2NZDA

Nucleosome core particle containing 145 bp of dna
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (145-MER)
publication title DNA stretching and extreme kinking in the nucleosome core
pubmed doi rcsb
source organism Xenopus laevis
total genus 33
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2nzdA00
5AV8A 3W99B 3AZID 5JRGC 3AZKA 3B6GD 4WZSB 1M1AA 4KGCC 3B6FB 3AV1D 1P3KB 3AZGB 3X1SC 5AV8C 2LY8A 5B24B 5GT3D 3AZKC 3RELB 4EO5C 1M1AC 5B33B 3AZMD 1KX4D 4CAYA 3MGPD 3AZFA 1P3GA 3UTAD 5JA4A 3WA9A 4WU8A 4XUJB 5B32A 3W96D 1HTAA 5B2IA 3AZFC 1U35D 1P3GC 4KHAB 3MVDD 3X1TD 1F66C 1JFIA 1HQ3C 5B2IC 5BO0A 5AV5D 3C1BB 1N1JB 4CSRB 2HUEB 3REHB 3R45A 4Z5TA 3AN2D 5AY8D 5CP6D 3KWQC 3REJA 2YFWA 4NE6A 2F8ND 2F8NK 1P3AB 1P3IB 4Z5TC 4H9PA 3WAAB 3O62A 2AROB 3A6NB 3REJC 4YM6A 4QLCD 5AV6B 5B31A 1P3BD 1M19D 5CPJD 3WTPD 5B1MB 3UTBB 4J8VB 5F99C 1BH8A 3O62C 5B2JC 1ZLAA 3W99D 4J8XA 5B31C 1M18A 2F8NG 4LD9D 4R8PA 3REKB 4WU9B 3B6FD 1BH9A 3B0BA 1P3KD 3AZGD 1H3OB 4J8WB 1S32A 5B24D 4J8XC 1M18C 3RELD 3VH5W 4R8PC 5B32G 1P3PA 5B1LB 3W98B 5B40A 1S32C 1ID3B 3WKJC 4XUJD 1P34B 1P3LB 1TZYC 1P3PC 5B40C 3LZ1B 1P3MC 4YS3A 3AZNA 4H9RA 4G92C 3AZIB 3LZ0A 1TAFA 3REIC 3B6GB 5AV9A 3W97A 4JJNA 5GSUC 4YS3C 5KDMA 5G49A 3AZNC 5GT0A 3C1CC 3LZ0C 4XZQA 2HIOA 5AVBB 1AOIA 5AV9C 3W97C 2YFVA 2CWEA 2PYOA 3AZMB 1P3ID 1P3AD 3MGPB 5GT0C 3KXBB 4XZQC 3WAAD 2PYOC 5AV6D 5CPKB 1EQZC 4H9SC 5B0YC 5E5AA 5AVCD 3MGSD 3UTBD 1P3OA 3NQUA 1KX5A 5AV5B 4Z2MG 4WU9D 4H9QA 4X23A 3V9RB 4J8WD 2RVQD 3AZHA 3TU4B 3MGQD 3W98D 2F8NB 2JSSA 3LELD 3UT9B 4X23C 4AWLC 4UUZB 4CAYB 1ID3D 4ZUXC 1P3LD 3X1VD 1P34D 3WA9B 4WU8B 4QLCB 5B32B 1P3FB 3VH5T 3WTPB 4G91C 5B2IB 5BNVA 3AZEA 4KUDB 3VH6W 3AZLA 2BYMA 2FJ7A 4H9OA 4LD9B 1JFIB 3AYWA 1KU5A 3AZEC 5CPIA 5B0ZB 3KUYB 3AFAA 1KX4A 4Z66D 3AZLC 3R45B 5AVBD 2FJ7C 3AYWC 5CPIC 4H9NA 3AFAC 3AV2B 1KX4C 3B0DB 2NQBA 3UTAC 3KXBD 3NQJA 3MNNB 3X1TA 1F66A 2BYKA 2L5AA 3X1UD 1HQ3A 5CPKD 4YM6B 5JRGD 1U35C 2NQBC 3MVDC 2NZDA 3X1TC 1BH8B 3X1SD 1ZLAB 5AV8D 3KWQA 3AZKD 1M18B 4R8PB 4NE5A 1M1AD 2NZDC 1KX3B 3AN2C 5CHLB 3TU4D 5CP6C 5FUGB 3UT9D 5CPJA 3AZFD 1P3GD 5F99A 3WA9D 5B2JA 4WU8D 5B32D 1P3FD 1M19C 5CPJC 5AVCB 3MGSB 5B2ID 4KUDD 3B6FA 3MGRA 1P3KA 3AZGA 3RELA 1TAFB 5B0ZD 5C3IB 3KUYD 4JJNB 5B33A 3B6FC 3MGRC 1P3KC 5DNNB 3AZGC 5KDMB 5B24C 3WKJA 1TZYA 4XUJA 3RELC 5GXQB 3MGQB 2HIOB 3VH6T 1AOIB 3LELB 5B33C 3REJD 3AV2D 2PYOB 5DNMB 1P3MA 5BT1D 3X1VB 3MNND 4XUJC 1A7WA 3REIA 4YM6D 4HGAB 5B31D 5GSUA 3C1BA 1N1JA 5E5AB 3REHA 3C1CA 1P3OB 1ZLAD 4WNNA 4J8XD 1M18D 3NQUB 1KX5B 3C1BC 4R8PD 1P3IA 2HUEC 4NE3A 4J8UA 3REHC 4Z66B 3AZJA 1KX3D 3VH5A 1S32D 2AROA 3A6NA 3AZHB 5BNXA 5B31G 5AV6A 1P3PD 4H9SA 5B0YA 1P3AC 1P3IC 1EQZA 4J8UC 4ZBJB 3AZJC 4DRAA 5B1MA 5B40D 4J8VA 2IO5B 1B67A 3WAAC 2AROC 3A6NC 2CV5B 3X1UB 5AV6C 5JRGB 3REKA 5B1MC 3UTBC 4J8VC 4KGCB 1R4VA 4YS3D 3AZND 1H3OA 3X1SB 5AV8B 3AZLB 3LZ0D 3AZKB 3REKC 5B1LA 3W98A 4EO5B 3LJAA 4JJND 3AYWB 1M1AB 3W97D 5DNND 4J8WC 4ZUXA 1ID3A 2RVQC 1P3LA 5GXQD 4XZQD 2HIOD 1AOID 5B1LC 3W98C 3LJAC 2PYOD 5DNMD 3AZFB 3LZ1A 1P3GB 1ID3C 5JA4B 1ULYA 1P34C 1P3LC 3KSYA 3AZIA 1F66B 3B6GA 1HQ3B 3LZ1C 5E5AD 3AV1A 1P3OD 3AZIC 5GT3A 2NZDB 5AVBA 3B6GC 1KX5D 5BO0B 3KWQB 3AV1C 3AZMA 3MGPA 3UTAA 1BFMA 5GT3C 3KXBA 4Z5TB 5AVBC 3AZHD 3W96A 3REJB 2YFWB 4E44A 3AZMC 5CPKA 3MGPC 1U35A 3MVDA 1B6WA 3KXBC 4H9PB 5F99B 3W96C 3O62B 2CV5D 5B2JB 5CPKC 5AV5A 5B31B 4KGCD 3AZED 3VH6A 3V9RA 3MGRB 3AN2A 3AZLD 4J8XB 5AY8A 5CP6A 5AV5C 3TU4A 2FJ7D 2F8NA 3AYWD 5CPID 1BH9B 3UT9A 4UUZA 3AFAD 1S32B 5AY8C 3WKJB 3TU4C 1TZYB 4QLCA 1P3PB 1P3FA 1P3BA 3UT9C 1M19A 5B40B 3WTPA 4KUDA 1P3MB 2NQBD 3WA9C 4WU8C 3W99A 4QLCC 4G92B 5B32C 1P3FC 1P3BC 1F66D 4LD9A 3REIB 1HQ3D 3WTPC 4KUDC 5B0ZA 3KUYA 5GSUB 3B0CW 4YS3B 3AZNB 3W99C 4H9RB 5B24A 3C1CB 2F8NH 2NZDD 3LZ0B 4LD9C 4WNNB 5AV9B 3KWQD 5B0ZC 3KUYC 3W97B 3AV2A 5G49B 5GT0B 4J8UB 3AZJB 4Z5TD 3MNNA 4XZQB 1Q9CA 4NFTA 2YFVB 5BS7A 3AV2C 5BNXB 1EQZB 3B0DC 5B0YB 4KHAA 5BT1C 3MNNC 5F99D 3O62D 5B2JD 5BS7C 4YM6C 4WV4B 4E45A 1F1EA 4CSRA 3MGRD 1KX3A 1WWSA 1ZLAC 5FUGA 1P3AA 4H9QB 3LJAB 5B33D 1KX3C 4X23B 4AWLB 3WAAA 4ZUXB 3WKJD 1TZYD 5AVCA 3MGSA 3UTBA 1WWIA 1P3MD 4G91B 3REID 4WU9A 5AVCC 3MGSC 5GSUD 3AZEB 5BNVB 3WTPE 3C1BD 3AV1B 5DNNA 4J8WA 3REHD 3C1CD 4Z2MH 2BYMB 5GT3B 5GXQA 4H9OB 3MGQA 4WU9C 5AV9D 2FJ7B 5C3IC 3LELA 4JJNC 5CPIB 3X1SA 5DNMA 3AFAB 5DNNC 1KX4B 5GT0D 4J8UD 3AZJD 3B0CT 3UTAB 3X1VA 1P34A 5GXQC 3MGQC 2HIOC 1AOIC 3LELC 2AROD 3A6ND 3W96B 1EQZD 4H9NB 5DNMC 5B0YD 1U35B 2NQBB 5B1MD 3X1VC 3MVDB 3NQJB 4J8VD 3X1TB 2BYKB 4HGAC 3REKD 5E5AC 4Z66A 1P3OC 3AN2B 1KX5C 5CP6B 5AY8B 5B1LD 3LJAD 4Z66C 4X23D 4ZUXD 4DRBA 3AZHC 2CV5A 3X1UA 5JRGA 4M6BA 4ZBJC 1P3BB 1M19B 5CPJB 2IO5C 3LZ1D 4KGCA 2CV5C 3X1UC
chains in the Genus database with same CATH superfamily
5AV8A 1PZRA 3W99B 3AZID 5JRGC 3AZKA 3B6GD 4WZSB 1M1AA 4KGCC 3B6FB 3AV1D 1P3KB 3AZGB 3X1SC 5AV8C 2LY8A 5B24B 5GT3D 3AZKC 3RELB 4EO5C 1M1AC 1Z2CB 5B33B 3AZMD 1KX4D 4CAYA 3MGPD 3AZFA 1P3GA 3UTAD 5JA4A 3WA9A 4WU8A 4XUJB 5B32A 3W96D 1HTAA 5B2IA 3AZFC 1U35D 1P3GC 4KHAB 3MVDD 3X1TD 1F66C 1JFIA 1HQ3C 5B2IC 5BO0A 5AV5D 3C1BB 1N1JB 4CSRB 2HUEB 3REHB 2UWXA 3R45A 4Z5TA 3AN2D 5AY8D 5CP6D 3KWQC 3REJA 2XD5A 2YFWA 4NE6A 2F8ND 2F8NK 1P3AB 1P3IB 4Z5TC 4H9PA 3WAAB 3O62A 2AROB 3A6NB 3REJC 4YM6A 4QLCD 5AV6B 5B31A 1P3BD 1M19D 5CPJD 3WTPD 5B1MB 3UTBB 4J8VB 5F99C 1BH8A 3O62C 5B2JC 1ZLAA 3W99D 4J8XA 5B31C 1M18A 2F8NG 4LD9D 4R8PA 3REKB 4WU9B 3B6FD 1BH9A 3B0BA 1P3KD 3AZGD 1H3OB 4J8WB 3P5JB 5B24D 4J8XC 1S32A 1M18C 3RELD 3VH5W 4R8PC 5B32G 1P3PA 5B1LB 3W98B 5B40A 1S32C 1ID3B 3WKJC 4XUJD 1P34B 1P3LB 1TZYC 1P3PC 5B40C 3LZ1B 1P3MC 4YS3A 3AZNA 4H9RA 4G92C 3AZIB 3LZ0A 1TAFA 3REIC 3B6GB 5AV9A 3W97A 4JJNA 2Y2MA 5GSUC 4YS3C 5KDMA 5G49A 3AZNC 5GT0A 3C1CC 3LZ0C 4XZQA 2HIOA 5AVBB 1AOIA 5AV9C 3W97C 2YFVA 2CWEA 2PYOA 3AZMB 1P3ID 1P3AD 3MGPB 5GT0C 3KXBB 4XZQC 3WAAD 2PYOC 2VQRA 5AV6D 5CPKB 1EQZC 4H9SC 5B0YC 5E5AA 5AVCD 3MGSD 3UTBD 1P3OA 3NQUA 1KX5A 5AV5B 4Z2MG 4WU9D 4H9QA 4X23A 3V9RB 4J8WD 2RVQD 3AZHA 3TU4B 3MGQD 3W98D 2F8NB 2JSSA 3LELD 3UT9B 4X23C 4AWLC 4UUZB 4CAYB 1ID3D 4ZUXC 1P3LD 3X1VD 1P34D 3WA9B 4WU8B 4QLCB 3IP4C 5B32B 1P3FB 3VH5T 3WTPB 3X1UC 4G91C 5B2IB 5BNVA 3AZEA 4KUDB 3VH6W 3AZLA 2BYMA 2FJ7A 4H9OA 3H0MC 4LD9B 1JFIB 3AYWA 1KU5A 3AZEC 5CPIA 5B0ZB 3KUYB 3AFAA 1KX4A 4Z66D 3AZLC 3R45B 2W8SA 5AVBD 2FJ7C 3AYWC 2FFFB 5CPIC 4H9NA 3AFAC 3AV2B 1KX4C 3A1IA 3B0DB 2NQBA 3UTAC 3KXBD 3NQJA 3MNNB 3X1TA 1F66A 2BYKA 2L5AA 2Y2IA 1HQ3A 3X1UD 4YM6B 5CPKD 5JRGD 1U35C 2NQBC 3MVDC 2NZDA 2BG1A 3X1TC 1BH8B 3X1SD 1ZLAB 5AV8D 3KWQA 3AZKD 1M18B 4R8PB 4NE5A 2ZY2A 1M1AD 2NZDC 1KX3B 3AN2C 2JCHA 5CHLB 3TU4D 2DF4C 5CP6C 5FUGB 3UT9D 5CPJA 3AZFD 1P3GD 5F99A 3WA9D 5B2JA 4WU8D 5B32D 1P3FD 1M19C 5CPJC 5AVCB 3MGSB 5B2ID 3EPLA 3B6FA 4KUDD 3MGRA 1P3KA 3AZGA 2XD1A 3RELA 1TAFB 5B0ZD 5C3IB 3KUYD 4JJNB 5B33A 3B6FC 3MGRC 1P3KC 5DNNB 3AZGC 5KDMB 5B24C 2RIQA 3WKJA 1TZYA 4XUJA 3RELC 5GXQB 3MGQB 2HIOB 3VH6T 1AOIB 3LELB 5B33C 3REJD 3AV2D 2PYOB 5DNMB 1P3MA 5BT1D 3X1VB 3MNND 2Y2OA 4XUJC 1A7WA 3REIA 3EPHA 4YM6D 4HGAB 5B31D 5GSUA 3C1BA 1N1JA 5E5AB 3REHA 3C1CA 1P3OB 1ZLAD 4WNNA 4J8XD 1M18D 3NQUB 1KX5B 3C1BC 4R8PD 1P3IA 2HUEC 4NE3A 4J8UA 3REHC 4Z66B 3AZJA 1KX3D 3VH5A 1S32D 2AROA 3A6NA 3AZHB 5BNXA 5B31G 5AV6A 1P3PD 4H9SA 5B0YA 1P3AC 1P3IC 1EQZA 4J8UC 4ZBJB 3AZJC 4DRAA 5B1MA 5B40D 4J8VA 2IO5B 1B67A 3WAAC 2AROC 3A6NC 2CV5B 3X1UB 5AV6C 5JRGB 3REKA 5B1MC 3UTBC 4J8VC 4KGCB 1R4VA 4YS3D 3AZND 1H3OA 3X1SB 5AV8B 3AZLB 3A1KA 3LZ0D 3AZKB 3H0RC 3REKC 5B1LA 3W98A 4EO5B 3LJAA 4JJND 3AYWB 1M1AB 2J8PA 3W97D 2Y2KA 5DNND 3AL0C 4J8WC 3EG5B 4ZUXA 1ID3A 2RVQC 1P3LA 5GXQD 4XZQD 2HIOD 1AOID 5B1LC 3W98C 3LJAC 2PYOD 5DNMD 3AZFB 3LZ1A 1P3GB 1ID3C 5JA4B 1T3UA 1ULYA 1P34C 1P3LC 2Y2NA 2ZY5A 3KSYA 3AZIA 1F66B 3B6GA 1HQ3B 3LZ1C 5E5AD 3AV1A 4UPKA 1P3OD 3AZIC 2DQNC 5GT3A 2NZDB 5AVBA 3B6GC 1KX5D 5BO0B 3KWQB 3AV1C 3AZMA 3MGPA 3UTAA 1BFMA 5GT3C 3KXBA 4Z5TB 5AVBC 3AZHD 3W96A 3REJB 2YFWB 4E44A 3AZMC 5CPKA 3MGPC 1U35A 3MVDA 1B6WA 3KXBC 4H9PB 5F99B 3W96C 3O62B 2CV5D 5B2JB 5CPKC 5AV5A 5B31B 4KGCD 3AZED 3VH6A 3V9RA 3MGRB 3AN2A 3AZLD 4J8XB 5AY8A 5CP6A 5AV5C 3TU4A 2FJ7D 2F8NA 3AYWD 5CPID 1BH9B 3UT9A 3F6TA 4UUZA 3AFAD 2Y2QA 1S32B 5AY8C 3WKJB 3TU4C 1TZYB 4QLCA 1P3PB 1P3FA 1P3BA 3UT9C 1M19A 5B40B 3WTPA 4KUDA 1P3MB 2NQBD 3WA9C 4WU8C 3W99A 4QLCC 4G92B 5B32C 1P3FC 1P3BC 1F66D 4LD9A 3REIB 1HQ3D 3WTPC 4KUDC 5B0ZA 3KUYA 5GSUB 3B0CW 4YS3B 3AZNB 3W99C 4H9RB 5B24A 3C1CB 2F8NH 2NZDD 3LZ0B 4LD9C 2JE5A 4WNNB 5AV9B 3KWQD 5B0ZC 3KUYC 3W97B 3AV2A 3H0LC 5G49B 5GT0B 4J8UB 3AZJB 4Z5TD 3MNNA 4XZQB 1Q9CA 4NFTA 2YFVB 5BS7A 3AV2C 5BNXB 2ZY4A 1EQZB 3B0DC 5B0YB 4KHAA 5BT1C 2Y2GA 3MNNC 5F99D 3O62D 5B2JD 5BS7C 4YM6C 4WV4B 4E45A 1F1EA 4CSRA 3EPKA 3MGRD 1KX3A 1WWSA 1ZLAC 5FUGA 1P3AA 4H9QB 3LJAB 5B33D 1KX3C 4X23B 4AWLB 3WAAA 1W2EA 4ZUXB 3WKJD 2ZM5A 1TZYD 2Y2LA 5AVCA 3MGSA 3UTBA 1WWIA 1P3MD 4G91B 3EPJA 3KFUG 3REID 4WU9A 5AVCC 3MGSC 5GSUD 3AZEB 2Y2HA 5BNVB 3WTPE 3C1BD 3AV1B 5DNNA 4J8WA 3REHD 3C1CD 4Z2MH 2BYMB 5GT3B 5GXQA 4H9OB 3MGQA 4WU9C 5AV9D 2FJ7B 5C3IC 3LELA 4JJNC 5CPIB 5DNMA 3AFAB 5DNNC 1KX4B 5GT0D 4J8UD 3AZJD 3B0CT 3UTAB 3X1VA 1P34A 4WJ3C 5GXQC 3MGQC 2HIOC 1AOIC 2ZY3A 3LELC 2AROD 3A6ND 3W96B 1EQZD 4H9NB 5DNMC 5B0YD 1U35B 2NQBB 5B1MD 3X1VC 3MVDB 3NQJB 4J8VD 3X1TB 2F2AC 2BYKB 4HGAC 3REKD 5E5AC 4Z66A 2G5HC 1P3OC 4DQYB 3AN2B 1KX5C 5CP6B 5AY8B 5B1LD 3LJAD 4Z66C 4X23D 4ZUXD 2Y2PA 4DRBA 3AZHC 2CV5A 3X1UA 2G5IC 5JRGA 4M6BA 4ZBJC 1P3BB 2Y2JA 5CPJB 1M19B 2IO5C 3LZ1D 4KGCA 3FDDA 2CV5C 3X1SA
chains in the Genus database with same CATH topology
5AV8A 1PZRA 3W99B 3AZID 5JRGC 3AZKA 3B6GD 4WZSB 1M1AA 4KGCC 3B6FB 3AV1D 1P3KB 3AZGB 3X1SC 5AV8C 2LY8A 5B24B 5GT3D 3AZKC 3RELB 4EO5C 1M1AC 1Z2CB 5B33B 3AZMD 1KX4D 4CAYA 3MGPD 3AZFA 1P3GA 3UTAD 5JA4A 3WA9A 4WU8A 4XUJB 5B32A 3W96D 1HTAA 5B2IA 3AZFC 1U35D 1P3GC 4KHAB 3MVDD 3X1TD 1F66C 1JFIA 1HQ3C 5B2IC 5BO0A 5AV5D 3C1BB 1N1JB 4CSRB 2HUEB 3REHB 2UWXA 3R45A 4Z5TA 3AN2D 5AY8D 5CP6D 3KWQC 3REJA 2XD5A 2YFWA 4NE6A 2F8ND 2F8NK 1P3AB 1P3IB 4Z5TC 4H9PA 3WAAB 3O62A 2AROB 3A6NB 3REJC 4YM6A 4QLCD 5AV6B 5B31A 1P3BD 1M19D 5CPJD 3WTPD 5B1MB 3UTBB 4J8VB 5F99C 1BH8A 3O62C 5B2JC 1ZLAA 3W99D 4J8XA 5B31C 1M18A 2F8NG 4LD9D 4R8PA 3REKB 4WU9B 3B6FD 1BH9A 3B0BA 1P3KD 3AZGD 1H3OB 4J8WB 3P5JB 5B24D 4J8XC 1S32A 1M18C 3RELD 3VH5W 4R8PC 5B32G 1P3PA 5B1LB 3W98B 5B40A 1S32C 1ID3B 3WKJC 4XUJD 1P34B 1P3LB 1TZYC 1P3PC 5B40C 3LZ1B 1P3MC 4YS3A 3AZNA 4H9RA 4G92C 3AZIB 3LZ0A 1TAFA 3REIC 3B6GB 5AV9A 3W97A 4JJNA 2Y2MA 5GSUC 4YS3C 5KDMA 5G49A 3AZNC 5GT0A 3C1CC 3LZ0C 4XZQA 2HIOA 5AVBB 1AOIA 5AV9C 3W97C 2YFVA 2CWEA 2PYOA 3AZMB 1P3ID 1P3AD 3MGPB 5GT0C 3KXBB 4XZQC 3WAAD 2PYOC 2VQRA 5AV6D 5CPKB 1EQZC 4H9SC 5B0YC 5E5AA 5AVCD 3MGSD 3UTBD 1P3OA 3NQUA 1KX5A 5AV5B 4Z2MG 4WU9D 4H9QA 4X23A 3V9RB 4J8WD 2RVQD 3AZHA 3TU4B 3MGQD 3W98D 2F8NB 2JSSA 3LELD 3UT9B 4X23C 4AWLC 4UUZB 4CAYB 1ID3D 4ZUXC 1P3LD 3X1VD 1P34D 3WA9B 4WU8B 4QLCB 3IP4C 5B32B 1P3FB 3VH5T 3WTPB 3X1UC 4G91C 5B2IB 5BNVA 3AZEA 4KUDB 3VH6W 3AZLA 2BYMA 2FJ7A 4H9OA 3H0MC 4LD9B 1JFIB 3AYWA 1KU5A 3AZEC 5CPIA 5B0ZB 3KUYB 3AFAA 1KX4A 4Z66D 3AZLC 3R45B 2W8SA 5AVBD 2FJ7C 3AYWC 2FFFB 5CPIC 4H9NA 3AFAC 3AV2B 1KX4C 3A1IA 3B0DB 2NQBA 3UTAC 3KXBD 3NQJA 3MNNB 3X1TA 1F66A 2BYKA 2L5AA 2Y2IA 1HQ3A 3X1UD 4YM6B 5CPKD 5JRGD 1U35C 2NQBC 3MVDC 2NZDA 2BG1A 3X1TC 1BH8B 3X1SD 1ZLAB 5AV8D 3KWQA 3AZKD 1M18B 4R8PB 4NE5A 2ZY2A 1M1AD 2NZDC 1KX3B 3AN2C 2JCHA 5CHLB 3TU4D 2DF4C 5CP6C 5FUGB 3UT9D 5CPJA 3AZFD 1P3GD 5F99A 3WA9D 5B2JA 4WU8D 5B32D 1P3FD 1M19C 5CPJC 5AVCB 3MGSB 5B2ID 3EPLA 3B6FA 4KUDD 3MGRA 1P3KA 3AZGA 2XD1A 3RELA 1TAFB 5B0ZD 5C3IB 3KUYD 4JJNB 5B33A 3B6FC 3MGRC 1P3KC 5DNNB 3AZGC 5KDMB 5B24C 2RIQA 3WKJA 1TZYA 4XUJA 3RELC 5GXQB 3MGQB 2HIOB 3VH6T 1AOIB 3LELB 5B33C 3REJD 3AV2D 2PYOB 5DNMB 1P3MA 5BT1D 3X1VB 3MNND 2Y2OA 4XUJC 1A7WA 3REIA 3EPHA 4YM6D 4HGAB 5B31D 5GSUA 3C1BA 1N1JA 5E5AB 3REHA 3C1CA 1P3OB 1ZLAD 4WNNA 4J8XD 1M18D 3NQUB 1KX5B 3C1BC 4R8PD 1P3IA 2HUEC 4NE3A 4J8UA 3REHC 4Z66B 3AZJA 1KX3D 3VH5A 1S32D 2AROA 3A6NA 3AZHB 5BNXA 5B31G 5AV6A 1P3PD 4H9SA 5B0YA 1P3AC 1P3IC 1EQZA 4J8UC 4ZBJB 3AZJC 4DRAA 5B1MA 5B40D 4J8VA 2IO5B 1B67A 3WAAC 2AROC 3A6NC 2CV5B 3X1UB 5AV6C 5JRGB 3REKA 5B1MC 3UTBC 4J8VC 4KGCB 1R4VA 4YS3D 3AZND 1H3OA 3X1SB 5AV8B 3AZLB 3A1KA 3LZ0D 3AZKB 3H0RC 3REKC 5B1LA 3W98A 4EO5B 3LJAA 4JJND 3AYWB 1M1AB 2J8PA 3W97D 2Y2KA 5DNND 3AL0C 4J8WC 3EG5B 4ZUXA 1ID3A 2RVQC 1P3LA 5GXQD 4XZQD 2HIOD 1AOID 5B1LC 3W98C 3LJAC 2PYOD 5DNMD 3AZFB 3LZ1A 1P3GB 1ID3C 5JA4B 1T3UA 1ULYA 1P34C 1P3LC 2Y2NA 2ZY5A 3KSYA 3AZIA 1F66B 3B6GA 1HQ3B 3LZ1C 5E5AD 3AV1A 4UPKA 1P3OD 3AZIC 2DQNC 5GT3A 2NZDB 5AVBA 3B6GC 1KX5D 5BO0B 3KWQB 3AV1C 3AZMA 3MGPA 3UTAA 1BFMA 5GT3C 3KXBA 4Z5TB 5AVBC 3AZHD 3W96A 3REJB 2YFWB 4E44A 3AZMC 5CPKA 3MGPC 1U35A 3MVDA 1B6WA 3KXBC 4H9PB 5F99B 3W96C 3O62B 2CV5D 5B2JB 5CPKC 5AV5A 5B31B 4KGCD 3AZED 3VH6A 3V9RA 3MGRB 3AN2A 3AZLD 4J8XB 5AY8A 5CP6A 5AV5C 3TU4A 2FJ7D 2F8NA 3AYWD 5CPID 1BH9B 3UT9A 3F6TA 4UUZA 3AFAD 2Y2QA 1S32B 5AY8C 3WKJB 3TU4C 1TZYB 4QLCA 1P3PB 1P3FA 1P3BA 3UT9C 1M19A 5B40B 3WTPA 4KUDA 1P3MB 2NQBD 3WA9C 4WU8C 3W99A 4QLCC 4G92B 5B32C 1P3FC 1P3BC 1F66D 4LD9A 3REIB 1HQ3D 3WTPC 4KUDC 5B0ZA 3KUYA 5GSUB 3B0CW 4YS3B 3AZNB 3W99C 4H9RB 5B24A 3C1CB 2F8NH 2NZDD 3LZ0B 4LD9C 2JE5A 4WNNB 5AV9B 3KWQD 5B0ZC 3KUYC 3W97B 3AV2A 3H0LC 5G49B 5GT0B 4J8UB 3AZJB 4Z5TD 3MNNA 4XZQB 1Q9CA 4NFTA 2YFVB 5BS7A 3AV2C 5BNXB 2ZY4A 1EQZB 3B0DC 5B0YB 4KHAA 5BT1C 2Y2GA 3MNNC 5F99D 3O62D 5B2JD 5BS7C 4YM6C 4WV4B 4E45A 1F1EA 4CSRA 3EPKA 3MGRD 1KX3A 1WWSA 1ZLAC 5FUGA 1P3AA 4H9QB 3LJAB 5B33D 1KX3C 4X23B 4AWLB 3WAAA 1W2EA 4ZUXB 3WKJD 2ZM5A 1TZYD 2Y2LA 5AVCA 3MGSA 3UTBA 1WWIA 1P3MD 4G91B 3EPJA 3KFUG 3REID 4WU9A 5AVCC 3MGSC 5GSUD 3AZEB 2Y2HA 5BNVB 3WTPE 3C1BD 3AV1B 5DNNA 4J8WA 3REHD 3C1CD 4Z2MH 2BYMB 5GT3B 5GXQA 4H9OB 3MGQA 4WU9C 5AV9D 2FJ7B 5C3IC 3LELA 4JJNC 5CPIB 5DNMA 3AFAB 5DNNC 1KX4B 5GT0D 4J8UD 3AZJD 3B0CT 3UTAB 3X1VA 1P34A 4WJ3C 5GXQC 3MGQC 2HIOC 1AOIC 2ZY3A 3LELC 2AROD 3A6ND 3W96B 1EQZD 4H9NB 5DNMC 5B0YD 1U35B 2NQBB 5B1MD 3X1VC 3MVDB 3NQJB 4J8VD 3X1TB 2F2AC 2BYKB 4HGAC 3REKD 5E5AC 4Z66A 2G5HC 1P3OC 4DQYB 3AN2B 1KX5C 5CP6B 5AY8B 5B1LD 3LJAD 4Z66C 4X23D 4ZUXD 2Y2PA 4DRBA 3AZHC 2CV5A 3X1UA 2G5IC 5JRGA 4M6BA 4ZBJC 1P3BB 2Y2JA 5CPJB 1M19B 2IO5C 3LZ1D 4KGCA 3FDDA 2CV5C 3X1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV8 A;  3W99 B;  3AZI D;  5JRG C;  3AZK A;  3B6G D;  4WZS B;  1M1A A;  4KGC C;  3B6F B;  3AV1 D;  1P3K B;  3AZG B;  3X1S C;  5AV8 C;  2LY8 A;  5B24 B;  5GT3 D;  3AZK C;  3REL B;  4EO5 C;  1M1A C;  5B33 B;  3AZM D;  1KX4 D;  4CAY A;  3MGP D;  3AZF A;  1P3G A;  3UTA D;  5JA4 A;  3WA9 A;  4WU8 A;  4XUJ B;  5B32 A;  3W96 D;  1HTA A;  5B2I A;  3AZF C;  1U35 D;  1P3G C;  4KHA B;  3MVD D;  3X1T D;  1F66 C;  1JFI A;  1HQ3 C;  5B2I C;  5BO0 A;  5AV5 D;  3C1B B;  1N1J B;  4CSR B;  2HUE B;  3REH B;  3R45 A;  4Z5T A;  3AN2 D;  5AY8 D;  5CP6 D;  3KWQ C;  3REJ A;  2YFW A;  4NE6 A;  2F8N D;  2F8N K;  1P3A B;  1P3I B;  4Z5T C;  4H9P A;  3WAA B;  3O62 A;  2ARO B;  3A6N B;  3REJ C;  4YM6 A;  4QLC D;  5AV6 B;  5B31 A;  1P3B D;  1M19 D;  5CPJ D;  3WTP D;  5B1M B;  3UTB B;  4J8V B;  5F99 C;  1BH8 A;  3O62 C;  5B2J C;  1ZLA A;  3W99 D;  4J8X A;  5B31 C;  1M18 A;  2F8N G;  4LD9 D;  4R8P A;  3REK B;  4WU9 B;  3B6F D;  1BH9 A;  3B0B A;  1P3K D;  3AZG D;  1H3O B;  4J8W B;  1S32 A;  5B24 D;  4J8X C;  1M18 C;  3REL D;  3VH5 W;  4R8P C;  5B32 G;  1P3P A;  5B1L B;  3W98 B;  5B40 A;  1S32 C;  1ID3 B;  3WKJ C;  4XUJ D;  1P34 B;  1P3L B;  1TZY C;  1P3P C;  5B40 C;  3LZ1 B;  1P3M C;  4YS3 A;  3AZN A;  4H9R A;  4G92 C;  3AZI B;  3LZ0 A;  1TAF A;  3REI C;  3B6G B;  5AV9 A;  3W97 A;  4JJN A;  5GSU C;  4YS3 C;  5KDM A;  5G49 A;  3AZN C;  5GT0 A;  3C1C C;  3LZ0 C;  4XZQ A;  2HIO A;  5AVB B;  1AOI A;  5AV9 C;  3W97 C;  2YFV A;  2CWE A;  2PYO A;  3AZM B;  1P3I D;  1P3A D;  3MGP B;  5GT0 C;  3KXB B;  4XZQ C;  3WAA D;  2PYO C;  5AV6 D;  5CPK B;  1EQZ C;  4H9S C;  5B0Y C;  5E5A A;  5AVC D;  3MGS D;  3UTB D;  1P3O A;  3NQU A;  1KX5 A;  5AV5 B;  4Z2M G;  4WU9 D;  4H9Q A;  4X23 A;  3V9R B;  4J8W D;  2RVQ D;  3AZH A;  3TU4 B;  3MGQ D;  3W98 D;  2F8N B;  2JSS A;  3LEL D;  3UT9 B;  4X23 C;  4AWL C;  4UUZ B;  4CAY B;  1ID3 D;  4ZUX C;  1P3L D;  3X1V D;  1P34 D;  3WA9 B;  4WU8 B;  4QLC B;  5B32 B;  1P3F B;  3VH5 T;  3WTP B;  4G91 C;  5B2I B;  5BNV A;  3AZE A;  4KUD B;  3VH6 W;  3AZL A;  2BYM A;  2FJ7 A;  4H9O A;  4LD9 B;  1JFI B;  3AYW A;  1KU5 A;  3AZE C;  5CPI A;  5B0Z B;  3KUY B;  3AFA A;  1KX4 A;  4Z66 D;  3AZL C;  3R45 B;  5AVB D;  2FJ7 C;  3AYW C;  5CPI C;  4H9N A;  3AFA C;  3AV2 B;  1KX4 C;  3B0D B;  2NQB A;  3UTA C;  3KXB D;  3NQJ A;  3MNN B;  3X1T A;  1F66 A;  2BYK A;  2L5A A;  3X1U D;  1HQ3 A;  5CPK D;  4YM6 B;  5JRG D;  1U35 C;  2NQB C;  3MVD C;  2NZD A;  3X1T C;  1BH8 B;  3X1S D;  1ZLA B;  5AV8 D;  3KWQ A;  3AZK D;  1M18 B;  4R8P B;  4NE5 A;  1M1A D;  2NZD C;  1KX3 B;  3AN2 C;  5CHL B;  3TU4 D;  5CP6 C;  5FUG B;  3UT9 D;  5CPJ A;  3AZF D;  1P3G D;  5F99 A;  3WA9 D;  5B2J A;  4WU8 D;  5B32 D;  1P3F D;  1M19 C;  5CPJ C;  5AVC B;  3MGS B;  5B2I D;  4KUD D;  3B6F A;  3MGR A;  1P3K A;  3AZG A;  3REL A;  1TAF B;  5B0Z D;  5C3I B;  3KUY D;  4JJN B;  5B33 A;  3B6F C;  3MGR C;  1P3K C;  5DNN B;  3AZG C;  5KDM B;  5B24 C;  3WKJ A;  1TZY A;  4XUJ A;  3REL C;  5GXQ B;  3MGQ B;  2HIO B;  3VH6 T;  1AOI B;  3LEL B;  5B33 C;  3REJ D;  3AV2 D;  2PYO B;  5DNM B;  1P3M A;  5BT1 D;  3X1V B;  3MNN D;  4XUJ C;  1A7W A;  3REI A;  4YM6 D;  4HGA B;  5B31 D;  5GSU A;  3C1B A;  1N1J A;  5E5A B;  3REH A;  3C1C A;  1P3O B;  1ZLA D;  4WNN A;  4J8X D;  1M18 D;  3NQU B;  1KX5 B;  3C1B C;  4R8P D;  1P3I A;  2HUE C;  4NE3 A;  4J8U A;  3REH C;  4Z66 B;  3AZJ A;  1KX3 D;  3VH5 A;  1S32 D;  2ARO A;  3A6N A;  3AZH B;  5BNX A;  5B31 G;  5AV6 A;  1P3P D;  4H9S A;  5B0Y A;  1P3A C;  1P3I C;  1EQZ A;  4J8U C;  4ZBJ B;  3AZJ C;  4DRA A;  5B1M A;  5B40 D;  4J8V A;  2IO5 B;  1B67 A;  3WAA C;  2ARO C;  3A6N C;  2CV5 B;  3X1U B;  5AV6 C;  5JRG B;  3REK A;  5B1M C;  3UTB C;  4J8V C;  4KGC B;  1R4V A;  4YS3 D;  3AZN D;  1H3O A;  3X1S B;  5AV8 B;  3AZL B;  3LZ0 D;  3AZK B;  3REK C;  5B1L A;  3W98 A;  4EO5 B;  3LJA A;  4JJN D;  3AYW B;  1M1A B;  3W97 D;  5DNN D;  4J8W C;  4ZUX A;  1ID3 A;  2RVQ C;  1P3L A;  5GXQ D;  4XZQ D;  2HIO D;  1AOI D;  5B1L C;  3W98 C;  3LJA C;  2PYO D;  5DNM D;  3AZF B;  3LZ1 A;  1P3G B;  1ID3 C;  5JA4 B;  1ULY A;  1P34 C;  1P3L C;  3KSY A;  3AZI A;  1F66 B;  3B6G A;  1HQ3 B;  3LZ1 C;  5E5A D;  3AV1 A;  1P3O D;  3AZI C;  5GT3 A;  2NZD B;  5AVB A;  3B6G C;  1KX5 D;  5BO0 B;  3KWQ B;  3AV1 C;  3AZM A;  3MGP A;  3UTA A;  1BFM A;  5GT3 C;  3KXB A;  4Z5T B;  5AVB C;  3AZH D;  3W96 A;  3REJ B;  2YFW B;  4E44 A;  3AZM C;  5CPK A;  3MGP C;  1U35 A;  3MVD A;  1B6W A;  3KXB C;  4H9P B;  5F99 B;  3W96 C;  3O62 B;  2CV5 D;  5B2J B;  5CPK C;  5AV5 A;  5B31 B;  4KGC D;  3AZE D;  3VH6 A;  3V9R A;  3MGR B;  3AN2 A;  3AZL D;  4J8X B;  5AY8 A;  5CP6 A;  5AV5 C;  3TU4 A;  2FJ7 D;  2F8N A;  3AYW D;  5CPI D;  1BH9 B;  3UT9 A;  4UUZ A;  3AFA D;  1S32 B;  5AY8 C;  3WKJ B;  3TU4 C;  1TZY B;  4QLC A;  1P3P B;  1P3F A;  1P3B A;  3UT9 C;  1M19 A;  5B40 B;  3WTP A;  4KUD A;  1P3M B;  2NQB D;  3WA9 C;  4WU8 C;  3W99 A;  4QLC C;  4G92 B;  5B32 C;  1P3F C;  1P3B C;  1F66 D;  4LD9 A;  3REI B;  1HQ3 D;  3WTP C;  4KUD C;  5B0Z A;  3KUY A;  5GSU B;  3B0C W;  4YS3 B;  3AZN B;  3W99 C;  4H9R B;  5B24 A;  3C1C B;  2F8N H;  2NZD D;  3LZ0 B;  4LD9 C;  4WNN B;  5AV9 B;  3KWQ D;  5B0Z C;  3KUY C;  3W97 B;  3AV2 A;  5G49 B;  5GT0 B;  4J8U B;  3AZJ B;  4Z5T D;  3MNN A;  4XZQ B;  1Q9C A;  4NFT A;  2YFV B;  5BS7 A;  3AV2 C;  5BNX B;  1EQZ B;  3B0D C;  5B0Y B;  4KHA A;  5BT1 C;  3MNN C;  5F99 D;  3O62 D;  5B2J D;  5BS7 C;  4YM6 C;  4WV4 B;  4E45 A;  1F1E A;  4CSR A;  3MGR D;  1KX3 A;  1WWS A;  1ZLA C;  5FUG A;  1P3A A;  4H9Q B;  3LJA B;  5B33 D;  1KX3 C;  4X23 B;  4AWL B;  3WAA A;  4ZUX B;  3WKJ D;  1TZY D;  5AVC A;  3MGS A;  3UTB A;  1WWI A;  1P3M D;  4G91 B;  3REI D;  4WU9 A;  5AVC C;  3MGS C;  5GSU D;  3AZE B;  5BNV B;  3WTP E;  3C1B D;  3AV1 B;  5DNN A;  4J8W A;  3REH D;  3C1C D;  4Z2M H;  2BYM B;  5GT3 B;  5GXQ A;  4H9O B;  3MGQ A;  4WU9 C;  5AV9 D;  2FJ7 B;  5C3I C;  3LEL A;  4JJN C;  5CPI B;  3X1S A;  5DNM A;  3AFA B;  5DNN C;  1KX4 B;  5GT0 D;  4J8U D;  3AZJ D;  3B0C T;  3UTA B;  3X1V A;  1P34 A;  5GXQ C;  3MGQ C;  2HIO C;  1AOI C;  3LEL C;  2ARO D;  3A6N D;  3W96 B;  1EQZ D;  4H9N B;  5DNM C;  5B0Y D;  1U35 B;  2NQB B;  5B1M D;  3X1V C;  3MVD B;  3NQJ B;  4J8V D;  3X1T B;  2BYK B;  4HGA C;  3REK D;  5E5A C;  4Z66 A;  1P3O C;  3AN2 B;  1KX5 C;  5CP6 B;  5AY8 B;  5B1L D;  3LJA D;  4Z66 C;  4X23 D;  4ZUX D;  4DRB A;  3AZH C;  2CV5 A;  3X1U A;  5JRG A;  4M6B A;  4ZBJ C;  1P3B B;  1M19 B;  5CPJ B;  2IO5 C;  3LZ1 D;  4KGC A;  2CV5 C;  3X1U C; 
#chains in the Genus database with same CATH topology
 5AV8 A;  1PZR A;  3W99 B;  3AZI D;  5JRG C;  3AZK A;  3B6G D;  4WZS B;  1M1A A;  4KGC C;  3B6F B;  3AV1 D;  1P3K B;  3AZG B;  3X1S C;  5AV8 C;  2LY8 A;  5B24 B;  5GT3 D;  3AZK C;  3REL B;  4EO5 C;  1M1A C;  1Z2C B;  5B33 B;  3AZM D;  1KX4 D;  4CAY A;  3MGP D;  3AZF A;  1P3G A;  3UTA D;  5JA4 A;  3WA9 A;  4WU8 A;  4XUJ B;  5B32 A;  3W96 D;  1HTA A;  5B2I A;  3AZF C;  1U35 D;  1P3G C;  4KHA B;  3MVD D;  3X1T D;  1F66 C;  1JFI A;  1HQ3 C;  5B2I C;  5BO0 A;  5AV5 D;  3C1B B;  1N1J B;  4CSR B;  2HUE B;  3REH B;  2UWX A;  3R45 A;  4Z5T A;  3AN2 D;  5AY8 D;  5CP6 D;  3KWQ C;  3REJ A;  2XD5 A;  2YFW A;  4NE6 A;  2F8N D;  2F8N K;  1P3A B;  1P3I B;  4Z5T C;  4H9P A;  3WAA B;  3O62 A;  2ARO B;  3A6N B;  3REJ C;  4YM6 A;  4QLC D;  5AV6 B;  5B31 A;  1P3B D;  1M19 D;  5CPJ D;  3WTP D;  5B1M B;  3UTB B;  4J8V B;  5F99 C;  1BH8 A;  3O62 C;  5B2J C;  1ZLA A;  3W99 D;  4J8X A;  5B31 C;  1M18 A;  2F8N G;  4LD9 D;  4R8P A;  3REK B;  4WU9 B;  3B6F D;  1BH9 A;  3B0B A;  1P3K D;  3AZG D;  1H3O B;  4J8W B;  3P5J B;  5B24 D;  4J8X C;  1S32 A;  1M18 C;  3REL D;  3VH5 W;  4R8P C;  5B32 G;  1P3P A;  5B1L B;  3W98 B;  5B40 A;  1S32 C;  1ID3 B;  3WKJ C;  4XUJ D;  1P34 B;  1P3L B;  1TZY C;  1P3P C;  5B40 C;  3LZ1 B;  1P3M C;  4YS3 A;  3AZN A;  4H9R A;  4G92 C;  3AZI B;  3LZ0 A;  1TAF A;  3REI C;  3B6G B;  5AV9 A;  3W97 A;  4JJN A;  2Y2M A;  5GSU C;  4YS3 C;  5KDM A;  5G49 A;  3AZN C;  5GT0 A;  3C1C C;  3LZ0 C;  4XZQ A;  2HIO A;  5AVB B;  1AOI A;  5AV9 C;  3W97 C;  2YFV A;  2CWE A;  2PYO A;  3AZM B;  1P3I D;  1P3A D;  3MGP B;  5GT0 C;  3KXB B;  4XZQ C;  3WAA D;  2PYO C;  2VQR A;  5AV6 D;  5CPK B;  1EQZ C;  4H9S C;  5B0Y C;  5E5A A;  5AVC D;  3MGS D;  3UTB D;  1P3O A;  3NQU A;  1KX5 A;  5AV5 B;  4Z2M G;  4WU9 D;  4H9Q A;  4X23 A;  3V9R B;  4J8W D;  2RVQ D;  3AZH A;  3TU4 B;  3MGQ D;  3W98 D;  2F8N B;  2JSS A;  3LEL D;  3UT9 B;  4X23 C;  4AWL C;  4UUZ B;  4CAY B;  1ID3 D;  4ZUX C;  1P3L D;  3X1V D;  1P34 D;  3WA9 B;  4WU8 B;  4QLC B;  3IP4 C;  5B32 B;  1P3F B;  3VH5 T;  3WTP B;  3X1U C;  4G91 C;  5B2I B;  5BNV A;  3AZE A;  4KUD B;  3VH6 W;  3AZL A;  2BYM A;  2FJ7 A;  4H9O A;  3H0M C;  4LD9 B;  1JFI B;  3AYW A;  1KU5 A;  3AZE C;  5CPI A;  5B0Z B;  3KUY B;  3AFA A;  1KX4 A;  4Z66 D;  3AZL C;  3R45 B;  2W8S A;  5AVB D;  2FJ7 C;  3AYW C;  2FFF B;  5CPI C;  4H9N A;  3AFA C;  3AV2 B;  1KX4 C;  3A1I A;  3B0D B;  2NQB A;  3UTA C;  3KXB D;  3NQJ A;  3MNN B;  3X1T A;  1F66 A;  2BYK A;  2L5A A;  2Y2I A;  1HQ3 A;  3X1U D;  4YM6 B;  5CPK D;  5JRG D;  1U35 C;  2NQB C;  3MVD C;  2NZD A;  2BG1 A;  3X1T C;  1BH8 B;  3X1S D;  1ZLA B;  5AV8 D;  3KWQ A;  3AZK D;  1M18 B;  4R8P B;  4NE5 A;  2ZY2 A;  1M1A D;  2NZD C;  1KX3 B;  3AN2 C;  2JCH A;  5CHL B;  3TU4 D;  2DF4 C;  5CP6 C;  5FUG B;  3UT9 D;  5CPJ A;  3AZF D;  1P3G D;  5F99 A;  3WA9 D;  5B2J A;  4WU8 D;  5B32 D;  1P3F D;  1M19 C;  5CPJ C;  5AVC B;  3MGS B;  5B2I D;  3EPL A;  3B6F A;  4KUD D;  3MGR A;  1P3K A;  3AZG A;  2XD1 A;  3REL A;  1TAF B;  5B0Z D;  5C3I B;  3KUY D;  4JJN B;  5B33 A;  3B6F C;  3MGR C;  1P3K C;  5DNN B;  3AZG C;  5KDM B;  5B24 C;  2RIQ A;  3WKJ A;  1TZY A;  4XUJ A;  3REL C;  5GXQ B;  3MGQ B;  2HIO B;  3VH6 T;  1AOI B;  3LEL B;  5B33 C;  3REJ D;  3AV2 D;  2PYO B;  5DNM B;  1P3M A;  5BT1 D;  3X1V B;  3MNN D;  2Y2O A;  4XUJ C;  1A7W A;  3REI A;  3EPH A;  4YM6 D;  4HGA B;  5B31 D;  5GSU A;  3C1B A;  1N1J A;  5E5A B;  3REH A;  3C1C A;  1P3O B;  1ZLA D;  4WNN A;  4J8X D;  1M18 D;  3NQU B;  1KX5 B;  3C1B C;  4R8P D;  1P3I A;  2HUE C;  4NE3 A;  4J8U A;  3REH C;  4Z66 B;  3AZJ A;  1KX3 D;  3VH5 A;  1S32 D;  2ARO A;  3A6N A;  3AZH B;  5BNX A;  5B31 G;  5AV6 A;  1P3P D;  4H9S A;  5B0Y A;  1P3A C;  1P3I C;  1EQZ A;  4J8U C;  4ZBJ B;  3AZJ C;  4DRA A;  5B1M A;  5B40 D;  4J8V A;  2IO5 B;  1B67 A;  3WAA C;  2ARO C;  3A6N C;  2CV5 B;  3X1U B;  5AV6 C;  5JRG B;  3REK A;  5B1M C;  3UTB C;  4J8V C;  4KGC B;  1R4V A;  4YS3 D;  3AZN D;  1H3O A;  3X1S B;  5AV8 B;  3AZL B;  3A1K A;  3LZ0 D;  3AZK B;  3H0R C;  3REK C;  5B1L A;  3W98 A;  4EO5 B;  3LJA A;  4JJN D;  3AYW B;  1M1A B;  2J8P A;  3W97 D;  2Y2K A;  5DNN D;  3AL0 C;  4J8W C;  3EG5 B;  4ZUX A;  1ID3 A;  2RVQ C;  1P3L A;  5GXQ D;  4XZQ D;  2HIO D;  1AOI D;  5B1L C;  3W98 C;  3LJA C;  2PYO D;  5DNM D;  3AZF B;  3LZ1 A;  1P3G B;  1ID3 C;  5JA4 B;  1T3U A;  1ULY A;  1P34 C;  1P3L C;  2Y2N A;  2ZY5 A;  3KSY A;  3AZI A;  1F66 B;  3B6G A;  1HQ3 B;  3LZ1 C;  5E5A D;  3AV1 A;  4UPK A;  1P3O D;  3AZI C;  2DQN C;  5GT3 A;  2NZD B;  5AVB A;  3B6G C;  1KX5 D;  5BO0 B;  3KWQ B;  3AV1 C;  3AZM A;  3MGP A;  3UTA A;  1BFM A;  5GT3 C;  3KXB A;  4Z5T B;  5AVB C;  3AZH D;  3W96 A;  3REJ B;  2YFW B;  4E44 A;  3AZM C;  5CPK A;  3MGP C;  1U35 A;  3MVD A;  1B6W A;  3KXB C;  4H9P B;  5F99 B;  3W96 C;  3O62 B;  2CV5 D;  5B2J B;  5CPK C;  5AV5 A;  5B31 B;  4KGC D;  3AZE D;  3VH6 A;  3V9R A;  3MGR B;  3AN2 A;  3AZL D;  4J8X B;  5AY8 A;  5CP6 A;  5AV5 C;  3TU4 A;  2FJ7 D;  2F8N A;  3AYW D;  5CPI D;  1BH9 B;  3UT9 A;  3F6T A;  4UUZ A;  3AFA D;  2Y2Q A;  1S32 B;  5AY8 C;  3WKJ B;  3TU4 C;  1TZY B;  4QLC A;  1P3P B;  1P3F A;  1P3B A;  3UT9 C;  1M19 A;  5B40 B;  3WTP A;  4KUD A;  1P3M B;  2NQB D;  3WA9 C;  4WU8 C;  3W99 A;  4QLC C;  4G92 B;  5B32 C;  1P3F C;  1P3B C;  1F66 D;  4LD9 A;  3REI B;  1HQ3 D;  3WTP C;  4KUD C;  5B0Z A;  3KUY A;  5GSU B;  3B0C W;  4YS3 B;  3AZN B;  3W99 C;  4H9R B;  5B24 A;  3C1C B;  2F8N H;  2NZD D;  3LZ0 B;  4LD9 C;  2JE5 A;  4WNN B;  5AV9 B;  3KWQ D;  5B0Z C;  3KUY C;  3W97 B;  3AV2 A;  3H0L C;  5G49 B;  5GT0 B;  4J8U B;  3AZJ B;  4Z5T D;  3MNN A;  4XZQ B;  1Q9C A;  4NFT A;  2YFV B;  5BS7 A;  3AV2 C;  5BNX B;  2ZY4 A;  1EQZ B;  3B0D C;  5B0Y B;  4KHA A;  5BT1 C;  2Y2G A;  3MNN C;  5F99 D;  3O62 D;  5B2J D;  5BS7 C;  4YM6 C;  4WV4 B;  4E45 A;  1F1E A;  4CSR A;  3EPK A;  3MGR D;  1KX3 A;  1WWS A;  1ZLA C;  5FUG A;  1P3A A;  4H9Q B;  3LJA B;  5B33 D;  1KX3 C;  4X23 B;  4AWL B;  3WAA A;  1W2E A;  4ZUX B;  3WKJ D;  2ZM5 A;  1TZY D;  2Y2L A;  5AVC A;  3MGS A;  3UTB A;  1WWI A;  1P3M D;  4G91 B;  3EPJ A;  3KFU G;  3REI D;  4WU9 A;  5AVC C;  3MGS C;  5GSU D;  3AZE B;  2Y2H A;  5BNV B;  3WTP E;  3C1B D;  3AV1 B;  5DNN A;  4J8W A;  3REH D;  3C1C D;  4Z2M H;  2BYM B;  5GT3 B;  5GXQ A;  4H9O B;  3MGQ A;  4WU9 C;  5AV9 D;  2FJ7 B;  5C3I C;  3LEL A;  4JJN C;  5CPI B;  5DNM A;  3AFA B;  5DNN C;  1KX4 B;  5GT0 D;  4J8U D;  3AZJ D;  3B0C T;  3UTA B;  3X1V A;  1P34 A;  4WJ3 C;  5GXQ C;  3MGQ C;  2HIO C;  1AOI C;  2ZY3 A;  3LEL C;  2ARO D;  3A6N D;  3W96 B;  1EQZ D;  4H9N B;  5DNM C;  5B0Y D;  1U35 B;  2NQB B;  5B1M D;  3X1V C;  3MVD B;  3NQJ B;  4J8V D;  3X1T B;  2F2A C;  2BYK B;  4HGA C;  3REK D;  5E5A C;  4Z66 A;  2G5H C;  1P3O C;  4DQY B;  3AN2 B;  1KX5 C;  5CP6 B;  5AY8 B;  5B1L D;  3LJA D;  4Z66 C;  4X23 D;  4ZUX D;  2Y2P A;  4DRB A;  3AZH C;  2CV5 A;  3X1U A;  2G5I C;  5JRG A;  4M6B A;  4ZBJ C;  1P3B B;  2Y2J A;  5CPJ B;  1M19 B;  2IO5 C;  3LZ1 D;  4KGC A;  3FDD A;  2CV5 C;  3X1S A; 
#chains in the Genus database with same CATH homology
 5AV8 A;  1PZR A;  3W99 B;  3AZI D;  5JRG C;  3AZK A;  3B6G D;  4WZS B;  1M1A A;  4KGC C;  3B6F B;  3AV1 D;  1P3K B;  3AZG B;  3X1S C;  5AV8 C;  2LY8 A;  5B24 B;  5GT3 D;  3AZK C;  3REL B;  4EO5 C;  1M1A C;  1Z2C B;  5B33 B;  3AZM D;  1KX4 D;  4CAY A;  3MGP D;  3AZF A;  1P3G A;  3UTA D;  5JA4 A;  3WA9 A;  4WU8 A;  4XUJ B;  5B32 A;  3W96 D;  1HTA A;  5B2I A;  3AZF C;  1U35 D;  1P3G C;  4KHA B;  3MVD D;  3X1T D;  1F66 C;  1JFI A;  1HQ3 C;  5B2I C;  5BO0 A;  5AV5 D;  3C1B B;  1N1J B;  4CSR B;  2HUE B;  3REH B;  2UWX A;  3R45 A;  4Z5T A;  3AN2 D;  5AY8 D;  5CP6 D;  3KWQ C;  3REJ A;  2XD5 A;  2YFW A;  4NE6 A;  2F8N D;  2F8N K;  1P3A B;  1P3I B;  4Z5T C;  4H9P A;  3WAA B;  3O62 A;  2ARO B;  3A6N B;  3REJ C;  4YM6 A;  4QLC D;  5AV6 B;  5B31 A;  1P3B D;  1M19 D;  5CPJ D;  3WTP D;  5B1M B;  3UTB B;  4J8V B;  5F99 C;  1BH8 A;  3O62 C;  5B2J C;  1ZLA A;  3W99 D;  4J8X A;  5B31 C;  1M18 A;  2F8N G;  4LD9 D;  4R8P A;  3REK B;  4WU9 B;  3B6F D;  1BH9 A;  3B0B A;  1P3K D;  3AZG D;  1H3O B;  4J8W B;  3P5J B;  5B24 D;  4J8X C;  1S32 A;  1M18 C;  3REL D;  3VH5 W;  4R8P C;  5B32 G;  1P3P A;  5B1L B;  3W98 B;  5B40 A;  1S32 C;  1ID3 B;  3WKJ C;  4XUJ D;  1P34 B;  1P3L B;  1TZY C;  1P3P C;  5B40 C;  3LZ1 B;  1P3M C;  4YS3 A;  3AZN A;  4H9R A;  4G92 C;  3AZI B;  3LZ0 A;  1TAF A;  3REI C;  3B6G B;  5AV9 A;  3W97 A;  4JJN A;  2Y2M A;  5GSU C;  4YS3 C;  5KDM A;  5G49 A;  3AZN C;  5GT0 A;  3C1C C;  3LZ0 C;  4XZQ A;  2HIO A;  5AVB B;  1AOI A;  5AV9 C;  3W97 C;  2YFV A;  2CWE A;  2PYO A;  3AZM B;  1P3I D;  1P3A D;  3MGP B;  5GT0 C;  3KXB B;  4XZQ C;  3WAA D;  2PYO C;  2VQR A;  5AV6 D;  5CPK B;  1EQZ C;  4H9S C;  5B0Y C;  5E5A A;  5AVC D;  3MGS D;  3UTB D;  1P3O A;  3NQU A;  1KX5 A;  5AV5 B;  4Z2M G;  4WU9 D;  4H9Q A;  4X23 A;  3V9R B;  4J8W D;  2RVQ D;  3AZH A;  3TU4 B;  3MGQ D;  3W98 D;  2F8N B;  2JSS A;  3LEL D;  3UT9 B;  4X23 C;  4AWL C;  4UUZ B;  4CAY B;  1ID3 D;  4ZUX C;  1P3L D;  3X1V D;  1P34 D;  3WA9 B;  4WU8 B;  4QLC B;  3IP4 C;  5B32 B;  1P3F B;  3VH5 T;  3WTP B;  3X1U C;  4G91 C;  5B2I B;  5BNV A;  3AZE A;  4KUD B;  3VH6 W;  3AZL A;  2BYM A;  2FJ7 A;  4H9O A;  3H0M C;  4LD9 B;  1JFI B;  3AYW A;  1KU5 A;  3AZE C;  5CPI A;  5B0Z B;  3KUY B;  3AFA A;  1KX4 A;  4Z66 D;  3AZL C;  3R45 B;  2W8S A;  5AVB D;  2FJ7 C;  3AYW C;  2FFF B;  5CPI C;  4H9N A;  3AFA C;  3AV2 B;  1KX4 C;  3A1I A;  3B0D B;  2NQB A;  3UTA C;  3KXB D;  3NQJ A;  3MNN B;  3X1T A;  1F66 A;  2BYK A;  2L5A A;  2Y2I A;  1HQ3 A;  3X1U D;  4YM6 B;  5CPK D;  5JRG D;  1U35 C;  2NQB C;  3MVD C;  2NZD A;  2BG1 A;  3X1T C;  1BH8 B;  3X1S D;  1ZLA B;  5AV8 D;  3KWQ A;  3AZK D;  1M18 B;  4R8P B;  4NE5 A;  2ZY2 A;  1M1A D;  2NZD C;  1KX3 B;  3AN2 C;  2JCH A;  5CHL B;  3TU4 D;  2DF4 C;  5CP6 C;  5FUG B;  3UT9 D;  5CPJ A;  3AZF D;  1P3G D;  5F99 A;  3WA9 D;  5B2J A;  4WU8 D;  5B32 D;  1P3F D;  1M19 C;  5CPJ C;  5AVC B;  3MGS B;  5B2I D;  3EPL A;  3B6F A;  4KUD D;  3MGR A;  1P3K A;  3AZG A;  2XD1 A;  3REL A;  1TAF B;  5B0Z D;  5C3I B;  3KUY D;  4JJN B;  5B33 A;  3B6F C;  3MGR C;  1P3K C;  5DNN B;  3AZG C;  5KDM B;  5B24 C;  2RIQ A;  3WKJ A;  1TZY A;  4XUJ A;  3REL C;  5GXQ B;  3MGQ B;  2HIO B;  3VH6 T;  1AOI B;  3LEL B;  5B33 C;  3REJ D;  3AV2 D;  2PYO B;  5DNM B;  1P3M A;  5BT1 D;  3X1V B;  3MNN D;  2Y2O A;  4XUJ C;  1A7W A;  3REI A;  3EPH A;  4YM6 D;  4HGA B;  5B31 D;  5GSU A;  3C1B A;  1N1J A;  5E5A B;  3REH A;  3C1C A;  1P3O B;  1ZLA D;  4WNN A;  4J8X D;  1M18 D;  3NQU B;  1KX5 B;  3C1B C;  4R8P D;  1P3I A;  2HUE C;  4NE3 A;  4J8U A;  3REH C;  4Z66 B;  3AZJ A;  1KX3 D;  3VH5 A;  1S32 D;  2ARO A;  3A6N A;  3AZH B;  5BNX A;  5B31 G;  5AV6 A;  1P3P D;  4H9S A;  5B0Y A;  1P3A C;  1P3I C;  1EQZ A;  4J8U C;  4ZBJ B;  3AZJ C;  4DRA A;  5B1M A;  5B40 D;  4J8V A;  2IO5 B;  1B67 A;  3WAA C;  2ARO C;  3A6N C;  2CV5 B;  3X1U B;  5AV6 C;  5JRG B;  3REK A;  5B1M C;  3UTB C;  4J8V C;  4KGC B;  1R4V A;  4YS3 D;  3AZN D;  1H3O A;  3X1S B;  5AV8 B;  3AZL B;  3A1K A;  3LZ0 D;  3AZK B;  3H0R C;  3REK C;  5B1L A;  3W98 A;  4EO5 B;  3LJA A;  4JJN D;  3AYW B;  1M1A B;  2J8P A;  3W97 D;  2Y2K A;  5DNN D;  3AL0 C;  4J8W C;  3EG5 B;  4ZUX A;  1ID3 A;  2RVQ C;  1P3L A;  5GXQ D;  4XZQ D;  2HIO D;  1AOI D;  5B1L C;  3W98 C;  3LJA C;  2PYO D;  5DNM D;  3AZF B;  3LZ1 A;  1P3G B;  1ID3 C;  5JA4 B;  1T3U A;  1ULY A;  1P34 C;  1P3L C;  2Y2N A;  2ZY5 A;  3KSY A;  3AZI A;  1F66 B;  3B6G A;  1HQ3 B;  3LZ1 C;  5E5A D;  3AV1 A;  4UPK A;  1P3O D;  3AZI C;  2DQN C;  5GT3 A;  2NZD B;  5AVB A;  3B6G C;  1KX5 D;  5BO0 B;  3KWQ B;  3AV1 C;  3AZM A;  3MGP A;  3UTA A;  1BFM A;  5GT3 C;  3KXB A;  4Z5T B;  5AVB C;  3AZH D;  3W96 A;  3REJ B;  2YFW B;  4E44 A;  3AZM C;  5CPK A;  3MGP C;  1U35 A;  3MVD A;  1B6W A;  3KXB C;  4H9P B;  5F99 B;  3W96 C;  3O62 B;  2CV5 D;  5B2J B;  5CPK C;  5AV5 A;  5B31 B;  4KGC D;  3AZE D;  3VH6 A;  3V9R A;  3MGR B;  3AN2 A;  3AZL D;  4J8X B;  5AY8 A;  5CP6 A;  5AV5 C;  3TU4 A;  2FJ7 D;  2F8N A;  3AYW D;  5CPI D;  1BH9 B;  3UT9 A;  3F6T A;  4UUZ A;  3AFA D;  2Y2Q A;  1S32 B;  5AY8 C;  3WKJ B;  3TU4 C;  1TZY B;  4QLC A;  1P3P B;  1P3F A;  1P3B A;  3UT9 C;  1M19 A;  5B40 B;  3WTP A;  4KUD A;  1P3M B;  2NQB D;  3WA9 C;  4WU8 C;  3W99 A;  4QLC C;  4G92 B;  5B32 C;  1P3F C;  1P3B C;  1F66 D;  4LD9 A;  3REI B;  1HQ3 D;  3WTP C;  4KUD C;  5B0Z A;  3KUY A;  5GSU B;  3B0C W;  4YS3 B;  3AZN B;  3W99 C;  4H9R B;  5B24 A;  3C1C B;  2F8N H;  2NZD D;  3LZ0 B;  4LD9 C;  2JE5 A;  4WNN B;  5AV9 B;  3KWQ D;  5B0Z C;  3KUY C;  3W97 B;  3AV2 A;  3H0L C;  5G49 B;  5GT0 B;  4J8U B;  3AZJ B;  4Z5T D;  3MNN A;  4XZQ B;  1Q9C A;  4NFT A;  2YFV B;  5BS7 A;  3AV2 C;  5BNX B;  2ZY4 A;  1EQZ B;  3B0D C;  5B0Y B;  4KHA A;  5BT1 C;  2Y2G A;  3MNN C;  5F99 D;  3O62 D;  5B2J D;  5BS7 C;  4YM6 C;  4WV4 B;  4E45 A;  1F1E A;  4CSR A;  3EPK A;  3MGR D;  1KX3 A;  1WWS A;  1ZLA C;  5FUG A;  1P3A A;  4H9Q B;  3LJA B;  5B33 D;  1KX3 C;  4X23 B;  4AWL B;  3WAA A;  1W2E A;  4ZUX B;  3WKJ D;  2ZM5 A;  1TZY D;  2Y2L A;  5AVC A;  3MGS A;  3UTB A;  1WWI A;  1P3M D;  4G91 B;  3EPJ A;  3KFU G;  3REI D;  4WU9 A;  5AVC C;  3MGS C;  5GSU D;  3AZE B;  2Y2H A;  5BNV B;  3WTP E;  3C1B D;  3AV1 B;  5DNN A;  4J8W A;  3REH D;  3C1C D;  4Z2M H;  2BYM B;  5GT3 B;  5GXQ A;  4H9O B;  3MGQ A;  4WU9 C;  5AV9 D;  2FJ7 B;  5C3I C;  3LEL A;  4JJN C;  5CPI B;  5DNM A;  3AFA B;  5DNN C;  1KX4 B;  5GT0 D;  4J8U D;  3AZJ D;  3B0C T;  3UTA B;  3X1V A;  1P34 A;  4WJ3 C;  5GXQ C;  3MGQ C;  2HIO C;  1AOI C;  2ZY3 A;  3LEL C;  2ARO D;  3A6N D;  3W96 B;  1EQZ D;  4H9N B;  5DNM C;  5B0Y D;  1U35 B;  2NQB B;  5B1M D;  3X1V C;  3MVD B;  3NQJ B;  4J8V D;  3X1T B;  2F2A C;  2BYK B;  4HGA C;  3REK D;  5E5A C;  4Z66 A;  2G5H C;  1P3O C;  4DQY B;  3AN2 B;  1KX5 C;  5CP6 B;  5AY8 B;  5B1L D;  3LJA D;  4Z66 C;  4X23 D;  4ZUX D;  2Y2P A;  4DRB A;  3AZH C;  2CV5 A;  3X1U A;  2G5I C;  5JRG A;  4M6B A;  4ZBJ C;  1P3B B;  2Y2J A;  5CPJ B;  1M19 B;  2IO5 C;  3LZ1 D;  4KGC A;  3FDD A;  2CV5 C;  3X1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...