2NZDA

Nucleosome core particle containing 145 bp of dna
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (145-MER)
publication title DNA stretching and extreme kinking in the nucleosome core
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2nzdA00
3MGQC 3C1CD 4J8WC 4Z5TA 1P3KC 5AV8A 1TZYB 3AV1C 1B67A 1Q9CA 2LY8A 1KX3C 4J8UC 3REHB 1P3PC 3VH6T 3VH6W 4KUDA 5AVCC 5AV5B 1P3FC 1KU5A 2AROB 4ZBJB 3REIC 3AN2C 3WTPE 3MGRB 3KXBC 3RELD 2HIOB 3LZ0A 3MNNC 3V9RB 2FJ7D 5B1LD 1ZLAA 3W97B 1TZYC 3LELB 5AVBA 1EQZB 4H9SA 5JRGB 5AV6D 3B0DB 4YM6A 5B24A 1M18A 1F66D 3REHC 4QLCA 4CAYB 3UT9B 3AZJB 5AV5C 4YM6D 5AV9B 1M18D 3AZNA 2AROC 3W99D 4J8XA 4Z66A 4ZBJC 5B32B 3REKA 5B31B 4EO5B 3AZND 3MGRC 3REKD 2HIOC 2BYMB 5DNMA 4DRAA 4WU9B 3WKJB 3W97C 3W98D 1ID3D 1S32D 5DNMD 5GT3B 3X1TA 3LELC 1KX5D 1EQZC 3AV2B 5JRGC 5B2IB 3B0DC 4XUJB 5JA4A 4WNNB 3UT9C 3AZJC 3AZEA 1TAFB 5AV9C 5GSUD 4WU8A 4X23B 5CPKA 5B32C 5B31C 5DNND 5B0ZB 3AZED 1P3GA 4EO5C 3KUYA 1P3LB 1HTAA 4WU8D 3MGPB 1WWSA 3O62A 4WU9C 5E5AA 3LZ1A 3AFAA 3MVDA 3WKJC 5B0YB 4KGCA 1BH9A 3O62D 5GT3C 5B2JD 5E5AD 3LZ1D 5B40A 3AV2C 1HQ3B 3REJB 5B2IC 3AZHA 1M19D 1P3BD 3WTPB 5F99A 4XUJC 4KGCD 5BO0B 4J8VD 3AZGD 3WAAA 1P34A 4NE6A 3X1UB 5BS7A 3B6GB 3AZHD 4LD9B 3AZLD 4X23C 5CP6A 1P3OB 4JJNA 2YFWA 5B0ZC 3AZMB 5AY8B 3TU4A 4R8PD 1P3LC 3MGPC 2RVQD 3X1VB 1AOID 1BH8A 1M1AB 5BNXB 3TU4D 5BNVA 5B0YC 3B6FB 3A6NA 1U35A 1P3IB 2CV5B 3AZIB 5GT0D 1HQ3C 1F1EA 3REJC 2PYOD 3WTPC 4WV4B 1KX4A 4Z2MH 1A7WA 5GXQB 3X1UC 5CPID 2IO5B 3UTBA 3B6GC 3UTAA 4LD9C 1P3OC 4Z5TB 5AV8B 3C1BA 3AZMC 5AY8C 3X1VC 1M1AC 4KHAA 1N1JA 4KUDB 3AZKA 4G91B 1JFIA 3KWQD 3C1CA 2NZDA 3B6FC 1P3IC 4NE3A 4YS3D 3AZIC 2CV5C 1WWIA 3R45B 2NZDD 3W96B 4H9RB 2NQBD 5GXQC 3LZ0B 3LJAB 3AZFA 2IO5C 1ZLAB 3X1SD 4XZQD 3AZFD 4Z5TC 5AV8C 4UUZA 3NQJA 5AVBB 3RELA 1M18B 5B24B 2FJ7A 5CPJD 4QLCB 4KUDC 5B1LA 4G91C 3MGQD 4J8UA 3AV1D 4G92B 1H3OA 4J8XB 4Z66B 3REKB 2F8ND 1KX3D 4WZSB 1P3FA 4J8UD 1P3PD 5AV6A 3W96C 1F66A 4NE5A 3LZ0C 4M6BA 3LJAC 1P3FD 5DNMB 4DRBA 2HUEB 1ZLAC 2CWEA 3W99A 3AN2D 3KXBD 3X1TB 5AVBC 5BT1C 3MNND 1M18C 5B24C 4QLCC 5JA4B 3NQUA 3AZEB 3REHA 3W98A 4G92C 1P3AB 1S32A 1ID3A 5CPKB 4J8XC 4Z66C 3REKC 1KX5A 1P3GB 3REHD 3KUYB 5B1MB 1ULYA 2JSSA 2AROD 5DNMC 5GSUA 2HUEC 5E5AB 3LZ1B 3MVDB 3AFAB 5DNNA 3MGRD 3X1TC 2HIOD 5B40B 3AZHB 5F99B 5C3IB 3LELA 3WAAB 1EQZA 1P34B 3WA9B 3AZEC 3VH5T 3VH5W 3VH6A 3LELD 1P3AC 5CP6B 4CSRB 1EQZD 5CPKC 5B2JA 4JJNB 5JRGD 5B33B 2YFWB 5AV9A 1P3GC 3TU4B 3KUYC 1M19A 5B1MC 1P3BA 5G49B 4J8VA 3AZGA 4ZUXB 3AZJD 5AV9D 5E5AC 2BYKA 3LZ1C 3AFAC 5BNVB 5B32D 3MVDC 5B31D 3AZLA 3A6NB 1U35B 2F8NG 4R8PA 5B40C 3AZHC 1AOIA 5F99C 5C3IC 4WU9D 3WAAC 1KX4B 5KDMA 4AWLB 3B0CT 3B0CW 1P34C 3WKJD 3WA9C 5B2IA 3UTBB 5BS7C 3UTAB 5CP6C 3AV2D 4JJNC 5B2ID 5GT0A 5B33C 4XUJD 3C1BB 3TU4C 3AYWB 2PYOA 2YFVA 4H9NA 4ZUXC 1P3MA 4NFTA 5CPIA 4X23D 4H9PA 3AZKB 4E44A 5FUGB 4H9QA 1P3MD 3C1CB 5B0ZD 3A6NC 1U35C 1P3LD 1KX4C 4AWLC 3REJA 3UTBC 3WTPA 3KWQA 3UTAC 5BO0A 4H9OA 4YS3A 1HQ3D 3REJD 4UUZB 3NQJB 3B6GA 3WTPD 3C1BC 3AYWC 3RELB 1P3OA 2NQBA 3X1UD 2FJ7B 3B6GD 4LD9D 5B1LB 3AZKC 3X1SA 1P3OD 4XZQA 3C1CC 3AZMD 5AY8D 3X1VD 3B6FA 5AV6B 3MGSA 1F66B 2CV5A 5CPJA 4HGAB 3MGQA 4J8WA 1P3KA 3B6FD 4YM6B 3MGSD 1P3ID 5B32G 3AV1A 2CV5D 3AZID 3W99B 2F8NA 1KX3A 4J8WD 1P3KD 1P3PA 3AZNB 5GXQD 3RELC 5AVCA 2FJ7C 5B1LC 3NQUB 3REIA 4Z5TD 5AV8D 5AVCD 3W98B 3AN2A 1ID3B 1S32B 3KXBA 1KX5B 3REID 3MNNA 5AV6C 4KUDD 1F66C 3R45A 4HGAC 4H9SC 3W96A 4H9RA 4YM6C 1TZYA 5GSUB 3W99C 3LJAA 5DNNB 3W96D 1TZYD 3AZNC 4WU8B 3LZ0D 3LJAD 5AV5A 2AROA 1ZLAD 3W98C 5AV5D 5AVBD 1S32C 1ID3C 3MGRA 5BT1D 3O62B 5B2JB 1KX5C 2HIOA 5B24D 3V9RA 4QLCD 1M19B 4KGCB 1P3BB 1BH9B 4J8VB 3AZGB 3W97A 5GSUC 4J8XD 2BYKB 4Z66D 3AZLB 4E45A 3W97D 2F8NK 5JRGA 5DNNC 4R8PB 4WU8C 4CAYA 3UT9A 3AZJA 1AOIB 5KDMB 5B32A 3UT9D 5B31A 1BH8B 3X1TD 3O62C 5B2JC 5GT0B 1P3AA 1M19C 2BYMA 2YFVB 4H9NB 1P3BC 2PYOB 4WU9A 4KGCC 4J8VC 3AZGC 1P3MB 3WKJA 5CPIB 5B1MA 1R4VA 1P3AD 4H9PB 5CPKD 5GT3A 3AZLC 4H9QB 3AV2A 1P3GD 3KUYD 5B1MD 4XUJA 4R8PC 5GT3D 5CPJC 2RVQC 4WNNA 1AOIC 1TAFA 4Z2MG 3AFAD 3MVDD 4X23A 3KWQB 5B0ZA 4H9OB 4KHAB 1N1JB 1P3LA 4YS3B 3MGPA 5B40D 3WA9A 5GT0C 1JFIB 5F99D 3KSYA 2NZDB 3WAAD 2PYOC 4CSRA 2NQBB 1P34D 3MGPD 3WA9D 5B33A 1P3MC 5B0YA 5CPIC 5CHLB 5G49A 5CP6D 2F8NH 3X1SB 4ZUXA 4JJND 4XZQB 5B33D 3AZFB 1HQ3A 5B0YD 4ZUXD 3X1UA 3MGSB 5CPJB 4LD9A 3MGQB 4J8WB 1P3KB 3A6ND 1U35D 3KWQC 3AV1B 1B6WA 3AZMA 3B0BA 5AY8A 4YS3C 2F8NB 1KX3B 3VH5A 3X1VA 4J8UB 1M1AA 1P3PB 2NZDC 2L5AA 1KX4D 1BFMA 1H3OB 5BNXA 2NQBC 5AVCB 3UTBD 1P3FB 3UTAD 1M1AD 3AYWA 1P3IA 3AZIA 3REIB 3X1SC 4XZQC 3AZFC 3C1BD 3AN2B 3AYWD 3KXBB 5FUGA 5B31G 5GXQA 3MNNB 3MGSC 3AZKD
chains in the Genus database with same CATH superfamily
2ZY5A 1T3UA 3MGQC 3EPKA 3FDDA 4Z5TA 3C1CD 4J8WC 5AV8A 1TZYB 2Y2GA 1P3KC 3AV1C 1B67A 1Q9CA 2LY8A 1KX3C 4J8UC 3REHB 1P3PC 3VH6T 3VH6W 4KUDA 5AVCC 5AV5B 1P3FC 1KU5A 2AROB 4ZBJB 3REIC 3AN2C 3WTPE 3MGRB 3KXBC 3RELD 2HIOB 3LZ0A 3MNNC 3V9RB 2FJ7D 5B1LD 1ZLAA 3W97B 1TZYC 3LELB 5AVBA 1EQZB 4H9SA 5JRGB 5AV6D 3B0DB 4YM6A 5B24A 1M18A 1F66D 3REHC 4QLCA 4CAYB 3UT9B 3AZJB 5AV5C 4YM6D 5AV9B 1M18D 3AZNA 2AROC 3W99D 4J8XA 4Z66A 4ZBJC 5B32B 3REKA 5B31B 4EO5B 3AZND 2G5IC 3MGRC 3REKD 2HIOC 3IP4C 2BYMB 5DNMA 4DRAA 4WU9B 3WKJB 3W97C 3W98D 1ID3D 1S32D 5DNMD 2Y2LA 5GT3B 3X1TA 3LELC 1KX5D 1EQZC 3AV2B 5JRGC 5B2IB 3B0DC 4XUJB 5JA4A 4WNNB 3UT9C 3AZJC 3AZEA 1TAFB 5AV9C 5GSUD 4WU8A 4X23B 2JCHA 5CPKA 5B32C 5B31C 5DNND 5B0ZB 3AZED 1P3GA 4EO5C 3KUYA 1P3LB 1HTAA 4WU8D 3MGPB 3H0RC 1WWSA 3O62A 4WU9C 5E5AA 3LZ1A 3AFAA 3MVDA 3WKJC 5B0YB 4KGCA 1BH9A 3O62D 5GT3C 5B2JD 5E5AD 3LZ1D 2XD5A 5B40A 3AV2C 1HQ3B 3REJB 5B2IC 3AZHA 1M19D 1P3BD 3WTPB 5F99A 4XUJC 4KGCD 5BO0B 2W8SA 4J8VD 3AZGD 3WAAA 1P34A 4NE6A 3X1UB 5BS7A 3B6GB 3AZHD 4LD9B 3AZLD 4X23C 5CP6A 1P3OB 4JJNA 2YFWA 5B0ZC 3AZMB 5AY8B 3TU4A 4R8PD 1P3LC 3MGPC 2RVQD 3X1VB 1AOID 1BH8A 3A1KA 1M1AB 3EPJA 5BNXB 3TU4D 5BNVA 5B0YC 3B6FB 3A6NA 1U35A 1P3IB 2CV5B 3AZIB 5GT0D 1HQ3C 1F1EA 3REJC 2PYOD 3WTPC 2ZY3A 4WV4B 1KX4A 4Z2MH 1A7WA 5GXQB 3X1UC 5CPID 2IO5B 3UTBA 3B6GC 3UTAA 4LD9C 1P3OC 4Z5TB 5AV8B 3F6TA 3C1BA 3AZMC 5AY8C 2UWXA 3X1VC 1M1AC 2Y2PA 4KHAA 1N1JA 4KUDB 3AZKA 4G91B 1JFIA 3KWQD 3C1CA 2NZDA 3B6FC 1P3IC 4NE3A 4YS3D 3AZIC 2CV5C 1WWIA 3R45B 2NZDD 3W96B 4H9RB 2NQBD 5GXQC 3LZ0B 3LJAB 3AZFA 2IO5C 1ZLAB 3X1SD 4XZQD 3AZFD 4Z5TC 5AV8C 4UUZA 3NQJA 5AVBB 3RELA 1M18B 5B24B 2FJ7A 5CPJD 4QLCB 4KUDC 5B1LA 4G91C 3MGQD 4J8UA 3AV1D 4G92B 1H3OA 4J8XB 4Z66B 3REKB 2F8ND 1KX3D 4WZSB 1P3FA 4J8UD 1P3PD 5AV6A 1PZRA 3W96C 1F66A 4NE5A 3LZ0C 4M6BA 3LJAC 1P3FD 5DNMB 4DRBA 2HUEB 1ZLAC 2CWEA 2G5HC 3W99A 3AN2D 3KXBD 3X1TB 5AVBC 5BT1C 3MNND 1M18C 3EPLA 5B24C 4QLCC 5JA4B 3NQUA 3AZEB 3REHA 3W98A 4G92C 2RIQA 1S32A 1P3AB 1ID3A 5CPKB 4J8XC 4Z66C 3REKC 1KX5A 2Y2QA 1P3GB 3REHD 3KUYB 5B1MB 1ULYA 2JSSA 2AROD 5DNMC 5GSUA 2HUEC 5E5AB 3LZ1B 3MVDB 3AFAB 5DNNA 3MGRD 3X1TC 2HIOD 5B40B 3AZHB 3H0LC 5F99B 5C3IB 3LELA 3WAAB 1EQZA 3P5JB 1P34B 3WA9B 3AZEC 3VH5T 3VH5W 3VH6A 3LELD 1P3AC 5CP6B 4CSRB 1EQZD 5CPKC 5B2JA 4JJNB 5JRGD 5B33B 2YFWB 5AV9A 1P3GC 3TU4B 3KUYC 1M19A 5B1MC 1P3BA 3AL0C 5G49B 1Z2CB 4J8VA 3AZGA 4ZUXB 3AZJD 5AV9D 4DQYB 5E5AC 2BYKA 3LZ1C 3AFAC 5BNVB 5B32D 3MVDC 5B31D 3AZLA 3A6NB 1U35B 2F8NG 4R8PA 5B40C 3AZHC 1AOIA 5F99C 5C3IC 4WU9D 3WAAC 1KX4B 5KDMA 4AWLB 3B0CT 3B0CW 1P34C 3WKJD 2DQNC 3WA9C 5B2IA 3UTBB 5BS7C 3UTAB 3EPHA 5CP6C 3AV2D 4JJNC 5B2ID 5GT0A 5B33C 4XUJD 3C1BB 3TU4C 3AYWB 2PYOA 2YFVA 4H9NA 4ZUXC 1P3MA 4NFTA 5CPIA 4X23D 4H9PA 3AZKB 4E44A 5FUGB 4H9QA 1P3MD 3C1CB 5B0ZD 3A6NC 1U35C 1P3LD 2FFFB 1KX4C 4AWLC 3REJA 3UTBC 3WTPA 3KWQA 3UTAC 5BO0A 2J8PA 4H9OA 4YS3A 1HQ3D 3REJD 4UUZB 3NQJB 3B6GA 3WTPD 3C1BC 2Y2OA 3AYWC 3RELB 1P3OA 2NQBA 3X1UD 2FJ7B 3B6GD 4LD9D 5B1LB 3AZKC 4UPKA 3X1SA 1P3OD 4XZQA 2F2AC 3C1CC 3AZMD 5AY8D 3X1VD 3B6FA 5AV6B 3MGSA 1F66B 2CV5A 5CPJA 4HGAB 3MGQA 4J8WA 1P3KA 3B6FD 4YM6B 3MGSD 1P3ID 5B32G 3AV1A 2CV5D 3AZID 3W99B 2F8NA 1KX3A 4J8WD 1P3KD 1P3PA 3AZNB 5GXQD 3RELC 5AVCA 2FJ7C 5B1LC 3NQUB 3REIA 4Z5TD 5AV8D 5AVCD 3W98B 3AN2A 1ID3B 1S32B 3KXBA 1KX5B 3REID 3MNNA 5AV6C 4KUDD 1F66C 3R45A 4HGAC 4H9SC 3W96A 4H9RA 4YM6C 1TZYA 3EG5B 5GSUB 3H0MC 3W99C 3LJAA 2ZY4A 2DF4C 5DNNB 3W96D 1TZYD 3AZNC 4WU8B 3LZ0D 3LJAD 5AV5A 2AROA 1ZLAD 2Y2HA 3W98C 5AV5D 5AVBD 1S32C 1ID3C 3MGRA 5BT1D 2Y2JA 2Y2KA 5B2JB 3O62B 1KX5C 2HIOA 5B24D 3V9RA 4QLCD 1M19B 4KGCB 1P3BB 1BH9B 4J8VB 3AZGB 3W97A 5GSUC 4J8XD 2BYKB 4Z66D 3AZLB 4E45A 3W97D 2F8NK 5JRGA 5DNNC 4R8PB 4WU8C 4CAYA 3UT9A 3AZJA 1AOIB 2Y2MA 5KDMB 5B32A 3UT9D 5B31A 1BH8B 2JE5A 3X1TD 3O62C 3A1IA 5B2JC 5GT0B 2BG1A 1P3AA 1M19C 2BYMA 2YFVB 4H9NB 1P3BC 2PYOB 4WU9A 4KGCC 4J8VC 3AZGC 1P3MB 3WKJA 5CPIB 2Y2NA 5B1MA 1R4VA 1P3AD 4H9PB 5CPKD 5GT3A 3AZLC 4H9QB 3AV2A 1P3GD 3KUYD 5B1MD 4XUJA 4WJ3C 4R8PC 5GT3D 5CPJC 2RVQC 4WNNA 1AOIC 1TAFA 4Z2MG 3AFAD 3MVDD 4X23A 3KWQB 5B0ZA 4H9OB 4KHAB 1N1JB 1P3LA 4YS3B 3MGPA 5B40D 3WA9A 2ZM5A 5GT0C 1JFIB 5F99D 3KSYA 2NZDB 3WAAD 2PYOC 4CSRA 2NQBB 1P34D 3MGPD 3WA9D 5B33A 1P3MC 5B0YA 5CPIC 2ZY2A 5CHLB 5G49A 5CP6D 2F8NH 3X1SB 4ZUXA 4JJND 4XZQB 2XD1A 5B33D 3AZFB 1HQ3A 5B0YD 4ZUXD 3X1UA 3MGSB 5CPJB 4LD9A 3MGQB 4J8WB 1W2EA 1P3KB 3A6ND 1U35D 3KWQC 3AV1B 1B6WA 3AZMA 3B0BA 5AY8A 4YS3C 2F8NB 1KX3B 3VH5A 3X1VA 4J8UB 1M1AA 1P3PB 2NZDC 2L5AA 1KX4D 1BFMA 1H3OB 5BNXA 2NQBC 5AVCB 3UTBD 1P3FB 3UTAD 1M1AD 3AYWA 1P3IA 3KFUG 2Y2IA 3AZIA 3REIB 3X1SC 4XZQC 3AZFC 3C1BD 3AN2B 3AYWD 3KXBB 5FUGA 5B31G 2VQRA 5GXQA 3MNNB 3MGSC 3AZKD
chains in the Genus database with same CATH topology
2ZY5A 1T3UA 3MGQC 3EPKA 3FDDA 4Z5TA 3C1CD 4J8WC 5AV8A 1TZYB 2Y2GA 1P3KC 3AV1C 1B67A 1Q9CA 2LY8A 1KX3C 4J8UC 3REHB 1P3PC 3VH6T 3VH6W 4KUDA 5AVCC 5AV5B 1P3FC 1KU5A 2AROB 4ZBJB 3REIC 3AN2C 3WTPE 3MGRB 3KXBC 3RELD 2HIOB 3LZ0A 3MNNC 3V9RB 2FJ7D 5B1LD 1ZLAA 3W97B 1TZYC 3LELB 5AVBA 1EQZB 4H9SA 5JRGB 5AV6D 3B0DB 4YM6A 5B24A 1M18A 1F66D 3REHC 4QLCA 4CAYB 3UT9B 3AZJB 5AV5C 4YM6D 5AV9B 1M18D 3AZNA 2AROC 3W99D 4J8XA 4Z66A 4ZBJC 5B32B 3REKA 5B31B 4EO5B 3AZND 2G5IC 3MGRC 3REKD 2HIOC 3IP4C 2BYMB 5DNMA 4DRAA 4WU9B 3WKJB 3W97C 3W98D 1ID3D 1S32D 5DNMD 2Y2LA 5GT3B 3X1TA 3LELC 1KX5D 1EQZC 3AV2B 5JRGC 5B2IB 3B0DC 4XUJB 5JA4A 4WNNB 3UT9C 3AZJC 3AZEA 1TAFB 5AV9C 5GSUD 4WU8A 4X23B 2JCHA 5CPKA 5B32C 5B31C 5DNND 5B0ZB 3AZED 1P3GA 4EO5C 3KUYA 1P3LB 1HTAA 4WU8D 3MGPB 3H0RC 1WWSA 3O62A 4WU9C 5E5AA 3LZ1A 3AFAA 3MVDA 3WKJC 5B0YB 4KGCA 1BH9A 3O62D 5GT3C 5B2JD 5E5AD 3LZ1D 2XD5A 5B40A 3AV2C 1HQ3B 3REJB 5B2IC 3AZHA 1M19D 1P3BD 3WTPB 5F99A 4XUJC 4KGCD 5BO0B 2W8SA 4J8VD 3AZGD 3WAAA 1P34A 4NE6A 3X1UB 5BS7A 3B6GB 3AZHD 4LD9B 3AZLD 4X23C 5CP6A 1P3OB 4JJNA 2YFWA 5B0ZC 3AZMB 5AY8B 3TU4A 4R8PD 1P3LC 3MGPC 2RVQD 3X1VB 1AOID 1BH8A 3A1KA 1M1AB 3EPJA 5BNXB 3TU4D 5BNVA 5B0YC 3B6FB 3A6NA 1U35A 1P3IB 2CV5B 3AZIB 5GT0D 1HQ3C 1F1EA 3REJC 2PYOD 3WTPC 2ZY3A 4WV4B 1KX4A 4Z2MH 1A7WA 5GXQB 3X1UC 5CPID 2IO5B 3UTBA 3B6GC 3UTAA 4LD9C 1P3OC 4Z5TB 5AV8B 3F6TA 3C1BA 3AZMC 5AY8C 2UWXA 3X1VC 1M1AC 2Y2PA 4KHAA 1N1JA 4KUDB 3AZKA 4G91B 1JFIA 3KWQD 3C1CA 2NZDA 3B6FC 1P3IC 4NE3A 4YS3D 3AZIC 2CV5C 1WWIA 3R45B 2NZDD 3W96B 4H9RB 2NQBD 5GXQC 3LZ0B 3LJAB 3AZFA 2IO5C 1ZLAB 3X1SD 4XZQD 3AZFD 4Z5TC 5AV8C 4UUZA 3NQJA 5AVBB 3RELA 1M18B 5B24B 2FJ7A 5CPJD 4QLCB 4KUDC 5B1LA 4G91C 3MGQD 4J8UA 3AV1D 4G92B 1H3OA 4J8XB 4Z66B 3REKB 2F8ND 1KX3D 4WZSB 1P3FA 4J8UD 1P3PD 5AV6A 1PZRA 3W96C 1F66A 4NE5A 3LZ0C 4M6BA 3LJAC 1P3FD 5DNMB 4DRBA 2HUEB 1ZLAC 2CWEA 2G5HC 3W99A 3AN2D 3KXBD 3X1TB 5AVBC 5BT1C 3MNND 1M18C 3EPLA 5B24C 4QLCC 5JA4B 3NQUA 3AZEB 3REHA 3W98A 4G92C 2RIQA 1S32A 1P3AB 1ID3A 5CPKB 4J8XC 4Z66C 3REKC 1KX5A 2Y2QA 1P3GB 3REHD 3KUYB 5B1MB 1ULYA 2JSSA 2AROD 5DNMC 5GSUA 2HUEC 5E5AB 3LZ1B 3MVDB 3AFAB 5DNNA 3MGRD 3X1TC 2HIOD 5B40B 3AZHB 3H0LC 5F99B 5C3IB 3LELA 3WAAB 1EQZA 3P5JB 1P34B 3WA9B 3AZEC 3VH5T 3VH5W 3VH6A 3LELD 1P3AC 5CP6B 4CSRB 1EQZD 5CPKC 5B2JA 4JJNB 5JRGD 5B33B 2YFWB 5AV9A 1P3GC 3TU4B 3KUYC 1M19A 5B1MC 1P3BA 3AL0C 5G49B 1Z2CB 4J8VA 3AZGA 4ZUXB 3AZJD 5AV9D 4DQYB 5E5AC 2BYKA 3LZ1C 3AFAC 5BNVB 5B32D 3MVDC 5B31D 3AZLA 3A6NB 1U35B 2F8NG 4R8PA 5B40C 3AZHC 1AOIA 5F99C 5C3IC 4WU9D 3WAAC 1KX4B 5KDMA 4AWLB 3B0CT 3B0CW 1P34C 3WKJD 2DQNC 3WA9C 5B2IA 3UTBB 5BS7C 3UTAB 3EPHA 5CP6C 3AV2D 4JJNC 5B2ID 5GT0A 5B33C 4XUJD 3C1BB 3TU4C 3AYWB 2PYOA 2YFVA 4H9NA 4ZUXC 1P3MA 4NFTA 5CPIA 4X23D 4H9PA 3AZKB 4E44A 5FUGB 4H9QA 1P3MD 3C1CB 5B0ZD 3A6NC 1U35C 1P3LD 2FFFB 1KX4C 4AWLC 3REJA 3UTBC 3WTPA 3KWQA 3UTAC 5BO0A 2J8PA 4H9OA 4YS3A 1HQ3D 3REJD 4UUZB 3NQJB 3B6GA 3WTPD 3C1BC 2Y2OA 3AYWC 3RELB 1P3OA 2NQBA 3X1UD 2FJ7B 3B6GD 4LD9D 5B1LB 3AZKC 4UPKA 3X1SA 1P3OD 4XZQA 2F2AC 3C1CC 3AZMD 5AY8D 3X1VD 3B6FA 5AV6B 3MGSA 1F66B 2CV5A 5CPJA 4HGAB 3MGQA 4J8WA 1P3KA 3B6FD 4YM6B 3MGSD 1P3ID 5B32G 3AV1A 2CV5D 3AZID 3W99B 2F8NA 1KX3A 4J8WD 1P3KD 1P3PA 3AZNB 5GXQD 3RELC 5AVCA 2FJ7C 5B1LC 3NQUB 3REIA 4Z5TD 5AV8D 5AVCD 3W98B 3AN2A 1ID3B 1S32B 3KXBA 1KX5B 3REID 3MNNA 5AV6C 4KUDD 1F66C 3R45A 4HGAC 4H9SC 3W96A 4H9RA 4YM6C 1TZYA 3EG5B 5GSUB 3H0MC 3W99C 3LJAA 2ZY4A 2DF4C 5DNNB 3W96D 1TZYD 3AZNC 4WU8B 3LZ0D 3LJAD 5AV5A 2AROA 1ZLAD 2Y2HA 3W98C 5AV5D 5AVBD 1S32C 1ID3C 3MGRA 5BT1D 2Y2JA 2Y2KA 5B2JB 3O62B 1KX5C 2HIOA 5B24D 3V9RA 4QLCD 1M19B 4KGCB 1P3BB 1BH9B 4J8VB 3AZGB 3W97A 5GSUC 4J8XD 2BYKB 4Z66D 3AZLB 4E45A 3W97D 2F8NK 5JRGA 5DNNC 4R8PB 4WU8C 4CAYA 3UT9A 3AZJA 1AOIB 2Y2MA 5KDMB 5B32A 3UT9D 5B31A 1BH8B 2JE5A 3X1TD 3O62C 3A1IA 5B2JC 5GT0B 2BG1A 1P3AA 1M19C 2BYMA 2YFVB 4H9NB 1P3BC 2PYOB 4WU9A 4KGCC 4J8VC 3AZGC 1P3MB 3WKJA 5CPIB 2Y2NA 5B1MA 1R4VA 1P3AD 4H9PB 5CPKD 5GT3A 3AZLC 4H9QB 3AV2A 1P3GD 3KUYD 5B1MD 4XUJA 4WJ3C 4R8PC 5GT3D 5CPJC 2RVQC 4WNNA 1AOIC 1TAFA 4Z2MG 3AFAD 3MVDD 4X23A 3KWQB 5B0ZA 4H9OB 4KHAB 1N1JB 1P3LA 4YS3B 3MGPA 5B40D 3WA9A 2ZM5A 5GT0C 1JFIB 5F99D 3KSYA 2NZDB 3WAAD 2PYOC 4CSRA 2NQBB 1P34D 3MGPD 3WA9D 5B33A 1P3MC 5B0YA 5CPIC 2ZY2A 5CHLB 5G49A 5CP6D 2F8NH 3X1SB 4ZUXA 4JJND 4XZQB 2XD1A 5B33D 3AZFB 1HQ3A 5B0YD 4ZUXD 3X1UA 3MGSB 5CPJB 4LD9A 3MGQB 4J8WB 1W2EA 1P3KB 3A6ND 1U35D 3KWQC 3AV1B 1B6WA 3AZMA 3B0BA 5AY8A 4YS3C 2F8NB 1KX3B 3VH5A 3X1VA 4J8UB 1M1AA 1P3PB 2NZDC 2L5AA 1KX4D 1BFMA 1H3OB 5BNXA 2NQBC 5AVCB 3UTBD 1P3FB 3UTAD 1M1AD 3AYWA 1P3IA 3KFUG 2Y2IA 3AZIA 3REIB 3X1SC 4XZQC 3AZFC 3C1BD 3AN2B 3AYWD 3KXBB 5FUGA 5B31G 2VQRA 5GXQA 3MNNB 3MGSC 3AZKD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGQ C;  3C1C D;  4J8W C;  4Z5T A;  1P3K C;  5AV8 A;  1TZY B;  3AV1 C;  1B67 A;  1Q9C A;  2LY8 A;  1KX3 C;  4J8U C;  3REH B;  1P3P C;  3VH6 T;  3VH6 W;  4KUD A;  5AVC C;  5AV5 B;  1P3F C;  1KU5 A;  2ARO B;  4ZBJ B;  3REI C;  3AN2 C;  3WTP E;  3MGR B;  3KXB C;  3REL D;  2HIO B;  3LZ0 A;  3MNN C;  3V9R B;  2FJ7 D;  5B1L D;  1ZLA A;  3W97 B;  1TZY C;  3LEL B;  5AVB A;  1EQZ B;  4H9S A;  5JRG B;  5AV6 D;  3B0D B;  4YM6 A;  5B24 A;  1M18 A;  1F66 D;  3REH C;  4QLC A;  4CAY B;  3UT9 B;  3AZJ B;  5AV5 C;  4YM6 D;  5AV9 B;  1M18 D;  3AZN A;  2ARO C;  3W99 D;  4J8X A;  4Z66 A;  4ZBJ C;  5B32 B;  3REK A;  5B31 B;  4EO5 B;  3AZN D;  3MGR C;  3REK D;  2HIO C;  2BYM B;  5DNM A;  4DRA A;  4WU9 B;  3WKJ B;  3W97 C;  3W98 D;  1ID3 D;  1S32 D;  5DNM D;  5GT3 B;  3X1T A;  3LEL C;  1KX5 D;  1EQZ C;  3AV2 B;  5JRG C;  5B2I B;  3B0D C;  4XUJ B;  5JA4 A;  4WNN B;  3UT9 C;  3AZJ C;  3AZE A;  1TAF B;  5AV9 C;  5GSU D;  4WU8 A;  4X23 B;  5CPK A;  5B32 C;  5B31 C;  5DNN D;  5B0Z B;  3AZE D;  1P3G A;  4EO5 C;  3KUY A;  1P3L B;  1HTA A;  4WU8 D;  3MGP B;  1WWS A;  3O62 A;  4WU9 C;  5E5A A;  3LZ1 A;  3AFA A;  3MVD A;  3WKJ C;  5B0Y B;  4KGC A;  1BH9 A;  3O62 D;  5GT3 C;  5B2J D;  5E5A D;  3LZ1 D;  5B40 A;  3AV2 C;  1HQ3 B;  3REJ B;  5B2I C;  3AZH A;  1M19 D;  1P3B D;  3WTP B;  5F99 A;  4XUJ C;  4KGC D;  5BO0 B;  4J8V D;  3AZG D;  3WAA A;  1P34 A;  4NE6 A;  3X1U B;  5BS7 A;  3B6G B;  3AZH D;  4LD9 B;  3AZL D;  4X23 C;  5CP6 A;  1P3O B;  4JJN A;  2YFW A;  5B0Z C;  3AZM B;  5AY8 B;  3TU4 A;  4R8P D;  1P3L C;  3MGP C;  2RVQ D;  3X1V B;  1AOI D;  1BH8 A;  1M1A B;  5BNX B;  3TU4 D;  5BNV A;  5B0Y C;  3B6F B;  3A6N A;  1U35 A;  1P3I B;  2CV5 B;  3AZI B;  5GT0 D;  1HQ3 C;  1F1E A;  3REJ C;  2PYO D;  3WTP C;  4WV4 B;  1KX4 A;  4Z2M H;  1A7W A;  5GXQ B;  3X1U C;  5CPI D;  2IO5 B;  3UTB A;  3B6G C;  3UTA A;  4LD9 C;  1P3O C;  4Z5T B;  5AV8 B;  3C1B A;  3AZM C;  5AY8 C;  3X1V C;  1M1A C;  4KHA A;  1N1J A;  4KUD B;  3AZK A;  4G91 B;  1JFI A;  3KWQ D;  3C1C A;  2NZD A;  3B6F C;  1P3I C;  4NE3 A;  4YS3 D;  3AZI C;  2CV5 C;  1WWI A;  3R45 B;  2NZD D;  3W96 B;  4H9R B;  2NQB D;  5GXQ C;  3LZ0 B;  3LJA B;  3AZF A;  2IO5 C;  1ZLA B;  3X1S D;  4XZQ D;  3AZF D;  4Z5T C;  5AV8 C;  4UUZ A;  3NQJ A;  5AVB B;  3REL A;  1M18 B;  5B24 B;  2FJ7 A;  5CPJ D;  4QLC B;  4KUD C;  5B1L A;  4G91 C;  3MGQ D;  4J8U A;  3AV1 D;  4G92 B;  1H3O A;  4J8X B;  4Z66 B;  3REK B;  2F8N D;  1KX3 D;  4WZS B;  1P3F A;  4J8U D;  1P3P D;  5AV6 A;  3W96 C;  1F66 A;  4NE5 A;  3LZ0 C;  4M6B A;  3LJA C;  1P3F D;  5DNM B;  4DRB A;  2HUE B;  1ZLA C;  2CWE A;  3W99 A;  3AN2 D;  3KXB D;  3X1T B;  5AVB C;  5BT1 C;  3MNN D;  1M18 C;  5B24 C;  4QLC C;  5JA4 B;  3NQU A;  3AZE B;  3REH A;  3W98 A;  4G92 C;  1P3A B;  1S32 A;  1ID3 A;  5CPK B;  4J8X C;  4Z66 C;  3REK C;  1KX5 A;  1P3G B;  3REH D;  3KUY B;  5B1M B;  1ULY A;  2JSS A;  2ARO D;  5DNM C;  5GSU A;  2HUE C;  5E5A B;  3LZ1 B;  3MVD B;  3AFA B;  5DNN A;  3MGR D;  3X1T C;  2HIO D;  5B40 B;  3AZH B;  5F99 B;  5C3I B;  3LEL A;  3WAA B;  1EQZ A;  1P34 B;  3WA9 B;  3AZE C;  3VH5 T;  3VH5 W;  3VH6 A;  3LEL D;  1P3A C;  5CP6 B;  4CSR B;  1EQZ D;  5CPK C;  5B2J A;  4JJN B;  5JRG D;  5B33 B;  2YFW B;  5AV9 A;  1P3G C;  3TU4 B;  3KUY C;  1M19 A;  5B1M C;  1P3B A;  5G49 B;  4J8V A;  3AZG A;  4ZUX B;  3AZJ D;  5AV9 D;  5E5A C;  2BYK A;  3LZ1 C;  3AFA C;  5BNV B;  5B32 D;  3MVD C;  5B31 D;  3AZL A;  3A6N B;  1U35 B;  2F8N G;  4R8P A;  5B40 C;  3AZH C;  1AOI A;  5F99 C;  5C3I C;  4WU9 D;  3WAA C;  1KX4 B;  5KDM A;  4AWL B;  3B0C T;  3B0C W;  1P34 C;  3WKJ D;  3WA9 C;  5B2I A;  3UTB B;  5BS7 C;  3UTA B;  5CP6 C;  3AV2 D;  4JJN C;  5B2I D;  5GT0 A;  5B33 C;  4XUJ D;  3C1B B;  3TU4 C;  3AYW B;  2PYO A;  2YFV A;  4H9N A;  4ZUX C;  1P3M A;  4NFT A;  5CPI A;  4X23 D;  4H9P A;  3AZK B;  4E44 A;  5FUG B;  4H9Q A;  1P3M D;  3C1C B;  5B0Z D;  3A6N C;  1U35 C;  1P3L D;  1KX4 C;  4AWL C;  3REJ A;  3UTB C;  3WTP A;  3KWQ A;  3UTA C;  5BO0 A;  4H9O A;  4YS3 A;  1HQ3 D;  3REJ D;  4UUZ B;  3NQJ B;  3B6G A;  3WTP D;  3C1B C;  3AYW C;  3REL B;  1P3O A;  2NQB A;  3X1U D;  2FJ7 B;  3B6G D;  4LD9 D;  5B1L B;  3AZK C;  3X1S A;  1P3O D;  4XZQ A;  3C1C C;  3AZM D;  5AY8 D;  3X1V D;  3B6F A;  5AV6 B;  3MGS A;  1F66 B;  2CV5 A;  5CPJ A;  4HGA B;  3MGQ A;  4J8W A;  1P3K A;  3B6F D;  4YM6 B;  3MGS D;  1P3I D;  5B32 G;  3AV1 A;  2CV5 D;  3AZI D;  3W99 B;  2F8N A;  1KX3 A;  4J8W D;  1P3K D;  1P3P A;  3AZN B;  5GXQ D;  3REL C;  5AVC A;  2FJ7 C;  5B1L C;  3NQU B;  3REI A;  4Z5T D;  5AV8 D;  5AVC D;  3W98 B;  3AN2 A;  1ID3 B;  1S32 B;  3KXB A;  1KX5 B;  3REI D;  3MNN A;  5AV6 C;  4KUD D;  1F66 C;  3R45 A;  4HGA C;  4H9S C;  3W96 A;  4H9R A;  4YM6 C;  1TZY A;  5GSU B;  3W99 C;  3LJA A;  5DNN B;  3W96 D;  1TZY D;  3AZN C;  4WU8 B;  3LZ0 D;  3LJA D;  5AV5 A;  2ARO A;  1ZLA D;  3W98 C;  5AV5 D;  5AVB D;  1S32 C;  1ID3 C;  3MGR A;  5BT1 D;  3O62 B;  5B2J B;  1KX5 C;  2HIO A;  5B24 D;  3V9R A;  4QLC D;  1M19 B;  4KGC B;  1P3B B;  1BH9 B;  4J8V B;  3AZG B;  3W97 A;  5GSU C;  4J8X D;  2BYK B;  4Z66 D;  3AZL B;  4E45 A;  3W97 D;  2F8N K;  5JRG A;  5DNN C;  4R8P B;  4WU8 C;  4CAY A;  3UT9 A;  3AZJ A;  1AOI B;  5KDM B;  5B32 A;  3UT9 D;  5B31 A;  1BH8 B;  3X1T D;  3O62 C;  5B2J C;  5GT0 B;  1P3A A;  1M19 C;  2BYM A;  2YFV B;  4H9N B;  1P3B C;  2PYO B;  4WU9 A;  4KGC C;  4J8V C;  3AZG C;  1P3M B;  3WKJ A;  5CPI B;  5B1M A;  1R4V A;  1P3A D;  4H9P B;  5CPK D;  5GT3 A;  3AZL C;  4H9Q B;  3AV2 A;  1P3G D;  3KUY D;  5B1M D;  4XUJ A;  4R8P C;  5GT3 D;  5CPJ C;  2RVQ C;  4WNN A;  1AOI C;  1TAF A;  4Z2M G;  3AFA D;  3MVD D;  4X23 A;  3KWQ B;  5B0Z A;  4H9O B;  4KHA B;  1N1J B;  1P3L A;  4YS3 B;  3MGP A;  5B40 D;  3WA9 A;  5GT0 C;  1JFI B;  5F99 D;  3KSY A;  2NZD B;  3WAA D;  2PYO C;  4CSR A;  2NQB B;  1P34 D;  3MGP D;  3WA9 D;  5B33 A;  1P3M C;  5B0Y A;  5CPI C;  5CHL B;  5G49 A;  5CP6 D;  2F8N H;  3X1S B;  4ZUX A;  4JJN D;  4XZQ B;  5B33 D;  3AZF B;  1HQ3 A;  5B0Y D;  4ZUX D;  3X1U A;  3MGS B;  5CPJ B;  4LD9 A;  3MGQ B;  4J8W B;  1P3K B;  3A6N D;  1U35 D;  3KWQ C;  3AV1 B;  1B6W A;  3AZM A;  3B0B A;  5AY8 A;  4YS3 C;  2F8N B;  1KX3 B;  3VH5 A;  3X1V A;  4J8U B;  1M1A A;  1P3P B;  2NZD C;  2L5A A;  1KX4 D;  1BFM A;  1H3O B;  5BNX A;  2NQB C;  5AVC B;  3UTB D;  1P3F B;  3UTA D;  1M1A D;  3AYW A;  1P3I A;  3AZI A;  3REI B;  3X1S C;  4XZQ C;  3AZF C;  3C1B D;  3AN2 B;  3AYW D;  3KXB B;  5FUG A;  5B31 G;  5GXQ A;  3MNN B;  3MGS C;  3AZK D; 
#chains in the Genus database with same CATH topology
 2ZY5 A;  1T3U A;  3MGQ C;  3EPK A;  3FDD A;  4Z5T A;  3C1C D;  4J8W C;  5AV8 A;  1TZY B;  2Y2G A;  1P3K C;  3AV1 C;  1B67 A;  1Q9C A;  2LY8 A;  1KX3 C;  4J8U C;  3REH B;  1P3P C;  3VH6 T;  3VH6 W;  4KUD A;  5AVC C;  5AV5 B;  1P3F C;  1KU5 A;  2ARO B;  4ZBJ B;  3REI C;  3AN2 C;  3WTP E;  3MGR B;  3KXB C;  3REL D;  2HIO B;  3LZ0 A;  3MNN C;  3V9R B;  2FJ7 D;  5B1L D;  1ZLA A;  3W97 B;  1TZY C;  3LEL B;  5AVB A;  1EQZ B;  4H9S A;  5JRG B;  5AV6 D;  3B0D B;  4YM6 A;  5B24 A;  1M18 A;  1F66 D;  3REH C;  4QLC A;  4CAY B;  3UT9 B;  3AZJ B;  5AV5 C;  4YM6 D;  5AV9 B;  1M18 D;  3AZN A;  2ARO C;  3W99 D;  4J8X A;  4Z66 A;  4ZBJ C;  5B32 B;  3REK A;  5B31 B;  4EO5 B;  3AZN D;  2G5I C;  3MGR C;  3REK D;  2HIO C;  3IP4 C;  2BYM B;  5DNM A;  4DRA A;  4WU9 B;  3WKJ B;  3W97 C;  3W98 D;  1ID3 D;  1S32 D;  5DNM D;  2Y2L A;  5GT3 B;  3X1T A;  3LEL C;  1KX5 D;  1EQZ C;  3AV2 B;  5JRG C;  5B2I B;  3B0D C;  4XUJ B;  5JA4 A;  4WNN B;  3UT9 C;  3AZJ C;  3AZE A;  1TAF B;  5AV9 C;  5GSU D;  4WU8 A;  4X23 B;  2JCH A;  5CPK A;  5B32 C;  5B31 C;  5DNN D;  5B0Z B;  3AZE D;  1P3G A;  4EO5 C;  3KUY A;  1P3L B;  1HTA A;  4WU8 D;  3MGP B;  3H0R C;  1WWS A;  3O62 A;  4WU9 C;  5E5A A;  3LZ1 A;  3AFA A;  3MVD A;  3WKJ C;  5B0Y B;  4KGC A;  1BH9 A;  3O62 D;  5GT3 C;  5B2J D;  5E5A D;  3LZ1 D;  2XD5 A;  5B40 A;  3AV2 C;  1HQ3 B;  3REJ B;  5B2I C;  3AZH A;  1M19 D;  1P3B D;  3WTP B;  5F99 A;  4XUJ C;  4KGC D;  5BO0 B;  2W8S A;  4J8V D;  3AZG D;  3WAA A;  1P34 A;  4NE6 A;  3X1U B;  5BS7 A;  3B6G B;  3AZH D;  4LD9 B;  3AZL D;  4X23 C;  5CP6 A;  1P3O B;  4JJN A;  2YFW A;  5B0Z C;  3AZM B;  5AY8 B;  3TU4 A;  4R8P D;  1P3L C;  3MGP C;  2RVQ D;  3X1V B;  1AOI D;  1BH8 A;  3A1K A;  1M1A B;  3EPJ A;  5BNX B;  3TU4 D;  5BNV A;  5B0Y C;  3B6F B;  3A6N A;  1U35 A;  1P3I B;  2CV5 B;  3AZI B;  5GT0 D;  1HQ3 C;  1F1E A;  3REJ C;  2PYO D;  3WTP C;  2ZY3 A;  4WV4 B;  1KX4 A;  4Z2M H;  1A7W A;  5GXQ B;  3X1U C;  5CPI D;  2IO5 B;  3UTB A;  3B6G C;  3UTA A;  4LD9 C;  1P3O C;  4Z5T B;  5AV8 B;  3F6T A;  3C1B A;  3AZM C;  5AY8 C;  2UWX A;  3X1V C;  1M1A C;  2Y2P A;  4KHA A;  1N1J A;  4KUD B;  3AZK A;  4G91 B;  1JFI A;  3KWQ D;  3C1C A;  2NZD A;  3B6F C;  1P3I C;  4NE3 A;  4YS3 D;  3AZI C;  2CV5 C;  1WWI A;  3R45 B;  2NZD D;  3W96 B;  4H9R B;  2NQB D;  5GXQ C;  3LZ0 B;  3LJA B;  3AZF A;  2IO5 C;  1ZLA B;  3X1S D;  4XZQ D;  3AZF D;  4Z5T C;  5AV8 C;  4UUZ A;  3NQJ A;  5AVB B;  3REL A;  1M18 B;  5B24 B;  2FJ7 A;  5CPJ D;  4QLC B;  4KUD C;  5B1L A;  4G91 C;  3MGQ D;  4J8U A;  3AV1 D;  4G92 B;  1H3O A;  4J8X B;  4Z66 B;  3REK B;  2F8N D;  1KX3 D;  4WZS B;  1P3F A;  4J8U D;  1P3P D;  5AV6 A;  1PZR A;  3W96 C;  1F66 A;  4NE5 A;  3LZ0 C;  4M6B A;  3LJA C;  1P3F D;  5DNM B;  4DRB A;  2HUE B;  1ZLA C;  2CWE A;  2G5H C;  3W99 A;  3AN2 D;  3KXB D;  3X1T B;  5AVB C;  5BT1 C;  3MNN D;  1M18 C;  3EPL A;  5B24 C;  4QLC C;  5JA4 B;  3NQU A;  3AZE B;  3REH A;  3W98 A;  4G92 C;  2RIQ A;  1S32 A;  1P3A B;  1ID3 A;  5CPK B;  4J8X C;  4Z66 C;  3REK C;  1KX5 A;  2Y2Q A;  1P3G B;  3REH D;  3KUY B;  5B1M B;  1ULY A;  2JSS A;  2ARO D;  5DNM C;  5GSU A;  2HUE C;  5E5A B;  3LZ1 B;  3MVD B;  3AFA B;  5DNN A;  3MGR D;  3X1T C;  2HIO D;  5B40 B;  3AZH B;  3H0L C;  5F99 B;  5C3I B;  3LEL A;  3WAA B;  1EQZ A;  3P5J B;  1P34 B;  3WA9 B;  3AZE C;  3VH5 T;  3VH5 W;  3VH6 A;  3LEL D;  1P3A C;  5CP6 B;  4CSR B;  1EQZ D;  5CPK C;  5B2J A;  4JJN B;  5JRG D;  5B33 B;  2YFW B;  5AV9 A;  1P3G C;  3TU4 B;  3KUY C;  1M19 A;  5B1M C;  1P3B A;  3AL0 C;  5G49 B;  1Z2C B;  4J8V A;  3AZG A;  4ZUX B;  3AZJ D;  5AV9 D;  4DQY B;  5E5A C;  2BYK A;  3LZ1 C;  3AFA C;  5BNV B;  5B32 D;  3MVD C;  5B31 D;  3AZL A;  3A6N B;  1U35 B;  2F8N G;  4R8P A;  5B40 C;  3AZH C;  1AOI A;  5F99 C;  5C3I C;  4WU9 D;  3WAA C;  1KX4 B;  5KDM A;  4AWL B;  3B0C T;  3B0C W;  1P34 C;  3WKJ D;  2DQN C;  3WA9 C;  5B2I A;  3UTB B;  5BS7 C;  3UTA B;  3EPH A;  5CP6 C;  3AV2 D;  4JJN C;  5B2I D;  5GT0 A;  5B33 C;  4XUJ D;  3C1B B;  3TU4 C;  3AYW B;  2PYO A;  2YFV A;  4H9N A;  4ZUX C;  1P3M A;  4NFT A;  5CPI A;  4X23 D;  4H9P A;  3AZK B;  4E44 A;  5FUG B;  4H9Q A;  1P3M D;  3C1C B;  5B0Z D;  3A6N C;  1U35 C;  1P3L D;  2FFF B;  1KX4 C;  4AWL C;  3REJ A;  3UTB C;  3WTP A;  3KWQ A;  3UTA C;  5BO0 A;  2J8P A;  4H9O A;  4YS3 A;  1HQ3 D;  3REJ D;  4UUZ B;  3NQJ B;  3B6G A;  3WTP D;  3C1B C;  2Y2O A;  3AYW C;  3REL B;  1P3O A;  2NQB A;  3X1U D;  2FJ7 B;  3B6G D;  4LD9 D;  5B1L B;  3AZK C;  4UPK A;  3X1S A;  1P3O D;  4XZQ A;  2F2A C;  3C1C C;  3AZM D;  5AY8 D;  3X1V D;  3B6F A;  5AV6 B;  3MGS A;  1F66 B;  2CV5 A;  5CPJ A;  4HGA B;  3MGQ A;  4J8W A;  1P3K A;  3B6F D;  4YM6 B;  3MGS D;  1P3I D;  5B32 G;  3AV1 A;  2CV5 D;  3AZI D;  3W99 B;  2F8N A;  1KX3 A;  4J8W D;  1P3K D;  1P3P A;  3AZN B;  5GXQ D;  3REL C;  5AVC A;  2FJ7 C;  5B1L C;  3NQU B;  3REI A;  4Z5T D;  5AV8 D;  5AVC D;  3W98 B;  3AN2 A;  1ID3 B;  1S32 B;  3KXB A;  1KX5 B;  3REI D;  3MNN A;  5AV6 C;  4KUD D;  1F66 C;  3R45 A;  4HGA C;  4H9S C;  3W96 A;  4H9R A;  4YM6 C;  1TZY A;  3EG5 B;  5GSU B;  3H0M C;  3W99 C;  3LJA A;  2ZY4 A;  2DF4 C;  5DNN B;  3W96 D;  1TZY D;  3AZN C;  4WU8 B;  3LZ0 D;  3LJA D;  5AV5 A;  2ARO A;  1ZLA D;  2Y2H A;  3W98 C;  5AV5 D;  5AVB D;  1S32 C;  1ID3 C;  3MGR A;  5BT1 D;  2Y2J A;  2Y2K A;  5B2J B;  3O62 B;  1KX5 C;  2HIO A;  5B24 D;  3V9R A;  4QLC D;  1M19 B;  4KGC B;  1P3B B;  1BH9 B;  4J8V B;  3AZG B;  3W97 A;  5GSU C;  4J8X D;  2BYK B;  4Z66 D;  3AZL B;  4E45 A;  3W97 D;  2F8N K;  5JRG A;  5DNN C;  4R8P B;  4WU8 C;  4CAY A;  3UT9 A;  3AZJ A;  1AOI B;  2Y2M A;  5KDM B;  5B32 A;  3UT9 D;  5B31 A;  1BH8 B;  2JE5 A;  3X1T D;  3O62 C;  3A1I A;  5B2J C;  5GT0 B;  2BG1 A;  1P3A A;  1M19 C;  2BYM A;  2YFV B;  4H9N B;  1P3B C;  2PYO B;  4WU9 A;  4KGC C;  4J8V C;  3AZG C;  1P3M B;  3WKJ A;  5CPI B;  2Y2N A;  5B1M A;  1R4V A;  1P3A D;  4H9P B;  5CPK D;  5GT3 A;  3AZL C;  4H9Q B;  3AV2 A;  1P3G D;  3KUY D;  5B1M D;  4XUJ A;  4WJ3 C;  4R8P C;  5GT3 D;  5CPJ C;  2RVQ C;  4WNN A;  1AOI C;  1TAF A;  4Z2M G;  3AFA D;  3MVD D;  4X23 A;  3KWQ B;  5B0Z A;  4H9O B;  4KHA B;  1N1J B;  1P3L A;  4YS3 B;  3MGP A;  5B40 D;  3WA9 A;  2ZM5 A;  5GT0 C;  1JFI B;  5F99 D;  3KSY A;  2NZD B;  3WAA D;  2PYO C;  4CSR A;  2NQB B;  1P34 D;  3MGP D;  3WA9 D;  5B33 A;  1P3M C;  5B0Y A;  5CPI C;  2ZY2 A;  5CHL B;  5G49 A;  5CP6 D;  2F8N H;  3X1S B;  4ZUX A;  4JJN D;  4XZQ B;  2XD1 A;  5B33 D;  3AZF B;  1HQ3 A;  5B0Y D;  4ZUX D;  3X1U A;  3MGS B;  5CPJ B;  4LD9 A;  3MGQ B;  4J8W B;  1W2E A;  1P3K B;  3A6N D;  1U35 D;  3KWQ C;  3AV1 B;  1B6W A;  3AZM A;  3B0B A;  5AY8 A;  4YS3 C;  2F8N B;  1KX3 B;  3VH5 A;  3X1V A;  4J8U B;  1M1A A;  1P3P B;  2NZD C;  2L5A A;  1KX4 D;  1BFM A;  1H3O B;  5BNX A;  2NQB C;  5AVC B;  3UTB D;  1P3F B;  3UTA D;  1M1A D;  3AYW A;  1P3I A;  3KFU G;  2Y2I A;  3AZI A;  3REI B;  3X1S C;  4XZQ C;  3AZF C;  3C1B D;  3AN2 B;  3AYW D;  3KXB B;  5FUG A;  5B31 G;  2VQR A;  5GXQ A;  3MNN B;  3MGS C;  3AZK D; 
#chains in the Genus database with same CATH homology
 2ZY5 A;  1T3U A;  3MGQ C;  3EPK A;  3FDD A;  4Z5T A;  3C1C D;  4J8W C;  5AV8 A;  1TZY B;  2Y2G A;  1P3K C;  3AV1 C;  1B67 A;  1Q9C A;  2LY8 A;  1KX3 C;  4J8U C;  3REH B;  1P3P C;  3VH6 T;  3VH6 W;  4KUD A;  5AVC C;  5AV5 B;  1P3F C;  1KU5 A;  2ARO B;  4ZBJ B;  3REI C;  3AN2 C;  3WTP E;  3MGR B;  3KXB C;  3REL D;  2HIO B;  3LZ0 A;  3MNN C;  3V9R B;  2FJ7 D;  5B1L D;  1ZLA A;  3W97 B;  1TZY C;  3LEL B;  5AVB A;  1EQZ B;  4H9S A;  5JRG B;  5AV6 D;  3B0D B;  4YM6 A;  5B24 A;  1M18 A;  1F66 D;  3REH C;  4QLC A;  4CAY B;  3UT9 B;  3AZJ B;  5AV5 C;  4YM6 D;  5AV9 B;  1M18 D;  3AZN A;  2ARO C;  3W99 D;  4J8X A;  4Z66 A;  4ZBJ C;  5B32 B;  3REK A;  5B31 B;  4EO5 B;  3AZN D;  2G5I C;  3MGR C;  3REK D;  2HIO C;  3IP4 C;  2BYM B;  5DNM A;  4DRA A;  4WU9 B;  3WKJ B;  3W97 C;  3W98 D;  1ID3 D;  1S32 D;  5DNM D;  2Y2L A;  5GT3 B;  3X1T A;  3LEL C;  1KX5 D;  1EQZ C;  3AV2 B;  5JRG C;  5B2I B;  3B0D C;  4XUJ B;  5JA4 A;  4WNN B;  3UT9 C;  3AZJ C;  3AZE A;  1TAF B;  5AV9 C;  5GSU D;  4WU8 A;  4X23 B;  2JCH A;  5CPK A;  5B32 C;  5B31 C;  5DNN D;  5B0Z B;  3AZE D;  1P3G A;  4EO5 C;  3KUY A;  1P3L B;  1HTA A;  4WU8 D;  3MGP B;  3H0R C;  1WWS A;  3O62 A;  4WU9 C;  5E5A A;  3LZ1 A;  3AFA A;  3MVD A;  3WKJ C;  5B0Y B;  4KGC A;  1BH9 A;  3O62 D;  5GT3 C;  5B2J D;  5E5A D;  3LZ1 D;  2XD5 A;  5B40 A;  3AV2 C;  1HQ3 B;  3REJ B;  5B2I C;  3AZH A;  1M19 D;  1P3B D;  3WTP B;  5F99 A;  4XUJ C;  4KGC D;  5BO0 B;  2W8S A;  4J8V D;  3AZG D;  3WAA A;  1P34 A;  4NE6 A;  3X1U B;  5BS7 A;  3B6G B;  3AZH D;  4LD9 B;  3AZL D;  4X23 C;  5CP6 A;  1P3O B;  4JJN A;  2YFW A;  5B0Z C;  3AZM B;  5AY8 B;  3TU4 A;  4R8P D;  1P3L C;  3MGP C;  2RVQ D;  3X1V B;  1AOI D;  1BH8 A;  3A1K A;  1M1A B;  3EPJ A;  5BNX B;  3TU4 D;  5BNV A;  5B0Y C;  3B6F B;  3A6N A;  1U35 A;  1P3I B;  2CV5 B;  3AZI B;  5GT0 D;  1HQ3 C;  1F1E A;  3REJ C;  2PYO D;  3WTP C;  2ZY3 A;  4WV4 B;  1KX4 A;  4Z2M H;  1A7W A;  5GXQ B;  3X1U C;  5CPI D;  2IO5 B;  3UTB A;  3B6G C;  3UTA A;  4LD9 C;  1P3O C;  4Z5T B;  5AV8 B;  3F6T A;  3C1B A;  3AZM C;  5AY8 C;  2UWX A;  3X1V C;  1M1A C;  2Y2P A;  4KHA A;  1N1J A;  4KUD B;  3AZK A;  4G91 B;  1JFI A;  3KWQ D;  3C1C A;  2NZD A;  3B6F C;  1P3I C;  4NE3 A;  4YS3 D;  3AZI C;  2CV5 C;  1WWI A;  3R45 B;  2NZD D;  3W96 B;  4H9R B;  2NQB D;  5GXQ C;  3LZ0 B;  3LJA B;  3AZF A;  2IO5 C;  1ZLA B;  3X1S D;  4XZQ D;  3AZF D;  4Z5T C;  5AV8 C;  4UUZ A;  3NQJ A;  5AVB B;  3REL A;  1M18 B;  5B24 B;  2FJ7 A;  5CPJ D;  4QLC B;  4KUD C;  5B1L A;  4G91 C;  3MGQ D;  4J8U A;  3AV1 D;  4G92 B;  1H3O A;  4J8X B;  4Z66 B;  3REK B;  2F8N D;  1KX3 D;  4WZS B;  1P3F A;  4J8U D;  1P3P D;  5AV6 A;  1PZR A;  3W96 C;  1F66 A;  4NE5 A;  3LZ0 C;  4M6B A;  3LJA C;  1P3F D;  5DNM B;  4DRB A;  2HUE B;  1ZLA C;  2CWE A;  2G5H C;  3W99 A;  3AN2 D;  3KXB D;  3X1T B;  5AVB C;  5BT1 C;  3MNN D;  1M18 C;  3EPL A;  5B24 C;  4QLC C;  5JA4 B;  3NQU A;  3AZE B;  3REH A;  3W98 A;  4G92 C;  2RIQ A;  1S32 A;  1P3A B;  1ID3 A;  5CPK B;  4J8X C;  4Z66 C;  3REK C;  1KX5 A;  2Y2Q A;  1P3G B;  3REH D;  3KUY B;  5B1M B;  1ULY A;  2JSS A;  2ARO D;  5DNM C;  5GSU A;  2HUE C;  5E5A B;  3LZ1 B;  3MVD B;  3AFA B;  5DNN A;  3MGR D;  3X1T C;  2HIO D;  5B40 B;  3AZH B;  3H0L C;  5F99 B;  5C3I B;  3LEL A;  3WAA B;  1EQZ A;  3P5J B;  1P34 B;  3WA9 B;  3AZE C;  3VH5 T;  3VH5 W;  3VH6 A;  3LEL D;  1P3A C;  5CP6 B;  4CSR B;  1EQZ D;  5CPK C;  5B2J A;  4JJN B;  5JRG D;  5B33 B;  2YFW B;  5AV9 A;  1P3G C;  3TU4 B;  3KUY C;  1M19 A;  5B1M C;  1P3B A;  3AL0 C;  5G49 B;  1Z2C B;  4J8V A;  3AZG A;  4ZUX B;  3AZJ D;  5AV9 D;  4DQY B;  5E5A C;  2BYK A;  3LZ1 C;  3AFA C;  5BNV B;  5B32 D;  3MVD C;  5B31 D;  3AZL A;  3A6N B;  1U35 B;  2F8N G;  4R8P A;  5B40 C;  3AZH C;  1AOI A;  5F99 C;  5C3I C;  4WU9 D;  3WAA C;  1KX4 B;  5KDM A;  4AWL B;  3B0C T;  3B0C W;  1P34 C;  3WKJ D;  2DQN C;  3WA9 C;  5B2I A;  3UTB B;  5BS7 C;  3UTA B;  3EPH A;  5CP6 C;  3AV2 D;  4JJN C;  5B2I D;  5GT0 A;  5B33 C;  4XUJ D;  3C1B B;  3TU4 C;  3AYW B;  2PYO A;  2YFV A;  4H9N A;  4ZUX C;  1P3M A;  4NFT A;  5CPI A;  4X23 D;  4H9P A;  3AZK B;  4E44 A;  5FUG B;  4H9Q A;  1P3M D;  3C1C B;  5B0Z D;  3A6N C;  1U35 C;  1P3L D;  2FFF B;  1KX4 C;  4AWL C;  3REJ A;  3UTB C;  3WTP A;  3KWQ A;  3UTA C;  5BO0 A;  2J8P A;  4H9O A;  4YS3 A;  1HQ3 D;  3REJ D;  4UUZ B;  3NQJ B;  3B6G A;  3WTP D;  3C1B C;  2Y2O A;  3AYW C;  3REL B;  1P3O A;  2NQB A;  3X1U D;  2FJ7 B;  3B6G D;  4LD9 D;  5B1L B;  3AZK C;  4UPK A;  3X1S A;  1P3O D;  4XZQ A;  2F2A C;  3C1C C;  3AZM D;  5AY8 D;  3X1V D;  3B6F A;  5AV6 B;  3MGS A;  1F66 B;  2CV5 A;  5CPJ A;  4HGA B;  3MGQ A;  4J8W A;  1P3K A;  3B6F D;  4YM6 B;  3MGS D;  1P3I D;  5B32 G;  3AV1 A;  2CV5 D;  3AZI D;  3W99 B;  2F8N A;  1KX3 A;  4J8W D;  1P3K D;  1P3P A;  3AZN B;  5GXQ D;  3REL C;  5AVC A;  2FJ7 C;  5B1L C;  3NQU B;  3REI A;  4Z5T D;  5AV8 D;  5AVC D;  3W98 B;  3AN2 A;  1ID3 B;  1S32 B;  3KXB A;  1KX5 B;  3REI D;  3MNN A;  5AV6 C;  4KUD D;  1F66 C;  3R45 A;  4HGA C;  4H9S C;  3W96 A;  4H9R A;  4YM6 C;  1TZY A;  3EG5 B;  5GSU B;  3H0M C;  3W99 C;  3LJA A;  2ZY4 A;  2DF4 C;  5DNN B;  3W96 D;  1TZY D;  3AZN C;  4WU8 B;  3LZ0 D;  3LJA D;  5AV5 A;  2ARO A;  1ZLA D;  2Y2H A;  3W98 C;  5AV5 D;  5AVB D;  1S32 C;  1ID3 C;  3MGR A;  5BT1 D;  2Y2J A;  2Y2K A;  5B2J B;  3O62 B;  1KX5 C;  2HIO A;  5B24 D;  3V9R A;  4QLC D;  1M19 B;  4KGC B;  1P3B B;  1BH9 B;  4J8V B;  3AZG B;  3W97 A;  5GSU C;  4J8X D;  2BYK B;  4Z66 D;  3AZL B;  4E45 A;  3W97 D;  2F8N K;  5JRG A;  5DNN C;  4R8P B;  4WU8 C;  4CAY A;  3UT9 A;  3AZJ A;  1AOI B;  2Y2M A;  5KDM B;  5B32 A;  3UT9 D;  5B31 A;  1BH8 B;  2JE5 A;  3X1T D;  3O62 C;  3A1I A;  5B2J C;  5GT0 B;  2BG1 A;  1P3A A;  1M19 C;  2BYM A;  2YFV B;  4H9N B;  1P3B C;  2PYO B;  4WU9 A;  4KGC C;  4J8V C;  3AZG C;  1P3M B;  3WKJ A;  5CPI B;  2Y2N A;  5B1M A;  1R4V A;  1P3A D;  4H9P B;  5CPK D;  5GT3 A;  3AZL C;  4H9Q B;  3AV2 A;  1P3G D;  3KUY D;  5B1M D;  4XUJ A;  4WJ3 C;  4R8P C;  5GT3 D;  5CPJ C;  2RVQ C;  4WNN A;  1AOI C;  1TAF A;  4Z2M G;  3AFA D;  3MVD D;  4X23 A;  3KWQ B;  5B0Z A;  4H9O B;  4KHA B;  1N1J B;  1P3L A;  4YS3 B;  3MGP A;  5B40 D;  3WA9 A;  2ZM5 A;  5GT0 C;  1JFI B;  5F99 D;  3KSY A;  2NZD B;  3WAA D;  2PYO C;  4CSR A;  2NQB B;  1P34 D;  3MGP D;  3WA9 D;  5B33 A;  1P3M C;  5B0Y A;  5CPI C;  2ZY2 A;  5CHL B;  5G49 A;  5CP6 D;  2F8N H;  3X1S B;  4ZUX A;  4JJN D;  4XZQ B;  2XD1 A;  5B33 D;  3AZF B;  1HQ3 A;  5B0Y D;  4ZUX D;  3X1U A;  3MGS B;  5CPJ B;  4LD9 A;  3MGQ B;  4J8W B;  1W2E A;  1P3K B;  3A6N D;  1U35 D;  3KWQ C;  3AV1 B;  1B6W A;  3AZM A;  3B0B A;  5AY8 A;  4YS3 C;  2F8N B;  1KX3 B;  3VH5 A;  3X1V A;  4J8U B;  1M1A A;  1P3P B;  2NZD C;  2L5A A;  1KX4 D;  1BFM A;  1H3O B;  5BNX A;  2NQB C;  5AVC B;  3UTB D;  1P3F B;  3UTA D;  1M1A D;  3AYW A;  1P3I A;  3KFU G;  2Y2I A;  3AZI A;  3REI B;  3X1S C;  4XZQ C;  3AZF C;  3C1B D;  3AN2 B;  3AYW D;  3KXB B;  5FUG A;  5B31 G;  2VQR A;  5GXQ A;  3MNN B;  3MGS C;  3AZK D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...