2NZDA

Nucleosome core particle containing 145 bp of dna
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (145-MER)
publication title DNA stretching and extreme kinking in the nucleosome core
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2nzdA00
1KX3C 2HIOD 3V9RA 5B33B 1H3OB 1Q9CA 4XZQA 1HQ3C 3W96B 1M18D 3AZNC 3KWQC 3MGSC 1BH9A 3LZ0A 5JA4A 3X1TB 5AV5D 1P3GB 4H9RA 2F8NH 3AZJC 3MGQD 5AVCB 1BFMA 3X1VB 3REHB 3AFAB 5GSUC 3C1BC 5DNNA 1EQZD 1KX5B 1P3KD 5CPKC 5B1LD 3W97D 3AZMD 3MVDC 5B31B 3WKJC 5AV6C 4H9NB 3AZIC 1A7WA 3UT9B 1M19B 5AV8C 3UTAB 1P3OC 1P34C 4JJNA 3B6GD 4R8PC 1F66B 4Z2MG 5CP6C 2F8NA 2PYOB 3B6FA 5CPIC 4X23B 3AZKC 3MGRC 1P3FA 1KX3D 3X1SC 4LD9C 1P3AC 1P3BB 4Z5TA 3X1UB 3KWQD 1AOID 3KXBA 4WV4B 4J8UC 4XUJA 2BYMA 3MGPD 4XZQC 3B0BA 5B24D 4YS3C 3REKB 1P3IB 3VH5A 4CSRA 5GSUD 5B0YB 5B2IC 3LZ0C 5AV9C 1M1AD 1U35C 5JRGB 5B40B 5BT1C 5AV5A 2IO5C 4YM6D 5BNXB 5B0ZA 5GXQD 1P3PA 2FJ7A 5DNMD 3A6NB 3AZID 3WKJD 3AZED 1B67A 2YFVA 3AV2D 1EQZA 3W99B 1P3LB 3LELB 1ZLAD 3RELD 5B2JA 1P34D 5B1LA 3AZMA 2RVQC 3AZLD 3LZ1B 3VH6W 5AY8C 5CPID 5CPJC 1ID3D 2F8NK 4NFTA 3C1CD 4J8VA 4JJNC 2L5AA 3O62B 4J8UD 5B1MA 3B6FC 1P3FC 3LJAD 3TU4B 4NE6A 1KX4B 2AROA 3KXBC 1AOIA 2CV5B 3NQUA 4XUJC 4NE5A 5BT1D 3C1CC 4QLCB 2HIOC 4EO5B 4J8XB 5B24A 4WU9B 4ZUXD 5AVBB 2NQBB 5DNND 5AV5C 5E5AA 4YM6A 3AZFA 5GXQA 3AN2B 4Z66B 3WAAD 1F66D 1EQZC 5DNMA 1P3KC 3AZGB 5GT0B 3AZEA 5B1LC 3W97C 1HQ3B 4J8WB 3AZMC 3AZNB 1ZLAA 3RELA 5FUGA 3MGSB 1N1JA 3B6FD 3REIA 1P3FD 3B0CW 3WA9B 4Z5TD 3AZLA 1ULYA 3AZJB 4WU8B 3AV1B 1ID3A 4H9PA 3KXBD 5B33A 1H3OA 3W96A 4XUJD 3B6GC 3B0DC 3C1BB 3X1TA 5B32B 3AZHD 1P3GA 3LJAA 4HGAC 5CPKB 5B32G 3X1VA 3AFAA 3REJD 4DRBA 1AOIC 3NQJB 3WTPB 3MVDB 3MGPC 5B0ZD 5B24C 3UTBB 1KX5A 5AV8B 1JFIB 1P3OB 4ZUXA 1P3PD 1R4VA 2FJ7D 4R8PB 1M1AC 5CP6B 4KGCB 3AZKB 5B2JD 4YM6C 4H9NA 1P3AB 4LD9B 4H9SC 5GXQC 3MNNB 3AYWD 5DNMC 3WAAA 1F66A 3AZEC 3AV2C 5B31G 3V9RB 4J8VD 2PYOA 4YS3B 4KHAB 1ZLAC 3RELC 1KX4D 5C3IC 1P3BA 5B1MD 5B2IB 3X1UA 5AV9B 4H9RB 1TZYD 1U35B 3AZLC 1S32D 2YFWA 1P3MB 1ID3C 2AROD 2IO5B 4J8XD 3KUYD 3REKA 3W96C 1P3IA 5B0YA 3W98B 3VH6A 3WTPE 3LJAC 3AZHA 3AFAC 3REJA 3AN2D 4Z66D 5E5AD 5AY8B 5CPJB 2JSSA 3A6NA 3AZFD 1P3LA 4ZUXC 3LELA 4JJNB 5DNNC 4J8WD 4G91C 1F1EA 5GT3B 4KUDB 2NZDB 3LZ1A 1BH8B 4E44A 3REID 3WAAC 2BYKB 1F66C 3O62A 3AYWA 5F99B 3C1CB 3VH5T 2HIOB 5B33D 3W96D 1M18B 3X1UC 1KX4A 2HUEC 2CV5A 3X1TD 4WZSB 1P3GD 5AV5B 1TZYA 1S32A 4Z5TC 4ZBJB 5AVCD 3MGQB 4UUZB 3REHD 3AFAD 3REKC 3X1VD 1P3IC 4QLCA 4J8XA 5B0YC 4WU9A 3KUYA 5AVBA 2NQBA 2YFVB 4AWLC 1KX5D 1EQZB 1P3KB 3AZHC 5CHLB 5KDMB 5B1LB 3W97B 3AZMB 3REJC 5BNVB 5B31D 3AN2A 4Z66A 5B0ZC 3UT9D 1M19D 3UTAD 3AZGA 5GT0A 5G49A 1P3PC 2FJ7C 1TAFB 4J8WA 3AZNA 3B6GB 3MGSA 2PYOD 4X23D 1KX3B 5B2JC 1P3BD 3WA9A 3AZJA 4WU8A 3X1UD 3AV1A 3KWQB 3NQUB 3AYWC 3W98D 3C1BA 4J8VC 3MGPB 5B24B 3REKD 4WNNB 4G92C 1P3ID 5B32A 5GSUB 5B0YD 1KX4C 5B1MC 5CPKA 1M1AB 1TZYC 3NQJA 5JRGD 5B40D 3WTPA 1S32C 2AROC 4QLCC 4YM6B 5AVCA 4J8XC 3UTBA 3KUYC 3REHA 5AV8A 5GXQB 1JFIA 1P3OA 5BO0B 3A6ND 5AV6B 5DNMB 3AZIB 4R8PA 3WKJB 5GT3D 3AV2B 3W99D 1P3LD 5CP6A 3LELD 4KGCA 3RELB 4LD9A 1P3AA 5C3IB 1P34B 3R45B 1N1JB 4CAYB 3AN2C 4Z66C 5E5AC 3MNNA 5B31A 3LZ1D 3AZLB 5CPIB 3MGRB 4NE3A 3X1SB 4H9OB 3UT9A 1M19A 3AZFC 3UTAA 4YS3A 4J8WC 4KHAA 3O62D 4J8UB 4H9QB 5B2IA 5AV9A 1HTAA 4XZQB 3LJAB 3WA9C 1U35A 4X23A 3TU4D 4WU8C 1P3MA 3AV1C 1BH9B 3LZ0B 3REIC 5BS7A 5JA4B 2CV5D 3W98A 4QLCD 5B32C 5B33C 4WU9D 5AVBD 4ZUXB 2CWEA 2NQBD 5DNNB 4G91B 3WTPC 3X1TC 1P3GC 1B6WA 5JRGA 5B40A 5AVCC 3UTBC 3X1VC 5AY8A 3REHC 5CPJA 5BNXA 3WAAB 1KX5C 3AZGD 4KGCC 5GT0D 4E45A 5GT3A 4KUDA 3W99A 1HQ3D 2NZDA 3AZND 1BH8A 3MGSD 2HUEB 3MNNC 2F8NB 5B31C 3B6FB 1P3FB 2YFWB 2BYKA 3WA9D 4Z5TB 3AZJD 5F99A 3UT9C 4WU8D 1M19C 3UTAC 3AV1D 2F8NG 3KXBB 3C1CA 2HIOA 2LY8A 4XUJB 3C1BD 1M18A 3VH6T 2BYMB 4AWLB 2PYOC 4X23C 5B32D 4CSRB 3AZHB 1P3MC 1P3BC 3MGQA 3TU4A 5CPKD 4UUZA 5BS7C 3REJB 3WTPD 3W98C 3MVDD 5AV6D 3UTBD 5B0ZB 5AV8D 1P3KA 1P3OD 5KDMA 3W97A 1P3PB 2FJ7B 4R8PD 5BNVA 5JRGC 5CP6D 5B40C 4KGCD 3AZKD 3MGRD 3X1SD 4LD9D 5B2JB 1P3AD 3VH5W 3MNND 3AYWB 1TAFA 3A6NC 3B6GA 5GT3C 4KUDC 3W99C 4XZQD 4J8VB 1P3LC 4YS3D 3LELC 1KU5A 1KX3A 4G92B 2NZDC 1HQ3A 3B0DB 5B1MB 5B2ID 3LZ0D 5AV9D 3KWQA 1U35D 1TZYB 3LZ1C 1S32B 5F99C 1P3MD 4M6BA 2AROB 4HGAB 3MGPA 3KUYB 1AOIB 4WNNA 1M18C 5GSUA 3O62C 3B0CT 1WWSA 1M1AA 1WWIA 4ZBJC 3MGQC 3TU4C 4DRAA 4H9SA 2CV5C 2RVQD 5E5AB 3MVDA 5AY8D 5CPJD 5BO0A 3WKJA 5AV6A 4EO5C 3AZIA 3AV2A 4WU9C 5G49B 3AZFB 5AVBC 4JJND 2NQBC 1P34A 3R45A 2F8ND 4CAYA 3AZEB 4KUDD 2NZDD 5CPIA 3AZKA 3MGRA 3KSYA 1ZLAB 3X1SA 5FUGB 4H9OA 3REIB 4Z2MH 5F99D 4J8UA 4H9QA 3AZGC 1ID3B 5GT0C 4H9PB
chains in the Genus database with same CATH superfamily
1KX3C 2HIOD 3V9RA 5B33B 1H3OB 1Q9CA 4XZQA 1HQ3C 3W96B 1M18D 3AZNC 3KWQC 3MGSC 1BH9A 3LZ0A 5JA4A 3X1TB 5AV5D 1P3GB 4H9RA 2F8NH 3AZJC 3MGQD 5AVCB 1BFMA 3X1VB 3REHB 3AFAB 5GSUC 3C1BC 2Y2JA 5DNNA 3A1IA 1EQZD 1KX5B 1P3KD 2DF4C 5CPKC 5B1LD 3W97D 3AZMD 2Y2NA 3MVDC 5B31B 3WKJC 5AV6C 4H9NB 3AZIC 1A7WA 3UT9B 1M19B 5AV8C 3UTAB 1P3OC 1P34C 4JJNA 3B6GD 4R8PC 1F66B 4Z2MG 5CP6C 2F8NA 2PYOB 3B6FA 5CPIC 4X23B 3AZKC 3MGRC 1P3FA 1KX3D 3X1SC 4LD9C 1P3AC 1P3BB 4Z5TA 3X1UB 3KWQD 1AOID 3KXBA 4WV4B 4J8UC 4XUJA 2Y2PA 2BYMA 3MGPD 4XZQC 3B0BA 5B24D 4YS3C 3REKB 1P3IB 3VH5A 4CSRA 5GSUD 5B0YB 4UPKA 5B2IC 3LZ0C 3EPKA 5AV9C 1M1AD 1U35C 3A1KA 5JRGB 5B40B 5BT1C 5AV5A 2UWXA 2IO5C 4YM6D 5BNXB 5B0ZA 5GXQD 1P3PA 2FJ7A 5DNMD 3A6NB 3AZID 3WKJD 3AZED 1B67A 2YFVA 3AV2D 4WJ3C 1EQZA 3W99B 1P3LB 3LELB 1ZLAD 3RELD 5B2JA 1P34D 5B1LA 3F6TA 3AZMA 2RVQC 2Y2HA 1Z2CB 3AZLD 3LZ1B 3VH6W 5AY8C 3EPJA 5CPJC 5CPID 1ID3D 2F8NK 4NFTA 3C1CD 4J8VA 2Y2OA 4JJNC 2L5AA 3O62B 4J8UD 5B1MA 3B6FC 1P3FC 3AL0C 3LJAD 3TU4B 4NE6A 1KX4B 2AROA 3KXBC 1AOIA 2CV5B 3NQUA 4XUJC 4NE5A 5BT1D 3C1CC 4QLCB 2HIOC 4EO5B 4J8XB 5B24A 4WU9B 4ZUXD 5AVBB 2JCHA 2NQBB 5DNND 5AV5C 5E5AA 4YM6A 3AZFA 5GXQA 3AN2B 4Z66B 3WAAD 1F66D 3H0MC 3H0LC 1EQZC 5DNMA 1P3KC 3AZGB 5GT0B 3AZEA 5B1LC 3W97C 1HQ3B 4J8WB 3AZMC 3AZNB 1ZLAA 3RELA 5FUGA 2ZY2A 3MGSB 1N1JA 3B6FD 3REIA 1P3FD 3B0CW 3H0RC 3WA9B 4Z5TD 3AZLA 1ULYA 3AZJB 4WU8B 3AV1B 1ID3A 4H9PA 1PZRA 3KXBD 5B33A 1H3OA 3W96A 4XUJD 3B6GC 3B0DC 3C1BB 3X1TA 5B32B 3AZHD 1P3GA 3LJAA 4HGAC 5CPKB 5B32G 3X1VA 3AFAA 3REJD 4DRBA 1AOIC 3NQJB 3WTPB 3MVDB 3MGPC 5B0ZD 5B24C 3UTBB 1KX5A 5AV8B 4DQYB 1JFIB 1P3OB 4ZUXA 1P3PD 1R4VA 2FJ7D 4R8PB 1M1AC 3EPHA 5CP6B 4KGCB 3AZKB 5B2JD 4H9NA 4YM6C 1P3AB 4LD9B 4H9SC 5GXQC 3MNNB 3AYWD 2BG1A 5DNMC 3WAAA 1F66A 3AZEC 3AV2C 5B31G 3V9RB 4J8VD 2PYOA 4YS3B 4KHAB 1ZLAC 3RELC 1KX4D 5C3IC 1P3BA 5B1MD 5B2IB 3X1UA 5AV9B 4H9RB 1TZYD 1U35B 3AZLC 1S32D 2YFWA 1P3MB 1ID3C 2AROD 2IO5B 4J8XD 3KUYD 3REKA 3W96C 1P3IA 5B0YA 3W98B 3VH6A 3WTPE 3LJAC 2W8SA 3AZHA 3AFAC 3REJA 3AN2D 4Z66D 5E5AD 5AY8B 5CPJB 2JSSA 3A6NA 2VQRA 3AZFD 1P3LA 4ZUXC 3LELA 4JJNB 5DNNC 4J8WD 4G91C 1F1EA 5GT3B 4KUDB 2NZDB 3LZ1A 1BH8B 4E44A 3REID 2G5IC 2XD1A 3WAAC 2BYKB 1F66C 3O62A 3AYWA 5F99B 3C1CB 3VH5T 2HIOB 5B33D 3W96D 1M18B 3X1UC 1KX4A 2HUEC 2CV5A 3X1TD 4WZSB 1P3GD 5AV5B 1TZYA 1S32A 4Z5TC 4ZBJB 5AVCD 3MGQB 4UUZB 3REHD 3AFAD 2ZM5A 3REKC 3X1VD 4QLCA 1P3IC 4J8XA 5B0YC 4WU9A 3KUYA 5AVBA 2NQBA 2YFVB 4AWLC 1KX5D 1EQZB 1P3KB 3AZHC 5CHLB 5KDMB 5B1LB 3W97B 3AZMB 3REJC 5BNVB 5B31D 3AN2A 4Z66A 5B0ZC 3UT9D 1M19D 3UTAD 3AZGA 5GT0A 5G49A 1P3PC 2FJ7C 1TAFB 2Y2IA 4J8WA 3AZNA 3B6GB 3MGSA 2PYOD 4X23D 1KX3B 2ZY3A 3IP4C 5B2JC 1P3BD 3WA9A 3AZJA 4WU8A 3X1UD 3AV1A 3KWQB 3NQUB 3AYWC 3W98D 3P5JB 3C1BA 4J8VC 3MGPB 5B24B 3REKD 4WNNB 4G92C 1P3ID 5B32A 5GSUB 5B0YD 1KX4C 5B1MC 5CPKA 1M1AB 1TZYC 3NQJA 5JRGD 5B40D 3WTPA 1S32C 2AROC 4QLCC 4YM6B 5AVCA 4J8XC 3UTBA 3KUYC 3REHA 5AV8A 5GXQB 1JFIA 1P3OA 5BO0B 3A6ND 5AV6B 5DNMB 3AZIB 4R8PA 3WKJB 2Y2KA 5GT3D 3AV2B 3W99D 1P3LD 5CP6A 3LELD 2Y2QA 4KGCA 3RELB 4LD9A 1P3AA 5C3IB 1P34B 3R45B 1N1JB 4CAYB 3AN2C 4Z66C 5E5AC 3MNNA 5B31A 3LZ1D 3AZLB 5CPIB 3MGRB 4NE3A 3X1SB 4H9OB 3UT9A 1M19A 3AZFC 3UTAA 4YS3A 4J8WC 4KHAA 3O62D 2XD5A 4J8UB 4H9QB 5B2IA 5AV9A 1HTAA 4XZQB 3LJAB 3WA9C 1U35A 4X23A 3TU4D 4WU8C 1P3MA 3AV1C 2J8PA 2ZY4A 1BH9B 3LZ0B 3REIC 5BS7A 5JA4B 2CV5D 3EPLA 3W98A 4QLCD 5B32C 5B33C 4WU9D 5AVBD 4ZUXB 2CWEA 2NQBD 5DNNB 3FDDA 4G91B 3WTPC 3X1TC 1P3GC 1B6WA 5JRGA 5B40A 2F2AC 5AVCC 3UTBC 3X1VC 5AY8A 3REHC 5CPJA 5BNXA 3WAAB 1KX5C 3AZGD 4KGCC 5GT0D 4E45A 5GT3A 4KUDA 3W99A 1HQ3D 2NZDA 3AZND 1BH8A 3KFUG 3MGSD 2G5HC 2HUEB 3MNNC 2F8NB 5B31C 3B6FB 1P3FB 2YFWB 2BYKA 3WA9D 4Z5TB 3AZJD 5F99A 3UT9C 2DQNC 4WU8D 3UTAC 3AV1D 1M19C 2F8NG 3KXBB 3C1CA 2HIOA 2LY8A 4XUJB 2JE5A 3C1BD 1M18A 3VH6T 2BYMB 4AWLB 2PYOC 4X23C 5B32D 4CSRB 3AZHB 1P3MC 1P3BC 3MGQA 3TU4A 5CPKD 4UUZA 5BS7C 3REJB 3WTPD 3W98C 3MVDD 5AV6D 3UTBD 5B0ZB 5AV8D 1P3KA 1P3OD 5KDMA 3W97A 1W2EA 1P3PB 2FJ7B 2Y2MA 2RIQA 4R8PD 2FFFB 5BNVA 5JRGC 5CP6D 5B40C 4KGCD 3AZKD 3MGRD 3X1SD 4LD9D 5B2JB 1P3AD 3VH5W 3MNND 3AYWB 1TAFA 3A6NC 3B6GA 5GT3C 4KUDC 3W99C 4XZQD 4J8VB 1P3LC 4YS3D 3LELC 1KU5A 1KX3A 4G92B 2NZDC 1HQ3A 3B0DB 5B1MB 5B2ID 3LZ0D 5AV9D 3KWQA 2Y2GA 1U35D 1TZYB 3LZ1C 1S32B 5F99C 1P3MD 4M6BA 2AROB 4HGAB 3MGPA 3KUYB 1AOIB 4WNNA 1M18C 5GSUA 3O62C 3B0CT 1WWSA 1M1AA 1WWIA 2Y2LA 2ZY5A 4ZBJC 3MGQC 3TU4C 4DRAA 4H9SA 2CV5C 2RVQD 5E5AB 3MVDA 3EG5B 5AY8D 5CPJD 5BO0A 3WKJA 5AV6A 4EO5C 3AZIA 3AV2A 4WU9C 5G49B 3AZFB 5AVBC 4JJND 2NQBC 1P34A 3R45A 2F8ND 4CAYA 3AZEB 4KUDD 2NZDD 5CPIA 3AZKA 3MGRA 3KSYA 1ZLAB 3X1SA 1T3UA 5FUGB 4H9OA 3REIB 4Z2MH 5F99D 4J8UA 4H9QA 3AZGC 1ID3B 5GT0C 4H9PB
chains in the Genus database with same CATH topology
1KX3C 2HIOD 3V9RA 5B33B 1H3OB 1Q9CA 4XZQA 1HQ3C 3W96B 1M18D 3AZNC 3KWQC 3MGSC 1BH9A 3LZ0A 5JA4A 3X1TB 5AV5D 1P3GB 4H9RA 2F8NH 3AZJC 3MGQD 5AVCB 1BFMA 3X1VB 3REHB 3AFAB 5GSUC 3C1BC 2Y2JA 5DNNA 3A1IA 1EQZD 1KX5B 1P3KD 2DF4C 5CPKC 5B1LD 3W97D 3AZMD 2Y2NA 3MVDC 5B31B 3WKJC 5AV6C 4H9NB 3AZIC 1A7WA 3UT9B 1M19B 5AV8C 3UTAB 1P3OC 1P34C 4JJNA 3B6GD 4R8PC 1F66B 4Z2MG 5CP6C 2F8NA 2PYOB 3B6FA 5CPIC 4X23B 3AZKC 3MGRC 1P3FA 1KX3D 3X1SC 4LD9C 1P3AC 1P3BB 4Z5TA 3X1UB 3KWQD 1AOID 3KXBA 4WV4B 4J8UC 4XUJA 2Y2PA 2BYMA 3MGPD 4XZQC 3B0BA 5B24D 4YS3C 3REKB 1P3IB 3VH5A 4CSRA 5GSUD 5B0YB 4UPKA 5B2IC 3LZ0C 3EPKA 5AV9C 1M1AD 1U35C 3A1KA 5JRGB 5B40B 5BT1C 5AV5A 2UWXA 2IO5C 4YM6D 5BNXB 5B0ZA 5GXQD 1P3PA 2FJ7A 5DNMD 3A6NB 3AZID 3WKJD 3AZED 1B67A 2YFVA 3AV2D 4WJ3C 1EQZA 3W99B 1P3LB 3LELB 1ZLAD 3RELD 5B2JA 1P34D 5B1LA 3F6TA 3AZMA 2RVQC 2Y2HA 1Z2CB 3AZLD 3LZ1B 3VH6W 5AY8C 3EPJA 5CPJC 5CPID 1ID3D 2F8NK 4NFTA 3C1CD 4J8VA 2Y2OA 4JJNC 2L5AA 3O62B 4J8UD 5B1MA 3B6FC 1P3FC 3AL0C 3LJAD 3TU4B 4NE6A 1KX4B 2AROA 3KXBC 1AOIA 2CV5B 3NQUA 4XUJC 4NE5A 5BT1D 3C1CC 4QLCB 2HIOC 4EO5B 4J8XB 5B24A 4WU9B 4ZUXD 5AVBB 2JCHA 2NQBB 5DNND 5AV5C 5E5AA 4YM6A 3AZFA 5GXQA 3AN2B 4Z66B 3WAAD 1F66D 3H0MC 3H0LC 1EQZC 5DNMA 1P3KC 3AZGB 5GT0B 3AZEA 5B1LC 3W97C 1HQ3B 4J8WB 3AZMC 3AZNB 1ZLAA 3RELA 5FUGA 2ZY2A 3MGSB 1N1JA 3B6FD 3REIA 1P3FD 3B0CW 3H0RC 3WA9B 4Z5TD 3AZLA 1ULYA 3AZJB 4WU8B 3AV1B 1ID3A 4H9PA 1PZRA 3KXBD 5B33A 1H3OA 3W96A 4XUJD 3B6GC 3B0DC 3C1BB 3X1TA 5B32B 3AZHD 1P3GA 3LJAA 4HGAC 5CPKB 5B32G 3X1VA 3AFAA 3REJD 4DRBA 1AOIC 3NQJB 3WTPB 3MVDB 3MGPC 5B0ZD 5B24C 3UTBB 1KX5A 5AV8B 4DQYB 1JFIB 1P3OB 4ZUXA 1P3PD 1R4VA 2FJ7D 4R8PB 1M1AC 3EPHA 5CP6B 4KGCB 3AZKB 5B2JD 4H9NA 4YM6C 1P3AB 4LD9B 4H9SC 5GXQC 3MNNB 3AYWD 2BG1A 5DNMC 3WAAA 1F66A 3AZEC 3AV2C 5B31G 3V9RB 4J8VD 2PYOA 4YS3B 4KHAB 1ZLAC 3RELC 1KX4D 5C3IC 1P3BA 5B1MD 5B2IB 3X1UA 5AV9B 4H9RB 1TZYD 1U35B 3AZLC 1S32D 2YFWA 1P3MB 1ID3C 2AROD 2IO5B 4J8XD 3KUYD 3REKA 3W96C 1P3IA 5B0YA 3W98B 3VH6A 3WTPE 3LJAC 2W8SA 3AZHA 3AFAC 3REJA 3AN2D 4Z66D 5E5AD 5AY8B 5CPJB 2JSSA 3A6NA 2VQRA 3AZFD 1P3LA 4ZUXC 3LELA 4JJNB 5DNNC 4J8WD 4G91C 1F1EA 5GT3B 4KUDB 2NZDB 3LZ1A 1BH8B 4E44A 3REID 2G5IC 2XD1A 3WAAC 2BYKB 1F66C 3O62A 3AYWA 5F99B 3C1CB 3VH5T 2HIOB 5B33D 3W96D 1M18B 3X1UC 1KX4A 2HUEC 2CV5A 3X1TD 4WZSB 1P3GD 5AV5B 1TZYA 1S32A 4Z5TC 4ZBJB 5AVCD 3MGQB 4UUZB 3REHD 3AFAD 2ZM5A 3REKC 3X1VD 4QLCA 1P3IC 4J8XA 5B0YC 4WU9A 3KUYA 5AVBA 2NQBA 2YFVB 4AWLC 1KX5D 1EQZB 1P3KB 3AZHC 5CHLB 5KDMB 5B1LB 3W97B 3AZMB 3REJC 5BNVB 5B31D 3AN2A 4Z66A 5B0ZC 3UT9D 1M19D 3UTAD 3AZGA 5GT0A 5G49A 1P3PC 2FJ7C 1TAFB 2Y2IA 4J8WA 3AZNA 3B6GB 3MGSA 2PYOD 4X23D 1KX3B 2ZY3A 3IP4C 5B2JC 1P3BD 3WA9A 3AZJA 4WU8A 3X1UD 3AV1A 3KWQB 3NQUB 3AYWC 3W98D 3P5JB 3C1BA 4J8VC 3MGPB 5B24B 3REKD 4WNNB 4G92C 1P3ID 5B32A 5GSUB 5B0YD 1KX4C 5B1MC 5CPKA 1M1AB 1TZYC 3NQJA 5JRGD 5B40D 3WTPA 1S32C 2AROC 4QLCC 4YM6B 5AVCA 4J8XC 3UTBA 3KUYC 3REHA 5AV8A 5GXQB 1JFIA 1P3OA 5BO0B 3A6ND 5AV6B 5DNMB 3AZIB 4R8PA 3WKJB 2Y2KA 5GT3D 3AV2B 3W99D 1P3LD 5CP6A 3LELD 2Y2QA 4KGCA 3RELB 4LD9A 1P3AA 5C3IB 1P34B 3R45B 1N1JB 4CAYB 3AN2C 4Z66C 5E5AC 3MNNA 5B31A 3LZ1D 3AZLB 5CPIB 3MGRB 4NE3A 3X1SB 4H9OB 3UT9A 1M19A 3AZFC 3UTAA 4YS3A 4J8WC 4KHAA 3O62D 2XD5A 4J8UB 4H9QB 5B2IA 5AV9A 1HTAA 4XZQB 3LJAB 3WA9C 1U35A 4X23A 3TU4D 4WU8C 1P3MA 3AV1C 2J8PA 2ZY4A 1BH9B 3LZ0B 3REIC 5BS7A 5JA4B 2CV5D 3EPLA 3W98A 4QLCD 5B32C 5B33C 4WU9D 5AVBD 4ZUXB 2CWEA 2NQBD 5DNNB 3FDDA 4G91B 3WTPC 3X1TC 1P3GC 1B6WA 5JRGA 5B40A 2F2AC 5AVCC 3UTBC 3X1VC 5AY8A 3REHC 5CPJA 5BNXA 3WAAB 1KX5C 3AZGD 4KGCC 5GT0D 4E45A 5GT3A 4KUDA 3W99A 1HQ3D 2NZDA 3AZND 1BH8A 3KFUG 3MGSD 2G5HC 2HUEB 3MNNC 2F8NB 5B31C 3B6FB 1P3FB 2YFWB 2BYKA 3WA9D 4Z5TB 3AZJD 5F99A 3UT9C 2DQNC 4WU8D 3UTAC 3AV1D 1M19C 2F8NG 3KXBB 3C1CA 2HIOA 2LY8A 4XUJB 2JE5A 3C1BD 1M18A 3VH6T 2BYMB 4AWLB 2PYOC 4X23C 5B32D 4CSRB 3AZHB 1P3MC 1P3BC 3MGQA 3TU4A 5CPKD 4UUZA 5BS7C 3REJB 3WTPD 3W98C 3MVDD 5AV6D 3UTBD 5B0ZB 5AV8D 1P3KA 1P3OD 5KDMA 3W97A 1W2EA 1P3PB 2FJ7B 2Y2MA 2RIQA 4R8PD 2FFFB 5BNVA 5JRGC 5CP6D 5B40C 4KGCD 3AZKD 3MGRD 3X1SD 4LD9D 5B2JB 1P3AD 3VH5W 3MNND 3AYWB 1TAFA 3A6NC 3B6GA 5GT3C 4KUDC 3W99C 4XZQD 4J8VB 1P3LC 4YS3D 3LELC 1KU5A 1KX3A 4G92B 2NZDC 1HQ3A 3B0DB 5B1MB 5B2ID 3LZ0D 5AV9D 3KWQA 2Y2GA 1U35D 1TZYB 3LZ1C 1S32B 5F99C 1P3MD 4M6BA 2AROB 4HGAB 3MGPA 3KUYB 1AOIB 4WNNA 1M18C 5GSUA 3O62C 3B0CT 1WWSA 1M1AA 1WWIA 2Y2LA 2ZY5A 4ZBJC 3MGQC 3TU4C 4DRAA 4H9SA 2CV5C 2RVQD 5E5AB 3MVDA 3EG5B 5AY8D 5CPJD 5BO0A 3WKJA 5AV6A 4EO5C 3AZIA 3AV2A 4WU9C 5G49B 3AZFB 5AVBC 4JJND 2NQBC 1P34A 3R45A 2F8ND 4CAYA 3AZEB 4KUDD 2NZDD 5CPIA 3AZKA 3MGRA 3KSYA 1ZLAB 3X1SA 1T3UA 5FUGB 4H9OA 3REIB 4Z2MH 5F99D 4J8UA 4H9QA 3AZGC 1ID3B 5GT0C 4H9PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KX3 C;  2HIO D;  3V9R A;  5B33 B;  1H3O B;  1Q9C A;  4XZQ A;  1HQ3 C;  3W96 B;  1M18 D;  3AZN C;  3KWQ C;  3MGS C;  1BH9 A;  3LZ0 A;  5JA4 A;  3X1T B;  5AV5 D;  1P3G B;  4H9R A;  2F8N H;  3AZJ C;  3MGQ D;  5AVC B;  1BFM A;  3X1V B;  3REH B;  3AFA B;  5GSU C;  3C1B C;  5DNN A;  1EQZ D;  1KX5 B;  1P3K D;  5CPK C;  5B1L D;  3W97 D;  3AZM D;  3MVD C;  5B31 B;  3WKJ C;  5AV6 C;  4H9N B;  3AZI C;  1A7W A;  3UT9 B;  1M19 B;  5AV8 C;  3UTA B;  1P3O C;  1P34 C;  4JJN A;  3B6G D;  4R8P C;  1F66 B;  4Z2M G;  5CP6 C;  2F8N A;  2PYO B;  3B6F A;  5CPI C;  4X23 B;  3AZK C;  3MGR C;  1P3F A;  1KX3 D;  3X1S C;  4LD9 C;  1P3A C;  1P3B B;  4Z5T A;  3X1U B;  3KWQ D;  1AOI D;  3KXB A;  4WV4 B;  4J8U C;  4XUJ A;  2BYM A;  3MGP D;  4XZQ C;  3B0B A;  5B24 D;  4YS3 C;  3REK B;  1P3I B;  3VH5 A;  4CSR A;  5GSU D;  5B0Y B;  5B2I C;  3LZ0 C;  5AV9 C;  1M1A D;  1U35 C;  5JRG B;  5B40 B;  5BT1 C;  5AV5 A;  2IO5 C;  4YM6 D;  5BNX B;  5B0Z A;  5GXQ D;  1P3P A;  2FJ7 A;  5DNM D;  3A6N B;  3AZI D;  3WKJ D;  3AZE D;  1B67 A;  2YFV A;  3AV2 D;  1EQZ A;  3W99 B;  1P3L B;  3LEL B;  1ZLA D;  3REL D;  5B2J A;  1P34 D;  5B1L A;  3AZM A;  2RVQ C;  3AZL D;  3LZ1 B;  3VH6 W;  5AY8 C;  5CPI D;  5CPJ C;  1ID3 D;  2F8N K;  4NFT A;  3C1C D;  4J8V A;  4JJN C;  2L5A A;  3O62 B;  4J8U D;  5B1M A;  3B6F C;  1P3F C;  3LJA D;  3TU4 B;  4NE6 A;  1KX4 B;  2ARO A;  3KXB C;  1AOI A;  2CV5 B;  3NQU A;  4XUJ C;  4NE5 A;  5BT1 D;  3C1C C;  4QLC B;  2HIO C;  4EO5 B;  4J8X B;  5B24 A;  4WU9 B;  4ZUX D;  5AVB B;  2NQB B;  5DNN D;  5AV5 C;  5E5A A;  4YM6 A;  3AZF A;  5GXQ A;  3AN2 B;  4Z66 B;  3WAA D;  1F66 D;  1EQZ C;  5DNM A;  1P3K C;  3AZG B;  5GT0 B;  3AZE A;  5B1L C;  3W97 C;  1HQ3 B;  4J8W B;  3AZM C;  3AZN B;  1ZLA A;  3REL A;  5FUG A;  3MGS B;  1N1J A;  3B6F D;  3REI A;  1P3F D;  3B0C W;  3WA9 B;  4Z5T D;  3AZL A;  1ULY A;  3AZJ B;  4WU8 B;  3AV1 B;  1ID3 A;  4H9P A;  3KXB D;  5B33 A;  1H3O A;  3W96 A;  4XUJ D;  3B6G C;  3B0D C;  3C1B B;  3X1T A;  5B32 B;  3AZH D;  1P3G A;  3LJA A;  4HGA C;  5CPK B;  5B32 G;  3X1V A;  3AFA A;  3REJ D;  4DRB A;  1AOI C;  3NQJ B;  3WTP B;  3MVD B;  3MGP C;  5B0Z D;  5B24 C;  3UTB B;  1KX5 A;  5AV8 B;  1JFI B;  1P3O B;  4ZUX A;  1P3P D;  1R4V A;  2FJ7 D;  4R8P B;  1M1A C;  5CP6 B;  4KGC B;  3AZK B;  5B2J D;  4YM6 C;  4H9N A;  1P3A B;  4LD9 B;  4H9S C;  5GXQ C;  3MNN B;  3AYW D;  5DNM C;  3WAA A;  1F66 A;  3AZE C;  3AV2 C;  5B31 G;  3V9R B;  4J8V D;  2PYO A;  4YS3 B;  4KHA B;  1ZLA C;  3REL C;  1KX4 D;  5C3I C;  1P3B A;  5B1M D;  5B2I B;  3X1U A;  5AV9 B;  4H9R B;  1TZY D;  1U35 B;  3AZL C;  1S32 D;  2YFW A;  1P3M B;  1ID3 C;  2ARO D;  2IO5 B;  4J8X D;  3KUY D;  3REK A;  3W96 C;  1P3I A;  5B0Y A;  3W98 B;  3VH6 A;  3WTP E;  3LJA C;  3AZH A;  3AFA C;  3REJ A;  3AN2 D;  4Z66 D;  5E5A D;  5AY8 B;  5CPJ B;  2JSS A;  3A6N A;  3AZF D;  1P3L A;  4ZUX C;  3LEL A;  4JJN B;  5DNN C;  4J8W D;  4G91 C;  1F1E A;  5GT3 B;  4KUD B;  2NZD B;  3LZ1 A;  1BH8 B;  4E44 A;  3REI D;  3WAA C;  2BYK B;  1F66 C;  3O62 A;  3AYW A;  5F99 B;  3C1C B;  3VH5 T;  2HIO B;  5B33 D;  3W96 D;  1M18 B;  3X1U C;  1KX4 A;  2HUE C;  2CV5 A;  3X1T D;  4WZS B;  1P3G D;  5AV5 B;  1TZY A;  1S32 A;  4Z5T C;  4ZBJ B;  5AVC D;  3MGQ B;  4UUZ B;  3REH D;  3AFA D;  3REK C;  3X1V D;  1P3I C;  4QLC A;  4J8X A;  5B0Y C;  4WU9 A;  3KUY A;  5AVB A;  2NQB A;  2YFV B;  4AWL C;  1KX5 D;  1EQZ B;  1P3K B;  3AZH C;  5CHL B;  5KDM B;  5B1L B;  3W97 B;  3AZM B;  3REJ C;  5BNV B;  5B31 D;  3AN2 A;  4Z66 A;  5B0Z C;  3UT9 D;  1M19 D;  3UTA D;  3AZG A;  5GT0 A;  5G49 A;  1P3P C;  2FJ7 C;  1TAF B;  4J8W A;  3AZN A;  3B6G B;  3MGS A;  2PYO D;  4X23 D;  1KX3 B;  5B2J C;  1P3B D;  3WA9 A;  3AZJ A;  4WU8 A;  3X1U D;  3AV1 A;  3KWQ B;  3NQU B;  3AYW C;  3W98 D;  3C1B A;  4J8V C;  3MGP B;  5B24 B;  3REK D;  4WNN B;  4G92 C;  1P3I D;  5B32 A;  5GSU B;  5B0Y D;  1KX4 C;  5B1M C;  5CPK A;  1M1A B;  1TZY C;  3NQJ A;  5JRG D;  5B40 D;  3WTP A;  1S32 C;  2ARO C;  4QLC C;  4YM6 B;  5AVC A;  4J8X C;  3UTB A;  3KUY C;  3REH A;  5AV8 A;  5GXQ B;  1JFI A;  1P3O A;  5BO0 B;  3A6N D;  5AV6 B;  5DNM B;  3AZI B;  4R8P A;  3WKJ B;  5GT3 D;  3AV2 B;  3W99 D;  1P3L D;  5CP6 A;  3LEL D;  4KGC A;  3REL B;  4LD9 A;  1P3A A;  5C3I B;  1P34 B;  3R45 B;  1N1J B;  4CAY B;  3AN2 C;  4Z66 C;  5E5A C;  3MNN A;  5B31 A;  3LZ1 D;  3AZL B;  5CPI B;  3MGR B;  4NE3 A;  3X1S B;  4H9O B;  3UT9 A;  1M19 A;  3AZF C;  3UTA A;  4YS3 A;  4J8W C;  4KHA A;  3O62 D;  4J8U B;  4H9Q B;  5B2I A;  5AV9 A;  1HTA A;  4XZQ B;  3LJA B;  3WA9 C;  1U35 A;  4X23 A;  3TU4 D;  4WU8 C;  1P3M A;  3AV1 C;  1BH9 B;  3LZ0 B;  3REI C;  5BS7 A;  5JA4 B;  2CV5 D;  3W98 A;  4QLC D;  5B32 C;  5B33 C;  4WU9 D;  5AVB D;  4ZUX B;  2CWE A;  2NQB D;  5DNN B;  4G91 B;  3WTP C;  3X1T C;  1P3G C;  1B6W A;  5JRG A;  5B40 A;  5AVC C;  3UTB C;  3X1V C;  5AY8 A;  3REH C;  5CPJ A;  5BNX A;  3WAA B;  1KX5 C;  3AZG D;  4KGC C;  5GT0 D;  4E45 A;  5GT3 A;  4KUD A;  3W99 A;  1HQ3 D;  2NZD A;  3AZN D;  1BH8 A;  3MGS D;  2HUE B;  3MNN C;  2F8N B;  5B31 C;  3B6F B;  1P3F B;  2YFW B;  2BYK A;  3WA9 D;  4Z5T B;  3AZJ D;  5F99 A;  3UT9 C;  4WU8 D;  1M19 C;  3UTA C;  3AV1 D;  2F8N G;  3KXB B;  3C1C A;  2HIO A;  2LY8 A;  4XUJ B;  3C1B D;  1M18 A;  3VH6 T;  2BYM B;  4AWL B;  2PYO C;  4X23 C;  5B32 D;  4CSR B;  3AZH B;  1P3M C;  1P3B C;  3MGQ A;  3TU4 A;  5CPK D;  4UUZ A;  5BS7 C;  3REJ B;  3WTP D;  3W98 C;  3MVD D;  5AV6 D;  3UTB D;  5B0Z B;  5AV8 D;  1P3K A;  1P3O D;  5KDM A;  3W97 A;  1P3P B;  2FJ7 B;  4R8P D;  5BNV A;  5JRG C;  5CP6 D;  5B40 C;  4KGC D;  3AZK D;  3MGR D;  3X1S D;  4LD9 D;  5B2J B;  1P3A D;  3VH5 W;  3MNN D;  3AYW B;  1TAF A;  3A6N C;  3B6G A;  5GT3 C;  4KUD C;  3W99 C;  4XZQ D;  4J8V B;  1P3L C;  4YS3 D;  3LEL C;  1KU5 A;  1KX3 A;  4G92 B;  2NZD C;  1HQ3 A;  3B0D B;  5B1M B;  5B2I D;  3LZ0 D;  5AV9 D;  3KWQ A;  1U35 D;  1TZY B;  3LZ1 C;  1S32 B;  5F99 C;  1P3M D;  4M6B A;  2ARO B;  4HGA B;  3MGP A;  3KUY B;  1AOI B;  4WNN A;  1M18 C;  5GSU A;  3O62 C;  3B0C T;  1WWS A;  1M1A A;  1WWI A;  4ZBJ C;  3MGQ C;  3TU4 C;  4DRA A;  4H9S A;  2CV5 C;  2RVQ D;  5E5A B;  3MVD A;  5AY8 D;  5CPJ D;  5BO0 A;  3WKJ A;  5AV6 A;  4EO5 C;  3AZI A;  3AV2 A;  4WU9 C;  5G49 B;  3AZF B;  5AVB C;  4JJN D;  2NQB C;  1P34 A;  3R45 A;  2F8N D;  4CAY A;  3AZE B;  4KUD D;  2NZD D;  5CPI A;  3AZK A;  3MGR A;  3KSY A;  1ZLA B;  3X1S A;  5FUG B;  4H9O A;  3REI B;  4Z2M H;  5F99 D;  4J8U A;  4H9Q A;  3AZG C;  1ID3 B;  5GT0 C;  4H9P B; 
#chains in the Genus database with same CATH topology
 1KX3 C;  2HIO D;  3V9R A;  5B33 B;  1H3O B;  1Q9C A;  4XZQ A;  1HQ3 C;  3W96 B;  1M18 D;  3AZN C;  3KWQ C;  3MGS C;  1BH9 A;  3LZ0 A;  5JA4 A;  3X1T B;  5AV5 D;  1P3G B;  4H9R A;  2F8N H;  3AZJ C;  3MGQ D;  5AVC B;  1BFM A;  3X1V B;  3REH B;  3AFA B;  5GSU C;  3C1B C;  2Y2J A;  5DNN A;  3A1I A;  1EQZ D;  1KX5 B;  1P3K D;  2DF4 C;  5CPK C;  5B1L D;  3W97 D;  3AZM D;  2Y2N A;  3MVD C;  5B31 B;  3WKJ C;  5AV6 C;  4H9N B;  3AZI C;  1A7W A;  3UT9 B;  1M19 B;  5AV8 C;  3UTA B;  1P3O C;  1P34 C;  4JJN A;  3B6G D;  4R8P C;  1F66 B;  4Z2M G;  5CP6 C;  2F8N A;  2PYO B;  3B6F A;  5CPI C;  4X23 B;  3AZK C;  3MGR C;  1P3F A;  1KX3 D;  3X1S C;  4LD9 C;  1P3A C;  1P3B B;  4Z5T A;  3X1U B;  3KWQ D;  1AOI D;  3KXB A;  4WV4 B;  4J8U C;  4XUJ A;  2Y2P A;  2BYM A;  3MGP D;  4XZQ C;  3B0B A;  5B24 D;  4YS3 C;  3REK B;  1P3I B;  3VH5 A;  4CSR A;  5GSU D;  5B0Y B;  4UPK A;  5B2I C;  3LZ0 C;  3EPK A;  5AV9 C;  1M1A D;  1U35 C;  3A1K A;  5JRG B;  5B40 B;  5BT1 C;  5AV5 A;  2UWX A;  2IO5 C;  4YM6 D;  5BNX B;  5B0Z A;  5GXQ D;  1P3P A;  2FJ7 A;  5DNM D;  3A6N B;  3AZI D;  3WKJ D;  3AZE D;  1B67 A;  2YFV A;  3AV2 D;  4WJ3 C;  1EQZ A;  3W99 B;  1P3L B;  3LEL B;  1ZLA D;  3REL D;  5B2J A;  1P34 D;  5B1L A;  3F6T A;  3AZM A;  2RVQ C;  2Y2H A;  1Z2C B;  3AZL D;  3LZ1 B;  3VH6 W;  5AY8 C;  3EPJ A;  5CPJ C;  5CPI D;  1ID3 D;  2F8N K;  4NFT A;  3C1C D;  4J8V A;  2Y2O A;  4JJN C;  2L5A A;  3O62 B;  4J8U D;  5B1M A;  3B6F C;  1P3F C;  3AL0 C;  3LJA D;  3TU4 B;  4NE6 A;  1KX4 B;  2ARO A;  3KXB C;  1AOI A;  2CV5 B;  3NQU A;  4XUJ C;  4NE5 A;  5BT1 D;  3C1C C;  4QLC B;  2HIO C;  4EO5 B;  4J8X B;  5B24 A;  4WU9 B;  4ZUX D;  5AVB B;  2JCH A;  2NQB B;  5DNN D;  5AV5 C;  5E5A A;  4YM6 A;  3AZF A;  5GXQ A;  3AN2 B;  4Z66 B;  3WAA D;  1F66 D;  3H0M C;  3H0L C;  1EQZ C;  5DNM A;  1P3K C;  3AZG B;  5GT0 B;  3AZE A;  5B1L C;  3W97 C;  1HQ3 B;  4J8W B;  3AZM C;  3AZN B;  1ZLA A;  3REL A;  5FUG A;  2ZY2 A;  3MGS B;  1N1J A;  3B6F D;  3REI A;  1P3F D;  3B0C W;  3H0R C;  3WA9 B;  4Z5T D;  3AZL A;  1ULY A;  3AZJ B;  4WU8 B;  3AV1 B;  1ID3 A;  4H9P A;  1PZR A;  3KXB D;  5B33 A;  1H3O A;  3W96 A;  4XUJ D;  3B6G C;  3B0D C;  3C1B B;  3X1T A;  5B32 B;  3AZH D;  1P3G A;  3LJA A;  4HGA C;  5CPK B;  5B32 G;  3X1V A;  3AFA A;  3REJ D;  4DRB A;  1AOI C;  3NQJ B;  3WTP B;  3MVD B;  3MGP C;  5B0Z D;  5B24 C;  3UTB B;  1KX5 A;  5AV8 B;  4DQY B;  1JFI B;  1P3O B;  4ZUX A;  1P3P D;  1R4V A;  2FJ7 D;  4R8P B;  1M1A C;  3EPH A;  5CP6 B;  4KGC B;  3AZK B;  5B2J D;  4H9N A;  4YM6 C;  1P3A B;  4LD9 B;  4H9S C;  5GXQ C;  3MNN B;  3AYW D;  2BG1 A;  5DNM C;  3WAA A;  1F66 A;  3AZE C;  3AV2 C;  5B31 G;  3V9R B;  4J8V D;  2PYO A;  4YS3 B;  4KHA B;  1ZLA C;  3REL C;  1KX4 D;  5C3I C;  1P3B A;  5B1M D;  5B2I B;  3X1U A;  5AV9 B;  4H9R B;  1TZY D;  1U35 B;  3AZL C;  1S32 D;  2YFW A;  1P3M B;  1ID3 C;  2ARO D;  2IO5 B;  4J8X D;  3KUY D;  3REK A;  3W96 C;  1P3I A;  5B0Y A;  3W98 B;  3VH6 A;  3WTP E;  3LJA C;  2W8S A;  3AZH A;  3AFA C;  3REJ A;  3AN2 D;  4Z66 D;  5E5A D;  5AY8 B;  5CPJ B;  2JSS A;  3A6N A;  2VQR A;  3AZF D;  1P3L A;  4ZUX C;  3LEL A;  4JJN B;  5DNN C;  4J8W D;  4G91 C;  1F1E A;  5GT3 B;  4KUD B;  2NZD B;  3LZ1 A;  1BH8 B;  4E44 A;  3REI D;  2G5I C;  2XD1 A;  3WAA C;  2BYK B;  1F66 C;  3O62 A;  3AYW A;  5F99 B;  3C1C B;  3VH5 T;  2HIO B;  5B33 D;  3W96 D;  1M18 B;  3X1U C;  1KX4 A;  2HUE C;  2CV5 A;  3X1T D;  4WZS B;  1P3G D;  5AV5 B;  1TZY A;  1S32 A;  4Z5T C;  4ZBJ B;  5AVC D;  3MGQ B;  4UUZ B;  3REH D;  3AFA D;  2ZM5 A;  3REK C;  3X1V D;  4QLC A;  1P3I C;  4J8X A;  5B0Y C;  4WU9 A;  3KUY A;  5AVB A;  2NQB A;  2YFV B;  4AWL C;  1KX5 D;  1EQZ B;  1P3K B;  3AZH C;  5CHL B;  5KDM B;  5B1L B;  3W97 B;  3AZM B;  3REJ C;  5BNV B;  5B31 D;  3AN2 A;  4Z66 A;  5B0Z C;  3UT9 D;  1M19 D;  3UTA D;  3AZG A;  5GT0 A;  5G49 A;  1P3P C;  2FJ7 C;  1TAF B;  2Y2I A;  4J8W A;  3AZN A;  3B6G B;  3MGS A;  2PYO D;  4X23 D;  1KX3 B;  2ZY3 A;  3IP4 C;  5B2J C;  1P3B D;  3WA9 A;  3AZJ A;  4WU8 A;  3X1U D;  3AV1 A;  3KWQ B;  3NQU B;  3AYW C;  3W98 D;  3P5J B;  3C1B A;  4J8V C;  3MGP B;  5B24 B;  3REK D;  4WNN B;  4G92 C;  1P3I D;  5B32 A;  5GSU B;  5B0Y D;  1KX4 C;  5B1M C;  5CPK A;  1M1A B;  1TZY C;  3NQJ A;  5JRG D;  5B40 D;  3WTP A;  1S32 C;  2ARO C;  4QLC C;  4YM6 B;  5AVC A;  4J8X C;  3UTB A;  3KUY C;  3REH A;  5AV8 A;  5GXQ B;  1JFI A;  1P3O A;  5BO0 B;  3A6N D;  5AV6 B;  5DNM B;  3AZI B;  4R8P A;  3WKJ B;  2Y2K A;  5GT3 D;  3AV2 B;  3W99 D;  1P3L D;  5CP6 A;  3LEL D;  2Y2Q A;  4KGC A;  3REL B;  4LD9 A;  1P3A A;  5C3I B;  1P34 B;  3R45 B;  1N1J B;  4CAY B;  3AN2 C;  4Z66 C;  5E5A C;  3MNN A;  5B31 A;  3LZ1 D;  3AZL B;  5CPI B;  3MGR B;  4NE3 A;  3X1S B;  4H9O B;  3UT9 A;  1M19 A;  3AZF C;  3UTA A;  4YS3 A;  4J8W C;  4KHA A;  3O62 D;  2XD5 A;  4J8U B;  4H9Q B;  5B2I A;  5AV9 A;  1HTA A;  4XZQ B;  3LJA B;  3WA9 C;  1U35 A;  4X23 A;  3TU4 D;  4WU8 C;  1P3M A;  3AV1 C;  2J8P A;  2ZY4 A;  1BH9 B;  3LZ0 B;  3REI C;  5BS7 A;  5JA4 B;  2CV5 D;  3EPL A;  3W98 A;  4QLC D;  5B32 C;  5B33 C;  4WU9 D;  5AVB D;  4ZUX B;  2CWE A;  2NQB D;  5DNN B;  3FDD A;  4G91 B;  3WTP C;  3X1T C;  1P3G C;  1B6W A;  5JRG A;  5B40 A;  2F2A C;  5AVC C;  3UTB C;  3X1V C;  5AY8 A;  3REH C;  5CPJ A;  5BNX A;  3WAA B;  1KX5 C;  3AZG D;  4KGC C;  5GT0 D;  4E45 A;  5GT3 A;  4KUD A;  3W99 A;  1HQ3 D;  2NZD A;  3AZN D;  1BH8 A;  3KFU G;  3MGS D;  2G5H C;  2HUE B;  3MNN C;  2F8N B;  5B31 C;  3B6F B;  1P3F B;  2YFW B;  2BYK A;  3WA9 D;  4Z5T B;  3AZJ D;  5F99 A;  3UT9 C;  2DQN C;  4WU8 D;  3UTA C;  3AV1 D;  1M19 C;  2F8N G;  3KXB B;  3C1C A;  2HIO A;  2LY8 A;  4XUJ B;  2JE5 A;  3C1B D;  1M18 A;  3VH6 T;  2BYM B;  4AWL B;  2PYO C;  4X23 C;  5B32 D;  4CSR B;  3AZH B;  1P3M C;  1P3B C;  3MGQ A;  3TU4 A;  5CPK D;  4UUZ A;  5BS7 C;  3REJ B;  3WTP D;  3W98 C;  3MVD D;  5AV6 D;  3UTB D;  5B0Z B;  5AV8 D;  1P3K A;  1P3O D;  5KDM A;  3W97 A;  1W2E A;  1P3P B;  2FJ7 B;  2Y2M A;  2RIQ A;  4R8P D;  2FFF B;  5BNV A;  5JRG C;  5CP6 D;  5B40 C;  4KGC D;  3AZK D;  3MGR D;  3X1S D;  4LD9 D;  5B2J B;  1P3A D;  3VH5 W;  3MNN D;  3AYW B;  1TAF A;  3A6N C;  3B6G A;  5GT3 C;  4KUD C;  3W99 C;  4XZQ D;  4J8V B;  1P3L C;  4YS3 D;  3LEL C;  1KU5 A;  1KX3 A;  4G92 B;  2NZD C;  1HQ3 A;  3B0D B;  5B1M B;  5B2I D;  3LZ0 D;  5AV9 D;  3KWQ A;  2Y2G A;  1U35 D;  1TZY B;  3LZ1 C;  1S32 B;  5F99 C;  1P3M D;  4M6B A;  2ARO B;  4HGA B;  3MGP A;  3KUY B;  1AOI B;  4WNN A;  1M18 C;  5GSU A;  3O62 C;  3B0C T;  1WWS A;  1M1A A;  1WWI A;  2Y2L A;  2ZY5 A;  4ZBJ C;  3MGQ C;  3TU4 C;  4DRA A;  4H9S A;  2CV5 C;  2RVQ D;  5E5A B;  3MVD A;  3EG5 B;  5AY8 D;  5CPJ D;  5BO0 A;  3WKJ A;  5AV6 A;  4EO5 C;  3AZI A;  3AV2 A;  4WU9 C;  5G49 B;  3AZF B;  5AVB C;  4JJN D;  2NQB C;  1P34 A;  3R45 A;  2F8N D;  4CAY A;  3AZE B;  4KUD D;  2NZD D;  5CPI A;  3AZK A;  3MGR A;  3KSY A;  1ZLA B;  3X1S A;  1T3U A;  5FUG B;  4H9O A;  3REI B;  4Z2M H;  5F99 D;  4J8U A;  4H9Q A;  3AZG C;  1ID3 B;  5GT0 C;  4H9P B; 
#chains in the Genus database with same CATH homology
 1KX3 C;  2HIO D;  3V9R A;  5B33 B;  1H3O B;  1Q9C A;  4XZQ A;  1HQ3 C;  3W96 B;  1M18 D;  3AZN C;  3KWQ C;  3MGS C;  1BH9 A;  3LZ0 A;  5JA4 A;  3X1T B;  5AV5 D;  1P3G B;  4H9R A;  2F8N H;  3AZJ C;  3MGQ D;  5AVC B;  1BFM A;  3X1V B;  3REH B;  3AFA B;  5GSU C;  3C1B C;  2Y2J A;  5DNN A;  3A1I A;  1EQZ D;  1KX5 B;  1P3K D;  2DF4 C;  5CPK C;  5B1L D;  3W97 D;  3AZM D;  2Y2N A;  3MVD C;  5B31 B;  3WKJ C;  5AV6 C;  4H9N B;  3AZI C;  1A7W A;  3UT9 B;  1M19 B;  5AV8 C;  3UTA B;  1P3O C;  1P34 C;  4JJN A;  3B6G D;  4R8P C;  1F66 B;  4Z2M G;  5CP6 C;  2F8N A;  2PYO B;  3B6F A;  5CPI C;  4X23 B;  3AZK C;  3MGR C;  1P3F A;  1KX3 D;  3X1S C;  4LD9 C;  1P3A C;  1P3B B;  4Z5T A;  3X1U B;  3KWQ D;  1AOI D;  3KXB A;  4WV4 B;  4J8U C;  4XUJ A;  2Y2P A;  2BYM A;  3MGP D;  4XZQ C;  3B0B A;  5B24 D;  4YS3 C;  3REK B;  1P3I B;  3VH5 A;  4CSR A;  5GSU D;  5B0Y B;  4UPK A;  5B2I C;  3LZ0 C;  3EPK A;  5AV9 C;  1M1A D;  1U35 C;  3A1K A;  5JRG B;  5B40 B;  5BT1 C;  5AV5 A;  2UWX A;  2IO5 C;  4YM6 D;  5BNX B;  5B0Z A;  5GXQ D;  1P3P A;  2FJ7 A;  5DNM D;  3A6N B;  3AZI D;  3WKJ D;  3AZE D;  1B67 A;  2YFV A;  3AV2 D;  4WJ3 C;  1EQZ A;  3W99 B;  1P3L B;  3LEL B;  1ZLA D;  3REL D;  5B2J A;  1P34 D;  5B1L A;  3F6T A;  3AZM A;  2RVQ C;  2Y2H A;  1Z2C B;  3AZL D;  3LZ1 B;  3VH6 W;  5AY8 C;  3EPJ A;  5CPJ C;  5CPI D;  1ID3 D;  2F8N K;  4NFT A;  3C1C D;  4J8V A;  2Y2O A;  4JJN C;  2L5A A;  3O62 B;  4J8U D;  5B1M A;  3B6F C;  1P3F C;  3AL0 C;  3LJA D;  3TU4 B;  4NE6 A;  1KX4 B;  2ARO A;  3KXB C;  1AOI A;  2CV5 B;  3NQU A;  4XUJ C;  4NE5 A;  5BT1 D;  3C1C C;  4QLC B;  2HIO C;  4EO5 B;  4J8X B;  5B24 A;  4WU9 B;  4ZUX D;  5AVB B;  2JCH A;  2NQB B;  5DNN D;  5AV5 C;  5E5A A;  4YM6 A;  3AZF A;  5GXQ A;  3AN2 B;  4Z66 B;  3WAA D;  1F66 D;  3H0M C;  3H0L C;  1EQZ C;  5DNM A;  1P3K C;  3AZG B;  5GT0 B;  3AZE A;  5B1L C;  3W97 C;  1HQ3 B;  4J8W B;  3AZM C;  3AZN B;  1ZLA A;  3REL A;  5FUG A;  2ZY2 A;  3MGS B;  1N1J A;  3B6F D;  3REI A;  1P3F D;  3B0C W;  3H0R C;  3WA9 B;  4Z5T D;  3AZL A;  1ULY A;  3AZJ B;  4WU8 B;  3AV1 B;  1ID3 A;  4H9P A;  1PZR A;  3KXB D;  5B33 A;  1H3O A;  3W96 A;  4XUJ D;  3B6G C;  3B0D C;  3C1B B;  3X1T A;  5B32 B;  3AZH D;  1P3G A;  3LJA A;  4HGA C;  5CPK B;  5B32 G;  3X1V A;  3AFA A;  3REJ D;  4DRB A;  1AOI C;  3NQJ B;  3WTP B;  3MVD B;  3MGP C;  5B0Z D;  5B24 C;  3UTB B;  1KX5 A;  5AV8 B;  4DQY B;  1JFI B;  1P3O B;  4ZUX A;  1P3P D;  1R4V A;  2FJ7 D;  4R8P B;  1M1A C;  3EPH A;  5CP6 B;  4KGC B;  3AZK B;  5B2J D;  4H9N A;  4YM6 C;  1P3A B;  4LD9 B;  4H9S C;  5GXQ C;  3MNN B;  3AYW D;  2BG1 A;  5DNM C;  3WAA A;  1F66 A;  3AZE C;  3AV2 C;  5B31 G;  3V9R B;  4J8V D;  2PYO A;  4YS3 B;  4KHA B;  1ZLA C;  3REL C;  1KX4 D;  5C3I C;  1P3B A;  5B1M D;  5B2I B;  3X1U A;  5AV9 B;  4H9R B;  1TZY D;  1U35 B;  3AZL C;  1S32 D;  2YFW A;  1P3M B;  1ID3 C;  2ARO D;  2IO5 B;  4J8X D;  3KUY D;  3REK A;  3W96 C;  1P3I A;  5B0Y A;  3W98 B;  3VH6 A;  3WTP E;  3LJA C;  2W8S A;  3AZH A;  3AFA C;  3REJ A;  3AN2 D;  4Z66 D;  5E5A D;  5AY8 B;  5CPJ B;  2JSS A;  3A6N A;  2VQR A;  3AZF D;  1P3L A;  4ZUX C;  3LEL A;  4JJN B;  5DNN C;  4J8W D;  4G91 C;  1F1E A;  5GT3 B;  4KUD B;  2NZD B;  3LZ1 A;  1BH8 B;  4E44 A;  3REI D;  2G5I C;  2XD1 A;  3WAA C;  2BYK B;  1F66 C;  3O62 A;  3AYW A;  5F99 B;  3C1C B;  3VH5 T;  2HIO B;  5B33 D;  3W96 D;  1M18 B;  3X1U C;  1KX4 A;  2HUE C;  2CV5 A;  3X1T D;  4WZS B;  1P3G D;  5AV5 B;  1TZY A;  1S32 A;  4Z5T C;  4ZBJ B;  5AVC D;  3MGQ B;  4UUZ B;  3REH D;  3AFA D;  2ZM5 A;  3REK C;  3X1V D;  4QLC A;  1P3I C;  4J8X A;  5B0Y C;  4WU9 A;  3KUY A;  5AVB A;  2NQB A;  2YFV B;  4AWL C;  1KX5 D;  1EQZ B;  1P3K B;  3AZH C;  5CHL B;  5KDM B;  5B1L B;  3W97 B;  3AZM B;  3REJ C;  5BNV B;  5B31 D;  3AN2 A;  4Z66 A;  5B0Z C;  3UT9 D;  1M19 D;  3UTA D;  3AZG A;  5GT0 A;  5G49 A;  1P3P C;  2FJ7 C;  1TAF B;  2Y2I A;  4J8W A;  3AZN A;  3B6G B;  3MGS A;  2PYO D;  4X23 D;  1KX3 B;  2ZY3 A;  3IP4 C;  5B2J C;  1P3B D;  3WA9 A;  3AZJ A;  4WU8 A;  3X1U D;  3AV1 A;  3KWQ B;  3NQU B;  3AYW C;  3W98 D;  3P5J B;  3C1B A;  4J8V C;  3MGP B;  5B24 B;  3REK D;  4WNN B;  4G92 C;  1P3I D;  5B32 A;  5GSU B;  5B0Y D;  1KX4 C;  5B1M C;  5CPK A;  1M1A B;  1TZY C;  3NQJ A;  5JRG D;  5B40 D;  3WTP A;  1S32 C;  2ARO C;  4QLC C;  4YM6 B;  5AVC A;  4J8X C;  3UTB A;  3KUY C;  3REH A;  5AV8 A;  5GXQ B;  1JFI A;  1P3O A;  5BO0 B;  3A6N D;  5AV6 B;  5DNM B;  3AZI B;  4R8P A;  3WKJ B;  2Y2K A;  5GT3 D;  3AV2 B;  3W99 D;  1P3L D;  5CP6 A;  3LEL D;  2Y2Q A;  4KGC A;  3REL B;  4LD9 A;  1P3A A;  5C3I B;  1P34 B;  3R45 B;  1N1J B;  4CAY B;  3AN2 C;  4Z66 C;  5E5A C;  3MNN A;  5B31 A;  3LZ1 D;  3AZL B;  5CPI B;  3MGR B;  4NE3 A;  3X1S B;  4H9O B;  3UT9 A;  1M19 A;  3AZF C;  3UTA A;  4YS3 A;  4J8W C;  4KHA A;  3O62 D;  2XD5 A;  4J8U B;  4H9Q B;  5B2I A;  5AV9 A;  1HTA A;  4XZQ B;  3LJA B;  3WA9 C;  1U35 A;  4X23 A;  3TU4 D;  4WU8 C;  1P3M A;  3AV1 C;  2J8P A;  2ZY4 A;  1BH9 B;  3LZ0 B;  3REI C;  5BS7 A;  5JA4 B;  2CV5 D;  3EPL A;  3W98 A;  4QLC D;  5B32 C;  5B33 C;  4WU9 D;  5AVB D;  4ZUX B;  2CWE A;  2NQB D;  5DNN B;  3FDD A;  4G91 B;  3WTP C;  3X1T C;  1P3G C;  1B6W A;  5JRG A;  5B40 A;  2F2A C;  5AVC C;  3UTB C;  3X1V C;  5AY8 A;  3REH C;  5CPJ A;  5BNX A;  3WAA B;  1KX5 C;  3AZG D;  4KGC C;  5GT0 D;  4E45 A;  5GT3 A;  4KUD A;  3W99 A;  1HQ3 D;  2NZD A;  3AZN D;  1BH8 A;  3KFU G;  3MGS D;  2G5H C;  2HUE B;  3MNN C;  2F8N B;  5B31 C;  3B6F B;  1P3F B;  2YFW B;  2BYK A;  3WA9 D;  4Z5T B;  3AZJ D;  5F99 A;  3UT9 C;  2DQN C;  4WU8 D;  3UTA C;  3AV1 D;  1M19 C;  2F8N G;  3KXB B;  3C1C A;  2HIO A;  2LY8 A;  4XUJ B;  2JE5 A;  3C1B D;  1M18 A;  3VH6 T;  2BYM B;  4AWL B;  2PYO C;  4X23 C;  5B32 D;  4CSR B;  3AZH B;  1P3M C;  1P3B C;  3MGQ A;  3TU4 A;  5CPK D;  4UUZ A;  5BS7 C;  3REJ B;  3WTP D;  3W98 C;  3MVD D;  5AV6 D;  3UTB D;  5B0Z B;  5AV8 D;  1P3K A;  1P3O D;  5KDM A;  3W97 A;  1W2E A;  1P3P B;  2FJ7 B;  2Y2M A;  2RIQ A;  4R8P D;  2FFF B;  5BNV A;  5JRG C;  5CP6 D;  5B40 C;  4KGC D;  3AZK D;  3MGR D;  3X1S D;  4LD9 D;  5B2J B;  1P3A D;  3VH5 W;  3MNN D;  3AYW B;  1TAF A;  3A6N C;  3B6G A;  5GT3 C;  4KUD C;  3W99 C;  4XZQ D;  4J8V B;  1P3L C;  4YS3 D;  3LEL C;  1KU5 A;  1KX3 A;  4G92 B;  2NZD C;  1HQ3 A;  3B0D B;  5B1M B;  5B2I D;  3LZ0 D;  5AV9 D;  3KWQ A;  2Y2G A;  1U35 D;  1TZY B;  3LZ1 C;  1S32 B;  5F99 C;  1P3M D;  4M6B A;  2ARO B;  4HGA B;  3MGP A;  3KUY B;  1AOI B;  4WNN A;  1M18 C;  5GSU A;  3O62 C;  3B0C T;  1WWS A;  1M1A A;  1WWI A;  2Y2L A;  2ZY5 A;  4ZBJ C;  3MGQ C;  3TU4 C;  4DRA A;  4H9S A;  2CV5 C;  2RVQ D;  5E5A B;  3MVD A;  3EG5 B;  5AY8 D;  5CPJ D;  5BO0 A;  3WKJ A;  5AV6 A;  4EO5 C;  3AZI A;  3AV2 A;  4WU9 C;  5G49 B;  3AZF B;  5AVB C;  4JJN D;  2NQB C;  1P34 A;  3R45 A;  2F8N D;  4CAY A;  3AZE B;  4KUD D;  2NZD D;  5CPI A;  3AZK A;  3MGR A;  3KSY A;  1ZLA B;  3X1S A;  1T3U A;  5FUG B;  4H9O A;  3REI B;  4Z2M H;  5F99 D;  4J8U A;  4H9Q A;  3AZG C;  1ID3 B;  5GT0 C;  4H9P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...