3W98D

Crystal structure of human nucleosome core particle lacking h3.1 n-terminal region
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
95
structure length
95
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Contribution of histone N-terminal tails to the structure and stability of nucleosomes
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3w98D00
4Z5TC 5BT1D 4DRAA 1P3AD 3W98A 3AV2A 3KXBD 1P34B 4WZSB 5B2IB 1N1JA 3LJAD 3LZ0C 4AWLB 5AV9D 3O62B 3LELB 1P3OB 1M1AC 1TZYD 2NQBA 1P3MC 1P34A 1JFIB 5B2IA 4WU9C 4KGCB 5B32C 3R45B 4H9QB 3AZIC 3LZ1C 3MGSB 4WU8C 5DNMB 5BS7C 1P3KB 1P3LB 5KDMB 3VH6T 4LD9A 3O62A 3LELA 3WTPB 3AV1D 1JFIA 2F8NB 3W98C 2HIOC 4KHAB 4H9QA 3MNNB 3AV2C 2L5AA 4J8VB 1S32B 1P3KA 5KDMA 5B24C 3AZHB 3X1UB 4X23D 4KUDA 4QLCD 3WTPA 3AZND 2F8NG 4H9OA 5BNVB 2F8NA 4H9PB 3AZFA 4KHAA 3REIB 2CV5D 1P34C 1S32A 5C3IB 4XZQD 3REKB 3A6ND 5B2IC 3KSYA 3AZHA 3X1UA 4AWLC 5BNVA 4H9PA 4YM6D 3O62C 3REIA 5E5AA 4JJND 3LELC 4XUJD 1P3OC 5JRGD 3C1BD 5AV5B 4G92B 3REKA 2F8NH 4KGCC 3X1TB 3WKJD 3MVDB 3MGSC 5CPJA 5DNMC 1P3KC 1P3LC 3MGRD 1ULYA 3MGPB 3B6GB 4NE3A 3TU4B 5B0YD 1A7WA 3WTPC 4M6BA 4R8PD 3AZED 3UTAB 5B40B 5GXQD 1HQ3B 5JA4A 3X1TA 3MNNC 4WNNA 4J8WD 5CPIB 4J8VC 1S32C 5GT0B 3X1SB 3B0CT 3MGPA 3AZHC 4Z2MH 5B31B 3TU4A 2HUEB 3X1UC 5AVBA 2BYKB 3UTBB 3UTAA 5GSUA 1EQZB 1HQ3A 1BH8A 5B2JB 4J8XD 3REIC 3AZMD 3WA9B 1KX3B 5AVCD 3AFAB 3RELB 3MGQB 5C3IC 3REKC 1P3PB 3X1SA 3KUYB 1M18D 1ID3D 2RVQD 5B31A 5B33D 3KWQB 3AYWD 2BYKA 3W96B 1R4VA 1EQZA 1B67A 5B2JA 3WA9A 3NQJB 3VH5T 4CAYB 5B0ZD 4Z66D 3AFAA 3AZGD 3AZLD 3RELA 3MGQA 4G92C 1P3PA 3UT9B 3X1TC 3KWQA 3MVDC 5F99D 3VH6A 5B32G 3AN2B 3W96A 3AZJB 3MGPC 4YS3B 3B6GC 3TU4C 3NQJA 5BS7A 3UTAC 5B40C 3UT9A 1HQ3C 1KX4B 1ZLAB 4Z5TD 5CPIC 3REHB 3AN2A 5GT0C 3X1SC 3AZJA 1B6WA 4YS3A 2HIOA 4H9NA 3X1VB 5B31C 2FJ7B 2HUEC 1KU5A 3UTBC 5B24A 4J8UD 1EQZC 5B2JC 3WA9C 1KX4A 1ZLAA 1KX3C 3AFAC 1F66B 3LZ0D 3REHA 3MGQC 3RELC 1P3PC 3KUYC 3X1VA 3KWQC 1P3BB 2FJ7A 4X23B 1M1AD 4QLCB 1P3MD 1U35D 3W96C 3C1CD 4WU9D 5CHLB 1P3ID 5B32D 3AZID 1F66A 4H9RB 3LZ1D 1M19D 4XZQB 4WU8D 1AOIB 3UT9C 3B0CW 1P3BA 1P3OA 4NE5A 2AROB 3AN2C 3V9RB 3AZJC 4EO5B 4YS3C 4YM6B 4KGCA 3R45A 3W98D 2NZDB 3MGSA 3AV2D 4NFTA 5DNMA 1P3LA 1AOIA 3AZKB 5B1LB 5B1MB 1KX4C 1ZLAC 5AV8B 1F1EA 3REHC 2AROA 3V9RA 3MGRB 3X1VC 3MNNA 2FJ7C 2NZDA 3VH5W 3AZEB 4J8VA 2NQBD 1P3FB 1P34D 3W97B 3AZKA 5GXQB 5CP6B 5B1LA 5B1MA 5B2ID 3REJB 5GT3B 5AV8A 1F66C 4LD9D 2BYMB 4ZUXB 1P3BC 4E45A 5DNNB 3O62D 3WAAB 4X23C 2PYOB 3LELD 4QLCC 5AY8B 1P3FA 3W97A 4Z2MG 5CP6A 3REJA 3AZMB 3VH5A 5GT3A 4XZQC 1AOIC 1HTAA 5AV6B 3W99B 1P3KD 1ID3B 2BYMA 4ZUXA 5DNNA 3WAAA 2PYOA 5AY8A 5AV5A 2AROC 4KUDD 3WTPD 4EO5C 4YM6C 2F8ND 3MVDA 3AZFD 2NZDC 5B0ZB 4Z66B 3AZLB 5AV6A 3AZKC 1S32D 3W99A 3B6GA 4UUZB 5B1LC 5B1MC 5CPKB 3AZHD 1KX5B 5AV8C 3X1UD 5B40A 3MGRC 3B6FB 3REID 5E5AD 1P3GB 3B0DB 3AZEC 5CPIA 1P3FC 5GT0A 5B31G 3W97C 5GXQC 5CP6C 3REKD 1WWIA 3REJC 5CPKA 1KX5A 5GT3C 3UTBA 5CPJD 1P3AB 3B6FA 4ZUXC 1KX3A 3WAAC 5DNNC 3KXBB 2PYOC 1P3GA 5AY8C 5AV5C 1H3OB 4J8UB 3KUYA 3LJAB 3AZMC 3X1TD 3LZ0B 5AV9B 3W99C 5AV6C 1P3AA 1ID3C 3MGPD 1TZYB 4CAYA 3KXBA 3TU4D 5AVBD 1U35B 3C1CB 3UTAD 3LJAA 5GSUD 1P3IB 1HQ3D 5B0ZC 4H9SC 5FUGB 4Z66C 3AZLC 1M19B 5AV9A 3X1SD 5CPKC 1KX5C 1TZYA 1BFMA 5B31D 3AV1B 3B0BA 3B6FC 1EQZD 5B2JD 3WA9D 1P3GC 3B0DC 5FUGA 3AFAD 3RELD 3MGQD 1P3PD 1N1JB 3KWQD 3AZNB 3AV1A 5BT1C 1P3AC 3W96D 2CV5B 3KXBC 2NQBB 3A6NB 4J8UC 3UT9D 3LJAC 4X23A 4QLCA 3AZNA 5AV9C 2JSSA 3AN2D 4LD9B 4JJNB 3AZJD 4XUJB 4YS3D 2CV5A 1TZYC 2HIOD 2IO5B 4HGAB 5JRGB 4H9RA 3C1BB 4XZQA 1U35C 5BO0B 3A6NA 3C1CC 5B24D 3WKJB 4E44A 1P3IC 1KX4D 1ZLAD 1M19C 3REHD 4YM6A 4JJNA 5B0YB 4XUJA 3NQUB 2CWEA 5G49B 3X1VD 2FJ7D 5JRGA 4R8PB 3C1BA 3AV1C 5BO0A 4KUDB 4H9OB 4WV4B 3WKJA 3AZFB 4J8WB 1F66D 3MGRA 5B0YA 3NQUA 5G49A 4G91B 1P3BD 3AZNC 1P3OD 4R8PA 3AZEA 5GXQA 4J8XB 2CV5C 4KGCD 5AVCB 5E5AB 2YFWB 4J8WA 3MGSD 2NQBC 3A6NC 5DNMD 1M18B 1P3LD 1AOID 5B33B 3AYWB 5CPJB 4ZBJB 2AROD 4J8XA 4LD9C 4JJNC 3AZMA 4XUJC 5AVCA 3MNND 2YFWA 2IO5C 4HGAC 5JRGC 3C1BC 3AZGB 2NZDD 4J8VD 1M18A 1ID3A 3WKJC 2LY8A 5B33A 3AZKD 3AYWA 5JA4B 5B1MD 5B1LD 4WNNB 5F99B 1WWSA 3WTPE 5AV8D 5B0YC 5B0ZA 4H9SA 1Q9CA 4Z66A 4NE6A 4R8PC 3AZGA 5AVBB 3AZLA 4KUDC 1P3FD 3W97D 4UUZA 5GSUB 5CP6D 1BH8B 3AZFC 3REJD 4Z5TB 4DRBA 4J8WC 5F99A 1TAFB 5GT3D 4G91C 4ZUXD 5DNND 3WAAD 2PYOD 5AY8D 5AV5D 4J8XC 5AVCC 5E5AC 4Z5TA 3MVDD 1TAFA 1M18C 2RVQC 3W99D 5AV6D 3VH6W 5B33C 3B6GD 3AYWC 2YFVB 1M1AB 1P3MB 1H3OA 5CPJC 4ZBJC 4J8UA 5BNXB 4CSRB 5B40D 4WU9B 5B32B 3AZGC 3AZIB 3LZ1B 3LZ0A 4WU8B 5CPID 5GT0D 1BH9B 2YFVA 1M1AA 5CPKD 1KX5D 5F99C 1P3MA 1U35A 3C1CA 5BNXA 4CSRA 3UTBD 4WU9A 1P3IA 3W98B 2HIOB 4H9NB 5B32A 3AV2B 3B6FD 3AZIA 1KX3D 3LZ1A 1M19A 2F8NK 5AVBC 4WU8A 1P3GD 5B24B 3KUYD 5GSUC 1BH9A
chains in the Genus database with same CATH superfamily
4Z5TC 5BT1D 4DRAA 1P3AD 3W98A 3AV2A 3KXBD 1P34B 4WZSB 1W2EA 5B2IB 1N1JA 3LJAD 3LZ0C 4AWLB 5AV9D 3O62B 3LELB 1P3OB 1M1AC 1TZYD 2NQBA 1P3MC 1P34A 1JFIB 5B2IA 4WU9C 4KGCB 3H0LC 5B32C 3R45B 4H9QB 3AZIC 3LZ1C 3MGSB 4WU8C 5DNMB 5BS7C 1P3KB 1P3LB 5KDMB 3VH6T 4LD9A 4WJ3C 3O62A 3LELA 3WTPB 3AV1D 1JFIA 2F8NB 3W98C 2HIOC 4KHAB 2Y2QA 4H9QA 3MNNB 3AV2C 2L5AA 4J8VB 1S32B 1P3KA 5KDMA 5B24C 3A1KA 2Y2KA 3AZHB 3X1UB 4X23D 4KUDA 4QLCD 3WTPA 3AZND 2F8NG 4H9OA 5BNVB 2F8NA 4H9PB 3AZFA 4KHAA 3REIB 2CV5D 1P34C 1S32A 5C3IB 4XZQD 3REKB 3A6ND 5B2IC 3KSYA 3AZHA 3X1UA 4AWLC 2W8SA 5BNVA 4H9PA 4YM6D 3O62C 3REIA 5E5AA 4JJND 3LELC 4XUJD 1P3OC 5JRGD 3C1BD 5AV5B 4G92B 3REKA 2F8NH 4KGCC 3X1TB 3WKJD 3MVDB 3MGSC 5CPJA 5DNMC 1P3KC 1P3LC 3MGRD 1ULYA 3MGPB 3B6GB 4NE3A 3TU4B 5B0YD 1A7WA 3WTPC 4M6BA 4R8PD 3AZED 3UTAB 5B40B 5GXQD 1HQ3B 5JA4A 3X1TA 3MNNC 4WNNA 1T3UA 4J8WD 5CPIB 4J8VC 1S32C 5GT0B 2Y2HA 3B0CT 3X1SB 3MGPA 3AZHC 4Z2MH 5B31B 3TU4A 2HUEB 3X1UC 5AVBA 2BYKB 3UTBB 3UTAA 5GSUA 1EQZB 1HQ3A 1BH8A 5B2JB 4J8XD 3REIC 3AZMD 3WA9B 1KX3B 5AVCD 3AFAB 3RELB 3MGQB 5C3IC 3REKC 1P3PB 3X1SA 3KUYB 1M18D 1ID3D 2RVQD 2Y2OA 5B31A 5B33D 3KWQB 3AYWD 2BYKA 1Z2CB 3W96B 1R4VA 2XD5A 1EQZA 1B67A 5B2JA 3WA9A 3NQJB 3VH5T 4CAYB 2ZY5A 5B0ZD 4Z66D 3AFAA 3AZGD 3AZLD 3RELA 3MGQA 4G92C 1P3PA 3UT9B 3X1TC 3KWQA 3MVDC 5F99D 3VH6A 5B32G 3AN2B 3W96A 3AZJB 3MGPC 4YS3B 3B6GC 3TU4C 3NQJA 5BS7A 3UTAC 5B40C 3UT9A 2DQNC 1HQ3C 1KX4B 1ZLAB 4Z5TD 5CPIC 3REHB 3AN2A 5GT0C 3X1SC 3F6TA 3AZJA 1B6WA 4YS3A 2HIOA 4H9NA 3X1VB 5B31C 2FJ7B 2HUEC 3H0MC 1KU5A 3UTBC 5B24A 2VQRA 4J8UD 1EQZC 5B2JC 3WA9C 1KX4A 1ZLAA 1KX3C 2Y2GA 3AFAC 1F66B 2F2AC 3LZ0D 3REHA 3MGQC 3RELC 3FDDA 1P3PC 3KUYC 3X1VA 3KWQC 4DQYB 1P3BB 2Y2MA 2FJ7A 4X23B 1M1AD 4QLCB 1P3MD 1U35D 3W96C 3EPJA 3C1CD 4WU9D 5CHLB 1P3ID 5B32D 3AZID 1F66A 4H9RB 3LZ1D 1M19D 4XZQB 4WU8D 1AOIB 3UT9C 3B0CW 1P3BA 1P3OA 4NE5A 2AROB 3AN2C 3V9RB 3AZJC 4EO5B 4YS3C 4YM6B 4KGCA 3R45A 3W98D 2NZDB 3MGSA 3AV2D 4NFTA 5DNMA 1P3LA 1AOIA 3AZKB 5B1LB 5B1MB 1KX4C 1ZLAC 5AV8B 1F1EA 3REHC 2AROA 3V9RA 3MGRB 3X1VC 3MNNA 2FJ7C 2NZDA 3VH5W 2Y2IA 4J8VA 3AZEB 1P3FB 2NQBD 1P34D 3W97B 3AZKA 5GXQB 5CP6B 5B1LA 5B1MA 5B2ID 3REJB 5GT3B 5AV8A 1F66C 4LD9D 2BYMB 4ZUXB 1P3BC 4E45A 5DNNB 3O62D 3WAAB 4X23C 2PYOB 3LELD 4QLCC 5AY8B 1P3FA 3W97A 3H0RC 4Z2MG 5CP6A 3REJA 3AZMB 3VH5A 3IP4C 5GT3A 4XZQC 1AOIC 1HTAA 5AV6B 3W99B 1P3KD 1ID3B 2BYMA 4ZUXA 5DNNA 3WAAA 2PYOA 5AY8A 5AV5A 2AROC 4KUDD 3WTPD 4EO5C 4YM6C 2Y2NA 2F8ND 3MVDA 3AZFD 2NZDC 5B0ZB 4Z66B 3AZLB 5AV6A 3AZKC 1S32D 3W99A 3B6GA 4UUZB 5B1LC 5B1MC 5CPKB 3AZHD 1KX5B 5AV8C 3X1UD 5B40A 3MGRC 3B6FB 3REID 5E5AD 1P3GB 3B0DB 3AZEC 5CPIA 1P3FC 5GT0A 5B31G 3W97C 5GXQC 5CP6C 3REKD 1WWIA 3REJC 5CPKA 1KX5A 5GT3C 2Y2JA 3UTBA 5CPJD 1P3AB 3B6FA 2ZM5A 4ZUXC 1KX3A 3WAAC 5DNNC 3KXBB 2PYOC 1P3GA 5AY8C 5AV5C 1H3OB 3KFUG 4J8UB 3KUYA 3LJAB 3AZMC 3X1TD 3LZ0B 5AV9B 3W99C 5AV6C 1P3AA 1ID3C 2FFFB 3MGPD 1TZYB 4CAYA 3KXBA 3TU4D 5AVBD 1U35B 3C1CB 3UTAD 3LJAA 5GSUD 1P3IB 1HQ3D 5B0ZC 4H9SC 5FUGB 4Z66C 3AZLC 1M19B 5AV9A 1PZRA 3X1SD 5CPKC 1KX5C 1TZYA 1BFMA 5B31D 3AV1B 3B0BA 3B6FC 1EQZD 5B2JD 3WA9D 1P3GC 3B0DC 5FUGA 3P5JB 3AFAD 3RELD 3MGQD 1P3PD 1N1JB 3KWQD 3AZNB 3AV1A 5BT1C 2BG1A 1P3AC 3W96D 2CV5B 3KXBC 2NQBB 3A6NB 4J8UC 3UT9D 3LJAC 4X23A 4QLCA 3AZNA 5AV9C 2JSSA 3AN2D 4LD9B 4JJNB 3AZJD 4XUJB 4YS3D 2CV5A 1TZYC 2HIOD 2IO5B 4HGAB 5JRGB 2UWXA 4H9RA 3C1BB 4XZQA 1U35C 5BO0B 3A6NA 2ZY4A 3C1CC 5B24D 3WKJB 4E44A 1P3IC 2DF4C 1KX4D 1ZLAD 1M19C 2Y2PA 3REHD 4YM6A 4JJNA 5B0YB 4XUJA 3AL0C 3NQUB 2CWEA 5G49B 3X1VD 2FJ7D 5JRGA 4R8PB 3C1BA 3AV1C 5BO0A 4KUDB 4H9OB 4WV4B 3WKJA 3AZFB 4J8WB 1F66D 3MGRA 2JCHA 5B0YA 3NQUA 5G49A 4G91B 1P3BD 3AZNC 1P3OD 4R8PA 3AZEA 2RIQA 5GXQA 4J8XB 2CV5C 4KGCD 5AVCB 5E5AB 2YFWB 4J8WA 3MGSD 2NQBC 3A6NC 5DNMD 1M18B 1P3LD 1AOID 2ZY3A 5B33B 3AYWB 5CPJB 4ZBJB 2AROD 4J8XA 4LD9C 3A1IA 4JJNC 3AZMA 4XUJC 5AVCA 3MNND 2YFWA 2IO5C 4HGAC 5JRGC 3C1BC 3AZGB 2NZDD 4J8VD 1M18A 1ID3A 3WKJC 2LY8A 5B33A 3AZKD 3AYWA 5JA4B 5B1MD 5B1LD 4WNNB 5F99B 1WWSA 3WTPE 5AV8D 3EG5B 5B0YC 5B0ZA 4H9SA 1Q9CA 4Z66A 4NE6A 4R8PC 3AZGA 5AVBB 3AZLA 4KUDC 1P3FD 3W97D 4UUZA 3EPKA 5GSUB 5CP6D 1BH8B 3AZFC 3REJD 4Z5TB 4DRBA 4J8WC 5F99A 1TAFB 5GT3D 2JE5A 4G91C 4ZUXD 5DNND 3WAAD 2PYOD 5AY8D 5AV5D 4J8XC 5AVCC 5E5AC 4Z5TA 3MVDD 2XD1A 1TAFA 1M18C 2RVQC 3W99D 5AV6D 3VH6W 3EPLA 5B33C 2ZY2A 3AYWC 3B6GD 2YFVB 1M1AB 1P3MB 1H3OA 2Y2LA 5CPJC 4ZBJC 4J8UA 5BNXB 4CSRB 5B40D 4WU9B 5B32B 3AZGC 3AZIB 3LZ1B 3LZ0A 4WU8B 5CPID 5GT0D 4UPKA 1BH9B 2J8PA 2YFVA 5CPKD 1M1AA 1KX5D 5F99C 3EPHA 1P3MA 1U35A 3C1CA 5BNXA 4CSRA 3UTBD 2G5HC 4WU9A 1P3IA 3W98B 2HIOB 4H9NB 5B32A 3AV2B 3B6FD 3AZIA 1KX3D 3LZ1A 1M19A 2F8NK 5AVBC 4WU8A 1P3GD 2G5IC 5B24B 3KUYD 5GSUC 1BH9A
chains in the Genus database with same CATH topology
4Z5TC 5BT1D 4DRAA 1P3AD 3W98A 3AV2A 3KXBD 1P34B 4WZSB 1W2EA 5B2IB 1N1JA 3LJAD 3LZ0C 4AWLB 5AV9D 3O62B 3LELB 1P3OB 1M1AC 1TZYD 2NQBA 1P3MC 1P34A 1JFIB 5B2IA 4WU9C 4KGCB 3H0LC 5B32C 3R45B 4H9QB 3AZIC 3LZ1C 3MGSB 4WU8C 5DNMB 5BS7C 1P3KB 1P3LB 5KDMB 3VH6T 4LD9A 4WJ3C 3O62A 3LELA 3WTPB 3AV1D 1JFIA 2F8NB 3W98C 2HIOC 4KHAB 2Y2QA 4H9QA 3MNNB 3AV2C 2L5AA 4J8VB 1S32B 1P3KA 5KDMA 5B24C 3A1KA 2Y2KA 3AZHB 3X1UB 4X23D 4KUDA 4QLCD 3WTPA 3AZND 2F8NG 4H9OA 5BNVB 2F8NA 4H9PB 3AZFA 4KHAA 3REIB 2CV5D 1P34C 1S32A 5C3IB 4XZQD 3REKB 3A6ND 5B2IC 3KSYA 3AZHA 3X1UA 4AWLC 2W8SA 5BNVA 4H9PA 4YM6D 3O62C 3REIA 5E5AA 4JJND 3LELC 4XUJD 1P3OC 5JRGD 3C1BD 5AV5B 4G92B 3REKA 2F8NH 4KGCC 3X1TB 3WKJD 3MVDB 3MGSC 5CPJA 5DNMC 1P3KC 1P3LC 3MGRD 1ULYA 3MGPB 3B6GB 4NE3A 3TU4B 5B0YD 1A7WA 3WTPC 4M6BA 4R8PD 3AZED 3UTAB 5B40B 5GXQD 1HQ3B 5JA4A 3X1TA 3MNNC 4WNNA 1T3UA 4J8WD 5CPIB 4J8VC 1S32C 5GT0B 2Y2HA 3B0CT 3X1SB 3MGPA 3AZHC 4Z2MH 5B31B 3TU4A 2HUEB 3X1UC 5AVBA 2BYKB 3UTBB 3UTAA 5GSUA 1EQZB 1HQ3A 1BH8A 5B2JB 4J8XD 3REIC 3AZMD 3WA9B 1KX3B 5AVCD 3AFAB 3RELB 3MGQB 5C3IC 3REKC 1P3PB 3X1SA 3KUYB 1M18D 1ID3D 2RVQD 2Y2OA 5B31A 5B33D 3KWQB 3AYWD 2BYKA 1Z2CB 3W96B 1R4VA 2XD5A 1EQZA 1B67A 5B2JA 3WA9A 3NQJB 3VH5T 4CAYB 2ZY5A 5B0ZD 4Z66D 3AFAA 3AZGD 3AZLD 3RELA 3MGQA 4G92C 1P3PA 3UT9B 3X1TC 3KWQA 3MVDC 5F99D 3VH6A 5B32G 3AN2B 3W96A 3AZJB 3MGPC 4YS3B 3B6GC 3TU4C 3NQJA 5BS7A 3UTAC 5B40C 3UT9A 2DQNC 1HQ3C 1KX4B 1ZLAB 4Z5TD 5CPIC 3REHB 3AN2A 5GT0C 3X1SC 3F6TA 3AZJA 1B6WA 4YS3A 2HIOA 4H9NA 3X1VB 5B31C 2FJ7B 2HUEC 3H0MC 1KU5A 3UTBC 5B24A 2VQRA 4J8UD 1EQZC 5B2JC 3WA9C 1KX4A 1ZLAA 1KX3C 2Y2GA 3AFAC 1F66B 2F2AC 3LZ0D 3REHA 3MGQC 3RELC 3FDDA 1P3PC 3KUYC 3X1VA 3KWQC 4DQYB 1P3BB 2Y2MA 2FJ7A 4X23B 1M1AD 4QLCB 1P3MD 1U35D 3W96C 3EPJA 3C1CD 4WU9D 5CHLB 1P3ID 5B32D 3AZID 1F66A 4H9RB 3LZ1D 1M19D 4XZQB 4WU8D 1AOIB 3UT9C 3B0CW 1P3BA 1P3OA 4NE5A 2AROB 3AN2C 3V9RB 3AZJC 4EO5B 4YS3C 4YM6B 4KGCA 3R45A 3W98D 2NZDB 3MGSA 3AV2D 4NFTA 5DNMA 1P3LA 1AOIA 3AZKB 5B1LB 5B1MB 1KX4C 1ZLAC 5AV8B 1F1EA 3REHC 2AROA 3V9RA 3MGRB 3X1VC 3MNNA 2FJ7C 2NZDA 3VH5W 2Y2IA 4J8VA 3AZEB 1P3FB 2NQBD 1P34D 3W97B 3AZKA 5GXQB 5CP6B 5B1LA 5B1MA 5B2ID 3REJB 5GT3B 5AV8A 1F66C 4LD9D 2BYMB 4ZUXB 1P3BC 4E45A 5DNNB 3O62D 3WAAB 4X23C 2PYOB 3LELD 4QLCC 5AY8B 1P3FA 3W97A 3H0RC 4Z2MG 5CP6A 3REJA 3AZMB 3VH5A 3IP4C 5GT3A 4XZQC 1AOIC 1HTAA 5AV6B 3W99B 1P3KD 1ID3B 2BYMA 4ZUXA 5DNNA 3WAAA 2PYOA 5AY8A 5AV5A 2AROC 4KUDD 3WTPD 4EO5C 4YM6C 2Y2NA 2F8ND 3MVDA 3AZFD 2NZDC 5B0ZB 4Z66B 3AZLB 5AV6A 3AZKC 1S32D 3W99A 3B6GA 4UUZB 5B1LC 5B1MC 5CPKB 3AZHD 1KX5B 5AV8C 3X1UD 5B40A 3MGRC 3B6FB 3REID 5E5AD 1P3GB 3B0DB 3AZEC 5CPIA 1P3FC 5GT0A 5B31G 3W97C 5GXQC 5CP6C 3REKD 1WWIA 3REJC 5CPKA 1KX5A 5GT3C 2Y2JA 3UTBA 5CPJD 1P3AB 3B6FA 2ZM5A 4ZUXC 1KX3A 3WAAC 5DNNC 3KXBB 2PYOC 1P3GA 5AY8C 5AV5C 1H3OB 3KFUG 4J8UB 3KUYA 3LJAB 3AZMC 3X1TD 3LZ0B 5AV9B 3W99C 5AV6C 1P3AA 1ID3C 2FFFB 3MGPD 1TZYB 4CAYA 3KXBA 3TU4D 5AVBD 1U35B 3C1CB 3UTAD 3LJAA 5GSUD 1P3IB 1HQ3D 5B0ZC 4H9SC 5FUGB 4Z66C 3AZLC 1M19B 5AV9A 1PZRA 3X1SD 5CPKC 1KX5C 1TZYA 1BFMA 5B31D 3AV1B 3B0BA 3B6FC 1EQZD 5B2JD 3WA9D 1P3GC 3B0DC 5FUGA 3P5JB 3AFAD 3RELD 3MGQD 1P3PD 1N1JB 3KWQD 3AZNB 3AV1A 5BT1C 2BG1A 1P3AC 3W96D 2CV5B 3KXBC 2NQBB 3A6NB 4J8UC 3UT9D 3LJAC 4X23A 4QLCA 3AZNA 5AV9C 2JSSA 3AN2D 4LD9B 4JJNB 3AZJD 4XUJB 4YS3D 2CV5A 1TZYC 2HIOD 2IO5B 4HGAB 5JRGB 2UWXA 4H9RA 3C1BB 4XZQA 1U35C 5BO0B 3A6NA 2ZY4A 3C1CC 5B24D 3WKJB 4E44A 1P3IC 2DF4C 1KX4D 1ZLAD 1M19C 2Y2PA 3REHD 4YM6A 4JJNA 5B0YB 4XUJA 3AL0C 3NQUB 2CWEA 5G49B 3X1VD 2FJ7D 5JRGA 4R8PB 3C1BA 3AV1C 5BO0A 4KUDB 4H9OB 4WV4B 3WKJA 3AZFB 4J8WB 1F66D 3MGRA 2JCHA 5B0YA 3NQUA 5G49A 4G91B 1P3BD 3AZNC 1P3OD 4R8PA 3AZEA 2RIQA 5GXQA 4J8XB 2CV5C 4KGCD 5AVCB 5E5AB 2YFWB 4J8WA 3MGSD 2NQBC 3A6NC 5DNMD 1M18B 1P3LD 1AOID 2ZY3A 5B33B 3AYWB 5CPJB 4ZBJB 2AROD 4J8XA 4LD9C 3A1IA 4JJNC 3AZMA 4XUJC 5AVCA 3MNND 2YFWA 2IO5C 4HGAC 5JRGC 3C1BC 3AZGB 2NZDD 4J8VD 1M18A 1ID3A 3WKJC 2LY8A 5B33A 3AZKD 3AYWA 5JA4B 5B1MD 5B1LD 4WNNB 5F99B 1WWSA 3WTPE 5AV8D 3EG5B 5B0YC 5B0ZA 4H9SA 1Q9CA 4Z66A 4NE6A 4R8PC 3AZGA 5AVBB 3AZLA 4KUDC 1P3FD 3W97D 4UUZA 3EPKA 5GSUB 5CP6D 1BH8B 3AZFC 3REJD 4Z5TB 4DRBA 4J8WC 5F99A 1TAFB 5GT3D 2JE5A 4G91C 4ZUXD 5DNND 3WAAD 2PYOD 5AY8D 5AV5D 4J8XC 5AVCC 5E5AC 4Z5TA 3MVDD 2XD1A 1TAFA 1M18C 2RVQC 3W99D 5AV6D 3VH6W 3EPLA 5B33C 2ZY2A 3AYWC 3B6GD 2YFVB 1M1AB 1P3MB 1H3OA 2Y2LA 5CPJC 4ZBJC 4J8UA 5BNXB 4CSRB 5B40D 4WU9B 5B32B 3AZGC 3AZIB 3LZ1B 3LZ0A 4WU8B 5CPID 5GT0D 4UPKA 1BH9B 2J8PA 2YFVA 5CPKD 1M1AA 1KX5D 5F99C 3EPHA 1P3MA 1U35A 3C1CA 5BNXA 4CSRA 3UTBD 2G5HC 4WU9A 1P3IA 3W98B 2HIOB 4H9NB 5B32A 3AV2B 3B6FD 3AZIA 1KX3D 3LZ1A 1M19A 2F8NK 5AVBC 4WU8A 1P3GD 2G5IC 5B24B 3KUYD 5GSUC 1BH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z5T C;  5BT1 D;  4DRA A;  1P3A D;  3W98 A;  3AV2 A;  3KXB D;  1P34 B;  4WZS B;  5B2I B;  1N1J A;  3LJA D;  3LZ0 C;  4AWL B;  5AV9 D;  3O62 B;  3LEL B;  1P3O B;  1M1A C;  1TZY D;  2NQB A;  1P3M C;  1P34 A;  1JFI B;  5B2I A;  4WU9 C;  4KGC B;  5B32 C;  3R45 B;  4H9Q B;  3AZI C;  3LZ1 C;  3MGS B;  4WU8 C;  5DNM B;  5BS7 C;  1P3K B;  1P3L B;  5KDM B;  3VH6 T;  4LD9 A;  3O62 A;  3LEL A;  3WTP B;  3AV1 D;  1JFI A;  2F8N B;  3W98 C;  2HIO C;  4KHA B;  4H9Q A;  3MNN B;  3AV2 C;  2L5A A;  4J8V B;  1S32 B;  1P3K A;  5KDM A;  5B24 C;  3AZH B;  3X1U B;  4X23 D;  4KUD A;  4QLC D;  3WTP A;  3AZN D;  2F8N G;  4H9O A;  5BNV B;  2F8N A;  4H9P B;  3AZF A;  4KHA A;  3REI B;  2CV5 D;  1P34 C;  1S32 A;  5C3I B;  4XZQ D;  3REK B;  3A6N D;  5B2I C;  3KSY A;  3AZH A;  3X1U A;  4AWL C;  5BNV A;  4H9P A;  4YM6 D;  3O62 C;  3REI A;  5E5A A;  4JJN D;  3LEL C;  4XUJ D;  1P3O C;  5JRG D;  3C1B D;  5AV5 B;  4G92 B;  3REK A;  2F8N H;  4KGC C;  3X1T B;  3WKJ D;  3MVD B;  3MGS C;  5CPJ A;  5DNM C;  1P3K C;  1P3L C;  3MGR D;  1ULY A;  3MGP B;  3B6G B;  4NE3 A;  3TU4 B;  5B0Y D;  1A7W A;  3WTP C;  4M6B A;  4R8P D;  3AZE D;  3UTA B;  5B40 B;  5GXQ D;  1HQ3 B;  5JA4 A;  3X1T A;  3MNN C;  4WNN A;  4J8W D;  5CPI B;  4J8V C;  1S32 C;  5GT0 B;  3X1S B;  3B0C T;  3MGP A;  3AZH C;  4Z2M H;  5B31 B;  3TU4 A;  2HUE B;  3X1U C;  5AVB A;  2BYK B;  3UTB B;  3UTA A;  5GSU A;  1EQZ B;  1HQ3 A;  1BH8 A;  5B2J B;  4J8X D;  3REI C;  3AZM D;  3WA9 B;  1KX3 B;  5AVC D;  3AFA B;  3REL B;  3MGQ B;  5C3I C;  3REK C;  1P3P B;  3X1S A;  3KUY B;  1M18 D;  1ID3 D;  2RVQ D;  5B31 A;  5B33 D;  3KWQ B;  3AYW D;  2BYK A;  3W96 B;  1R4V A;  1EQZ A;  1B67 A;  5B2J A;  3WA9 A;  3NQJ B;  3VH5 T;  4CAY B;  5B0Z D;  4Z66 D;  3AFA A;  3AZG D;  3AZL D;  3REL A;  3MGQ A;  4G92 C;  1P3P A;  3UT9 B;  3X1T C;  3KWQ A;  3MVD C;  5F99 D;  3VH6 A;  5B32 G;  3AN2 B;  3W96 A;  3AZJ B;  3MGP C;  4YS3 B;  3B6G C;  3TU4 C;  3NQJ A;  5BS7 A;  3UTA C;  5B40 C;  3UT9 A;  1HQ3 C;  1KX4 B;  1ZLA B;  4Z5T D;  5CPI C;  3REH B;  3AN2 A;  5GT0 C;  3X1S C;  3AZJ A;  1B6W A;  4YS3 A;  2HIO A;  4H9N A;  3X1V B;  5B31 C;  2FJ7 B;  2HUE C;  1KU5 A;  3UTB C;  5B24 A;  4J8U D;  1EQZ C;  5B2J C;  3WA9 C;  1KX4 A;  1ZLA A;  1KX3 C;  3AFA C;  1F66 B;  3LZ0 D;  3REH A;  3MGQ C;  3REL C;  1P3P C;  3KUY C;  3X1V A;  3KWQ C;  1P3B B;  2FJ7 A;  4X23 B;  1M1A D;  4QLC B;  1P3M D;  1U35 D;  3W96 C;  3C1C D;  4WU9 D;  5CHL B;  1P3I D;  5B32 D;  3AZI D;  1F66 A;  4H9R B;  3LZ1 D;  1M19 D;  4XZQ B;  4WU8 D;  1AOI B;  3UT9 C;  3B0C W;  1P3B A;  1P3O A;  4NE5 A;  2ARO B;  3AN2 C;  3V9R B;  3AZJ C;  4EO5 B;  4YS3 C;  4YM6 B;  4KGC A;  3R45 A;  3W98 D;  2NZD B;  3MGS A;  3AV2 D;  4NFT A;  5DNM A;  1P3L A;  1AOI A;  3AZK B;  5B1L B;  5B1M B;  1KX4 C;  1ZLA C;  5AV8 B;  1F1E A;  3REH C;  2ARO A;  3V9R A;  3MGR B;  3X1V C;  3MNN A;  2FJ7 C;  2NZD A;  3VH5 W;  3AZE B;  4J8V A;  2NQB D;  1P3F B;  1P34 D;  3W97 B;  3AZK A;  5GXQ B;  5CP6 B;  5B1L A;  5B1M A;  5B2I D;  3REJ B;  5GT3 B;  5AV8 A;  1F66 C;  4LD9 D;  2BYM B;  4ZUX B;  1P3B C;  4E45 A;  5DNN B;  3O62 D;  3WAA B;  4X23 C;  2PYO B;  3LEL D;  4QLC C;  5AY8 B;  1P3F A;  3W97 A;  4Z2M G;  5CP6 A;  3REJ A;  3AZM B;  3VH5 A;  5GT3 A;  4XZQ C;  1AOI C;  1HTA A;  5AV6 B;  3W99 B;  1P3K D;  1ID3 B;  2BYM A;  4ZUX A;  5DNN A;  3WAA A;  2PYO A;  5AY8 A;  5AV5 A;  2ARO C;  4KUD D;  3WTP D;  4EO5 C;  4YM6 C;  2F8N D;  3MVD A;  3AZF D;  2NZD C;  5B0Z B;  4Z66 B;  3AZL B;  5AV6 A;  3AZK C;  1S32 D;  3W99 A;  3B6G A;  4UUZ B;  5B1L C;  5B1M C;  5CPK B;  3AZH D;  1KX5 B;  5AV8 C;  3X1U D;  5B40 A;  3MGR C;  3B6F B;  3REI D;  5E5A D;  1P3G B;  3B0D B;  3AZE C;  5CPI A;  1P3F C;  5GT0 A;  5B31 G;  3W97 C;  5GXQ C;  5CP6 C;  3REK D;  1WWI A;  3REJ C;  5CPK A;  1KX5 A;  5GT3 C;  3UTB A;  5CPJ D;  1P3A B;  3B6F A;  4ZUX C;  1KX3 A;  3WAA C;  5DNN C;  3KXB B;  2PYO C;  1P3G A;  5AY8 C;  5AV5 C;  1H3O B;  4J8U B;  3KUY A;  3LJA B;  3AZM C;  3X1T D;  3LZ0 B;  5AV9 B;  3W99 C;  5AV6 C;  1P3A A;  1ID3 C;  3MGP D;  1TZY B;  4CAY A;  3KXB A;  3TU4 D;  5AVB D;  1U35 B;  3C1C B;  3UTA D;  3LJA A;  5GSU D;  1P3I B;  1HQ3 D;  5B0Z C;  4H9S C;  5FUG B;  4Z66 C;  3AZL C;  1M19 B;  5AV9 A;  3X1S D;  5CPK C;  1KX5 C;  1TZY A;  1BFM A;  5B31 D;  3AV1 B;  3B0B A;  3B6F C;  1EQZ D;  5B2J D;  3WA9 D;  1P3G C;  3B0D C;  5FUG A;  3AFA D;  3REL D;  3MGQ D;  1P3P D;  1N1J B;  3KWQ D;  3AZN B;  3AV1 A;  5BT1 C;  1P3A C;  3W96 D;  2CV5 B;  3KXB C;  2NQB B;  3A6N B;  4J8U C;  3UT9 D;  3LJA C;  4X23 A;  4QLC A;  3AZN A;  5AV9 C;  2JSS A;  3AN2 D;  4LD9 B;  4JJN B;  3AZJ D;  4XUJ B;  4YS3 D;  2CV5 A;  1TZY C;  2HIO D;  2IO5 B;  4HGA B;  5JRG B;  4H9R A;  3C1B B;  4XZQ A;  1U35 C;  5BO0 B;  3A6N A;  3C1C C;  5B24 D;  3WKJ B;  4E44 A;  1P3I C;  1KX4 D;  1ZLA D;  1M19 C;  3REH D;  4YM6 A;  4JJN A;  5B0Y B;  4XUJ A;  3NQU B;  2CWE A;  5G49 B;  3X1V D;  2FJ7 D;  5JRG A;  4R8P B;  3C1B A;  3AV1 C;  5BO0 A;  4KUD B;  4H9O B;  4WV4 B;  3WKJ A;  3AZF B;  4J8W B;  1F66 D;  3MGR A;  5B0Y A;  3NQU A;  5G49 A;  4G91 B;  1P3B D;  3AZN C;  1P3O D;  4R8P A;  3AZE A;  5GXQ A;  4J8X B;  2CV5 C;  4KGC D;  5AVC B;  5E5A B;  2YFW B;  4J8W A;  3MGS D;  2NQB C;  3A6N C;  5DNM D;  1M18 B;  1P3L D;  1AOI D;  5B33 B;  3AYW B;  5CPJ B;  4ZBJ B;  2ARO D;  4J8X A;  4LD9 C;  4JJN C;  3AZM A;  4XUJ C;  5AVC A;  3MNN D;  2YFW A;  2IO5 C;  4HGA C;  5JRG C;  3C1B C;  3AZG B;  2NZD D;  4J8V D;  1M18 A;  1ID3 A;  3WKJ C;  2LY8 A;  5B33 A;  3AZK D;  3AYW A;  5JA4 B;  5B1M D;  5B1L D;  4WNN B;  5F99 B;  1WWS A;  3WTP E;  5AV8 D;  5B0Y C;  5B0Z A;  4H9S A;  1Q9C A;  4Z66 A;  4NE6 A;  4R8P C;  3AZG A;  5AVB B;  3AZL A;  4KUD C;  1P3F D;  3W97 D;  4UUZ A;  5GSU B;  5CP6 D;  1BH8 B;  3AZF C;  3REJ D;  4Z5T B;  4DRB A;  4J8W C;  5F99 A;  1TAF B;  5GT3 D;  4G91 C;  4ZUX D;  5DNN D;  3WAA D;  2PYO D;  5AY8 D;  5AV5 D;  4J8X C;  5AVC C;  5E5A C;  4Z5T A;  3MVD D;  1TAF A;  1M18 C;  2RVQ C;  3W99 D;  5AV6 D;  3VH6 W;  5B33 C;  3B6G D;  3AYW C;  2YFV B;  1M1A B;  1P3M B;  1H3O A;  5CPJ C;  4ZBJ C;  4J8U A;  5BNX B;  4CSR B;  5B40 D;  4WU9 B;  5B32 B;  3AZG C;  3AZI B;  3LZ1 B;  3LZ0 A;  4WU8 B;  5CPI D;  5GT0 D;  1BH9 B;  2YFV A;  1M1A A;  5CPK D;  1KX5 D;  5F99 C;  1P3M A;  1U35 A;  3C1C A;  5BNX A;  4CSR A;  3UTB D;  4WU9 A;  1P3I A;  3W98 B;  2HIO B;  4H9N B;  5B32 A;  3AV2 B;  3B6F D;  3AZI A;  1KX3 D;  3LZ1 A;  1M19 A;  2F8N K;  5AVB C;  4WU8 A;  1P3G D;  5B24 B;  3KUY D;  5GSU C;  1BH9 A; 
#chains in the Genus database with same CATH topology
 4Z5T C;  5BT1 D;  4DRA A;  1P3A D;  3W98 A;  3AV2 A;  3KXB D;  1P34 B;  4WZS B;  1W2E A;  5B2I B;  1N1J A;  3LJA D;  3LZ0 C;  4AWL B;  5AV9 D;  3O62 B;  3LEL B;  1P3O B;  1M1A C;  1TZY D;  2NQB A;  1P3M C;  1P34 A;  1JFI B;  5B2I A;  4WU9 C;  4KGC B;  3H0L C;  5B32 C;  3R45 B;  4H9Q B;  3AZI C;  3LZ1 C;  3MGS B;  4WU8 C;  5DNM B;  5BS7 C;  1P3K B;  1P3L B;  5KDM B;  3VH6 T;  4LD9 A;  4WJ3 C;  3O62 A;  3LEL A;  3WTP B;  3AV1 D;  1JFI A;  2F8N B;  3W98 C;  2HIO C;  4KHA B;  2Y2Q A;  4H9Q A;  3MNN B;  3AV2 C;  2L5A A;  4J8V B;  1S32 B;  1P3K A;  5KDM A;  5B24 C;  3A1K A;  2Y2K A;  3AZH B;  3X1U B;  4X23 D;  4KUD A;  4QLC D;  3WTP A;  3AZN D;  2F8N G;  4H9O A;  5BNV B;  2F8N A;  4H9P B;  3AZF A;  4KHA A;  3REI B;  2CV5 D;  1P34 C;  1S32 A;  5C3I B;  4XZQ D;  3REK B;  3A6N D;  5B2I C;  3KSY A;  3AZH A;  3X1U A;  4AWL C;  2W8S A;  5BNV A;  4H9P A;  4YM6 D;  3O62 C;  3REI A;  5E5A A;  4JJN D;  3LEL C;  4XUJ D;  1P3O C;  5JRG D;  3C1B D;  5AV5 B;  4G92 B;  3REK A;  2F8N H;  4KGC C;  3X1T B;  3WKJ D;  3MVD B;  3MGS C;  5CPJ A;  5DNM C;  1P3K C;  1P3L C;  3MGR D;  1ULY A;  3MGP B;  3B6G B;  4NE3 A;  3TU4 B;  5B0Y D;  1A7W A;  3WTP C;  4M6B A;  4R8P D;  3AZE D;  3UTA B;  5B40 B;  5GXQ D;  1HQ3 B;  5JA4 A;  3X1T A;  3MNN C;  4WNN A;  1T3U A;  4J8W D;  5CPI B;  4J8V C;  1S32 C;  5GT0 B;  2Y2H A;  3B0C T;  3X1S B;  3MGP A;  3AZH C;  4Z2M H;  5B31 B;  3TU4 A;  2HUE B;  3X1U C;  5AVB A;  2BYK B;  3UTB B;  3UTA A;  5GSU A;  1EQZ B;  1HQ3 A;  1BH8 A;  5B2J B;  4J8X D;  3REI C;  3AZM D;  3WA9 B;  1KX3 B;  5AVC D;  3AFA B;  3REL B;  3MGQ B;  5C3I C;  3REK C;  1P3P B;  3X1S A;  3KUY B;  1M18 D;  1ID3 D;  2RVQ D;  2Y2O A;  5B31 A;  5B33 D;  3KWQ B;  3AYW D;  2BYK A;  1Z2C B;  3W96 B;  1R4V A;  2XD5 A;  1EQZ A;  1B67 A;  5B2J A;  3WA9 A;  3NQJ B;  3VH5 T;  4CAY B;  2ZY5 A;  5B0Z D;  4Z66 D;  3AFA A;  3AZG D;  3AZL D;  3REL A;  3MGQ A;  4G92 C;  1P3P A;  3UT9 B;  3X1T C;  3KWQ A;  3MVD C;  5F99 D;  3VH6 A;  5B32 G;  3AN2 B;  3W96 A;  3AZJ B;  3MGP C;  4YS3 B;  3B6G C;  3TU4 C;  3NQJ A;  5BS7 A;  3UTA C;  5B40 C;  3UT9 A;  2DQN C;  1HQ3 C;  1KX4 B;  1ZLA B;  4Z5T D;  5CPI C;  3REH B;  3AN2 A;  5GT0 C;  3X1S C;  3F6T A;  3AZJ A;  1B6W A;  4YS3 A;  2HIO A;  4H9N A;  3X1V B;  5B31 C;  2FJ7 B;  2HUE C;  3H0M C;  1KU5 A;  3UTB C;  5B24 A;  2VQR A;  4J8U D;  1EQZ C;  5B2J C;  3WA9 C;  1KX4 A;  1ZLA A;  1KX3 C;  2Y2G A;  3AFA C;  1F66 B;  2F2A C;  3LZ0 D;  3REH A;  3MGQ C;  3REL C;  3FDD A;  1P3P C;  3KUY C;  3X1V A;  3KWQ C;  4DQY B;  1P3B B;  2Y2M A;  2FJ7 A;  4X23 B;  1M1A D;  4QLC B;  1P3M D;  1U35 D;  3W96 C;  3EPJ A;  3C1C D;  4WU9 D;  5CHL B;  1P3I D;  5B32 D;  3AZI D;  1F66 A;  4H9R B;  3LZ1 D;  1M19 D;  4XZQ B;  4WU8 D;  1AOI B;  3UT9 C;  3B0C W;  1P3B A;  1P3O A;  4NE5 A;  2ARO B;  3AN2 C;  3V9R B;  3AZJ C;  4EO5 B;  4YS3 C;  4YM6 B;  4KGC A;  3R45 A;  3W98 D;  2NZD B;  3MGS A;  3AV2 D;  4NFT A;  5DNM A;  1P3L A;  1AOI A;  3AZK B;  5B1L B;  5B1M B;  1KX4 C;  1ZLA C;  5AV8 B;  1F1E A;  3REH C;  2ARO A;  3V9R A;  3MGR B;  3X1V C;  3MNN A;  2FJ7 C;  2NZD A;  3VH5 W;  2Y2I A;  4J8V A;  3AZE B;  1P3F B;  2NQB D;  1P34 D;  3W97 B;  3AZK A;  5GXQ B;  5CP6 B;  5B1L A;  5B1M A;  5B2I D;  3REJ B;  5GT3 B;  5AV8 A;  1F66 C;  4LD9 D;  2BYM B;  4ZUX B;  1P3B C;  4E45 A;  5DNN B;  3O62 D;  3WAA B;  4X23 C;  2PYO B;  3LEL D;  4QLC C;  5AY8 B;  1P3F A;  3W97 A;  3H0R C;  4Z2M G;  5CP6 A;  3REJ A;  3AZM B;  3VH5 A;  3IP4 C;  5GT3 A;  4XZQ C;  1AOI C;  1HTA A;  5AV6 B;  3W99 B;  1P3K D;  1ID3 B;  2BYM A;  4ZUX A;  5DNN A;  3WAA A;  2PYO A;  5AY8 A;  5AV5 A;  2ARO C;  4KUD D;  3WTP D;  4EO5 C;  4YM6 C;  2Y2N A;  2F8N D;  3MVD A;  3AZF D;  2NZD C;  5B0Z B;  4Z66 B;  3AZL B;  5AV6 A;  3AZK C;  1S32 D;  3W99 A;  3B6G A;  4UUZ B;  5B1L C;  5B1M C;  5CPK B;  3AZH D;  1KX5 B;  5AV8 C;  3X1U D;  5B40 A;  3MGR C;  3B6F B;  3REI D;  5E5A D;  1P3G B;  3B0D B;  3AZE C;  5CPI A;  1P3F C;  5GT0 A;  5B31 G;  3W97 C;  5GXQ C;  5CP6 C;  3REK D;  1WWI A;  3REJ C;  5CPK A;  1KX5 A;  5GT3 C;  2Y2J A;  3UTB A;  5CPJ D;  1P3A B;  3B6F A;  2ZM5 A;  4ZUX C;  1KX3 A;  3WAA C;  5DNN C;  3KXB B;  2PYO C;  1P3G A;  5AY8 C;  5AV5 C;  1H3O B;  3KFU G;  4J8U B;  3KUY A;  3LJA B;  3AZM C;  3X1T D;  3LZ0 B;  5AV9 B;  3W99 C;  5AV6 C;  1P3A A;  1ID3 C;  2FFF B;  3MGP D;  1TZY B;  4CAY A;  3KXB A;  3TU4 D;  5AVB D;  1U35 B;  3C1C B;  3UTA D;  3LJA A;  5GSU D;  1P3I B;  1HQ3 D;  5B0Z C;  4H9S C;  5FUG B;  4Z66 C;  3AZL C;  1M19 B;  5AV9 A;  1PZR A;  3X1S D;  5CPK C;  1KX5 C;  1TZY A;  1BFM A;  5B31 D;  3AV1 B;  3B0B A;  3B6F C;  1EQZ D;  5B2J D;  3WA9 D;  1P3G C;  3B0D C;  5FUG A;  3P5J B;  3AFA D;  3REL D;  3MGQ D;  1P3P D;  1N1J B;  3KWQ D;  3AZN B;  3AV1 A;  5BT1 C;  2BG1 A;  1P3A C;  3W96 D;  2CV5 B;  3KXB C;  2NQB B;  3A6N B;  4J8U C;  3UT9 D;  3LJA C;  4X23 A;  4QLC A;  3AZN A;  5AV9 C;  2JSS A;  3AN2 D;  4LD9 B;  4JJN B;  3AZJ D;  4XUJ B;  4YS3 D;  2CV5 A;  1TZY C;  2HIO D;  2IO5 B;  4HGA B;  5JRG B;  2UWX A;  4H9R A;  3C1B B;  4XZQ A;  1U35 C;  5BO0 B;  3A6N A;  2ZY4 A;  3C1C C;  5B24 D;  3WKJ B;  4E44 A;  1P3I C;  2DF4 C;  1KX4 D;  1ZLA D;  1M19 C;  2Y2P A;  3REH D;  4YM6 A;  4JJN A;  5B0Y B;  4XUJ A;  3AL0 C;  3NQU B;  2CWE A;  5G49 B;  3X1V D;  2FJ7 D;  5JRG A;  4R8P B;  3C1B A;  3AV1 C;  5BO0 A;  4KUD B;  4H9O B;  4WV4 B;  3WKJ A;  3AZF B;  4J8W B;  1F66 D;  3MGR A;  2JCH A;  5B0Y A;  3NQU A;  5G49 A;  4G91 B;  1P3B D;  3AZN C;  1P3O D;  4R8P A;  3AZE A;  2RIQ A;  5GXQ A;  4J8X B;  2CV5 C;  4KGC D;  5AVC B;  5E5A B;  2YFW B;  4J8W A;  3MGS D;  2NQB C;  3A6N C;  5DNM D;  1M18 B;  1P3L D;  1AOI D;  2ZY3 A;  5B33 B;  3AYW B;  5CPJ B;  4ZBJ B;  2ARO D;  4J8X A;  4LD9 C;  3A1I A;  4JJN C;  3AZM A;  4XUJ C;  5AVC A;  3MNN D;  2YFW A;  2IO5 C;  4HGA C;  5JRG C;  3C1B C;  3AZG B;  2NZD D;  4J8V D;  1M18 A;  1ID3 A;  3WKJ C;  2LY8 A;  5B33 A;  3AZK D;  3AYW A;  5JA4 B;  5B1M D;  5B1L D;  4WNN B;  5F99 B;  1WWS A;  3WTP E;  5AV8 D;  3EG5 B;  5B0Y C;  5B0Z A;  4H9S A;  1Q9C A;  4Z66 A;  4NE6 A;  4R8P C;  3AZG A;  5AVB B;  3AZL A;  4KUD C;  1P3F D;  3W97 D;  4UUZ A;  3EPK A;  5GSU B;  5CP6 D;  1BH8 B;  3AZF C;  3REJ D;  4Z5T B;  4DRB A;  4J8W C;  5F99 A;  1TAF B;  5GT3 D;  2JE5 A;  4G91 C;  4ZUX D;  5DNN D;  3WAA D;  2PYO D;  5AY8 D;  5AV5 D;  4J8X C;  5AVC C;  5E5A C;  4Z5T A;  3MVD D;  2XD1 A;  1TAF A;  1M18 C;  2RVQ C;  3W99 D;  5AV6 D;  3VH6 W;  3EPL A;  5B33 C;  2ZY2 A;  3AYW C;  3B6G D;  2YFV B;  1M1A B;  1P3M B;  1H3O A;  2Y2L A;  5CPJ C;  4ZBJ C;  4J8U A;  5BNX B;  4CSR B;  5B40 D;  4WU9 B;  5B32 B;  3AZG C;  3AZI B;  3LZ1 B;  3LZ0 A;  4WU8 B;  5CPI D;  5GT0 D;  4UPK A;  1BH9 B;  2J8P A;  2YFV A;  5CPK D;  1M1A A;  1KX5 D;  5F99 C;  3EPH A;  1P3M A;  1U35 A;  3C1C A;  5BNX A;  4CSR A;  3UTB D;  2G5H C;  4WU9 A;  1P3I A;  3W98 B;  2HIO B;  4H9N B;  5B32 A;  3AV2 B;  3B6F D;  3AZI A;  1KX3 D;  3LZ1 A;  1M19 A;  2F8N K;  5AVB C;  4WU8 A;  1P3G D;  2G5I C;  5B24 B;  3KUY D;  5GSU C;  1BH9 A; 
#chains in the Genus database with same CATH homology
 4Z5T C;  5BT1 D;  4DRA A;  1P3A D;  3W98 A;  3AV2 A;  3KXB D;  1P34 B;  4WZS B;  1W2E A;  5B2I B;  1N1J A;  3LJA D;  3LZ0 C;  4AWL B;  5AV9 D;  3O62 B;  3LEL B;  1P3O B;  1M1A C;  1TZY D;  2NQB A;  1P3M C;  1P34 A;  1JFI B;  5B2I A;  4WU9 C;  4KGC B;  3H0L C;  5B32 C;  3R45 B;  4H9Q B;  3AZI C;  3LZ1 C;  3MGS B;  4WU8 C;  5DNM B;  5BS7 C;  1P3K B;  1P3L B;  5KDM B;  3VH6 T;  4LD9 A;  4WJ3 C;  3O62 A;  3LEL A;  3WTP B;  3AV1 D;  1JFI A;  2F8N B;  3W98 C;  2HIO C;  4KHA B;  2Y2Q A;  4H9Q A;  3MNN B;  3AV2 C;  2L5A A;  4J8V B;  1S32 B;  1P3K A;  5KDM A;  5B24 C;  3A1K A;  2Y2K A;  3AZH B;  3X1U B;  4X23 D;  4KUD A;  4QLC D;  3WTP A;  3AZN D;  2F8N G;  4H9O A;  5BNV B;  2F8N A;  4H9P B;  3AZF A;  4KHA A;  3REI B;  2CV5 D;  1P34 C;  1S32 A;  5C3I B;  4XZQ D;  3REK B;  3A6N D;  5B2I C;  3KSY A;  3AZH A;  3X1U A;  4AWL C;  2W8S A;  5BNV A;  4H9P A;  4YM6 D;  3O62 C;  3REI A;  5E5A A;  4JJN D;  3LEL C;  4XUJ D;  1P3O C;  5JRG D;  3C1B D;  5AV5 B;  4G92 B;  3REK A;  2F8N H;  4KGC C;  3X1T B;  3WKJ D;  3MVD B;  3MGS C;  5CPJ A;  5DNM C;  1P3K C;  1P3L C;  3MGR D;  1ULY A;  3MGP B;  3B6G B;  4NE3 A;  3TU4 B;  5B0Y D;  1A7W A;  3WTP C;  4M6B A;  4R8P D;  3AZE D;  3UTA B;  5B40 B;  5GXQ D;  1HQ3 B;  5JA4 A;  3X1T A;  3MNN C;  4WNN A;  1T3U A;  4J8W D;  5CPI B;  4J8V C;  1S32 C;  5GT0 B;  2Y2H A;  3B0C T;  3X1S B;  3MGP A;  3AZH C;  4Z2M H;  5B31 B;  3TU4 A;  2HUE B;  3X1U C;  5AVB A;  2BYK B;  3UTB B;  3UTA A;  5GSU A;  1EQZ B;  1HQ3 A;  1BH8 A;  5B2J B;  4J8X D;  3REI C;  3AZM D;  3WA9 B;  1KX3 B;  5AVC D;  3AFA B;  3REL B;  3MGQ B;  5C3I C;  3REK C;  1P3P B;  3X1S A;  3KUY B;  1M18 D;  1ID3 D;  2RVQ D;  2Y2O A;  5B31 A;  5B33 D;  3KWQ B;  3AYW D;  2BYK A;  1Z2C B;  3W96 B;  1R4V A;  2XD5 A;  1EQZ A;  1B67 A;  5B2J A;  3WA9 A;  3NQJ B;  3VH5 T;  4CAY B;  2ZY5 A;  5B0Z D;  4Z66 D;  3AFA A;  3AZG D;  3AZL D;  3REL A;  3MGQ A;  4G92 C;  1P3P A;  3UT9 B;  3X1T C;  3KWQ A;  3MVD C;  5F99 D;  3VH6 A;  5B32 G;  3AN2 B;  3W96 A;  3AZJ B;  3MGP C;  4YS3 B;  3B6G C;  3TU4 C;  3NQJ A;  5BS7 A;  3UTA C;  5B40 C;  3UT9 A;  2DQN C;  1HQ3 C;  1KX4 B;  1ZLA B;  4Z5T D;  5CPI C;  3REH B;  3AN2 A;  5GT0 C;  3X1S C;  3F6T A;  3AZJ A;  1B6W A;  4YS3 A;  2HIO A;  4H9N A;  3X1V B;  5B31 C;  2FJ7 B;  2HUE C;  3H0M C;  1KU5 A;  3UTB C;  5B24 A;  2VQR A;  4J8U D;  1EQZ C;  5B2J C;  3WA9 C;  1KX4 A;  1ZLA A;  1KX3 C;  2Y2G A;  3AFA C;  1F66 B;  2F2A C;  3LZ0 D;  3REH A;  3MGQ C;  3REL C;  3FDD A;  1P3P C;  3KUY C;  3X1V A;  3KWQ C;  4DQY B;  1P3B B;  2Y2M A;  2FJ7 A;  4X23 B;  1M1A D;  4QLC B;  1P3M D;  1U35 D;  3W96 C;  3EPJ A;  3C1C D;  4WU9 D;  5CHL B;  1P3I D;  5B32 D;  3AZI D;  1F66 A;  4H9R B;  3LZ1 D;  1M19 D;  4XZQ B;  4WU8 D;  1AOI B;  3UT9 C;  3B0C W;  1P3B A;  1P3O A;  4NE5 A;  2ARO B;  3AN2 C;  3V9R B;  3AZJ C;  4EO5 B;  4YS3 C;  4YM6 B;  4KGC A;  3R45 A;  3W98 D;  2NZD B;  3MGS A;  3AV2 D;  4NFT A;  5DNM A;  1P3L A;  1AOI A;  3AZK B;  5B1L B;  5B1M B;  1KX4 C;  1ZLA C;  5AV8 B;  1F1E A;  3REH C;  2ARO A;  3V9R A;  3MGR B;  3X1V C;  3MNN A;  2FJ7 C;  2NZD A;  3VH5 W;  2Y2I A;  4J8V A;  3AZE B;  1P3F B;  2NQB D;  1P34 D;  3W97 B;  3AZK A;  5GXQ B;  5CP6 B;  5B1L A;  5B1M A;  5B2I D;  3REJ B;  5GT3 B;  5AV8 A;  1F66 C;  4LD9 D;  2BYM B;  4ZUX B;  1P3B C;  4E45 A;  5DNN B;  3O62 D;  3WAA B;  4X23 C;  2PYO B;  3LEL D;  4QLC C;  5AY8 B;  1P3F A;  3W97 A;  3H0R C;  4Z2M G;  5CP6 A;  3REJ A;  3AZM B;  3VH5 A;  3IP4 C;  5GT3 A;  4XZQ C;  1AOI C;  1HTA A;  5AV6 B;  3W99 B;  1P3K D;  1ID3 B;  2BYM A;  4ZUX A;  5DNN A;  3WAA A;  2PYO A;  5AY8 A;  5AV5 A;  2ARO C;  4KUD D;  3WTP D;  4EO5 C;  4YM6 C;  2Y2N A;  2F8N D;  3MVD A;  3AZF D;  2NZD C;  5B0Z B;  4Z66 B;  3AZL B;  5AV6 A;  3AZK C;  1S32 D;  3W99 A;  3B6G A;  4UUZ B;  5B1L C;  5B1M C;  5CPK B;  3AZH D;  1KX5 B;  5AV8 C;  3X1U D;  5B40 A;  3MGR C;  3B6F B;  3REI D;  5E5A D;  1P3G B;  3B0D B;  3AZE C;  5CPI A;  1P3F C;  5GT0 A;  5B31 G;  3W97 C;  5GXQ C;  5CP6 C;  3REK D;  1WWI A;  3REJ C;  5CPK A;  1KX5 A;  5GT3 C;  2Y2J A;  3UTB A;  5CPJ D;  1P3A B;  3B6F A;  2ZM5 A;  4ZUX C;  1KX3 A;  3WAA C;  5DNN C;  3KXB B;  2PYO C;  1P3G A;  5AY8 C;  5AV5 C;  1H3O B;  3KFU G;  4J8U B;  3KUY A;  3LJA B;  3AZM C;  3X1T D;  3LZ0 B;  5AV9 B;  3W99 C;  5AV6 C;  1P3A A;  1ID3 C;  2FFF B;  3MGP D;  1TZY B;  4CAY A;  3KXB A;  3TU4 D;  5AVB D;  1U35 B;  3C1C B;  3UTA D;  3LJA A;  5GSU D;  1P3I B;  1HQ3 D;  5B0Z C;  4H9S C;  5FUG B;  4Z66 C;  3AZL C;  1M19 B;  5AV9 A;  1PZR A;  3X1S D;  5CPK C;  1KX5 C;  1TZY A;  1BFM A;  5B31 D;  3AV1 B;  3B0B A;  3B6F C;  1EQZ D;  5B2J D;  3WA9 D;  1P3G C;  3B0D C;  5FUG A;  3P5J B;  3AFA D;  3REL D;  3MGQ D;  1P3P D;  1N1J B;  3KWQ D;  3AZN B;  3AV1 A;  5BT1 C;  2BG1 A;  1P3A C;  3W96 D;  2CV5 B;  3KXB C;  2NQB B;  3A6N B;  4J8U C;  3UT9 D;  3LJA C;  4X23 A;  4QLC A;  3AZN A;  5AV9 C;  2JSS A;  3AN2 D;  4LD9 B;  4JJN B;  3AZJ D;  4XUJ B;  4YS3 D;  2CV5 A;  1TZY C;  2HIO D;  2IO5 B;  4HGA B;  5JRG B;  2UWX A;  4H9R A;  3C1B B;  4XZQ A;  1U35 C;  5BO0 B;  3A6N A;  2ZY4 A;  3C1C C;  5B24 D;  3WKJ B;  4E44 A;  1P3I C;  2DF4 C;  1KX4 D;  1ZLA D;  1M19 C;  2Y2P A;  3REH D;  4YM6 A;  4JJN A;  5B0Y B;  4XUJ A;  3AL0 C;  3NQU B;  2CWE A;  5G49 B;  3X1V D;  2FJ7 D;  5JRG A;  4R8P B;  3C1B A;  3AV1 C;  5BO0 A;  4KUD B;  4H9O B;  4WV4 B;  3WKJ A;  3AZF B;  4J8W B;  1F66 D;  3MGR A;  2JCH A;  5B0Y A;  3NQU A;  5G49 A;  4G91 B;  1P3B D;  3AZN C;  1P3O D;  4R8P A;  3AZE A;  2RIQ A;  5GXQ A;  4J8X B;  2CV5 C;  4KGC D;  5AVC B;  5E5A B;  2YFW B;  4J8W A;  3MGS D;  2NQB C;  3A6N C;  5DNM D;  1M18 B;  1P3L D;  1AOI D;  2ZY3 A;  5B33 B;  3AYW B;  5CPJ B;  4ZBJ B;  2ARO D;  4J8X A;  4LD9 C;  3A1I A;  4JJN C;  3AZM A;  4XUJ C;  5AVC A;  3MNN D;  2YFW A;  2IO5 C;  4HGA C;  5JRG C;  3C1B C;  3AZG B;  2NZD D;  4J8V D;  1M18 A;  1ID3 A;  3WKJ C;  2LY8 A;  5B33 A;  3AZK D;  3AYW A;  5JA4 B;  5B1M D;  5B1L D;  4WNN B;  5F99 B;  1WWS A;  3WTP E;  5AV8 D;  3EG5 B;  5B0Y C;  5B0Z A;  4H9S A;  1Q9C A;  4Z66 A;  4NE6 A;  4R8P C;  3AZG A;  5AVB B;  3AZL A;  4KUD C;  1P3F D;  3W97 D;  4UUZ A;  3EPK A;  5GSU B;  5CP6 D;  1BH8 B;  3AZF C;  3REJ D;  4Z5T B;  4DRB A;  4J8W C;  5F99 A;  1TAF B;  5GT3 D;  2JE5 A;  4G91 C;  4ZUX D;  5DNN D;  3WAA D;  2PYO D;  5AY8 D;  5AV5 D;  4J8X C;  5AVC C;  5E5A C;  4Z5T A;  3MVD D;  2XD1 A;  1TAF A;  1M18 C;  2RVQ C;  3W99 D;  5AV6 D;  3VH6 W;  3EPL A;  5B33 C;  2ZY2 A;  3AYW C;  3B6G D;  2YFV B;  1M1A B;  1P3M B;  1H3O A;  2Y2L A;  5CPJ C;  4ZBJ C;  4J8U A;  5BNX B;  4CSR B;  5B40 D;  4WU9 B;  5B32 B;  3AZG C;  3AZI B;  3LZ1 B;  3LZ0 A;  4WU8 B;  5CPI D;  5GT0 D;  4UPK A;  1BH9 B;  2J8P A;  2YFV A;  5CPK D;  1M1A A;  1KX5 D;  5F99 C;  3EPH A;  1P3M A;  1U35 A;  3C1C A;  5BNX A;  4CSR A;  3UTB D;  2G5H C;  4WU9 A;  1P3I A;  3W98 B;  2HIO B;  4H9N B;  5B32 A;  3AV2 B;  3B6F D;  3AZI A;  1KX3 D;  3LZ1 A;  1M19 A;  2F8N K;  5AVB C;  4WU8 A;  1P3G D;  2G5I C;  5B24 B;  3KUY D;  5GSU C;  1BH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...