC 4J8UC 4DRBA 4X23C 1KX4C 3LZ0C 4YS3D 3X1VC 3AV1B 3W96D 5AVCD 5KDMA 4H9NA 4H9QA 3LJAA 4R8PC 3AZGB 3X1SC 1M19D 4YM6B 1P3KD 5DNMA 1P3GC 3R45B 3KXBC 1Q9CA 2NQBC 1KX4B 3LZ0B 2F8NG 3O62C 2HIOB 3AZNC 3WAAD 1P34B 2HUEB 3B6FA 4Z2MG 3LJAD 4R8PB 2NZDB 3X1SB 3W99A 4ZBJB 5BO0B 1P3IC 1HQ3A 3TU4A 2CV5B 2NQBB 2BYMA 5AV9C 4WU9C 5CHLB 1KX3D 5JRGA 3VH5T 1S32B 1ID3B 4E45A 3O62B 1AOIB 1EQZA 5CP6A 5B24B 3AZKC 3W99D 5CPKD 5F99C 5GT3C 1P3IB 2F8NA 3TU4D 3VH6W 5AV9B 5JRGD 4LD9A 2LY8A 3REJD 3KUYB 5FUGB 5B0ZA 5GXQA 5CP6D 3RELB 3AFAC 5JA4A 5B1MC 5AV8C 4KGCC 1TZYA 4H9OB 4LD9D 3AZEC 4E44A 5B0ZD 5GXQD 3MNNC 3X1UB 3A6NA 4KUDC 3AV1A 4KHAA 5C3IC 1U35A 4CSRB 1TZYD 3WA9D 3X1TC 3AZGA 5E5AD 2CWEA 5B31A 3AZHA 3KWQA 1M1AC 5B32C 3MNNB 1M18B 3LZ1A 3AV1D 2HIOA 3WKJB 1U35D 5C3IB 5DNNB 4ZUXA 4JJNB 5DNMC 3AZGD 3X1TB 1N1JB 2YFWB 5BO0A 4G92C 4J8VA 5AY8A 3AZHD 4EO5C 5CPIB 2CV5A 2F8NK 3LELA 3MGQA 3UT9B 3LZ1D 3W97B 1S32A 5B2IA 2HIOD 3MGPC 3B6FC 5AV6A 3AN2A 1P34D 2RVQD 5B2JB 2NZDD 4Z5TB 1HQ3C 5G49A 4XUJC 5AVBB 4J8VD 5AY8D 3B6GB 1JFIA 2CV5D 3MGQD 3AZIC 2YFVA 5GSUA 1ZLAC 4M6BA 3B0CW 3MVDC 4J8XC 1A7WA 4NE5A 1S32D 3MGPB 4NE6A 3V9RB 5AV6D 1ID3D 1AOID 2JSSA 2PYOC 3REHC 5B24D 4WU8B 3UTAB 3W98B 4YS3A 4QLCA 5GSUD 4H9OA 2IO5C 5AV5C 5AVCA 2F8ND 1P3MB 3MVDB 4J8XB 5B0YA 3KUYD 2AROC 1P3PB 1P3KA 3RELD 5BNVB 3AV2A 4XZQC 1P3OC 3AYWB 1P3FB 1H3OB 4H9PB 2BYKB 3C1CA 4QLCD 3WAAA
chains in the Genus database with same CATH superfamily
1P3AA 2F8NH 1P3BC 5AV5B 5B0YD 3A6NC 4WV4B 3UTBC 4Z2MH 3C1BB 2XD1A 4J8UB 1EQZC 3MGRA 3AV2D 3NQJA 4X23B 4XZQB 1P3OB 4J8WC 5DNNA 3C1CD 1KX3A 5GT0C 4JJNA 3X1VB 5B31C 1P3AD 1N1JA 5CPJC 2YFWA 3KWQC 3AZFA 5CPIA 3WTPA 5B40C 5BNXA 5CPKA 3A1IA 1P3GB 1M18D 3MGRD 4ZUXC 3REKC 1BH8B 3KXBB 3WKJD 3EPHA 5DNND 4JJND 5GT0B 5B2JA 3AZJC 3AZNB 3REJA 5AY8C 4Z5TA 3AZFD 5CPID 3REIC 3LELC 3WTPD 5B33A 5B40B 3B6GA 3EPJA 1BFMA 5B2IC 3UT9D 1KX5C 3MGSC 2FJ7C 3AN2C 3W97D 1BH9B 1P3LA 4H9RB 3REKB 3V9RA 4CAYB 4WU9B 5B1LC 5B2JD 4WU8A 1KU5A 2ZM5A 4Z5TD 1F66C 5AVBD 4WNNA 3REIB 5B33D 3B6GD 4Z66C 3VH5W 3AZKB 3AZLC 5F99B 4AWLC 5GT3B 1P3LD 3AZMC 5BT1C 1P3MA 2RIQA 4NFTA 3WA9A 5E5AA 5B1LB 4WU8D 5BNVA 4YS3C 2Y2QA 5B32G 1P3FA 3UTAD 2ZY3A 3W98D 3W96C 3NQUB 4G91C 5AVCC 3AFAB 5B1MB 3VH6A 5AV8B 1P3MD 4KGCB 3AZMB 1M19C 1P3KC 1P3PD 2DQNC 4YM6A 3C1BA 4H9SA 2FFFB 3R45A 3AZEB 1P3FD 2UWXA 4HGAC 3WAAC 1KX4A 3VH5A 3LZ0A 4KUDB 3FDDA 3LJAC 2F2AC 1P34A 1M19B 4R8PA 2NZDA 4YM6D 3X1SA 3C1BD 4J8UD 4X23D 1KX3C 3KXBA 1M1AB 1KX4D 5B32B 2NQBA 4HGAB 3LZ0D 5KDMB 3X1VD 1ID3A 3O62A 3AZNA 1AOIA 2Y2NA 2Y2GA 3W99C 5CPKC 5DNMB 4R8PD 5B24A 3H0RC 3AL0C 3X1SD 3TU4C 4G92B 1P3GD 1P3IA 4EO5B 5JRGC 4H9RA 3KXBD 2NQBD 2ZY4A 5AV9A 3REJC 4DRAA 3O62D 3AZND 3B6FB 3KUYA 5CP6C 5FUGA 1TAFB 2Y2IA 3W99B 3RELA 1HQ3B 4XUJB 5F99A 2Y2LA 1P3ID 2BYMB 4LD9C 5AV9D 4WU9D 3AZIB 5B0ZC 5GXQC 1ZLAB 1EQZB 3IP4C 3EPLA 2PYOB 5BS7A 3REHB 3X1UA 1F1EA 3AZKD 5F99D 1TZYC 3WA9C 5GT3D 5E5AC 4CSRA 5B31G 4LD9B 2IO5B 5B0ZB 5GXQB 3B0DC 2AROB 2G5HC 3KSYA 3X1UD 3MNNA 3AV1C 5JA4B 1U35C 1M18A 4KUDA 3AFAD 3WKJA 1TZYB 5B1MD 3AZGC 5AV8D 4KGCD 3X1TA 3AZHC 2Y2MA 1P3BB 2JE5A 3AZED 3A6NB 3UTBB 3B0DB 3LZ1C 3MNND 1M1AA 2HIOC 5B32A 4KHAB 3UT9A 4UUZB 1U35B 4KUDD 1P34C 3W97A 2HUEC 1R4VA 2RVQC 4NE3A 4UPKA 4J8WB 2NZDC 2BG1A 4ZBJC 2Y2OA 3X1TD 4J8VC 5B31B 3H0LC 3AZHB 5CPJB 5AVBA 3KWQB 2CV5C 3MGQC 1S32C 1M1AD 5B32D 3LZ1B 1ULYA 1ID3C 5AV6C 1AOIC 3KFUG 4ZUXB 3MGPA 3VH6T 5B24C 1TAFA 5DNMD 3AZJB 4J8VB 5AY8B 2L5AA 4XUJA 3UTAA 3W98A 3LELB 5GSUC 3MGQB 5B2IB 1KX5B 3KUYC 3MGSB 5AV6B 3AZIA 1WWSA 3AN2B 2FJ7B 1ZLAA 3MVDA 4J8XA 3MGPD 3B6FD 3RELC 4WJ3C 2PYOA 1P3PA 3EPKA 5G49B 3REHA 1B6WA 1F66B 1HQ3D 4XUJD 1JFIB 3AYWA 4QLCC 1H3OA 2YFVB 4H9PA 2BYKA 4Z66B 5GSUB 3AZLB 3H0MC 2F8NB 5B0YC 3AZID 4AWLB 1ZLAD 5AV5A 3MVDD 4J8XD 1EQZD 5BS7C 3X1UC 2AROA 2PYOD 3AV2C 3REHD 4J8UA 3C1CC 4X23A 4XZQA 3AYWD 4YS3B 1P3OA 2ZY5A 4QLCB 1P3AC 3W96B 4G91B 5AVCB 3X1VA 5B0YB 5AV5D 1P3BA 3WTPE 1P3KB 2Y2KA 2AROD 3UTBA 1M18C 1T3UA 3MGRC 2ZY2A 3AV2B 3WKJC 1P3GA 4UUZA 5DNNC 4XZQD 3C1CB 1BH8A 1P3OD 4JJNC 3WAAB 4J8WA 1P3AB 5GT0A 4H9NB 3AZFC 1HTAA 5CPIC 4H9QB 3LJAB 3WTPC 1P3BD 5CPJA 3A6ND 3UTBD 3UT9C 5B40A 2JCHA 3MGRB 3W97C 3NQJB 1BH9A 1KX3B 3REKA 5B2JC 4CAYA 4J8WD 4WU9A 4Z5TC 5GT0D 3B0CT 5AVBC 1B67A 3AZJA 5B31D 3AZFB 4WZSB 5B33C 3WTPB 5CPJD 3B6GC 5BNXB 3KWQD 1Z2CB 5CPKB 3REIA 5B40D 3B0BA 3AZKA 1P3LC 3TU4B 1KX5A 3MGSA 2FJ7A 5GT3A 5JRGB 4ZUXD 3REKD 4WU8C 1PZRA 3REJB 5B1LA 3AZJD 3UTAC 3W98C 5CP6B 1F66A 5B33B 3REID 3LELD 3NQUA 4Z66A 3AZLA 5B2ID 3AFAA 1P3LB 1P3MC 1KX5D 3MGSD 2FJ7D 5B1MA 3AN2D 1WWIA 5AV8A 4KGCA 3AZMA 1P3PC 5B1LD 3AYWC 1P3FC 4WNNB 3AZEA 1F66D 3P5JB 3W96A 4Z66D 3AZLD 3WA9B 5E5AB 3AZMD 5BT1D 4YM6C 3C1BC 1M19A 4H9SC 4J8UC 2Y2PA 4DRBA 4X23C 1KX4C 3LZ0C 4YS3D 3X1VC 3AV1B 3W96D 5AVCD 5KDMA 4H9NA 4H9QA 3LJAA 4R8PC 3AZGB 3EG5B 3X1SC 1M19D 4YM6B 1P3KD 5DNMA 1P3GC 3R45B 3KXBC 1Q9CA 2NQBC 1KX4B 3LZ0B 2F8NG 3O62C 2HIOB 3AZNC 3WAAD 2DF4C 1P34B 2HUEB 3B6FA 4Z2MG 3LJAD 4R8PB 2NZDB 3X1SB 3W99A 4ZBJB 5BO0B 1P3IC 1HQ3A 3TU4A 2W8SA 2CV5B 2NQBB 5AV9C 2BYMA 4WU9C 5CHLB 1KX3D 5JRGA 3VH5T 1S32B 1ID3B 4E45A 3O62B 2Y2HA 1AOIB 1EQZA 5CP6A 5B24B 3AZKC 3W99D 5CPKD 5F99C 5GT3C 1P3IB 2F8NA 3TU4D 3VH6W 5AV9B 5JRGD 4LD9A 2LY8A 3REJD 3KUYB 5FUGB 5B0ZA 5GXQA 5CP6D 3RELB 4DQYB 3AFAC 5JA4A 5B1MC 5AV8C 4KGCC 1TZYA 4H9OB 4LD9D 3AZEC 4E44A 5B0ZD 5GXQD 3MNNC 3X1UB 3A6NA 4KUDC 3AV1A 4KHAA 5C3IC 1U35A 4CSRB 1TZYD 3WA9D 3X1TC 3AZGA 5E5AD 2CWEA 5B31A 3AZHA 3KWQA 1M1AC 5B32C 3MNNB 1W2EA 1M18B 3LZ1A 3AV1D 2HIOA 3WKJB 1U35D 5C3IB 5DNNB 4ZUXA 4JJNB 5DNMC 3AZGD 3X1TB 1N1JB 2Y2JA 2YFWB 5BO0A 4G92C 4J8VA 5AY8A 3AZHD 4EO5C 5CPIB 2CV5A 3A1KA 2F8NK 3LELA 3MGQA 3UT9B 3LZ1D 3W97B 1S32A 5B2IA 2HIOD 3MGPC 3B6FC 5AV6A 3AN2A 1P34D 2RVQD 5B2JB 3F6TA 2NZDD 4Z5TB 1HQ3C 5G49A 4XUJC 5AVBB 4J8VD 5AY8D 3B6GB 1JFIA 2CV5D 3MGQD 3AZIC 2YFVA 5GSUA 1ZLAC 4M6BA 3B0CW 3MVDC 4J8XC 1A7WA 4NE5A 1S32D 3MGPB 4NE6A 3V9RB 5AV6D 1ID3D 1AOID 2JSSA 2PYOC 3REHC 5B24D 4WU8B 3UTAB 3W98B 2VQRA 4YS3A 4QLCA 5GSUD 4H9OA 2IO5C 5AV5C 5AVCA 2G5IC 1P3MB 3MVDB 4J8XB 2F8ND 5B0YA 3KUYD 2AROC 2J8PA 1P3PB 1P3KA 3RELD 5BNVB 3AV2A 4XZQC 1P3OC 3AYWB 1P3FB 1H3OB 4H9PB 2BYKB 3C1CA 4QLCD 2XD5A 3WAAA
chains in the Genus database with same CATH topology
1P3AA 2F8NH 1P3BC 5AV5B 5B0YD 3A6NC 4WV4B 3UTBC 4Z2MH 3C1BB 2XD1A 4J8UB 1EQZC 3MGRA 3AV2D 3NQJA 4X23B 4XZQB 1P3OB 4J8WC 5DNNA 3C1CD 1KX3A 5GT0C 4JJNA 3X1VB 5B31C 1P3AD 1N1JA 5CPJC 2YFWA 3KWQC 3AZFA 5CPIA 3WTPA 5B40C 5BNXA 5CPKA 3A1IA 1P3GB 1M18D 3MGRD 4ZUXC 3REKC 1BH8B 3KXBB 3WKJD 3EPHA 5DNND 4JJND 5GT0B 5B2JA 3AZJC 3AZNB 3REJA 5AY8C 4Z5TA 3AZFD 5CPID 3REIC 3LELC 3WTPD 5B33A 5B40B 3B6GA 3EPJA 1BFMA 5B2IC 3UT9D 1KX5C 3MGSC 2FJ7C 3AN2C 3W97D 1BH9B 1P3LA 4H9RB 3REKB 3V9RA 4CAYB 4WU9B 5B1LC 5B2JD 4WU8A 1KU5A 2ZM5A 4Z5TD 1F66C 5AVBD 4WNNA 3REIB 5B33D 3B6GD 4Z66C 3VH5W 3AZKB 3AZLC 5F99B 4AWLC 5GT3B 1P3LD 3AZMC 5BT1C 1P3MA 2RIQA 4NFTA 3WA9A 5E5AA 5B1LB 4WU8D 5BNVA 4YS3C 2Y2QA 5B32G 1P3FA 3UTAD 2ZY3A 3W98D 3W96C 3NQUB 4G91C 5AVCC 3AFAB 5B1MB 3VH6A 5AV8B 1P3MD 4KGCB 3AZMB 1M19C 1P3KC 1P3PD 2DQNC 4YM6A 3C1BA 4H9SA 2FFFB 3R45A 3AZEB 1P3FD 2UWXA 4HGAC 3WAAC 1KX4A 3VH5A 3LZ0A 4KUDB 3FDDA 3LJAC 2F2AC 1P34A 1M19B 4R8PA 2NZDA 4YM6D 3X1SA 3C1BD 4J8UD 4X23D 1KX3C 3KXBA 1M1AB 1KX4D 5B32B 2NQBA 4HGAB 3LZ0D 5KDMB 3X1VD 1ID3A 3O62A 3AZNA 1AOIA 2Y2NA 2Y2GA 3W99C 5CPKC 5DNMB 4R8PD 5B24A 3H0RC 3AL0C 3X1SD 3TU4C 4G92B 1P3GD 1P3IA 4EO5B 5JRGC 4H9RA 3KXBD 2NQBD 2ZY4A 5AV9A 3REJC 4DRAA 3O62D 3AZND 3B6FB 3KUYA 5CP6C 5FUGA 1TAFB 2Y2IA 3W99B 3RELA 1HQ3B 4XUJB 5F99A 2Y2LA 1P3ID 2BYMB 4LD9C 5AV9D 4WU9D 3AZIB 5B0ZC 5GXQC 1ZLAB 1EQZB 3IP4C 3EPLA 2PYOB 5BS7A 3REHB 3X1UA 1F1EA 3AZKD 5F99D 1TZYC 3WA9C 5GT3D 5E5AC 4CSRA 5B31G 4LD9B 2IO5B 5B0ZB 5GXQB 3B0DC 2AROB 2G5HC 3KSYA 3X1UD 3MNNA 3AV1C 5JA4B 1U35C 1M18A 4KUDA 3AFAD 3WKJA 1TZYB 5B1MD 3AZGC 5AV8D 4KGCD 3X1TA 3AZHC 2Y2MA 1P3BB 2JE5A 3AZED 3A6NB 3UTBB 3B0DB 3LZ1C 3MNND 1M1AA 2HIOC 5B32A 4KHAB 3UT9A 4UUZB 1U35B 4KUDD 1P34C 3W97A 2HUEC 1R4VA 2RVQC 4NE3A 4UPKA 4J8WB 2NZDC 2BG1A 4ZBJC 2Y2OA 3X1TD 4J8VC 5B31B 3H0LC 3AZHB 5CPJB 5AVBA 3KWQB 2CV5C 3MGQC 1S32C 1M1AD 5B32D 3LZ1B 1ULYA 1ID3C 5AV6C 1AOIC 3KFUG 4ZUXB 3MGPA 3VH6T 5B24C 1TAFA 5DNMD 3AZJB 4J8VB 5AY8B 2L5AA 4XUJA 3UTAA 3W98A 3LELB 5GSUC 3MGQB 5B2IB 1KX5B 3KUYC 3MGSB 5AV6B 3AZIA 1WWSA 3AN2B 2FJ7B 1ZLAA 3MVDA 4J8XA 3MGPD 3B6FD 3RELC 4WJ3C 2PYOA 1P3PA 3EPKA 5G49B 3REHA 1B6WA 1F66B 1HQ3D 4XUJD 1JFIB 3AYWA 4QLCC 1H3OA 2YFVB 4H9PA 2BYKA 4Z66B 5GSUB 3AZLB 3H0MC 2F8NB 5B0YC 3AZID 4AWLB 1ZLAD 5AV5A 3MVDD 4J8XD 1EQZD 5BS7C 3X1UC 2AROA 2PYOD 3AV2C 3REHD 4J8UA 3C1CC 4X23A 4XZQA 3AYWD 4YS3B 1P3OA 2ZY5A 4QLCB 1P3AC 3W96B 4G91B 5AVCB 3X1VA 5B0YB 5AV5D 1P3BA 3WTPE 1P3KB 2Y2KA 2AROD 3UTBA 1M18C 1T3UA 3MGRC 2ZY2A 3AV2B 3WKJC 1P3GA 4UUZA 5DNNC 4XZQD 3C1CB 1BH8A 1P3OD 4JJNC 3WAAB 4J8WA 1P3AB 5GT0A 4H9NB 3AZFC 1HTAA 5CPIC 4H9QB 3LJAB 3WTPC 1P3BD 5CPJA 3A6ND 3UTBD 3UT9C 5B40A 2JCHA 3MGRB 3W97C 3NQJB 1BH9A 1KX3B 3REKA 5B2JC 4CAYA 4J8WD 4WU9A 4Z5TC 5GT0D 3B0CT 5AVBC 1B67A 3AZJA 5B31D 3AZFB 4WZSB 5B33C 3WTPB 5CPJD 3B6GC 5BNXB 3KWQD 1Z2CB 5CPKB 3REIA 5B40D 3B0BA 3AZKA 1P3LC 3TU4B 1KX5A 3MGSA 2FJ7A 5GT3A 5JRGB 4ZUXD 3REKD 4WU8C 1PZRA 3REJB 5B1LA 3AZJD 3UTAC 3W98C 5CP6B 1F66A 5B33B 3REID 3LELD 3NQUA 4Z66A 3AZLA 5B2ID 3AFAA 1P3LB 1P3MC 1KX5D 3MGSD 2FJ7D 5B1MA 3AN2D 1WWIA 5AV8A 4KGCA 3AZMA 1P3PC 5B1LD 3AYWC 1P3FC 4WNNB 3AZEA 1F66D 3P5JB 3W96A 4Z66D 3AZLD 3WA9B 5E5AB 3AZMD 5BT1D 4YM6C 3C1BC 1M19A 4H9SC 4J8UC 2Y2PA 4DRBA 4X23C 1KX4C 3LZ0C 4YS3D 3X1VC 3AV1B 3W96D 5AVCD 5KDMA 4H9NA 4H9QA 3LJAA 4R8PC 3AZGB 3EG5B 3X1SC 1M19D 4YM6B 1P3KD 5DNMA 1P3GC 3R45B 3KXBC 1Q9CA 2NQBC 1KX4B 3LZ0B 2F8NG 3O62C 2HIOB 3AZNC 3WAAD 2DF4C 1P34B 2HUEB 3B6FA 4Z2MG 3LJAD 4R8PB 2NZDB 3X1SB 3W99A 4ZBJB 5BO0B 1P3IC 1HQ3A 3TU4A 2W8SA 2CV5B 2NQBB 5AV9C 2BYMA 4WU9C 5CHLB 1KX3D 5JRGA 3VH5T 1S32B 1ID3B 4E45A 3O62B 2Y2HA 1AOIB 1EQZA 5CP6A 5B24B 3AZKC 3W99D 5CPKD 5F99C 5GT3C 1P3IB 2F8NA 3TU4D 3VH6W 5AV9B 5JRGD 4LD9A 2LY8A 3REJD 3KUYB 5FUGB 5B0ZA 5GXQA 5CP6D 3RELB 4DQYB 3AFAC 5JA4A 5B1MC 5AV8C 4KGCC 1TZYA 4H9OB 4LD9D 3AZEC 4E44A 5B0ZD 5GXQD 3MNNC 3X1UB 3A6NA 4KUDC 3AV1A 4KHAA 5C3IC 1U35A 4CSRB 1TZYD 3WA9D 3X1TC 3AZGA 5E5AD 2CWEA 5B31A 3AZHA 3KWQA 1M1AC 5B32C 3MNNB 1W2EA 1M18B 3LZ1A 3AV1D 2HIOA 3WKJB 1U35D 5C3IB 5DNNB 4ZUXA 4JJNB 5DNMC 3AZGD 3X1TB 1N1JB 2Y2JA 2YFWB 5BO0A 4G92C 4J8VA 5AY8A 3AZHD 4EO5C 5CPIB 2CV5A 3A1KA 2F8NK 3LELA 3MGQA 3UT9B 3LZ1D 3W97B 1S32A 5B2IA 2HIOD 3MGPC 3B6FC 5AV6A 3AN2A 1P34D 2RVQD 5B2JB 3F6TA 2NZDD 4Z5TB 1HQ3C 5G49A 4XUJC 5AVBB 4J8VD 5AY8D 3B6GB 1JFIA 2CV5D 3MGQD 3AZIC 2YFVA 5GSUA 1ZLAC 4M6BA 3B0CW 3MVDC 4J8XC 1A7WA 4NE5A 1S32D 3MGPB 4NE6A 3V9RB 5AV6D 1ID3D 1AOID 2JSSA 2PYOC 3REHC 5B24D 4WU8B 3UTAB 3W98B 2VQRA 4YS3A 4QLCA 5GSUD 4H9OA 2IO5C 5AV5C 5AVCA 2G5IC 1P3MB 3MVDB 4J8XB 2F8ND 5B0YA 3KUYD 2AROC 2J8PA 1P3PB 1P3KA 3RELD 5BNVB 3AV2A 4XZQC 1P3OC 3AYWB 1P3FB 1H3OB 4H9PB 2BYKB 3C1CA 4QLCD 2XD5A 3WAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3A A;  2F8N H;  1P3B C;  5AV5 B;  5B0Y D;  3A6N C;  4WV4 B;  3UTB C;  4Z2M H;  3C1B B;  4J8U B;  1EQZ C;  3MGR A;  3AV2 D;  3NQJ A;  4X23 B;  4XZQ B;  1P3O B;  4J8W C;  5DNN A;  3C1C D;  1KX3 A;  5GT0 C;  4JJN A;  3X1V B;  5B31 C;  1P3A D;  1N1J A;  5CPJ C;  2YFW A;  3KWQ C;  3AZF A;  5CPI A;  3WTP A;  5B40 C;  5BNX A;  5CPK A;  1M18 D;  1P3G B;  3MGR D;  4ZUX C;  3REK C;  1BH8 B;  3KXB B;  3WKJ D;  5DNN D;  4JJN D;  5GT0 B;  5B2J A;  3AZJ C;  3AZN B;  3REJ A;  5AY8 C;  4Z5T A;  3AZF D;  5CPI D;  3REI C;  3LEL C;  3WTP D;  5B33 A;  5B40 B;  3B6G A;  1BFM A;  5B2I C;  3UT9 D;  1KX5 C;  3MGS C;  2FJ7 C;  3AN2 C;  3W97 D;  1BH9 B;  1P3L A;  4H9R B;  3REK B;  3V9R A;  4CAY B;  4WU9 B;  5B1L C;  5B2J D;  4WU8 A;  1KU5 A;  4Z5T D;  1F66 C;  5AVB D;  4WNN A;  3REI B;  5B33 D;  3B6G D;  4Z66 C;  3VH5 W;  3AZK B;  3AZL C;  5F99 B;  4AWL C;  5GT3 B;  1P3L D;  3AZM C;  5BT1 C;  1P3M A;  4NFT A;  3WA9 A;  5E5A A;  5B1L B;  4WU8 D;  5BNV A;  4YS3 C;  5B32 G;  1P3F A;  3UTA D;  3W98 D;  3W96 C;  3NQU B;  4G91 C;  5AVC C;  3AFA B;  5B1M B;  3VH6 A;  5AV8 B;  1P3M D;  4KGC B;  3AZM B;  1M19 C;  1P3K C;  1P3P D;  4YM6 A;  3C1B A;  4H9S A;  3R45 A;  3AZE B;  1P3F D;  4HGA C;  3WAA C;  1KX4 A;  3VH5 A;  3LZ0 A;  4KUD B;  3LJA C;  1P34 A;  1M19 B;  4R8P A;  2NZD A;  4YM6 D;  3X1S A;  3C1B D;  4J8U D;  4X23 D;  1KX3 C;  3KXB A;  1M1A B;  1KX4 D;  5B32 B;  2NQB A;  4HGA B;  3LZ0 D;  5KDM B;  3X1V D;  1ID3 A;  3O62 A;  3AZN A;  1AOI A;  3W99 C;  5CPK C;  5DNM B;  4R8P D;  5B24 A;  3X1S D;  3TU4 C;  4G92 B;  1P3G D;  1P3I A;  4EO5 B;  5JRG C;  4H9R A;  3KXB D;  2NQB D;  5AV9 A;  3REJ C;  4DRA A;  3O62 D;  3AZN D;  3B6F B;  3KUY A;  5CP6 C;  5FUG A;  1TAF B;  3W99 B;  3REL A;  1HQ3 B;  4XUJ B;  5F99 A;  1P3I D;  2BYM B;  4LD9 C;  5AV9 D;  4WU9 D;  3AZI B;  5B0Z C;  5GXQ C;  1ZLA B;  1EQZ B;  2PYO B;  5BS7 A;  3REH B;  3X1U A;  1F1E A;  3AZK D;  5F99 D;  1TZY C;  3WA9 C;  5GT3 D;  5E5A C;  4CSR A;  5B31 G;  4LD9 B;  2IO5 B;  5B0Z B;  5GXQ B;  3B0D C;  2ARO B;  3KSY A;  3X1U D;  3MNN A;  3AV1 C;  5JA4 B;  1U35 C;  1M18 A;  4KUD A;  3AFA D;  3WKJ A;  1TZY B;  5B1M D;  3AZG C;  5AV8 D;  4KGC D;  3X1T A;  3AZH C;  1P3B B;  3AZE D;  3A6N B;  3UTB B;  3B0D B;  3LZ1 C;  3MNN D;  1M1A A;  2HIO C;  5B32 A;  4KHA B;  3UT9 A;  4UUZ B;  1U35 B;  4KUD D;  1P34 C;  3W97 A;  2HUE C;  1R4V A;  2RVQ C;  4NE3 A;  4J8W B;  2NZD C;  4ZBJ C;  3X1T D;  4J8V C;  5B31 B;  3AZH B;  5CPJ B;  5AVB A;  3KWQ B;  2CV5 C;  3MGQ C;  1S32 C;  1M1A D;  5B32 D;  3LZ1 B;  1ULY A;  1ID3 C;  5AV6 C;  1AOI C;  4ZUX B;  3MGP A;  3VH6 T;  5B24 C;  1TAF A;  5DNM D;  3AZJ B;  4J8V B;  5AY8 B;  2L5A A;  4XUJ A;  3UTA A;  3W98 A;  3LEL B;  5GSU C;  3MGQ B;  5B2I B;  1KX5 B;  3KUY C;  3MGS B;  5AV6 B;  3AZI A;  1WWS A;  3AN2 B;  2FJ7 B;  1ZLA A;  3MVD A;  4J8X A;  3MGP D;  3B6F D;  3REL C;  2PYO A;  1P3P A;  5G49 B;  3REH A;  1B6W A;  1F66 B;  1HQ3 D;  4XUJ D;  1JFI B;  3AYW A;  4QLC C;  1H3O A;  2YFV B;  4H9P A;  2BYK A;  4Z66 B;  5GSU B;  3AZL B;  2F8N B;  5B0Y C;  3AZI D;  4AWL B;  1ZLA D;  5AV5 A;  3MVD D;  4J8X D;  1EQZ D;  5BS7 C;  3X1U C;  2ARO A;  2PYO D;  3AV2 C;  3REH D;  4J8U A;  3C1C C;  4X23 A;  4XZQ A;  3AYW D;  4YS3 B;  1P3O A;  4QLC B;  1P3A C;  3W96 B;  4G91 B;  5AVC B;  3X1V A;  5B0Y B;  5AV5 D;  1P3B A;  3WTP E;  1P3K B;  3UTB A;  2ARO D;  1M18 C;  3MGR C;  3AV2 B;  3WKJ C;  1P3G A;  4UUZ A;  5DNN C;  4XZQ D;  3C1C B;  1BH8 A;  1P3O D;  4JJN C;  3WAA B;  4J8W A;  1P3A B;  5GT0 A;  4H9N B;  3AZF C;  1HTA A;  5CPI C;  4H9Q B;  3LJA B;  3WTP C;  1P3B D;  5CPJ A;  3A6N D;  3UTB D;  3UT9 C;  5B40 A;  3MGR B;  3W97 C;  3NQJ B;  1BH9 A;  1KX3 B;  3REK A;  5B2J C;  4CAY A;  4J8W D;  4WU9 A;  4Z5T C;  5GT0 D;  3B0C T;  5AVB C;  1B67 A;  3AZJ A;  5B31 D;  3AZF B;  4WZS B;  5B33 C;  3WTP B;  5CPJ D;  3B6G C;  5BNX B;  3KWQ D;  5CPK B;  3REI A;  5B40 D;  3B0B A;  3AZK A;  1P3L C;  3TU4 B;  1KX5 A;  3MGS A;  2FJ7 A;  5GT3 A;  5JRG B;  4ZUX D;  3REK D;  4WU8 C;  3REJ B;  5B1L A;  3AZJ D;  3UTA C;  3W98 C;  5CP6 B;  1F66 A;  5B33 B;  3REI D;  3LEL D;  3NQU A;  4Z66 A;  3AZL A;  5B2I D;  3AFA A;  1P3L B;  1P3M C;  1KX5 D;  3MGS D;  2FJ7 D;  5B1M A;  3AN2 D;  1WWI A;  5AV8 A;  4KGC A;  3AZM A;  1P3P C;  5B1L D;  3AYW C;  1P3F C;  4WNN B;  3AZE A;  1F66 D;  3W96 A;  4Z66 D;  3AZL D;  3WA9 B;  5E5A B;  3AZM D;  5BT1 D;  4YM6 C;  3C1B C;  1M19 A;  4H9S C;  4J8U C;  4DRB A;  4X23 C;  1KX4 C;  3LZ0 C;  4YS3 D;  3X1V C;  3AV1 B;  3W96 D;  5AVC D;  5KDM A;  4H9N A;  4H9Q A;  3LJA A;  4R8P C;  3AZG B;  3X1S C;  1M19 D;  4YM6 B;  1P3K D;  5DNM A;  1P3G C;  3R45 B;  3KXB C;  1Q9C A;  2NQB C;  1KX4 B;  3LZ0 B;  2F8N G;  3O62 C;  2HIO B;  3AZN C;  3WAA D;  1P34 B;  2HUE B;  3B6F A;  4Z2M G;  3LJA D;  4R8P B;  2NZD B;  3X1S B;  3W99 A;  4ZBJ B;  5BO0 B;  1P3I C;  1HQ3 A;  3TU4 A;  2CV5 B;  2NQB B;  2BYM A;  5AV9 C;  4WU9 C;  5CHL B;  1KX3 D;  5JRG A;  3VH5 T;  1S32 B;  1ID3 B;  4E45 A;  3O62 B;  1AOI B;  1EQZ A;  5CP6 A;  5B24 B;  3AZK C;  3W99 D;  5CPK D;  5F99 C;  5GT3 C;  1P3I B;  2F8N A;  3TU4 D;  3VH6 W;  5AV9 B;  5JRG D;  4LD9 A;  2LY8 A;  3REJ D;  3KUY B;  5FUG B;  5B0Z A;  5GXQ A;  5CP6 D;  3REL B;  3AFA C;  5JA4 A;  5B1M C;  5AV8 C;  4KGC C;  1TZY A;  4H9O B;  4LD9 D;  3AZE C;  4E44 A;  5B0Z D;  5GXQ D;  3MNN C;  3X1U B;  3A6N A;  4KUD C;  3AV1 A;  4KHA A;  5C3I C;  1U35 A;  4CSR B;  1TZY D;  3WA9 D;  3X1T C;  3AZG A;  5E5A D;  2CWE A;  5B31 A;  3AZH A;  3KWQ A;  1M1A C;  5B32 C;  3MNN B;  1M18 B;  3LZ1 A;  3AV1 D;  2HIO A;  3WKJ B;  1U35 D;  5C3I B;  5DNN B;  4ZUX A;  4JJN B;  5DNM C;  3AZG D;  3X1T B;  1N1J B;  2YFW B;  5BO0 A;  4G92 C;  4J8V A;  5AY8 A;  3AZH D;  4EO5 C;  5CPI B;  2CV5 A;  2F8N K;  3LEL A;  3MGQ A;  3UT9 B;  3LZ1 D;  3W97 B;  1S32 A;  5B2I A;  2HIO D;  3MGP C;  3B6F C;  5AV6 A;  3AN2 A;  1P34 D;  2RVQ D;  5B2J B;  2NZD D;  4Z5T B;  1HQ3 C;  5G49 A;  4XUJ C;  5AVB B;  4J8V D;  5AY8 D;  3B6G B;  1JFI A;  2CV5 D;  3MGQ D;  3AZI C;  2YFV A;  5GSU A;  1ZLA C;  4M6B A;  3B0C W;  3MVD C;  4J8X C;  1A7W A;  4NE5 A;  1S32 D;  3MGP B;  4NE6 A;  3V9R B;  5AV6 D;  1ID3 D;  1AOI D;  2JSS A;  2PYO C;  3REH C;  5B24 D;  4WU8 B;  3UTA B;  3W98 B;  4YS3 A;  4QLC A;  5GSU D;  4H9O A;  2IO5 C;  5AV5 C;  5AVC A;  2F8N D;  1P3M B;  3MVD B;  4J8X B;  5B0Y A;  3KUY D;  2ARO C;  1P3P B;  1P3K A;  3REL D;  5BNV B;  3AV2 A;  4XZQ C;  1P3O C;  3AYW B;  1P3F B;  1H3O B;  4H9P B;  2BYK B;  3C1C A;  4QLC D;  3WAA A; 
#chains in the Genus database with same CATH topology
 1P3A A;  2F8N H;  1P3B C;  5AV5 B;  5B0Y D;  3A6N C;  4WV4 B;  3UTB C;  4Z2M H;  3C1B B;  2XD1 A;  4J8U B;  1EQZ C;  3MGR A;  3AV2 D;  3NQJ A;  4X23 B;  4XZQ B;  1P3O B;  4J8W C;  5DNN A;  3C1C D;  1KX3 A;  5GT0 C;  4JJN A;  3X1V B;  5B31 C;  1P3A D;  1N1J A;  5CPJ C;  2YFW A;  3KWQ C;  3AZF A;  5CPI A;  3WTP A;  5B40 C;  5BNX A;  5CPK A;  3A1I A;  1P3G B;  1M18 D;  3MGR D;  4ZUX C;  3REK C;  1BH8 B;  3KXB B;  3WKJ D;  3EPH A;  5DNN D;  4JJN D;  5GT0 B;  5B2J A;  3AZJ C;  3AZN B;  3REJ A;  5AY8 C;  4Z5T A;  3AZF D;  5CPI D;  3REI C;  3LEL C;  3WTP D;  5B33 A;  5B40 B;  3B6G A;  3EPJ A;  1BFM A;  5B2I C;  3UT9 D;  1KX5 C;  3MGS C;  2FJ7 C;  3AN2 C;  3W97 D;  1BH9 B;  1P3L A;  4H9R B;  3REK B;  3V9R A;  4CAY B;  4WU9 B;  5B1L C;  5B2J D;  4WU8 A;  1KU5 A;  2ZM5 A;  4Z5T D;  1F66 C;  5AVB D;  4WNN A;  3REI B;  5B33 D;  3B6G D;  4Z66 C;  3VH5 W;  3AZK B;  3AZL C;  5F99 B;  4AWL C;  5GT3 B;  1P3L D;  3AZM C;  5BT1 C;  1P3M A;  2RIQ A;  4NFT A;  3WA9 A;  5E5A A;  5B1L B;  4WU8 D;  5BNV A;  4YS3 C;  2Y2Q A;  5B32 G;  1P3F A;  3UTA D;  2ZY3 A;  3W98 D;  3W96 C;  3NQU B;  4G91 C;  5AVC C;  3AFA B;  5B1M B;  3VH6 A;  5AV8 B;  1P3M D;  4KGC B;  3AZM B;  1M19 C;  1P3K C;  1P3P D;  2DQN C;  4YM6 A;  3C1B A;  4H9S A;  2FFF B;  3R45 A;  3AZE B;  1P3F D;  2UWX A;  4HGA C;  3WAA C;  1KX4 A;  3VH5 A;  3LZ0 A;  4KUD B;  3FDD A;  3LJA C;  2F2A C;  1P34 A;  1M19 B;  4R8P A;  2NZD A;  4YM6 D;  3X1S A;  3C1B D;  4J8U D;  4X23 D;  1KX3 C;  3KXB A;  1M1A B;  1KX4 D;  5B32 B;  2NQB A;  4HGA B;  3LZ0 D;  5KDM B;  3X1V D;  1ID3 A;  3O62 A;  3AZN A;  1AOI A;  2Y2N A;  2Y2G A;  3W99 C;  5CPK C;  5DNM B;  4R8P D;  5B24 A;  3H0R C;  3AL0 C;  3X1S D;  3TU4 C;  4G92 B;  1P3G D;  1P3I A;  4EO5 B;  5JRG C;  4H9R A;  3KXB D;  2NQB D;  2ZY4 A;  5AV9 A;  3REJ C;  4DRA A;  3O62 D;  3AZN D;  3B6F B;  3KUY A;  5CP6 C;  5FUG A;  1TAF B;  2Y2I A;  3W99 B;  3REL A;  1HQ3 B;  4XUJ B;  5F99 A;  2Y2L A;  1P3I D;  2BYM B;  4LD9 C;  5AV9 D;  4WU9 D;  3AZI B;  5B0Z C;  5GXQ C;  1ZLA B;  1EQZ B;  3IP4 C;  3EPL A;  2PYO B;  5BS7 A;  3REH B;  3X1U A;  1F1E A;  3AZK D;  5F99 D;  1TZY C;  3WA9 C;  5GT3 D;  5E5A C;  4CSR A;  5B31 G;  4LD9 B;  2IO5 B;  5B0Z B;  5GXQ B;  3B0D C;  2ARO B;  2G5H C;  3KSY A;  3X1U D;  3MNN A;  3AV1 C;  5JA4 B;  1U35 C;  1M18 A;  4KUD A;  3AFA D;  3WKJ A;  1TZY B;  5B1M D;  3AZG C;  5AV8 D;  4KGC D;  3X1T A;  3AZH C;  2Y2M A;  1P3B B;  2JE5 A;  3AZE D;  3A6N B;  3UTB B;  3B0D B;  3LZ1 C;  3MNN D;  1M1A A;  2HIO C;  5B32 A;  4KHA B;  3UT9 A;  4UUZ B;  1U35 B;  4KUD D;  1P34 C;  3W97 A;  2HUE C;  1R4V A;  2RVQ C;  4NE3 A;  4UPK A;  4J8W B;  2NZD C;  2BG1 A;  4ZBJ C;  2Y2O A;  3X1T D;  4J8V C;  5B31 B;  3H0L C;  3AZH B;  5CPJ B;  5AVB A;  3KWQ B;  2CV5 C;  3MGQ C;  1S32 C;  1M1A D;  5B32 D;  3LZ1 B;  1ULY A;  1ID3 C;  5AV6 C;  1AOI C;  3KFU G;  4ZUX B;  3MGP A;  3VH6 T;  5B24 C;  1TAF A;  5DNM D;  3AZJ B;  4J8V B;  5AY8 B;  2L5A A;  4XUJ A;  3UTA A;  3W98 A;  3LEL B;  5GSU C;  3MGQ B;  5B2I B;  1KX5 B;  3KUY C;  3MGS B;  5AV6 B;  3AZI A;  1WWS A;  3AN2 B;  2FJ7 B;  1ZLA A;  3MVD A;  4J8X A;  3MGP D;  3B6F D;  3REL C;  4WJ3 C;  2PYO A;  1P3P A;  3EPK A;  5G49 B;  3REH A;  1B6W A;  1F66 B;  1HQ3 D;  4XUJ D;  1JFI B;  3AYW A;  4QLC C;  1H3O A;  2YFV B;  4H9P A;  2BYK A;  4Z66 B;  5GSU B;  3AZL B;  3H0M C;  2F8N B;  5B0Y C;  3AZI D;  4AWL B;  1ZLA D;  5AV5 A;  3MVD D;  4J8X D;  1EQZ D;  5BS7 C;  3X1U C;  2ARO A;  2PYO D;  3AV2 C;  3REH D;  4J8U A;  3C1C C;  4X23 A;  4XZQ A;  3AYW D;  4YS3 B;  1P3O A;  2ZY5 A;  4QLC B;  1P3A C;  3W96 B;  4G91 B;  5AVC B;  3X1V A;  5B0Y B;  5AV5 D;  1P3B A;  3WTP E;  1P3K B;  2Y2K A;  2ARO D;  3UTB A;  1M18 C;  1T3U A;  3MGR C;  2ZY2 A;  3AV2 B;  3WKJ C;  1P3G A;  4UUZ A;  5DNN C;  4XZQ D;  3C1C B;  1BH8 A;  1P3O D;  4JJN C;  3WAA B;  4J8W A;  1P3A B;  5GT0 A;  4H9N B;  3AZF C;  1HTA A;  5CPI C;  4H9Q B;  3LJA B;  3WTP C;  1P3B D;  5CPJ A;  3A6N D;  3UTB D;  3UT9 C;  5B40 A;  2JCH A;  3MGR B;  3W97 C;  3NQJ B;  1BH9 A;  1KX3 B;  3REK A;  5B2J C;  4CAY A;  4J8W D;  4WU9 A;  4Z5T C;  5GT0 D;  3B0C T;  5AVB C;  1B67 A;  3AZJ A;  5B31 D;  3AZF B;  4WZS B;  5B33 C;  3WTP B;  5CPJ D;  3B6G C;  5BNX B;  3KWQ D;  1Z2C B;  5CPK B;  3REI A;  5B40 D;  3B0B A;  3AZK A;  1P3L C;  3TU4 B;  1KX5 A;  3MGS A;  2FJ7 A;  5GT3 A;  5JRG B;  4ZUX D;  3REK D;  4WU8 C;  1PZR A;  3REJ B;  5B1L A;  3AZJ D;  3UTA C;  3W98 C;  5CP6 B;  1F66 A;  5B33 B;  3REI D;  3LEL D;  3NQU A;  4Z66 A;  3AZL A;  5B2I D;  3AFA A;  1P3L B;  1P3M C;  1KX5 D;  3MGS D;  2FJ7 D;  5B1M A;  3AN2 D;  1WWI A;  5AV8 A;  4KGC A;  3AZM A;  1P3P C;  5B1L D;  3AYW C;  1P3F C;  4WNN B;  3AZE A;  1F66 D;  3P5J B;  3W96 A;  4Z66 D;  3AZL D;  3WA9 B;  5E5A B;  3AZM D;  5BT1 D;  4YM6 C;  3C1B C;  1M19 A;  4H9S C;  4J8U C;  2Y2P A;  4DRB A;  4X23 C;  1KX4 C;  3LZ0 C;  4YS3 D;  3X1V C;  3AV1 B;  3W96 D;  5AVC D;  5KDM A;  4H9N A;  4H9Q A;  3LJA A;  4R8P C;  3AZG B;  3EG5 B;  3X1S C;  1M19 D;  4YM6 B;  1P3K D;  5DNM A;  1P3G C;  3R45 B;  3KXB C;  1Q9C A;  2NQB C;  1KX4 B;  3LZ0 B;  2F8N G;  3O62 C;  2HIO B;  3AZN C;  3WAA D;  2DF4 C;  1P34 B;  2HUE B;  3B6F A;  4Z2M G;  3LJA D;  4R8P B;  2NZD B;  3X1S B;  3W99 A;  4ZBJ B;  5BO0 B;  1P3I C;  1HQ3 A;  3TU4 A;  2W8S A;  2CV5 B;  2NQB B;  5AV9 C;  2BYM A;  4WU9 C;  5CHL B;  1KX3 D;  5JRG A;  3VH5 T;  1S32 B;  1ID3 B;  4E45 A;  3O62 B;  2Y2H A;  1AOI B;  1EQZ A;  5CP6 A;  5B24 B;  3AZK C;  3W99 D;  5CPK D;  5F99 C;  5GT3 C;  1P3I B;  2F8N A;  3TU4 D;  3VH6 W;  5AV9 B;  5JRG D;  4LD9 A;  2LY8 A;  3REJ D;  3KUY B;  5FUG B;  5B0Z A;  5GXQ A;  5CP6 D;  3REL B;  4DQY B;  3AFA C;  5JA4 A;  5B1M C;  5AV8 C;  4KGC C;  1TZY A;  4H9O B;  4LD9 D;  3AZE C;  4E44 A;  5B0Z D;  5GXQ D;  3MNN C;  3X1U B;  3A6N A;  4KUD C;  3AV1 A;  4KHA A;  5C3I C;  1U35 A;  4CSR B;  1TZY D;  3WA9 D;  3X1T C;  3AZG A;  5E5A D;  2CWE A;  5B31 A;  3AZH A;  3KWQ A;  1M1A C;  5B32 C;  3MNN B;  1W2E A;  1M18 B;  3LZ1 A;  3AV1 D;  2HIO A;  3WKJ B;  1U35 D;  5C3I B;  5DNN B;  4ZUX A;  4JJN B;  5DNM C;  3AZG D;  3X1T B;  1N1J B;  2Y2J A;  2YFW B;  5BO0 A;  4G92 C;  4J8V A;  5AY8 A;  3AZH D;  4EO5 C;  5CPI B;  2CV5 A;  3A1K A;  2F8N K;  3LEL A;  3MGQ A;  3UT9 B;  3LZ1 D;  3W97 B;  1S32 A;  5B2I A;  2HIO D;  3MGP C;  3B6F C;  5AV6 A;  3AN2 A;  1P34 D;  2RVQ D;  5B2J B;  3F6T A;  2NZD D;  4Z5T B;  1HQ3 C;  5G49 A;  4XUJ C;  5AVB B;  4J8V D;  5AY8 D;  3B6G B;  1JFI A;  2CV5 D;  3MGQ D;  3AZI C;  2YFV A;  5GSU A;  1ZLA C;  4M6B A;  3B0C W;  3MVD C;  4J8X C;  1A7W A;  4NE5 A;  1S32 D;  3MGP B;  4NE6 A;  3V9R B;  5AV6 D;  1ID3 D;  1AOI D;  2JSS A;  2PYO C;  3REH C;  5B24 D;  4WU8 B;  3UTA B;  3W98 B;  2VQR A;  4YS3 A;  4QLC A;  5GSU D;  4H9O A;  2IO5 C;  5AV5 C;  5AVC A;  2G5I C;  1P3M B;  3MVD B;  4J8X B;  2F8N D;  5B0Y A;  3KUY D;  2ARO C;  2J8P A;  1P3P B;  1P3K A;  3REL D;  5BNV B;  3AV2 A;  4XZQ C;  1P3O C;  3AYW B;  1P3F B;  1H3O B;  4H9P B;  2BYK B;  3C1C A;  4QLC D;  2XD5 A;  3WAA A; 
#chains in the Genus database with same CATH homology
 1P3A A;  2F8N H;  1P3B C;  5AV5 B;  5B0Y D;  3A6N C;  4WV4 B;  3UTB C;  4Z2M H;  3C1B B;  2XD1 A;  4J8U B;  1EQZ C;  3MGR A;  3AV2 D;  3NQJ A;  4X23 B;  4XZQ B;  1P3O B;  4J8W C;  5DNN A;  3C1C D;  1KX3 A;  5GT0 C;  4JJN A;  3X1V B;  5B31 C;  1P3A D;  1N1J A;  5CPJ C;  2YFW A;  3KWQ C;  3AZF A;  5CPI A;  3WTP A;  5B40 C;  5BNX A;  5CPK A;  3A1I A;  1P3G B;  1M18 D;  3MGR D;  4ZUX C;  3REK C;  1BH8 B;  3KXB B;  3WKJ D;  3EPH A;  5DNN D;  4JJN D;  5GT0 B;  5B2J A;  3AZJ C;  3AZN B;  3REJ A;  5AY8 C;  4Z5T A;  3AZF D;  5CPI D;  3REI C;  3LEL C;  3WTP D;  5B33 A;  5B40 B;  3B6G A;  3EPJ A;  1BFM A;  5B2I C;  3UT9 D;  1KX5 C;  3MGS C;  2FJ7 C;  3AN2 C;  3W97 D;  1BH9 B;  1P3L A;  4H9R B;  3REK B;  3V9R A;  4CAY B;  4WU9 B;  5B1L C;  5B2J D;  4WU8 A;  1KU5 A;  2ZM5 A;  4Z5T D;  1F66 C;  5AVB D;  4WNN A;  3REI B;  5B33 D;  3B6G D;  4Z66 C;  3VH5 W;  3AZK B;  3AZL C;  5F99 B;  4AWL C;  5GT3 B;  1P3L D;  3AZM C;  5BT1 C;  1P3M A;  2RIQ A;  4NFT A;  3WA9 A;  5E5A A;  5B1L B;  4WU8 D;  5BNV A;  4YS3 C;  2Y2Q A;  5B32 G;  1P3F A;  3UTA D;  2ZY3 A;  3W98 D;  3W96 C;  3NQU B;  4G91 C;  5AVC C;  3AFA B;  5B1M B;  3VH6 A;  5AV8 B;  1P3M D;  4KGC B;  3AZM B;  1M19 C;  1P3K C;  1P3P D;  2DQN C;  4YM6 A;  3C1B A;  4H9S A;  2FFF B;  3R45 A;  3AZE B;  1P3F D;  2UWX A;  4HGA C;  3WAA C;  1KX4 A;  3VH5 A;  3LZ0 A;  4KUD B;  3FDD A;  3LJA C;  2F2A C;  1P34 A;  1M19 B;  4R8P A;  2NZD A;  4YM6 D;  3X1S A;  3C1B D;  4J8U D;  4X23 D;  1KX3 C;  3KXB A;  1M1A B;  1KX4 D;  5B32 B;  2NQB A;  4HGA B;  3LZ0 D;  5KDM B;  3X1V D;  1ID3 A;  3O62 A;  3AZN A;  1AOI A;  2Y2N A;  2Y2G A;  3W99 C;  5CPK C;  5DNM B;  4R8P D;  5B24 A;  3H0R C;  3AL0 C;  3X1S D;  3TU4 C;  4G92 B;  1P3G D;  1P3I A;  4EO5 B;  5JRG C;  4H9R A;  3KXB D;  2NQB D;  2ZY4 A;  5AV9 A;  3REJ C;  4DRA A;  3O62 D;  3AZN D;  3B6F B;  3KUY A;  5CP6 C;  5FUG A;  1TAF B;  2Y2I A;  3W99 B;  3REL A;  1HQ3 B;  4XUJ B;  5F99 A;  2Y2L A;  1P3I D;  2BYM B;  4LD9 C;  5AV9 D;  4WU9 D;  3AZI B;  5B0Z C;  5GXQ C;  1ZLA B;  1EQZ B;  3IP4 C;  3EPL A;  2PYO B;  5BS7 A;  3REH B;  3X1U A;  1F1E A;  3AZK D;  5F99 D;  1TZY C;  3WA9 C;  5GT3 D;  5E5A C;  4CSR A;  5B31 G;  4LD9 B;  2IO5 B;  5B0Z B;  5GXQ B;  3B0D C;  2ARO B;  2G5H C;  3KSY A;  3X1U D;  3MNN A;  3AV1 C;  5JA4 B;  1U35 C;  1M18 A;  4KUD A;  3AFA D;  3WKJ A;  1TZY B;  5B1M D;  3AZG C;  5AV8 D;  4KGC D;  3X1T A;  3AZH C;  2Y2M A;  1P3B B;  2JE5 A;  3AZE D;  3A6N B;  3UTB B;  3B0D B;  3LZ1 C;  3MNN D;  1M1A A;  2HIO C;  5B32 A;  4KHA B;  3UT9 A;  4UUZ B;  1U35 B;  4KUD D;  1P34 C;  3W97 A;  2HUE C;  1R4V A;  2RVQ C;  4NE3 A;  4UPK A;  4J8W B;  2NZD C;  2BG1 A;  4ZBJ C;  2Y2O A;  3X1T D;  4J8V C;  5B31 B;  3H0L C;  3AZH B;  5CPJ B;  5AVB A;  3KWQ B;  2CV5 C;  3MGQ C;  1S32 C;  1M1A D;  5B32 D;  3LZ1 B;  1ULY A;  1ID3 C;  5AV6 C;  1AOI C;  3KFU G;  4ZUX B;  3MGP A;  3VH6 T;  5B24 C;  1TAF A;  5DNM D;  3AZJ B;  4J8V B;  5AY8 B;  2L5A A;  4XUJ A;  3UTA A;  3W98 A;  3LEL B;  5GSU C;  3MGQ B;  5B2I B;  1KX5 B;  3KUY C;  3MGS B;  5AV6 B;  3AZI A;  1WWS A;  3AN2 B;  2FJ7 B;  1ZLA A;  3MVD A;  4J8X A;  3MGP D;  3B6F D;  3REL C;  4WJ3 C;  2PYO A;  1P3P A;  3EPK A;  5G49 B;  3REH A;  1B6W A;  1F66 B;  1HQ3 D;  4XUJ D;  1JFI B;  3AYW A;  4QLC C;  1H3O A;  2YFV B;  4H9P A;  2BYK A;  4Z66 B;  5GSU B;  3AZL B;  3H0M C;  2F8N B;  5B0Y C;  3AZI D;  4AWL B;  1ZLA D;  5AV5 A;  3MVD D;  4J8X D;  1EQZ D;  5BS7 C;  3X1U C;  2ARO A;  2PYO D;  3AV2 C;  3REH D;  4J8U A;  3C1C C;  4X23 A;  4XZQ A;  3AYW D;  4YS3 B;  1P3O A;  2ZY5 A;  4QLC B;  1P3A C;  3W96 B;  4G91 B;  5AVC B;  3X1V A;  5B0Y B;  5AV5 D;  1P3B A;  3WTP E;  1P3K B;  2Y2K A;  2ARO D;  3UTB A;  1M18 C;  1T3U A;  3MGR C;  2ZY2 A;  3AV2 B;  3WKJ C;  1P3G A;  4UUZ A;  5DNN C;  4XZQ D;  3C1C B;  1BH8 A;  1P3O D;  4JJN C;  3WAA B;  4J8W A;  1P3A B;  5GT0 A;  4H9N B;  3AZF C;  1HTA A;  5CPI C;  4H9Q B;  3LJA B;  3WTP C;  1P3B D;  5CPJ A;  3A6N D;  3UTB D;  3UT9 C;  5B40 A;  2JCH A;  3MGR B;  3W97 C;  3NQJ B;  1BH9 A;  1KX3 B;  3REK A;  5B2J C;  4CAY A;  4J8W D;  4WU9 A;  4Z5T C;  5GT0 D;  3B0C T;  5AVB C;  1B67 A;  3AZJ A;  5B31 D;  3AZF B;  4WZS B;  5B33 C;  3WTP B;  5CPJ D;  3B6G C;  5BNX B;  3KWQ D;  1Z2C B;  5CPK B;  3REI A;  5B40 D;  3B0B A;  3AZK A;  1P3L C;  3TU4 B;  1KX5 A;  3MGS A;  2FJ7 A;  5GT3 A;  5JRG B;  4ZUX D;  3REK D;  4WU8 C;  1PZR A;  3REJ B;  5B1L A;  3AZJ D;  3UTA C;  3W98 C;  5CP6 B;  1F66 A;  5B33 B;  3REI D;  3LEL D;  3NQU A;  4Z66 A;  3AZL A;  5B2I D;  3AFA A;  1P3L B;  1P3M C;  1KX5 D;  3MGS D;  2FJ7 D;  5B1M A;  3AN2 D;  1WWI A;  5AV8 A;  4KGC A;  3AZM A;  1P3P C;  5B1L D;  3AYW C;  1P3F C;  4WNN B;  3AZE A;  1F66 D;  3P5J B;  3W96 A;  4Z66 D;  3AZL D;  3WA9 B;  5E5A B;  3AZM D;  5BT1 D;  4YM6 C;  3C1B C;  1M19 A;  4H9S C;  4J8U C;  2Y2P A;  4DRB A;  4X23 C;  1KX4 C;  3LZ0 C;  4YS3 D;  3X1V C;  3AV1 B;  3W96 D;  5AVC D;  5KDM A;  4H9N A;  4H9Q A;  3LJA A;  4R8P C;  3AZG B;  3EG5 B;  3X1S C;  1M19 D;  4YM6 B;  1P3K D;  5DNM A;  1P3G C;  3R45 B;  3KXB C;  1Q9C A;  2NQB C;  1KX4 B;  3LZ0 B;  2F8N G;  3O62 C;  2HIO B;  3AZN C;  3WAA D;  2DF4 C;  1P34 B;  2HUE B;  3B6F A;  4Z2M G;  3LJA D;  4R8P B;  2NZD B;  3X1S B;  3W99 A;  4ZBJ B;  5BO0 B;  1P3I C;  1HQ3 A;  3TU4 A;  2W8S A;  2CV5 B;  2NQB B;  5AV9 C;  2BYM A;  4WU9 C;  5CHL B;  1KX3 D;  5JRG A;  3VH5 T;  1S32 B;  1ID3 B;  4E45 A;  3O62 B;  2Y2H A;  1AOI B;  1EQZ A;  5CP6 A;  5B24 B;  3AZK C;  3W99 D;  5CPK D;  5F99 C;  5GT3 C;  1P3I B;  2F8N A;  3TU4 D;  3VH6 W;  5AV9 B;  5JRG D;  4LD9 A;  2LY8 A;  3REJ D;  3KUY B;  5FUG B;  5B0Z A;  5GXQ A;  5CP6 D;  3REL B;  4DQY B;  3AFA C;  5JA4 A;  5B1M C;  5AV8 C;  4KGC C;  1TZY A;  4H9O B;  4LD9 D;  3AZE C;  4E44 A;  5B0Z D;  5GXQ D;  3MNN C;  3X1U B;  3A6N A;  4KUD C;  3AV1 A;  4KHA A;  5C3I C;  1U35 A;  4CSR B;  1TZY D;  3WA9 D;  3X1T C;  3AZG A;  5E5A D;  2CWE A;  5B31 A;  3AZH A;  3KWQ A;  1M1A C;  5B32 C;  3MNN B;  1W2E A;  1M18 B;  3LZ1 A;  3AV1 D;  2HIO A;  3WKJ B;  1U35 D;  5C3I B;  5DNN B;  4ZUX A;  4JJN B;  5DNM C;  3AZG D;  3X1T B;  1N1J B;  2Y2J A;  2YFW B;  5BO0 A;  4G92 C;  4J8V A;  5AY8 A;  3AZH D;  4EO5 C;  5CPI B;  2CV5 A;  3A1K A;  2F8N K;  3LEL A;  3MGQ A;  3UT9 B;  3LZ1 D;  3W97 B;  1S32 A;  5B2I A;  2HIO D;  3MGP C;  3B6F C;  5AV6 A;  3AN2 A;  1P34 D;  2RVQ D;  5B2J B;  3F6T A;  2NZD D;  4Z5T B;  1HQ3 C;  5G49 A;  4XUJ C;  5AVB B;  4J8V D;  5AY8 D;  3B6G B;  1JFI A;  2CV5 D;  3MGQ D;  3AZI C;  2YFV A;  5GSU A;  1ZLA C;  4M6B A;  3B0C W;  3MVD C;  4J8X C;  1A7W A;  4NE5 A;  1S32 D;  3MGP B;  4NE6 A;  3V9R B;  5AV6 D;  1ID3 D;  1AOI D;  2JSS A;  2PYO C;  3REH C;  5B24 D;  4WU8 B;  3UTA B;  3W98 B;  2VQR A;  4YS3 A;  4QLC A;  5GSU D;  4H9O A;  2IO5 C;  5AV5 C;  5AVC A;  2G5I C;  1P3M B;  3MVD B;  4J8X B;  2F8N D;  5B0Y A;  3KUY D;  2ARO C;  2J8P A;  1P3P B;  1P3K A;  3REL D;  5BNV B;  3AV2 A;  4XZQ C;  1P3O C;  3AYW B;  1P3F B;  1H3O B;  4H9P B;  2BYK B;  3C1C A;  4QLC D;  2XD5 A;  3WAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...