2NZDA

Nucleosome core particle containing 145 bp of dna
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA stretching and extreme kinking in the nucleosome core
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords DNA (145-MER)
total genus 33
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2nzdA00
3MVDA 5G49B 3MVDB 5GXQD 4KUDC 1P3FC 1KX5A 4Z5TC 3AZMA 3AN2D 4KGCB 4UUZA 5KDMA 1M1AB 3AZEB 5JA4A 3REKB 5CP6B 5B0ZD 1KU5A 4WU9B 4H9QA 3MNNC 5B1LA 3AZGC 2F8NK 5BO0A 4QLCA 1EQZA 3WAAB 1TZYA 3LZ1A 5B1LB 5B2JA 4H9OB 3AZIA 3A6ND 2BYKB 4R8PA 5CPJD 3REHD 1ID3D 1P3LD 5AVCA 2NQBB 3REID 1HQ3D 1N1JB 1P3KD 5CPJA 3W97C 5B2IB 5F99C 3LZ0D 4YS3D 3X1UD 3UTAD 5AV6B 5KDMB 4HGAB 2RVQD 3VH5T 1U35B 4WU8D 5AV8B 4KUDA 4CAYB 1P3GD 1HQ3C 4H9NB 3WTPB 3AYWC 3MGRC 3X1SB 1KX3C 4JJND 3MGSD 3NQJB 5BT1D 3B6FD 2YFWB 3WA9D 3B0BA 1KX3A 3MGRA 4Z66A 4XZQA 4J8XD 5CHLB 5BS7A 4X23C 5B1MD 4G92B 3WKJB 3WA9C 3B6GC 3MNNB 3A6NA 3AZGB 5B2IC 5F99B 4ZUXB 3UT9C 3AFAB 5B40A 4X23B 3W98D 4WU8C 1P3LA 1JFIA 4M6BA 4KGCD 1P34B 1M1AD 5CPIB 5B2IA 2F8ND 3AV1D 3W97D 3TU4A 1F66A 3UT9B 1TZYD 3LZ1D 3C1BB 3W98C 2IO5C 4YS3C 3KXBD 4X23A 5E5AD 5B40B 5BNVA 5DNMC 3MGPC 2AROB 2NZDA 5AV9C 3X1TD 3REIC 3AZFD 3AV1C 2FJ7B 5B1LD 3MNNA 3A6NB 3AZGA 3MGSA 3C1CD 5B2JB 2F8NH 5AY8D 3MGPB 1KX5D 1M19C 3AZMD 2PYOB 1ULYA 5BO0B 2FJ7C 1P3PB 4XZQD 5B0ZC 4Z66D 4J8UB 3W96D 3AZLA 4ZBJB 5B0ZA 3V9RA 3B0DC 4Z5TD 3KWQA 1P3ID 4G91B 5AVCB 2NQBA 1B67A 4KUDD 2RVQC 1KX3D 1BH9A 2AROC 3AZHD 3MGPA 2NZDC 5CP6D 3AZFC 3RELC 1P3GC 4J8UA 5B2JC 1F66C 3AZKB 1P3BB 3AZFA 1TZYC 3LZ1C 2AROA 4H9SA 4QLCC 5JRGC 4WU8A 1S32A 1M1AA 3KWQC 5GT3D 3B6GA 1M18D 5JRGB 3C1BC 4QLCB 3LELD 2NQBD 3W98B 3R45B 4H9QB 4WNNA 4XUJB 3AZJB 4LD9D 1KX4C 1ZLAB 4LD9C 5BS7C 3REKA 1P3FB 5AVBB 4ZUXC 3KWQB 1P3AA 3AN2A 3KUYB 1P3GB 3X1TB 3MGSC 2HUEC 2CV5D 3AYWA 1KX4D 3C1CC 3UTBD 5B33A 5DNNC 5AV9A 5B32C 2YFWA 4Z2MG 3LJAA 5AV8C 3MGPD 5B24B 4YS3A 4J8VA 3KUYC 2PYOD 3KSYA 2HUEB 4E45A 4KHAA 4KHAB 3MGRB 3UTAC 5GXQB 3NQJA 1ID3A 5AVCC 3AZNB 4J8VD 4J8WA 3UT9A 5B31B 4H9NA 5GT0A 3AZEC 1P3KA 4R8PC 1N1JA 3REHC 3AZIC 2NZDD 2YFVB 1M18A 2YFVA 3W99D 5DNMB 5CPID 3MGQA 3LJAC 3AZHB 1U35A 1P3MB 3AV1B 1S32B 3C1CA 4XZQC 4Z66C 4R8PB 1BH8A 3AZHA 4H9OA 3AZIB 3MGQD 1ID3B 4ZUXA 4NFTA 1WWSA 5GSUD 5BNXA 4J8WB 1M18C 2IO5B 5B24A 4YS3B 5AVBC 3REJA 5E5AC 3WKJC 5AY8C 4H9PB 3MVDD 4CAYA 1P3OC 3VH6A 5B0YB 3REJD 3AN2B 4Z5TB 3X1SD 5AV5B 2L5AA 3UTAA 1P3IB 4JJNB 3KUYD 3X1VB 5B0ZB 4E44A 1P3GA 3AV2D 1P3OB 1A7WA 3KXBA 2BYMB 1AOIB 3B6FA 5AV5A 5B33C 5B24D 3NQUB 1F1EA 3MNND 3AZGD 1P3PA 4ZUXD 4DRBA 3AFAD 1TAFA 5B24C 5B31D 3AZLC 4XUJC 3AZJC 1F66B 2F8NB 5GT0C 5CP6A 3X1UB 2FJ7A 1U35D 1EQZB 3WAAA 5AV6C 4KGCA 3VH5W 5BNVB 4EO5C 3KXBB 1AOIA 3VH6T 1P3MD 5G49A 4Z2MH 4G91C 4R8PD 3AV1A 3REHB 4JJNA 4EO5B 3KXBC 5DNMA 3AV2A 5GXQA 5CPKC 4CSRA 1KX4B 4J8XA 4ZBJC 3WTPE 1P3KC 4WV4B 5GT0D 1Q9CA 4XZQB 4Z66B 4J8UD 3B0DB 3UTBC 3LZ0B 1WWIA 3W96B 3B0CT 5AV6D 3UTAB 1P3IA 2LY8A 1P3LC 3WKJD 5B0YC 5B40C 5AV8D 1P3IC 5CPKB 3W96A 5B31C 3AZLD 5DNND 3WTPD 5E5AA 4X23D 4J8VB 3KUYA 5B0YD 3REJB 4KUDB 5AV8A 5BNXB 3LJAD 3W97B 1H3OB 2HIOB 4WNNB 1P3MA 3W99B 3AN2C 4G92C 1AOID 5B1MB 1P3AD 3LELC 1BH8B 1S32D 2CWEA 2JSSA 3X1UA 2HIOA 5B2JD 3MGQB 1P3LB 1JFIB 3W98A 3O62C 4YM6D 5JRGD 4H9RB 3TU4C 1M19B 1M1AC 2PYOC 5F99A 1H3OA 1P3PC 1F66D 1ZLAD 5AVBD 3LZ1B 1TZYB 5JA4B 1ID3C 3O62B 1BH9B 5FUGA 3VH5A 5AV9B 3UTBA 3WTPA 3X1VC 3A6NC 3AYWB 3WTPC 1EQZC 5B32A 5B32B 5CPIC 5GSUA 4AWLB 3X1VD 1KX5B 5B33D 3RELB 3AZKD 1P3BD 4H9PA 3B0CW 3MGRD 2PYOA 3WAAC 3B6GB 5B32G 5AY8A 4Z5TA 3AZMC 3V9RB 5AVBA 3TU4D 3AZED 3REKD 4XUJA 3AZJA 4NE6A 3X1UC 5AVCD 5FUGB 4QLCD 3LELB 3LELA 1S32C 5DNMD 4XUJD 3AZJD 3VH6W 1P3MC 3UT9D 5B31G 5GSUC 5AV5C 4H9SC 5CPIA 2AROD 3MGQC 3REIB 3C1CB 3RELA 3X1VA 3AZEA 5AY8B 5B31A 5GSUB 3AFAC 1P34A 4J8WD 3W99C 3AZMB 4J8WC 1M18B 1P3OA 2NQBC 5B0YA 1ZLAC 4LD9B 1P3FD 5GT3C 3O62A 3REJC 3AZND 1KX5C 4J8VC 3WKJA 4YM6C 4NE5A 4DRAA 5CPKD 3AZLB 3MVDC 3MGSB 1BFMA 3WA9B 2HIOC 4WU9D 5DNNB 2CV5A 5DNNA 3AYWD 2CV5B 3LZ0C 4J8XB 3UTBB 1M19A 1KX3B 3X1SC 2NZDB 3AV2B 3WAAD 1P3AC 3LJAB 3AZHC 1AOIC 3X1SA 2HIOD 5AV6A 4WU9C 4KGCC 3AZKC 5B33B 1P3BC 1HTAA 3REKC 5CPJB 3REIA 5F99D 4CSRB 1HQ3A 1KX4A 4H9RA 4HGAC 3X1TA 1U35C 3AZNC 4YM6A 1P3AB 4NE3A 3C1BA 5GT3A 3REHA 3B6GD 1HQ3B 1P34D 3TU4B 1P3KB 1ZLAA 5B2ID 2F8NA 3W97A 5CPJC 3W96C 5GT3B 5B1MA 3R45A 4WU8B 3C1BD 1B6WA 5B1MC 4YM6B 5JRGA 1EQZD 3W99A 1M19D 5E5AB 5B40D 3AFAA 1P34C 5BT1C 5C3IC 3B6FC 3AZFB 2FJ7D 4WZSB 4J8XC 1R4VA 3NQUA 4J8UC 2BYKA 5GXQC 5CPKA 3KWQD 2F8NG 3WA9A 3AV2C 3AZID 5AV5D 3O62D 3AZNA 4UUZB 5AV9D 1TAFB 3X1TC 4JJNC 2BYMA 5C3IB 3B6FB 4AWLC 3AZKA 1P3BA 5B1LC 4WU9A 1P3PD 1P3OD 5GT0B 5B32D 3LZ0A 3RELD 2CV5C 1P3FA 5CP6C 4LD9A
chains in the Genus database with same CATH superfamily
3MVDA 5G49B 3MVDB 2F2AC 5GXQD 4KUDC 1P3FC 1KX5A 4Z5TC 3AZMA 3AN2D 4KGCB 4UUZA 5KDMA 1M1AB 3AZEB 5JA4A 3REKB 5CP6B 5B0ZD 1KU5A 4WU9B 4H9QA 3MNNC 5B1LA 3AZGC 2F8NK 3P5JB 5BO0A 4QLCA 1EQZA 3WAAB 1TZYA 3LZ1A 5B1LB 5B2JA 4H9OB 3AZIA 3A6ND 2BYKB 4R8PA 2XD5A 5CPJD 3REHD 1ID3D 1P3LD 5AVCA 2NQBB 3REID 1HQ3D 1N1JB 1P3KD 5CPJA 3W97C 5B2IB 5F99C 2VQRA 4YS3D 3LZ0D 3X1UD 3UTAD 5AV6B 5KDMB 4HGAB 2RVQD 3VH5T 1U35B 4WU8D 5AV8B 4KUDA 4CAYB 1P3GD 1HQ3C 4H9NB 3WTPB 3AYWC 3MGRC 3X1SB 1KX3C 4JJND 1Z2CB 3MGSD 3NQJB 5BT1D 3B6FD 2YFWB 3WA9D 3B0BA 1KX3A 3MGRA 4XZQA 4Z66A 4J8XD 5CHLB 5BS7A 4X23C 5B1MD 4G92B 3WKJB 3F6TA 3WA9C 3B6GC 3MNNB 3A6NA 3AZGB 5B2IC 5F99B 4ZUXB 4DQYB 2Y2KA 3AFAB 3UT9C 5B40A 4X23B 3W98D 4WU8C 1P3LA 1JFIA 4M6BA 4KGCD 1P34B 1M1AD 5CPIB 2Y2GA 5B2IA 2F8ND 3AV1D 3W97D 3TU4A 1F66A 3UT9B 1TZYD 3LZ1D 3C1BB 3W98C 2IO5C 4YS3C 3KXBD 5E5AD 5B40B 4X23A 5BNVA 5DNMC 3MGPC 2AROB 2NZDA 5AV9C 3X1TD 3REIC 3AZFD 3AV1C 2FJ7B 5B1LD 3MNNA 3A6NB 3AZGA 3MGSA 3C1CD 5B2JB 2F8NH 2RIQA 5AY8D 3MGPB 1KX5D 1M19C 3AZMD 2PYOB 1ULYA 5BO0B 2FJ7C 1P3PB 1PZRA 4XZQD 5B0ZC 4Z66D 4J8UB 2DQNC 3W96D 3AZLA 4ZBJB 5B0ZA 3V9RA 3B0DC 2ZM5A 4Z5TD 3KWQA 1P3ID 3EPLA 3H0MC 4G91B 5AVCB 2NQBA 1B67A 4KUDD 2RVQC 1KX3D 1BH9A 2AROC 3AZHD 3MGPA 2NZDC 5CP6D 3AZFC 3RELC 1P3GC 4J8UA 5B2JC 1F66C 3AZKB 1P3BB 3AZFA 1TZYC 3LZ1C 2AROA 4H9SA 4QLCC 5JRGC 4WU8A 1S32A 3FDDA 1M1AA 3KWQC 5GT3D 3B6GA 1M18D 5JRGB 3C1BC 4QLCB 3LELD 1W2EA 2NQBD 3W98B 3R45B 4H9QB 4WNNA 4XUJB 3AZJB 4LD9D 1KX4C 1ZLAB 4LD9C 5BS7C 3REKA 1P3FB 5AVBB 4ZUXC 3KWQB 2Y2HA 1P3AA 3AN2A 3KUYB 1P3GB 3X1TB 3MGSC 2HUEC 2CV5D 3AYWA 1KX4D 3C1CC 3UTBD 5B33A 5DNNC 5AV9A 5B32C 2YFWA 4Z2MG 3LJAA 5AV8C 3MGPD 5B24B 4YS3A 4J8VA 3KUYC 2PYOD 3KSYA 2HUEB 4E45A 4KHAA 4KHAB 3MGRB 3UTAC 5GXQB 3NQJA 1ID3A 5AVCC 3AZNB 4J8VD 4J8WA 3UT9A 5B31B 4H9NA 5GT0A 3AZEC 1P3KA 4R8PC 1N1JA 3REHC 3AZIC 2NZDD 2YFVB 1M18A 2YFVA 3W99D 5DNMB 5CPID 3MGQA 3LJAC 3AZHB 1U35A 1P3MB 3AV1B 1S32B 3C1CA 4XZQC 4Z66C 4R8PB 1BH8A 2JE5A 3AZHA 4H9OA 3AZIB 3MGQD 1ID3B 4ZUXA 3IP4C 4NFTA 2JCHA 1WWSA 5GSUD 5BNXA 4J8WB 1M18C 2IO5B 5B24A 4YS3B 5AVBC 3REJA 5E5AC 3WKJC 5AY8C 3H0RC 2ZY2A 4H9PB 3MVDD 4CAYA 1P3OC 3VH6A 5B0YB 3REJD 3KFUG 3AN2B 4Z5TB 3H0LC 3X1SD 5AV5B 2L5AA 3UTAA 1P3IB 4JJNB 3KUYD 3X1VB 5B0ZB 4E44A 1P3GA 3AV2D 1P3OB 1A7WA 3KXBA 2BYMB 1AOIB 3B6FA 5AV5A 3A1IA 5B33C 5B24D 3NQUB 1F1EA 3MNND 3AZGD 1P3PA 4ZUXD 4DRBA 3AFAD 1TAFA 5B24C 5B31D 3AZLC 4XUJC 2BG1A 3AZJC 1F66B 2F8NB 5GT0C 5CP6A 3X1UB 2FJ7A 1U35D 2W8SA 1EQZB 3WAAA 5AV6C 4KGCA 3VH5W 5BNVB 4EO5C 3KXBB 1AOIA 3VH6T 3EPHA 1P3MD 3AL0C 5G49A 2G5IC 4Z2MH 4G91C 4R8PD 3AV1A 3REHB 4JJNA 4EO5B 3KXBC 5DNMA 3AV2A 5GXQA 5CPKC 4CSRA 1KX4B 4J8XA 4ZBJC 3WTPE 2DF4C 1P3KC 4WV4B 1Q9CA 5GT0D 2UWXA 4XZQB 4Z66B 3B0DB 4J8UD 3LZ0B 1WWIA 3UTBC 3W96B 3B0CT 5AV6D 3UTAB 1P3IA 2LY8A 1P3LC 3WKJD 5B0YC 5B40C 2ZY4A 5AV8D 1P3IC 5CPKB 3W96A 5B31C 3AZLD 2Y2MA 5DNND 3WTPD 5E5AA 4X23D 4J8VB 3KUYA 5B0YD 3REJB 4KUDB 5AV8A 5BNXB 2ZY3A 3LJAD 3W97B 1H3OB 2HIOB 4WNNB 1P3MA 3W99B 3AN2C 4G92C 1AOID 5B1MB 1P3AD 3LELC 1BH8B 1S32D 2CWEA 2JSSA 3X1UA 2HIOA 2Y2NA 1T3UA 5B2JD 2XD1A 3MGQB 1P3LB 1JFIB 3A1KA 3W98A 3O62C 4YM6D 5JRGD 4H9RB 3TU4C 1M19B 1M1AC 2PYOC 5F99A 1H3OA 1P3PC 1F66D 1ZLAD 5AVBD 1TZYB 3LZ1B 5JA4B 1ID3C 3O62B 1BH9B 5FUGA 3VH5A 5AV9B 3UTBA 3WTPA 3X1VC 3A6NC 3AYWB 3WTPC 1EQZC 5B32A 5B32B 5CPIC 5GSUA 4AWLB 3X1VD 1KX5B 2FFFB 5B33D 3RELB 3AZKD 1P3BD 4H9PA 2J8PA 3B0CW 3MGRD 2PYOA 3WAAC 3B6GB 5B32G 5AY8A 4Z5TA 3AZMC 3V9RB 5AVBA 3TU4D 3AZED 3REKD 4XUJA 3AZJA 4NE6A 3X1UC 5AVCD 5FUGB 4QLCD 3LELB 3LELA 2G5HC 1S32C 5DNMD 4XUJD 3AZJD 3VH6W 1P3MC 3UT9D 5B31G 5GSUC 5AV5C 4H9SC 5CPIA 2AROD 3MGQC 3EPJA 3REIB 3C1CB 3RELA 3X1VA 3AZEA 5AY8B 5B31A 5GSUB 3AFAC 1P34A 4J8WD 3W99C 3AZMB 4J8WC 1M18B 1P3OA 2NQBC 5B0YA 2Y2JA 1ZLAC 4LD9B 1P3FD 5GT3C 3O62A 3REJC 3AZND 1KX5C 4J8VC 3WKJA 4YM6C 4NE5A 4DRAA 5CPKD 3AZLB 3MVDC 3MGSB 1BFMA 2ZY5A 3EPKA 3WA9B 2HIOC 4WU9D 5DNNB 2CV5A 5DNNA 3AYWD 2CV5B 3LZ0C 4J8XB 3UTBB 1M19A 1KX3B 3X1SC 2NZDB 3AV2B 3WAAD 1P3AC 3LJAB 3AZHC 1AOIC 4WJ3C 3X1SA 2HIOD 5AV6A 4WU9C 4KGCC 3AZKC 5B33B 1P3BC 1HTAA 3REKC 5CPJB 3REIA 5F99D 4CSRB 1HQ3A 1KX4A 4H9RA 4HGAC 3X1TA 1U35C 3AZNC 4YM6A 1P3AB 4NE3A 3C1BA 5GT3A 3REHA 3B6GD 1HQ3B 1P34D 3TU4B 1P3KB 4UPKA 1ZLAA 2Y2IA 5B2ID 2F8NA 3W97A 5CPJC 3W96C 5GT3B 3EG5B 5B1MA 3R45A 4WU8B 3C1BD 2Y2QA 1B6WA 5B1MC 4YM6B 5JRGA 1EQZD 3W99A 1M19D 5E5AB 5B40D 3AFAA 1P34C 5BT1C 5C3IC 3B6FC 3AZFB 2FJ7D 4WZSB 4J8XC 1R4VA 3NQUA 4J8UC 2BYKA 5GXQC 5CPKA 3KWQD 2F8NG 3WA9A 3AV2C 3AZID 5AV5D 3O62D 3AZNA 4UUZB 5AV9D 1TAFB 3X1TC 4JJNC 2BYMA 5C3IB 2Y2PA 2Y2LA 3B6FB 4AWLC 3AZKA 1P3BA 5B1LC 2Y2OA 4WU9A 1P3PD 1P3OD 5GT0B 5B32D 3LZ0A 3RELD 2CV5C 1P3FA 5CP6C 4LD9A
chains in the Genus database with same CATH topology
3MVDA 5G49B 3MVDB 2F2AC 5GXQD 4KUDC 1P3FC 1KX5A 4Z5TC 3AZMA 3AN2D 4KGCB 4UUZA 5KDMA 1M1AB 3AZEB 5JA4A 3REKB 5CP6B 5B0ZD 1KU5A 4WU9B 4H9QA 3MNNC 5B1LA 3AZGC 2F8NK 3P5JB 5BO0A 4QLCA 1EQZA 3WAAB 1TZYA 3LZ1A 5B1LB 5B2JA 4H9OB 3AZIA 3A6ND 2BYKB 4R8PA 2XD5A 5CPJD 3REHD 1ID3D 1P3LD 5AVCA 2NQBB 3REID 1HQ3D 1N1JB 1P3KD 5CPJA 3W97C 5B2IB 5F99C 2VQRA 4YS3D 3LZ0D 3X1UD 3UTAD 5AV6B 5KDMB 4HGAB 2RVQD 3VH5T 1U35B 4WU8D 5AV8B 4KUDA 4CAYB 1P3GD 1HQ3C 4H9NB 3WTPB 3AYWC 3MGRC 3X1SB 1KX3C 4JJND 1Z2CB 3MGSD 3NQJB 5BT1D 3B6FD 2YFWB 3WA9D 3B0BA 1KX3A 3MGRA 4XZQA 4Z66A 4J8XD 5CHLB 5BS7A 4X23C 5B1MD 4G92B 3WKJB 3F6TA 3WA9C 3B6GC 3MNNB 3A6NA 3AZGB 5B2IC 5F99B 4ZUXB 4DQYB 2Y2KA 3AFAB 3UT9C 5B40A 4X23B 3W98D 4WU8C 1P3LA 1JFIA 4M6BA 4KGCD 1P34B 1M1AD 5CPIB 2Y2GA 5B2IA 2F8ND 3AV1D 3W97D 3TU4A 1F66A 3UT9B 1TZYD 3LZ1D 3C1BB 3W98C 2IO5C 4YS3C 3KXBD 5E5AD 5B40B 4X23A 5BNVA 5DNMC 3MGPC 2AROB 2NZDA 5AV9C 3X1TD 3REIC 3AZFD 3AV1C 2FJ7B 5B1LD 3MNNA 3A6NB 3AZGA 3MGSA 3C1CD 5B2JB 2F8NH 2RIQA 5AY8D 3MGPB 1KX5D 1M19C 3AZMD 2PYOB 1ULYA 5BO0B 2FJ7C 1P3PB 1PZRA 4XZQD 5B0ZC 4Z66D 4J8UB 2DQNC 3W96D 3AZLA 4ZBJB 5B0ZA 3V9RA 3B0DC 2ZM5A 4Z5TD 3KWQA 1P3ID 3EPLA 3H0MC 4G91B 5AVCB 2NQBA 1B67A 4KUDD 2RVQC 1KX3D 1BH9A 2AROC 3AZHD 3MGPA 2NZDC 5CP6D 3AZFC 3RELC 1P3GC 4J8UA 5B2JC 1F66C 3AZKB 1P3BB 3AZFA 1TZYC 3LZ1C 2AROA 4H9SA 4QLCC 5JRGC 4WU8A 1S32A 3FDDA 1M1AA 3KWQC 5GT3D 3B6GA 1M18D 5JRGB 3C1BC 4QLCB 3LELD 1W2EA 2NQBD 3W98B 3R45B 4H9QB 4WNNA 4XUJB 3AZJB 4LD9D 1KX4C 1ZLAB 4LD9C 5BS7C 3REKA 1P3FB 5AVBB 4ZUXC 3KWQB 2Y2HA 1P3AA 3AN2A 3KUYB 1P3GB 3X1TB 3MGSC 2HUEC 2CV5D 3AYWA 1KX4D 3C1CC 3UTBD 5B33A 5DNNC 5AV9A 5B32C 2YFWA 4Z2MG 3LJAA 5AV8C 3MGPD 5B24B 4YS3A 4J8VA 3KUYC 2PYOD 3KSYA 2HUEB 4E45A 4KHAA 4KHAB 3MGRB 3UTAC 5GXQB 3NQJA 1ID3A 5AVCC 3AZNB 4J8VD 4J8WA 3UT9A 5B31B 4H9NA 5GT0A 3AZEC 1P3KA 4R8PC 1N1JA 3REHC 3AZIC 2NZDD 2YFVB 1M18A 2YFVA 3W99D 5DNMB 5CPID 3MGQA 3LJAC 3AZHB 1U35A 1P3MB 3AV1B 1S32B 3C1CA 4XZQC 4Z66C 4R8PB 1BH8A 2JE5A 3AZHA 4H9OA 3AZIB 3MGQD 1ID3B 4ZUXA 3IP4C 4NFTA 2JCHA 1WWSA 5GSUD 5BNXA 4J8WB 1M18C 2IO5B 5B24A 4YS3B 5AVBC 3REJA 5E5AC 3WKJC 5AY8C 3H0RC 2ZY2A 4H9PB 3MVDD 4CAYA 1P3OC 3VH6A 5B0YB 3REJD 3KFUG 3AN2B 4Z5TB 3H0LC 3X1SD 5AV5B 2L5AA 3UTAA 1P3IB 4JJNB 3KUYD 3X1VB 5B0ZB 4E44A 1P3GA 3AV2D 1P3OB 1A7WA 3KXBA 2BYMB 1AOIB 3B6FA 5AV5A 3A1IA 5B33C 5B24D 3NQUB 1F1EA 3MNND 3AZGD 1P3PA 4ZUXD 4DRBA 3AFAD 1TAFA 5B24C 5B31D 3AZLC 4XUJC 2BG1A 3AZJC 1F66B 2F8NB 5GT0C 5CP6A 3X1UB 2FJ7A 1U35D 2W8SA 1EQZB 3WAAA 5AV6C 4KGCA 3VH5W 5BNVB 4EO5C 3KXBB 1AOIA 3VH6T 3EPHA 1P3MD 3AL0C 5G49A 2G5IC 4Z2MH 4G91C 4R8PD 3AV1A 3REHB 4JJNA 4EO5B 3KXBC 5DNMA 3AV2A 5GXQA 5CPKC 4CSRA 1KX4B 4J8XA 4ZBJC 3WTPE 2DF4C 1P3KC 4WV4B 1Q9CA 5GT0D 2UWXA 4XZQB 4Z66B 3B0DB 4J8UD 3LZ0B 1WWIA 3UTBC 3W96B 3B0CT 5AV6D 3UTAB 1P3IA 2LY8A 1P3LC 3WKJD 5B0YC 5B40C 2ZY4A 5AV8D 1P3IC 5CPKB 3W96A 5B31C 3AZLD 2Y2MA 5DNND 3WTPD 5E5AA 4X23D 4J8VB 3KUYA 5B0YD 3REJB 4KUDB 5AV8A 5BNXB 2ZY3A 3LJAD 3W97B 1H3OB 2HIOB 4WNNB 1P3MA 3W99B 3AN2C 4G92C 1AOID 5B1MB 1P3AD 3LELC 1BH8B 1S32D 2CWEA 2JSSA 3X1UA 2HIOA 2Y2NA 1T3UA 5B2JD 2XD1A 3MGQB 1P3LB 1JFIB 3A1KA 3W98A 3O62C 4YM6D 5JRGD 4H9RB 3TU4C 1M19B 1M1AC 2PYOC 5F99A 1H3OA 1P3PC 1F66D 1ZLAD 5AVBD 1TZYB 3LZ1B 5JA4B 1ID3C 3O62B 1BH9B 5FUGA 3VH5A 5AV9B 3UTBA 3WTPA 3X1VC 3A6NC 3AYWB 3WTPC 1EQZC 5B32A 5B32B 5CPIC 5GSUA 4AWLB 3X1VD 1KX5B 2FFFB 5B33D 3RELB 3AZKD 1P3BD 4H9PA 2J8PA 3B0CW 3MGRD 2PYOA 3WAAC 3B6GB 5B32G 5AY8A 4Z5TA 3AZMC 3V9RB 5AVBA 3TU4D 3AZED 3REKD 4XUJA 3AZJA 4NE6A 3X1UC 5AVCD 5FUGB 4QLCD 3LELB 3LELA 2G5HC 1S32C 5DNMD 4XUJD 3AZJD 3VH6W 1P3MC 3UT9D 5B31G 5GSUC 5AV5C 4H9SC 5CPIA 2AROD 3MGQC 3EPJA 3REIB 3C1CB 3RELA 3X1VA 3AZEA 5AY8B 5B31A 5GSUB 3AFAC 1P34A 4J8WD 3W99C 3AZMB 4J8WC 1M18B 1P3OA 2NQBC 5B0YA 2Y2JA 1ZLAC 4LD9B 1P3FD 5GT3C 3O62A 3REJC 3AZND 1KX5C 4J8VC 3WKJA 4YM6C 4NE5A 4DRAA 5CPKD 3AZLB 3MVDC 3MGSB 1BFMA 2ZY5A 3EPKA 3WA9B 2HIOC 4WU9D 5DNNB 2CV5A 5DNNA 3AYWD 2CV5B 3LZ0C 4J8XB 3UTBB 1M19A 1KX3B 3X1SC 2NZDB 3AV2B 3WAAD 1P3AC 3LJAB 3AZHC 1AOIC 4WJ3C 3X1SA 2HIOD 5AV6A 4WU9C 4KGCC 3AZKC 5B33B 1P3BC 1HTAA 3REKC 5CPJB 3REIA 5F99D 4CSRB 1HQ3A 1KX4A 4H9RA 4HGAC 3X1TA 1U35C 3AZNC 4YM6A 1P3AB 4NE3A 3C1BA 5GT3A 3REHA 3B6GD 1HQ3B 1P34D 3TU4B 1P3KB 4UPKA 1ZLAA 2Y2IA 5B2ID 2F8NA 3W97A 5CPJC 3W96C 5GT3B 3EG5B 5B1MA 3R45A 4WU8B 3C1BD 2Y2QA 1B6WA 5B1MC 4YM6B 5JRGA 1EQZD 3W99A 1M19D 5E5AB 5B40D 3AFAA 1P34C 5BT1C 5C3IC 3B6FC 3AZFB 2FJ7D 4WZSB 4J8XC 1R4VA 3NQUA 4J8UC 2BYKA 5GXQC 5CPKA 3KWQD 2F8NG 3WA9A 3AV2C 3AZID 5AV5D 3O62D 3AZNA 4UUZB 5AV9D 1TAFB 3X1TC 4JJNC 2BYMA 5C3IB 2Y2PA 2Y2LA 3B6FB 4AWLC 3AZKA 1P3BA 5B1LC 2Y2OA 4WU9A 1P3PD 1P3OD 5GT0B 5B32D 3LZ0A 3RELD 2CV5C 1P3FA 5CP6C 4LD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MVD A;  5G49 B;  3MVD B;  5GXQ D;  4KUD C;  1P3F C;  1KX5 A;  4Z5T C;  3AZM A;  3AN2 D;  4KGC B;  4UUZ A;  5KDM A;  1M1A B;  3AZE B;  5JA4 A;  3REK B;  5CP6 B;  5B0Z D;  1KU5 A;  4WU9 B;  4H9Q A;  3MNN C;  5B1L A;  3AZG C;  2F8N K;  5BO0 A;  4QLC A;  1EQZ A;  3WAA B;  1TZY A;  3LZ1 A;  5B1L B;  5B2J A;  4H9O B;  3AZI A;  3A6N D;  2BYK B;  4R8P A;  5CPJ D;  3REH D;  1ID3 D;  1P3L D;  5AVC A;  2NQB B;  3REI D;  1HQ3 D;  1N1J B;  1P3K D;  5CPJ A;  3W97 C;  5B2I B;  5F99 C;  3LZ0 D;  4YS3 D;  3X1U D;  3UTA D;  5AV6 B;  5KDM B;  4HGA B;  2RVQ D;  3VH5 T;  1U35 B;  4WU8 D;  5AV8 B;  4KUD A;  4CAY B;  1P3G D;  1HQ3 C;  4H9N B;  3WTP B;  3AYW C;  3MGR C;  3X1S B;  1KX3 C;  4JJN D;  3MGS D;  3NQJ B;  5BT1 D;  3B6F D;  2YFW B;  3WA9 D;  3B0B A;  1KX3 A;  3MGR A;  4Z66 A;  4XZQ A;  4J8X D;  5CHL B;  5BS7 A;  4X23 C;  5B1M D;  4G92 B;  3WKJ B;  3WA9 C;  3B6G C;  3MNN B;  3A6N A;  3AZG B;  5B2I C;  5F99 B;  4ZUX B;  3UT9 C;  3AFA B;  5B40 A;  4X23 B;  3W98 D;  4WU8 C;  1P3L A;  1JFI A;  4M6B A;  4KGC D;  1P34 B;  1M1A D;  5CPI B;  5B2I A;  2F8N D;  3AV1 D;  3W97 D;  3TU4 A;  1F66 A;  3UT9 B;  1TZY D;  3LZ1 D;  3C1B B;  3W98 C;  2IO5 C;  4YS3 C;  3KXB D;  4X23 A;  5E5A D;  5B40 B;  5BNV A;  5DNM C;  3MGP C;  2ARO B;  2NZD A;  5AV9 C;  3X1T D;  3REI C;  3AZF D;  3AV1 C;  2FJ7 B;  5B1L D;  3MNN A;  3A6N B;  3AZG A;  3MGS A;  3C1C D;  5B2J B;  2F8N H;  5AY8 D;  3MGP B;  1KX5 D;  1M19 C;  3AZM D;  2PYO B;  1ULY A;  5BO0 B;  2FJ7 C;  1P3P B;  4XZQ D;  5B0Z C;  4Z66 D;  4J8U B;  3W96 D;  3AZL A;  4ZBJ B;  5B0Z A;  3V9R A;  3B0D C;  4Z5T D;  3KWQ A;  1P3I D;  4G91 B;  5AVC B;  2NQB A;  1B67 A;  4KUD D;  2RVQ C;  1KX3 D;  1BH9 A;  2ARO C;  3AZH D;  3MGP A;  2NZD C;  5CP6 D;  3AZF C;  3REL C;  1P3G C;  4J8U A;  5B2J C;  1F66 C;  3AZK B;  1P3B B;  3AZF A;  1TZY C;  3LZ1 C;  2ARO A;  4H9S A;  4QLC C;  5JRG C;  4WU8 A;  1S32 A;  1M1A A;  3KWQ C;  5GT3 D;  3B6G A;  1M18 D;  5JRG B;  3C1B C;  4QLC B;  3LEL D;  2NQB D;  3W98 B;  3R45 B;  4H9Q B;  4WNN A;  4XUJ B;  3AZJ B;  4LD9 D;  1KX4 C;  1ZLA B;  4LD9 C;  5BS7 C;  3REK A;  1P3F B;  5AVB B;  4ZUX C;  3KWQ B;  1P3A A;  3AN2 A;  3KUY B;  1P3G B;  3X1T B;  3MGS C;  2HUE C;  2CV5 D;  3AYW A;  1KX4 D;  3C1C C;  3UTB D;  5B33 A;  5DNN C;  5AV9 A;  5B32 C;  2YFW A;  4Z2M G;  3LJA A;  5AV8 C;  3MGP D;  5B24 B;  4YS3 A;  4J8V A;  3KUY C;  2PYO D;  3KSY A;  2HUE B;  4E45 A;  4KHA A;  4KHA B;  3MGR B;  3UTA C;  5GXQ B;  3NQJ A;  1ID3 A;  5AVC C;  3AZN B;  4J8V D;  4J8W A;  3UT9 A;  5B31 B;  4H9N A;  5GT0 A;  3AZE C;  1P3K A;  4R8P C;  1N1J A;  3REH C;  3AZI C;  2NZD D;  2YFV B;  1M18 A;  2YFV A;  3W99 D;  5DNM B;  5CPI D;  3MGQ A;  3LJA C;  3AZH B;  1U35 A;  1P3M B;  3AV1 B;  1S32 B;  3C1C A;  4XZQ C;  4Z66 C;  4R8P B;  1BH8 A;  3AZH A;  4H9O A;  3AZI B;  3MGQ D;  1ID3 B;  4ZUX A;  4NFT A;  1WWS A;  5GSU D;  5BNX A;  4J8W B;  1M18 C;  2IO5 B;  5B24 A;  4YS3 B;  5AVB C;  3REJ A;  5E5A C;  3WKJ C;  5AY8 C;  4H9P B;  3MVD D;  4CAY A;  1P3O C;  3VH6 A;  5B0Y B;  3REJ D;  3AN2 B;  4Z5T B;  3X1S D;  5AV5 B;  2L5A A;  3UTA A;  1P3I B;  4JJN B;  3KUY D;  3X1V B;  5B0Z B;  4E44 A;  1P3G A;  3AV2 D;  1P3O B;  1A7W A;  3KXB A;  2BYM B;  1AOI B;  3B6F A;  5AV5 A;  5B33 C;  5B24 D;  3NQU B;  1F1E A;  3MNN D;  3AZG D;  1P3P A;  4ZUX D;  4DRB A;  3AFA D;  1TAF A;  5B24 C;  5B31 D;  3AZL C;  4XUJ C;  3AZJ C;  1F66 B;  2F8N B;  5GT0 C;  5CP6 A;  3X1U B;  2FJ7 A;  1U35 D;  1EQZ B;  3WAA A;  5AV6 C;  4KGC A;  3VH5 W;  5BNV B;  4EO5 C;  3KXB B;  1AOI A;  3VH6 T;  1P3M D;  5G49 A;  4Z2M H;  4G91 C;  4R8P D;  3AV1 A;  3REH B;  4JJN A;  4EO5 B;  3KXB C;  5DNM A;  3AV2 A;  5GXQ A;  5CPK C;  4CSR A;  1KX4 B;  4J8X A;  4ZBJ C;  3WTP E;  1P3K C;  4WV4 B;  5GT0 D;  1Q9C A;  4XZQ B;  4Z66 B;  4J8U D;  3B0D B;  3UTB C;  3LZ0 B;  1WWI A;  3W96 B;  3B0C T;  5AV6 D;  3UTA B;  1P3I A;  2LY8 A;  1P3L C;  3WKJ D;  5B0Y C;  5B40 C;  5AV8 D;  1P3I C;  5CPK B;  3W96 A;  5B31 C;  3AZL D;  5DNN D;  3WTP D;  5E5A A;  4X23 D;  4J8V B;  3KUY A;  5B0Y D;  3REJ B;  4KUD B;  5AV8 A;  5BNX B;  3LJA D;  3W97 B;  1H3O B;  2HIO B;  4WNN B;  1P3M A;  3W99 B;  3AN2 C;  4G92 C;  1AOI D;  5B1M B;  1P3A D;  3LEL C;  1BH8 B;  1S32 D;  2CWE A;  2JSS A;  3X1U A;  2HIO A;  5B2J D;  3MGQ B;  1P3L B;  1JFI B;  3W98 A;  3O62 C;  4YM6 D;  5JRG D;  4H9R B;  3TU4 C;  1M19 B;  1M1A C;  2PYO C;  5F99 A;  1H3O A;  1P3P C;  1F66 D;  1ZLA D;  5AVB D;  3LZ1 B;  1TZY B;  5JA4 B;  1ID3 C;  3O62 B;  1BH9 B;  5FUG A;  3VH5 A;  5AV9 B;  3UTB A;  3WTP A;  3X1V C;  3A6N C;  3AYW B;  3WTP C;  1EQZ C;  5B32 A;  5B32 B;  5CPI C;  5GSU A;  4AWL B;  3X1V D;  1KX5 B;  5B33 D;  3REL B;  3AZK D;  1P3B D;  4H9P A;  3B0C W;  3MGR D;  2PYO A;  3WAA C;  3B6G B;  5B32 G;  5AY8 A;  4Z5T A;  3AZM C;  3V9R B;  5AVB A;  3TU4 D;  3AZE D;  3REK D;  4XUJ A;  3AZJ A;  4NE6 A;  3X1U C;  5AVC D;  5FUG B;  4QLC D;  3LEL B;  3LEL A;  1S32 C;  5DNM D;  4XUJ D;  3AZJ D;  3VH6 W;  1P3M C;  3UT9 D;  5B31 G;  5GSU C;  5AV5 C;  4H9S C;  5CPI A;  2ARO D;  3MGQ C;  3REI B;  3C1C B;  3REL A;  3X1V A;  3AZE A;  5AY8 B;  5B31 A;  5GSU B;  3AFA C;  1P34 A;  4J8W D;  3W99 C;  3AZM B;  4J8W C;  1M18 B;  1P3O A;  2NQB C;  5B0Y A;  1ZLA C;  4LD9 B;  1P3F D;  5GT3 C;  3O62 A;  3REJ C;  3AZN D;  1KX5 C;  4J8V C;  3WKJ A;  4YM6 C;  4NE5 A;  4DRA A;  5CPK D;  3AZL B;  3MVD C;  3MGS B;  1BFM A;  3WA9 B;  2HIO C;  4WU9 D;  5DNN B;  2CV5 A;  5DNN A;  3AYW D;  2CV5 B;  3LZ0 C;  4J8X B;  3UTB B;  1M19 A;  1KX3 B;  3X1S C;  2NZD B;  3AV2 B;  3WAA D;  1P3A C;  3LJA B;  3AZH C;  1AOI C;  3X1S A;  2HIO D;  5AV6 A;  4WU9 C;  4KGC C;  3AZK C;  5B33 B;  1P3B C;  1HTA A;  3REK C;  5CPJ B;  3REI A;  5F99 D;  4CSR B;  1HQ3 A;  1KX4 A;  4H9R A;  4HGA C;  3X1T A;  1U35 C;  3AZN C;  4YM6 A;  1P3A B;  4NE3 A;  3C1B A;  5GT3 A;  3REH A;  3B6G D;  1HQ3 B;  1P34 D;  3TU4 B;  1P3K B;  1ZLA A;  5B2I D;  2F8N A;  3W97 A;  5CPJ C;  3W96 C;  5GT3 B;  5B1M A;  3R45 A;  4WU8 B;  3C1B D;  1B6W A;  5B1M C;  4YM6 B;  5JRG A;  1EQZ D;  3W99 A;  1M19 D;  5E5A B;  5B40 D;  3AFA A;  1P34 C;  5BT1 C;  5C3I C;  3B6F C;  3AZF B;  2FJ7 D;  4WZS B;  4J8X C;  1R4V A;  3NQU A;  4J8U C;  2BYK A;  5GXQ C;  5CPK A;  3KWQ D;  2F8N G;  3WA9 A;  3AV2 C;  3AZI D;  5AV5 D;  3O62 D;  3AZN A;  4UUZ B;  5AV9 D;  1TAF B;  3X1T C;  4JJN C;  2BYM A;  5C3I B;  3B6F B;  4AWL C;  3AZK A;  1P3B A;  5B1L C;  4WU9 A;  1P3P D;  1P3O D;  5GT0 B;  5B32 D;  3LZ0 A;  3REL D;  2CV5 C;  1P3F A;  5CP6 C;  4LD9 A; 
#chains in the Genus database with same CATH topology
 3MVD A;  5G49 B;  3MVD B;  2F2A C;  5GXQ D;  4KUD C;  1P3F C;  1KX5 A;  4Z5T C;  3AZM A;  3AN2 D;  4KGC B;  4UUZ A;  5KDM A;  1M1A B;  3AZE B;  5JA4 A;  3REK B;  5CP6 B;  5B0Z D;  1KU5 A;  4WU9 B;  4H9Q A;  3MNN C;  5B1L A;  3AZG C;  2F8N K;  3P5J B;  5BO0 A;  4QLC A;  1EQZ A;  3WAA B;  1TZY A;  3LZ1 A;  5B1L B;  5B2J A;  4H9O B;  3AZI A;  3A6N D;  2BYK B;  4R8P A;  2XD5 A;  5CPJ D;  3REH D;  1ID3 D;  1P3L D;  5AVC A;  2NQB B;  3REI D;  1HQ3 D;  1N1J B;  1P3K D;  5CPJ A;  3W97 C;  5B2I B;  5F99 C;  2VQR A;  4YS3 D;  3LZ0 D;  3X1U D;  3UTA D;  5AV6 B;  5KDM B;  4HGA B;  2RVQ D;  3VH5 T;  1U35 B;  4WU8 D;  5AV8 B;  4KUD A;  4CAY B;  1P3G D;  1HQ3 C;  4H9N B;  3WTP B;  3AYW C;  3MGR C;  3X1S B;  1KX3 C;  4JJN D;  1Z2C B;  3MGS D;  3NQJ B;  5BT1 D;  3B6F D;  2YFW B;  3WA9 D;  3B0B A;  1KX3 A;  3MGR A;  4XZQ A;  4Z66 A;  4J8X D;  5CHL B;  5BS7 A;  4X23 C;  5B1M D;  4G92 B;  3WKJ B;  3F6T A;  3WA9 C;  3B6G C;  3MNN B;  3A6N A;  3AZG B;  5B2I C;  5F99 B;  4ZUX B;  4DQY B;  2Y2K A;  3AFA B;  3UT9 C;  5B40 A;  4X23 B;  3W98 D;  4WU8 C;  1P3L A;  1JFI A;  4M6B A;  4KGC D;  1P34 B;  1M1A D;  5CPI B;  2Y2G A;  5B2I A;  2F8N D;  3AV1 D;  3W97 D;  3TU4 A;  1F66 A;  3UT9 B;  1TZY D;  3LZ1 D;  3C1B B;  3W98 C;  2IO5 C;  4YS3 C;  3KXB D;  5E5A D;  5B40 B;  4X23 A;  5BNV A;  5DNM C;  3MGP C;  2ARO B;  2NZD A;  5AV9 C;  3X1T D;  3REI C;  3AZF D;  3AV1 C;  2FJ7 B;  5B1L D;  3MNN A;  3A6N B;  3AZG A;  3MGS A;  3C1C D;  5B2J B;  2F8N H;  2RIQ A;  5AY8 D;  3MGP B;  1KX5 D;  1M19 C;  3AZM D;  2PYO B;  1ULY A;  5BO0 B;  2FJ7 C;  1P3P B;  1PZR A;  4XZQ D;  5B0Z C;  4Z66 D;  4J8U B;  2DQN C;  3W96 D;  3AZL A;  4ZBJ B;  5B0Z A;  3V9R A;  3B0D C;  2ZM5 A;  4Z5T D;  3KWQ A;  1P3I D;  3EPL A;  3H0M C;  4G91 B;  5AVC B;  2NQB A;  1B67 A;  4KUD D;  2RVQ C;  1KX3 D;  1BH9 A;  2ARO C;  3AZH D;  3MGP A;  2NZD C;  5CP6 D;  3AZF C;  3REL C;  1P3G C;  4J8U A;  5B2J C;  1F66 C;  3AZK B;  1P3B B;  3AZF A;  1TZY C;  3LZ1 C;  2ARO A;  4H9S A;  4QLC C;  5JRG C;  4WU8 A;  1S32 A;  3FDD A;  1M1A A;  3KWQ C;  5GT3 D;  3B6G A;  1M18 D;  5JRG B;  3C1B C;  4QLC B;  3LEL D;  1W2E A;  2NQB D;  3W98 B;  3R45 B;  4H9Q B;  4WNN A;  4XUJ B;  3AZJ B;  4LD9 D;  1KX4 C;  1ZLA B;  4LD9 C;  5BS7 C;  3REK A;  1P3F B;  5AVB B;  4ZUX C;  3KWQ B;  2Y2H A;  1P3A A;  3AN2 A;  3KUY B;  1P3G B;  3X1T B;  3MGS C;  2HUE C;  2CV5 D;  3AYW A;  1KX4 D;  3C1C C;  3UTB D;  5B33 A;  5DNN C;  5AV9 A;  5B32 C;  2YFW A;  4Z2M G;  3LJA A;  5AV8 C;  3MGP D;  5B24 B;  4YS3 A;  4J8V A;  3KUY C;  2PYO D;  3KSY A;  2HUE B;  4E45 A;  4KHA A;  4KHA B;  3MGR B;  3UTA C;  5GXQ B;  3NQJ A;  1ID3 A;  5AVC C;  3AZN B;  4J8V D;  4J8W A;  3UT9 A;  5B31 B;  4H9N A;  5GT0 A;  3AZE C;  1P3K A;  4R8P C;  1N1J A;  3REH C;  3AZI C;  2NZD D;  2YFV B;  1M18 A;  2YFV A;  3W99 D;  5DNM B;  5CPI D;  3MGQ A;  3LJA C;  3AZH B;  1U35 A;  1P3M B;  3AV1 B;  1S32 B;  3C1C A;  4XZQ C;  4Z66 C;  4R8P B;  1BH8 A;  2JE5 A;  3AZH A;  4H9O A;  3AZI B;  3MGQ D;  1ID3 B;  4ZUX A;  3IP4 C;  4NFT A;  2JCH A;  1WWS A;  5GSU D;  5BNX A;  4J8W B;  1M18 C;  2IO5 B;  5B24 A;  4YS3 B;  5AVB C;  3REJ A;  5E5A C;  3WKJ C;  5AY8 C;  3H0R C;  2ZY2 A;  4H9P B;  3MVD D;  4CAY A;  1P3O C;  3VH6 A;  5B0Y B;  3REJ D;  3KFU G;  3AN2 B;  4Z5T B;  3H0L C;  3X1S D;  5AV5 B;  2L5A A;  3UTA A;  1P3I B;  4JJN B;  3KUY D;  3X1V B;  5B0Z B;  4E44 A;  1P3G A;  3AV2 D;  1P3O B;  1A7W A;  3KXB A;  2BYM B;  1AOI B;  3B6F A;  5AV5 A;  3A1I A;  5B33 C;  5B24 D;  3NQU B;  1F1E A;  3MNN D;  3AZG D;  1P3P A;  4ZUX D;  4DRB A;  3AFA D;  1TAF A;  5B24 C;  5B31 D;  3AZL C;  4XUJ C;  2BG1 A;  3AZJ C;  1F66 B;  2F8N B;  5GT0 C;  5CP6 A;  3X1U B;  2FJ7 A;  1U35 D;  2W8S A;  1EQZ B;  3WAA A;  5AV6 C;  4KGC A;  3VH5 W;  5BNV B;  4EO5 C;  3KXB B;  1AOI A;  3VH6 T;  3EPH A;  1P3M D;  3AL0 C;  5G49 A;  2G5I C;  4Z2M H;  4G91 C;  4R8P D;  3AV1 A;  3REH B;  4JJN A;  4EO5 B;  3KXB C;  5DNM A;  3AV2 A;  5GXQ A;  5CPK C;  4CSR A;  1KX4 B;  4J8X A;  4ZBJ C;  3WTP E;  2DF4 C;  1P3K C;  4WV4 B;  1Q9C A;  5GT0 D;  2UWX A;  4XZQ B;  4Z66 B;  3B0D B;  4J8U D;  3LZ0 B;  1WWI A;  3UTB C;  3W96 B;  3B0C T;  5AV6 D;  3UTA B;  1P3I A;  2LY8 A;  1P3L C;  3WKJ D;  5B0Y C;  5B40 C;  2ZY4 A;  5AV8 D;  1P3I C;  5CPK B;  3W96 A;  5B31 C;  3AZL D;  2Y2M A;  5DNN D;  3WTP D;  5E5A A;  4X23 D;  4J8V B;  3KUY A;  5B0Y D;  3REJ B;  4KUD B;  5AV8 A;  5BNX B;  2ZY3 A;  3LJA D;  3W97 B;  1H3O B;  2HIO B;  4WNN B;  1P3M A;  3W99 B;  3AN2 C;  4G92 C;  1AOI D;  5B1M B;  1P3A D;  3LEL C;  1BH8 B;  1S32 D;  2CWE A;  2JSS A;  3X1U A;  2HIO A;  2Y2N A;  1T3U A;  5B2J D;  2XD1 A;  3MGQ B;  1P3L B;  1JFI B;  3A1K A;  3W98 A;  3O62 C;  4YM6 D;  5JRG D;  4H9R B;  3TU4 C;  1M19 B;  1M1A C;  2PYO C;  5F99 A;  1H3O A;  1P3P C;  1F66 D;  1ZLA D;  5AVB D;  1TZY B;  3LZ1 B;  5JA4 B;  1ID3 C;  3O62 B;  1BH9 B;  5FUG A;  3VH5 A;  5AV9 B;  3UTB A;  3WTP A;  3X1V C;  3A6N C;  3AYW B;  3WTP C;  1EQZ C;  5B32 A;  5B32 B;  5CPI C;  5GSU A;  4AWL B;  3X1V D;  1KX5 B;  2FFF B;  5B33 D;  3REL B;  3AZK D;  1P3B D;  4H9P A;  2J8P A;  3B0C W;  3MGR D;  2PYO A;  3WAA C;  3B6G B;  5B32 G;  5AY8 A;  4Z5T A;  3AZM C;  3V9R B;  5AVB A;  3TU4 D;  3AZE D;  3REK D;  4XUJ A;  3AZJ A;  4NE6 A;  3X1U C;  5AVC D;  5FUG B;  4QLC D;  3LEL B;  3LEL A;  2G5H C;  1S32 C;  5DNM D;  4XUJ D;  3AZJ D;  3VH6 W;  1P3M C;  3UT9 D;  5B31 G;  5GSU C;  5AV5 C;  4H9S C;  5CPI A;  2ARO D;  3MGQ C;  3EPJ A;  3REI B;  3C1C B;  3REL A;  3X1V A;  3AZE A;  5AY8 B;  5B31 A;  5GSU B;  3AFA C;  1P34 A;  4J8W D;  3W99 C;  3AZM B;  4J8W C;  1M18 B;  1P3O A;  2NQB C;  5B0Y A;  2Y2J A;  1ZLA C;  4LD9 B;  1P3F D;  5GT3 C;  3O62 A;  3REJ C;  3AZN D;  1KX5 C;  4J8V C;  3WKJ A;  4YM6 C;  4NE5 A;  4DRA A;  5CPK D;  3AZL B;  3MVD C;  3MGS B;  1BFM A;  2ZY5 A;  3EPK A;  3WA9 B;  2HIO C;  4WU9 D;  5DNN B;  2CV5 A;  5DNN A;  3AYW D;  2CV5 B;  3LZ0 C;  4J8X B;  3UTB B;  1M19 A;  1KX3 B;  3X1S C;  2NZD B;  3AV2 B;  3WAA D;  1P3A C;  3LJA B;  3AZH C;  1AOI C;  4WJ3 C;  3X1S A;  2HIO D;  5AV6 A;  4WU9 C;  4KGC C;  3AZK C;  5B33 B;  1P3B C;  1HTA A;  3REK C;  5CPJ B;  3REI A;  5F99 D;  4CSR B;  1HQ3 A;  1KX4 A;  4H9R A;  4HGA C;  3X1T A;  1U35 C;  3AZN C;  4YM6 A;  1P3A B;  4NE3 A;  3C1B A;  5GT3 A;  3REH A;  3B6G D;  1HQ3 B;  1P34 D;  3TU4 B;  1P3K B;  4UPK A;  1ZLA A;  2Y2I A;  5B2I D;  2F8N A;  3W97 A;  5CPJ C;  3W96 C;  5GT3 B;  3EG5 B;  5B1M A;  3R45 A;  4WU8 B;  3C1B D;  2Y2Q A;  1B6W A;  5B1M C;  4YM6 B;  5JRG A;  1EQZ D;  3W99 A;  1M19 D;  5E5A B;  5B40 D;  3AFA A;  1P34 C;  5BT1 C;  5C3I C;  3B6F C;  3AZF B;  2FJ7 D;  4WZS B;  4J8X C;  1R4V A;  3NQU A;  4J8U C;  2BYK A;  5GXQ C;  5CPK A;  3KWQ D;  2F8N G;  3WA9 A;  3AV2 C;  3AZI D;  5AV5 D;  3O62 D;  3AZN A;  4UUZ B;  5AV9 D;  1TAF B;  3X1T C;  4JJN C;  2BYM A;  5C3I B;  2Y2P A;  2Y2L A;  3B6F B;  4AWL C;  3AZK A;  1P3B A;  5B1L C;  2Y2O A;  4WU9 A;  1P3P D;  1P3O D;  5GT0 B;  5B32 D;  3LZ0 A;  3REL D;  2CV5 C;  1P3F A;  5CP6 C;  4LD9 A; 
#chains in the Genus database with same CATH homology
 3MVD A;  5G49 B;  3MVD B;  2F2A C;  5GXQ D;  4KUD C;  1P3F C;  1KX5 A;  4Z5T C;  3AZM A;  3AN2 D;  4KGC B;  4UUZ A;  5KDM A;  1M1A B;  3AZE B;  5JA4 A;  3REK B;  5CP6 B;  5B0Z D;  1KU5 A;  4WU9 B;  4H9Q A;  3MNN C;  5B1L A;  3AZG C;  2F8N K;  3P5J B;  5BO0 A;  4QLC A;  1EQZ A;  3WAA B;  1TZY A;  3LZ1 A;  5B1L B;  5B2J A;  4H9O B;  3AZI A;  3A6N D;  2BYK B;  4R8P A;  2XD5 A;  5CPJ D;  3REH D;  1ID3 D;  1P3L D;  5AVC A;  2NQB B;  3REI D;  1HQ3 D;  1N1J B;  1P3K D;  5CPJ A;  3W97 C;  5B2I B;  5F99 C;  2VQR A;  4YS3 D;  3LZ0 D;  3X1U D;  3UTA D;  5AV6 B;  5KDM B;  4HGA B;  2RVQ D;  3VH5 T;  1U35 B;  4WU8 D;  5AV8 B;  4KUD A;  4CAY B;  1P3G D;  1HQ3 C;  4H9N B;  3WTP B;  3AYW C;  3MGR C;  3X1S B;  1KX3 C;  4JJN D;  1Z2C B;  3MGS D;  3NQJ B;  5BT1 D;  3B6F D;  2YFW B;  3WA9 D;  3B0B A;  1KX3 A;  3MGR A;  4XZQ A;  4Z66 A;  4J8X D;  5CHL B;  5BS7 A;  4X23 C;  5B1M D;  4G92 B;  3WKJ B;  3F6T A;  3WA9 C;  3B6G C;  3MNN B;  3A6N A;  3AZG B;  5B2I C;  5F99 B;  4ZUX B;  4DQY B;  2Y2K A;  3AFA B;  3UT9 C;  5B40 A;  4X23 B;  3W98 D;  4WU8 C;  1P3L A;  1JFI A;  4M6B A;  4KGC D;  1P34 B;  1M1A D;  5CPI B;  2Y2G A;  5B2I A;  2F8N D;  3AV1 D;  3W97 D;  3TU4 A;  1F66 A;  3UT9 B;  1TZY D;  3LZ1 D;  3C1B B;  3W98 C;  2IO5 C;  4YS3 C;  3KXB D;  5E5A D;  5B40 B;  4X23 A;  5BNV A;  5DNM C;  3MGP C;  2ARO B;  2NZD A;  5AV9 C;  3X1T D;  3REI C;  3AZF D;  3AV1 C;  2FJ7 B;  5B1L D;  3MNN A;  3A6N B;  3AZG A;  3MGS A;  3C1C D;  5B2J B;  2F8N H;  2RIQ A;  5AY8 D;  3MGP B;  1KX5 D;  1M19 C;  3AZM D;  2PYO B;  1ULY A;  5BO0 B;  2FJ7 C;  1P3P B;  1PZR A;  4XZQ D;  5B0Z C;  4Z66 D;  4J8U B;  2DQN C;  3W96 D;  3AZL A;  4ZBJ B;  5B0Z A;  3V9R A;  3B0D C;  2ZM5 A;  4Z5T D;  3KWQ A;  1P3I D;  3EPL A;  3H0M C;  4G91 B;  5AVC B;  2NQB A;  1B67 A;  4KUD D;  2RVQ C;  1KX3 D;  1BH9 A;  2ARO C;  3AZH D;  3MGP A;  2NZD C;  5CP6 D;  3AZF C;  3REL C;  1P3G C;  4J8U A;  5B2J C;  1F66 C;  3AZK B;  1P3B B;  3AZF A;  1TZY C;  3LZ1 C;  2ARO A;  4H9S A;  4QLC C;  5JRG C;  4WU8 A;  1S32 A;  3FDD A;  1M1A A;  3KWQ C;  5GT3 D;  3B6G A;  1M18 D;  5JRG B;  3C1B C;  4QLC B;  3LEL D;  1W2E A;  2NQB D;  3W98 B;  3R45 B;  4H9Q B;  4WNN A;  4XUJ B;  3AZJ B;  4LD9 D;  1KX4 C;  1ZLA B;  4LD9 C;  5BS7 C;  3REK A;  1P3F B;  5AVB B;  4ZUX C;  3KWQ B;  2Y2H A;  1P3A A;  3AN2 A;  3KUY B;  1P3G B;  3X1T B;  3MGS C;  2HUE C;  2CV5 D;  3AYW A;  1KX4 D;  3C1C C;  3UTB D;  5B33 A;  5DNN C;  5AV9 A;  5B32 C;  2YFW A;  4Z2M G;  3LJA A;  5AV8 C;  3MGP D;  5B24 B;  4YS3 A;  4J8V A;  3KUY C;  2PYO D;  3KSY A;  2HUE B;  4E45 A;  4KHA A;  4KHA B;  3MGR B;  3UTA C;  5GXQ B;  3NQJ A;  1ID3 A;  5AVC C;  3AZN B;  4J8V D;  4J8W A;  3UT9 A;  5B31 B;  4H9N A;  5GT0 A;  3AZE C;  1P3K A;  4R8P C;  1N1J A;  3REH C;  3AZI C;  2NZD D;  2YFV B;  1M18 A;  2YFV A;  3W99 D;  5DNM B;  5CPI D;  3MGQ A;  3LJA C;  3AZH B;  1U35 A;  1P3M B;  3AV1 B;  1S32 B;  3C1C A;  4XZQ C;  4Z66 C;  4R8P B;  1BH8 A;  2JE5 A;  3AZH A;  4H9O A;  3AZI B;  3MGQ D;  1ID3 B;  4ZUX A;  3IP4 C;  4NFT A;  2JCH A;  1WWS A;  5GSU D;  5BNX A;  4J8W B;  1M18 C;  2IO5 B;  5B24 A;  4YS3 B;  5AVB C;  3REJ A;  5E5A C;  3WKJ C;  5AY8 C;  3H0R C;  2ZY2 A;  4H9P B;  3MVD D;  4CAY A;  1P3O C;  3VH6 A;  5B0Y B;  3REJ D;  3KFU G;  3AN2 B;  4Z5T B;  3H0L C;  3X1S D;  5AV5 B;  2L5A A;  3UTA A;  1P3I B;  4JJN B;  3KUY D;  3X1V B;  5B0Z B;  4E44 A;  1P3G A;  3AV2 D;  1P3O B;  1A7W A;  3KXB A;  2BYM B;  1AOI B;  3B6F A;  5AV5 A;  3A1I A;  5B33 C;  5B24 D;  3NQU B;  1F1E A;  3MNN D;  3AZG D;  1P3P A;  4ZUX D;  4DRB A;  3AFA D;  1TAF A;  5B24 C;  5B31 D;  3AZL C;  4XUJ C;  2BG1 A;  3AZJ C;  1F66 B;  2F8N B;  5GT0 C;  5CP6 A;  3X1U B;  2FJ7 A;  1U35 D;  2W8S A;  1EQZ B;  3WAA A;  5AV6 C;  4KGC A;  3VH5 W;  5BNV B;  4EO5 C;  3KXB B;  1AOI A;  3VH6 T;  3EPH A;  1P3M D;  3AL0 C;  5G49 A;  2G5I C;  4Z2M H;  4G91 C;  4R8P D;  3AV1 A;  3REH B;  4JJN A;  4EO5 B;  3KXB C;  5DNM A;  3AV2 A;  5GXQ A;  5CPK C;  4CSR A;  1KX4 B;  4J8X A;  4ZBJ C;  3WTP E;  2DF4 C;  1P3K C;  4WV4 B;  1Q9C A;  5GT0 D;  2UWX A;  4XZQ B;  4Z66 B;  3B0D B;  4J8U D;  3LZ0 B;  1WWI A;  3UTB C;  3W96 B;  3B0C T;  5AV6 D;  3UTA B;  1P3I A;  2LY8 A;  1P3L C;  3WKJ D;  5B0Y C;  5B40 C;  2ZY4 A;  5AV8 D;  1P3I C;  5CPK B;  3W96 A;  5B31 C;  3AZL D;  2Y2M A;  5DNN D;  3WTP D;  5E5A A;  4X23 D;  4J8V B;  3KUY A;  5B0Y D;  3REJ B;  4KUD B;  5AV8 A;  5BNX B;  2ZY3 A;  3LJA D;  3W97 B;  1H3O B;  2HIO B;  4WNN B;  1P3M A;  3W99 B;  3AN2 C;  4G92 C;  1AOI D;  5B1M B;  1P3A D;  3LEL C;  1BH8 B;  1S32 D;  2CWE A;  2JSS A;  3X1U A;  2HIO A;  2Y2N A;  1T3U A;  5B2J D;  2XD1 A;  3MGQ B;  1P3L B;  1JFI B;  3A1K A;  3W98 A;  3O62 C;  4YM6 D;  5JRG D;  4H9R B;  3TU4 C;  1M19 B;  1M1A C;  2PYO C;  5F99 A;  1H3O A;  1P3P C;  1F66 D;  1ZLA D;  5AVB D;  1TZY B;  3LZ1 B;  5JA4 B;  1ID3 C;  3O62 B;  1BH9 B;  5FUG A;  3VH5 A;  5AV9 B;  3UTB A;  3WTP A;  3X1V C;  3A6N C;  3AYW B;  3WTP C;  1EQZ C;  5B32 A;  5B32 B;  5CPI C;  5GSU A;  4AWL B;  3X1V D;  1KX5 B;  2FFF B;  5B33 D;  3REL B;  3AZK D;  1P3B D;  4H9P A;  2J8P A;  3B0C W;  3MGR D;  2PYO A;  3WAA C;  3B6G B;  5B32 G;  5AY8 A;  4Z5T A;  3AZM C;  3V9R B;  5AVB A;  3TU4 D;  3AZE D;  3REK D;  4XUJ A;  3AZJ A;  4NE6 A;  3X1U C;  5AVC D;  5FUG B;  4QLC D;  3LEL B;  3LEL A;  2G5H C;  1S32 C;  5DNM D;  4XUJ D;  3AZJ D;  3VH6 W;  1P3M C;  3UT9 D;  5B31 G;  5GSU C;  5AV5 C;  4H9S C;  5CPI A;  2ARO D;  3MGQ C;  3EPJ A;  3REI B;  3C1C B;  3REL A;  3X1V A;  3AZE A;  5AY8 B;  5B31 A;  5GSU B;  3AFA C;  1P34 A;  4J8W D;  3W99 C;  3AZM B;  4J8W C;  1M18 B;  1P3O A;  2NQB C;  5B0Y A;  2Y2J A;  1ZLA C;  4LD9 B;  1P3F D;  5GT3 C;  3O62 A;  3REJ C;  3AZN D;  1KX5 C;  4J8V C;  3WKJ A;  4YM6 C;  4NE5 A;  4DRA A;  5CPK D;  3AZL B;  3MVD C;  3MGS B;  1BFM A;  2ZY5 A;  3EPK A;  3WA9 B;  2HIO C;  4WU9 D;  5DNN B;  2CV5 A;  5DNN A;  3AYW D;  2CV5 B;  3LZ0 C;  4J8X B;  3UTB B;  1M19 A;  1KX3 B;  3X1S C;  2NZD B;  3AV2 B;  3WAA D;  1P3A C;  3LJA B;  3AZH C;  1AOI C;  4WJ3 C;  3X1S A;  2HIO D;  5AV6 A;  4WU9 C;  4KGC C;  3AZK C;  5B33 B;  1P3B C;  1HTA A;  3REK C;  5CPJ B;  3REI A;  5F99 D;  4CSR B;  1HQ3 A;  1KX4 A;  4H9R A;  4HGA C;  3X1T A;  1U35 C;  3AZN C;  4YM6 A;  1P3A B;  4NE3 A;  3C1B A;  5GT3 A;  3REH A;  3B6G D;  1HQ3 B;  1P34 D;  3TU4 B;  1P3K B;  4UPK A;  1ZLA A;  2Y2I A;  5B2I D;  2F8N A;  3W97 A;  5CPJ C;  3W96 C;  5GT3 B;  3EG5 B;  5B1M A;  3R45 A;  4WU8 B;  3C1B D;  2Y2Q A;  1B6W A;  5B1M C;  4YM6 B;  5JRG A;  1EQZ D;  3W99 A;  1M19 D;  5E5A B;  5B40 D;  3AFA A;  1P34 C;  5BT1 C;  5C3I C;  3B6F C;  3AZF B;  2FJ7 D;  4WZS B;  4J8X C;  1R4V A;  3NQU A;  4J8U C;  2BYK A;  5GXQ C;  5CPK A;  3KWQ D;  2F8N G;  3WA9 A;  3AV2 C;  3AZI D;  5AV5 D;  3O62 D;  3AZN A;  4UUZ B;  5AV9 D;  1TAF B;  3X1T C;  4JJN C;  2BYM A;  5C3I B;  2Y2P A;  2Y2L A;  3B6F B;  4AWL C;  3AZK A;  1P3B A;  5B1L C;  2Y2O A;  4WU9 A;  1P3P D;  1P3O D;  5GT0 B;  5B32 D;  3LZ0 A;  3REL D;  2CV5 C;  1P3F A;  5CP6 C;  4LD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...