1M1AA

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146 Base Pair DNA Fragment
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
total genus 30
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m1aA00
3B6FA 3AV1A 1U35C 5B1MB 3AZLD 5FUGA 1P34D 1P3ID 3B6FB 3WKJC 3AV1B 3REHC 4KGCC 4DRAA 5FUGB 5AV5C 2F8NG 3W99C 5DNMA 3X1UA 5AV5D 2FJ7D 5DNMB 3W99D 3REIA 3AN2C 5B31A 3REIB 5B31B 4CAYA 3MGSA 3AZFC 4CAYB 3WTPE 3WA9A 3WAAA 3MGSB 1P3BC 4NFTA 4NE5A 3LZ1C 3WA9B 3WAAB 5G49B 3KUYC 3X1SA 4WV4B 3KUYD 4XZQC 3TU4C 2AROA 4Z2MG 5AY8A 1P3LA 5GT0D 2AROB 1P3MA 1M1AC 3X1TC 5AY8B 1P3PA 1WWSA 2CV5D 1P3MB 3REJA 3VH6T 1M1AD 5DNNC 3X1TD 3B0CW 1KX3A 3REJB 1KX3B 1TAFA 3AYWC 1M18D 3KXBC 5B33D 2F8NH 1TAFB 4WNNA 1P3GC 4EO5C 3AYWD 1P3AA 4WNNB 1B67A 1P3AB 4Z5TD 2IO5B 5AV9D 3MVDC 3AZJB 4J8VC 2RVQD 4QLCD 3AZHD 4XUJA 3LZ0A 5CPKA 3AZIC 4XUJB 3LZ0B 5GT3D 5CPKB 5B1LA 5B31G 5AV6C 3AZID 5B1LB 3C1CA 4WU8B 4Z2MH 3C1CB 5B0YC 4H9QA 1S32D 1F1EA 4H9QB 2PYOC 4WU9A 4JJNB 4H9NA 5AVCD 3RELC 5JA4A 5AV8A 5B0ZC 1P3OB 5JA4B 3KWQC 5B2IC 4R8PA 5BNXB 4ZUXD 1HQ3A 5B0ZD 4R8PB 5AVBA 2HIOD 1HQ3B 5B32C 5B2ID 3UTBC 4H9PB 5BT1C 5AVBB 3AZMC 1ZLAA 3C1BD 3UTBD 3AZMD 3B6GD 1AOIB 1EQZA 2F8NA 1M19C 1Q9CA 1EQZB 5F99D 5CPJB 1P3FA 1M19D 3X1VD 3W96C 1P3FB 4X23D 4G92C 3A6NC 1KX4C 3AZLA 3W96D 1P34A 3UTAD 1P3OD 1KX4D 3AV2D 3AZLB 5GXQA 1P34B 1P3IB 1F66C 2FJ7A 5AV5A 1KX5C 3AZED 5AV5B 1F66D 2FJ7B 3W99A 1BH9B 4NE6A 5B40D 3W99B 1KX5D 4H9RA 3KSYA 4H9RB 1HTAA 1AOID 1ID3D 5GSUD 5B2JC 1WWIA 3AZGC 3MGRC 4YS3C 5E5AC 4J8WC 3UT9D 4LD9D 5CPJD 5E5AD 3LJAD 3KUYA 3W98C 3KUYB 4YM6D 5GT0A 3MGQD 4AWLC 5CHLB 5GT0B 2CV5A 3W98D 2CV5B 3X1TA 5B24C 1M1AA 1U35D 1M1AB 3X1TB 3WKJD 4KGCD 3REHD 1M18A 5B24D 5B33A 1M18B 3AYWA 4CSRA 5B33B 2NZDC 3AYWB 4CSRB 4Z5TA 5AV9A 3AN2D 3B0DC 4EO5B 4Z5TB 5AV9B 5G49A 4QLCA 3AZFD 3AZHA 4QLCB 3AZHB 1P3BD 5GT3A 3LZ1D 3AZKC 4J8UC 5GT3B 3AZKD 3AZIB 4XZQD 3TU4D 1S32A 4KUDC 3VH5A 4G91B 1TZYC 1S32B 1JFIA 4KUDD 5AVCA 1JFIB 1TZYD 5DNND 5AVCB 5JRGC 3KXBD 3MNNC 4ZUXA 4M6BA 2L5AA 1P3GD 2HIOA 5B2IA 4ZUXB 5B0ZB 3MNND 2HIOB 5B2IB 3AZJA 3B0BA 3C1BA 3NQUA 2YFWA 4NE3A 3UTBA 2HUEB 3C1BB 5B32B 3NQUB 2YFWB 3UTBB 3AZMA 3B6GA 3MVDD 3AZMB 4J8VD 5DNMC 3X1UC 3B6GB 4WU8A 5BS7A 3REIC 3X1UD 5F99A 5B31C 5AV6D 5F99B 1M19A 3X1VA 4JJNA 4X23A 3MGSC 1M19B 3X1VB 5B0YD 3WA9C 4X23B 3UTAA 1P3OA 3AV2A 2PYOD 3W96B 5BNXA 3UTAB 3X1SC 3AV2B 1KX4B 3RELD 4ZBJB 4H9PA 3X1SD 2AROC 3KWQD 3AZEA 3VH5W 1F66A 5AY8C 1P3LC 1P3MC 3AZEB 1F66B 5B40A 1P3PC 1KX5A 5B32D 3B0CT 1P3LD 5B40B 3REJC 1KX5B 5BT1D 3V9RA 1AOIA 1ID3A 5GSUA 3V9RB 1ID3B 5GSUB 3UT9A 4LD9A 5CPJA 1P3AC 5E5AA 1B6WA 3LJAA 3UT9B 3AZGB 2IO5C 4LD9B 5E5AB 5B32G 3VH6A 3LJAB 3MGPC 1P3KC 4YM6A 3MGQA 3REKC 4YM6B 3MGQB 3MGPD 1P3KD 3W98A 1P3IA 3A6ND 3W98B 3REKD 2LY8A 4XUJC 3LZ0C 1U35A 4AWLB 3WKJA 5KDMA 3REHA 1U35B 4KGCA 5B1LC 5B24A 3WKJB 5KDMB 3REHB 4KGCB 1BH9A 5B24B 2NQBC 3WTPC 3AN2A 2NQBD 4DRBA 4WU9C 3AN2B 3WTPD 4KHAA 3AZFA 5AV8C 4E44A 4WU9D 5CPIC 3B0DB 4KHAB 3AZFB 3AZNC 5B2JD 3AZGD 4R8PC 3MGRD 5CP6C 1P3BA 4YS3D 3LZ1A 1HQ3C 1P3BB 5CPID 3LZ1B 3AZND 4J8WD 5CP6D 3AZKA 2BYMA 1ZLAC 4XZQA 3W97C 3TU4A 3AZKB 3O62C 2BYMB 1BH8A 4XZQB 3TU4B 3W97D 1BH8B 3O62D 1TZYA 5DNNA 4KUDB 1EQZC 1N1JA 3VH6W 1TZYB 5DNNB 3KXBA 1N1JB 4H9SC 1P3FC 2F8NK 3KXBB 1P3GA 1P3IC 2NZDD 1P3GB 3MNNB 3LELC 5GXQC 3MVDA 3LELD 4J8VA 2FJ7C 5GXQD 4HGAC 3MVDB 4J8VB 3AZIA 4J8UD 5AV6A 3X1UB 2BYKA 5AV6B 1BFMA 2BYKB 1KU5A 5B0YA 3AFAC 4H9OA 5B0YB 2PYOA 4H9OB 3AFAD 5BO0A 5C3IC 2PYOB 3RELA 5BO0B 4J8XC 5B0ZA 4Z66C 3RELB 3KWQA 5JRGD 3X1SB 5GT0C 5B1MC 4J8XD 3KWQB 3B6FC 4Z66D 3AV1C 5B32A 2CV5C 5B1MD 3B6FD 3AV1D 1P3LB 1P3PB 1M18C 5B33C 5DNMD 4Z5TC 3R45A 5AV9C 3REID 5B31D 3R45B 3WAAC 3MGPA 1P3KA 3W96A 2RVQC 4QLCC 3A6NA 3MGSD 3MGPB 3AZHC 3REKA 1P3KB 1KX4A 3WA9D 3WAAD 4G92B 3A6NB 3REKB 5GT3C 2AROD 2CWEA 4G91C 1S32C 5AY8D 1P3MD 2NQBA 1KX3C 1P3PD 4WZSB 1ULYA 2NQBB 3WTPA 3REJD 5AVCC 1KX3D 3WTPB 5B2JA 3AZGA 3MGRA 4WU9B 4YS3A 4ZUXC 4H9NB 5B2JB 5CPIA 3MGRB 4YS3B 3AZNA 4J8WA 2HIOC 5AV8B 5CP6A 1P3AD 5CPIB 3AZNB 4J8WB 5CP6B 2HUEC 3AZJC 3C1BC 1A7WA 3AZJD 3W97A 4E45A 5CPKC 3O62A 3B6GC 1ZLAB 3W97B 4UUZA 3O62B 4XUJD 3LZ0D 5CPKD 4WU8C 4UUZB 3C1CC 5BS7C 5B1LD 5F99C 4WU8D 5BNVA 3C1CD 3X1VC 2NZDA 4JJNC 4X23C 2F8NB 4H9SA 5BNVB 2NZDB 4JJND 3UTAC 1P3OC 3AV2C 4ZBJC 3LELA 5AV8D 3VH5T 3LELB 3NQJA 5GXQB 5AVBC 4R8PD 3AZEC 1HQ3D 4J8UA 3NQJB 1R4VA 5B40C 5AVBD 4HGAB 4J8UB 1ZLAD 1AOIC 1ID3C 5GSUC 4KUDA 1H3OA 2JSSA 3AFAA 3UT9C 1H3OB 5CPJC 4LD9C 3AFAB 3LJAC 1EQZD 2F8ND 5JRGA 5C3IB 4YM6C 3MNNA 3MGQC 4J8XA 1P3FD 2YFVA 5JRGB 4Z66A 4J8XB 3AZLC 1P34C 2YFVB 4Z66B 5B1MA
chains in the Genus database with same CATH superfamily
3B6FA 3AV1A 1U35C 5B1MB 2Y2KA 3AZLD 5FUGA 1P34D 1P3ID 3B6FB 3WKJC 3AV1B 3REHC 4KGCC 4DRAA 5FUGB 5AV5C 2F8NG 3W99C 5DNMA 3X1UA 5AV5D 2FJ7D 5DNMB 3W99D 3REIA 3AN2C 5B31A 3REIB 5B31B 4CAYA 3MGSA 3AZFC 4CAYB 3WTPE 3WA9A 3WAAA 3MGSB 1P3BC 2Y2HA 4NFTA 4NE5A 3LZ1C 3WA9B 3WAAB 2UWXA 5G49B 3KUYC 3X1SA 4WV4B 3KUYD 4XZQC 3TU4C 2AROA 4Z2MG 5AY8A 1P3LA 5GT0D 2AROB 1P3MA 1T3UA 2ZM5A 1M1AC 3X1TC 5AY8B 1P3PA 1WWSA 2CV5D 1P3MB 3REJA 1W2EA 3VH6T 1M1AD 5DNNC 3X1TD 3B0CW 1KX3A 3REJB 1KX3B 1TAFA 3AYWC 1M18D 3KXBC 5B33D 2F8NH 1TAFB 4WNNA 1P3GC 4EO5C 3AYWD 1P3AA 4WNNB 1B67A 1P3AB 4Z5TD 2IO5B 5AV9D 3MVDC 3AZJB 4J8VC 2RVQD 4QLCD 3AZHD 3EPLA 4XUJA 3LZ0A 5CPKA 3AZIC 4XUJB 3LZ0B 5GT3D 5CPKB 5B1LA 5B31G 5AV6C 3AZID 5B1LB 3C1CA 4WU8B 4Z2MH 3C1CB 2RIQA 5B0YC 4H9QA 1S32D 1F1EA 4H9QB 2PYOC 4WU9A 4JJNB 3AL0C 4H9NA 5AVCD 3RELC 5JA4A 5AV8A 5B0ZC 1P3OB 5JA4B 3KWQC 5B2IC 4R8PA 5BNXB 4ZUXD 1HQ3A 5B0ZD 4R8PB 3IP4C 5AVBA 1HQ3B 2HIOD 5B2ID 5B32C 3UTBC 4H9PB 5AVBB 5BT1C 3AZMC 1ZLAA 3C1BD 2Y2OA 3UTBD 3AZMD 3B6GD 2JE5A 1AOIB 1EQZA 3EPJA 2F8NA 1M19C 1Q9CA 2Y2PA 1EQZB 5F99D 5CPJB 1P3FA 1M19D 3X1VD 3W96C 1P3FB 4X23D 4G92C 3A6NC 1KX4C 3AZLA 3W96D 1P34A 3UTAD 1P3OD 1KX4D 3AV2D 3AZLB 5GXQA 1P34B 1P3IB 1F66C 2FJ7A 5AV5A 1KX5C 3AZED 5AV5B 1F66D 2FJ7B 3W99A 1BH9B 2Y2NA 4NE6A 5B40D 3W99B 3P5JB 1KX5D 4H9RA 3KSYA 4H9RB 1HTAA 1AOID 1ID3D 5GSUD 5B2JC 1WWIA 3AZGC 3MGRC 4YS3C 5E5AC 4J8WC 3UT9D 4LD9D 5CPJD 5E5AD 3LJAD 3KUYA 3W98C 3KUYB 3KFUG 4YM6D 5GT0A 3MGQD 4AWLC 5CHLB 5GT0B 2CV5A 3W98D 2CV5B 3X1TA 5B24C 1M1AA 1U35D 1M1AB 3X1TB 3WKJD 4KGCD 3REHD 1M18A 5B24D 3FDDA 5B33A 3A1IA 1M18B 3AYWA 4CSRA 5B33B 2NZDC 3AYWB 4CSRB 4Z5TA 5AV9A 3AN2D 3B0DC 4EO5B 4Z5TB 5AV9B 5G49A 4QLCA 3AZFD 3AZHA 4QLCB 3AZHB 1P3BD 5GT3A 3LZ1D 3AZKC 4J8UC 5GT3B 3AZKD 3AZIB 4XZQD 3TU4D 1S32A 4KUDC 3VH5A 2Y2MA 4G91B 1TZYC 1S32B 1JFIA 4KUDD 5AVCA 1JFIB 1TZYD 5DNND 5AVCB 5JRGC 3KXBD 3MNNC 4ZUXA 4M6BA 2L5AA 1P3GD 2HIOA 5B2IA 4ZUXB 5B0ZB 3MNND 2HIOB 5B2IB 3AZJA 3B0BA 3C1BA 3NQUA 2YFWA 4NE3A 3UTBA 2HUEB 3C1BB 5B32B 3NQUB 2YFWB 3UTBB 3AZMA 3B6GA 3MVDD 3AZMB 4J8VD 5DNMC 3X1UC 3B6GB 1Z2CB 2DF4C 4WU8A 2F2AC 5BS7A 3REIC 3X1UD 5F99A 5B31C 5AV6D 2FFFB 5F99B 1M19A 3X1VA 4JJNA 4X23A 3MGSC 1M19B 3X1VB 3EG5B 5B0YD 4X23B 3WA9C 3UTAA 1P3OA 3AV2A 2PYOD 3W96B 5BNXA 3UTAB 3H0RC 3AV2B 3X1SC 1KX4B 2Y2IA 3RELD 4ZBJB 4H9PA 3X1SD 2AROC 3KWQD 3AZEA 3VH5W 1F66A 5AY8C 1P3LC 1P3MC 3AZEB 1F66B 5B40A 1P3PC 1KX5A 5B32D 3B0CT 1P3LD 5B40B 3REJC 1KX5B 5BT1D 3V9RA 1AOIA 1ID3A 5GSUA 3V9RB 1ID3B 5GSUB 3EPHA 3UT9A 4LD9A 5CPJA 1P3AC 5E5AA 1B6WA 3LJAA 3UT9B 3AZGB 2IO5C 4LD9B 5E5AB 5B32G 3VH6A 3LJAB 3MGPC 1P3KC 4YM6A 3MGQA 3H0LC 3REKC 4YM6B 3MGQB 3MGPD 1P3KD 3W98A 1P3IA 3A6ND 3W98B 3REKD 2LY8A 4XUJC 3LZ0C 1U35A 4AWLB 2J8PA 3WKJA 5KDMA 3REHA 1U35B 4KGCA 5B1LC 5B24A 3WKJB 5KDMB 3REHB 4KGCB 1BH9A 5B24B 2NQBC 3WTPC 3AN2A 2NQBD 4DRBA 4WU9C 3AN2B 3WTPD 4KHAA 3AZFA 5AV8C 4E44A 4WU9D 5CPIC 3B0DB 4KHAB 3AZFB 3AZNC 5B2JD 3AZGD 4R8PC 3MGRD 5CP6C 1P3BA 4YS3D 3LZ1A 1HQ3C 1P3BB 5CPID 3LZ1B 3AZND 4J8WD 5CP6D 3AZKA 2BYMA 1ZLAC 4XZQA 3W97C 3TU4A 3AZKB 3O62C 2BYMB 1BH8A 4XZQB 3TU4B 3W97D 1BH8B 3O62D 1TZYA 5DNNA 4KUDB 4WJ3C 1EQZC 1N1JA 3VH6W 1TZYB 5DNNB 3KXBA 1N1JB 4H9SC 1P3FC 2F8NK 3KXBB 1P3GA 1P3IC 2NZDD 1P3GB 3MNNB 3LELC 5GXQC 2Y2QA 3MVDA 3LELD 4J8VA 2FJ7C 3F6TA 5GXQD 4HGAC 3MVDB 4J8VB 3AZIA 4J8UD 2BG1A 5AV6A 4DQYB 2Y2JA 3X1UB 2BYKA 5AV6B 1BFMA 2BYKB 1KU5A 2VQRA 5B0YA 3AFAC 4H9OA 5B0YB 2PYOA 4H9OB 3AFAD 5BO0A 5C3IC 2PYOB 3RELA 5BO0B 4J8XC 5B0ZA 2ZY2A 4Z66C 3RELB 3KWQA 5JRGD 3X1SB 5GT0C 5B1MC 4J8XD 3KWQB 3B6FC 4Z66D 3AV1C 5B32A 2CV5C 5B1MD 3B6FD 3AV1D 4UPKA 1P3LB 1P3PB 1M18C 5B33C 3A1KA 2DQNC 2ZY3A 5DNMD 4Z5TC 3R45A 5AV9C 3REID 5B31D 2W8SA 3R45B 3WAAC 3MGPA 1P3KA 3W96A 2RVQC 4QLCC 3A6NA 3MGSD 3MGPB 2Y2LA 3REKA 3AZHC 1P3KB 1KX4A 2G5HC 3WAAD 4G92B 3A6NB 3WA9D 3REKB 5GT3C 2G5IC 2AROD 2CWEA 4G91C 1S32C 5AY8D 1P3MD 2NQBA 1KX3C 1P3PD 4WZSB 1ULYA 2NQBB 3WTPA 3REJD 5AVCC 1KX3D 3WTPB 5B2JA 3AZGA 3MGRA 4WU9B 4YS3A 4ZUXC 4H9NB 5B2JB 5CPIA 3MGRB 4YS3B 3AZNA 4J8WA 2HIOC 5AV8B 5CP6A 1P3AD 5CPIB 3AZNB 4J8WB 5CP6B 2HUEC 2XD5A 3AZJC 3C1BC 1A7WA 3AZJD 3W97A 4E45A 5CPKC 3O62A 3B6GC 1ZLAB 3W97B 2ZY5A 4UUZA 3O62B 4XUJD 3LZ0D 5CPKD 4WU8C 4UUZB 3C1CC 5BS7C 5B1LD 5F99C 4WU8D 5BNVA 3C1CD 3X1VC 2NZDA 4JJNC 4X23C 2F8NB 4H9SA 5BNVB 2NZDB 4JJND 3UTAC 1P3OC 3AV2C 4ZBJC 2Y2GA 3LELA 2ZY4A 2XD1A 5AV8D 3VH5T 2JCHA 3LELB 1PZRA 3NQJA 5GXQB 5AVBC 4R8PD 3AZEC 1HQ3D 4J8UA 3NQJB 1R4VA 5B40C 5AVBD 4HGAB 4J8UB 1ZLAD 1AOIC 1ID3C 5GSUC 4KUDA 1H3OA 2JSSA 3AFAA 3UT9C 1H3OB 5CPJC 4LD9C 3AFAB 3LJAC 1EQZD 3EPKA 2F8ND 5JRGA 5C3IB 4YM6C 3MNNA 3MGQC 4J8XA 3H0MC 1P3FD 2YFVA 5JRGB 4Z66A 4J8XB 3AZLC 1P34C 2YFVB 4Z66B 5B1MA
chains in the Genus database with same CATH topology
3B6FA 3AV1A 1U35C 5B1MB 2Y2KA 3AZLD 5FUGA 1P34D 1P3ID 3B6FB 3WKJC 3AV1B 3REHC 4KGCC 4DRAA 5FUGB 5AV5C 2F8NG 3W99C 5DNMA 3X1UA 5AV5D 2FJ7D 5DNMB 3W99D 3REIA 3AN2C 5B31A 3REIB 5B31B 4CAYA 3MGSA 3AZFC 4CAYB 3WTPE 3WA9A 3WAAA 3MGSB 1P3BC 2Y2HA 4NFTA 4NE5A 3LZ1C 3WA9B 3WAAB 2UWXA 5G49B 3KUYC 3X1SA 4WV4B 3KUYD 4XZQC 3TU4C 2AROA 4Z2MG 5AY8A 1P3LA 5GT0D 2AROB 1P3MA 1T3UA 2ZM5A 1M1AC 3X1TC 5AY8B 1P3PA 1WWSA 2CV5D 1P3MB 3REJA 1W2EA 3VH6T 1M1AD 5DNNC 3X1TD 3B0CW 1KX3A 3REJB 1KX3B 1TAFA 3AYWC 1M18D 3KXBC 5B33D 2F8NH 1TAFB 4WNNA 1P3GC 4EO5C 3AYWD 1P3AA 4WNNB 1B67A 1P3AB 4Z5TD 2IO5B 5AV9D 3MVDC 3AZJB 4J8VC 2RVQD 4QLCD 3AZHD 3EPLA 4XUJA 3LZ0A 5CPKA 3AZIC 4XUJB 3LZ0B 5GT3D 5CPKB 5B1LA 5B31G 5AV6C 3AZID 5B1LB 3C1CA 4WU8B 4Z2MH 3C1CB 2RIQA 5B0YC 4H9QA 1S32D 1F1EA 4H9QB 2PYOC 4WU9A 4JJNB 3AL0C 4H9NA 5AVCD 3RELC 5JA4A 5AV8A 5B0ZC 1P3OB 5JA4B 3KWQC 5B2IC 4R8PA 5BNXB 4ZUXD 1HQ3A 5B0ZD 4R8PB 3IP4C 5AVBA 1HQ3B 2HIOD 5B2ID 5B32C 3UTBC 4H9PB 5AVBB 5BT1C 3AZMC 1ZLAA 3C1BD 2Y2OA 3UTBD 3AZMD 3B6GD 2JE5A 1AOIB 1EQZA 3EPJA 2F8NA 1M19C 1Q9CA 2Y2PA 1EQZB 5F99D 5CPJB 1P3FA 1M19D 3X1VD 3W96C 1P3FB 4X23D 4G92C 3A6NC 1KX4C 3AZLA 3W96D 1P34A 3UTAD 1P3OD 1KX4D 3AV2D 3AZLB 5GXQA 1P34B 1P3IB 1F66C 2FJ7A 5AV5A 1KX5C 3AZED 5AV5B 1F66D 2FJ7B 3W99A 1BH9B 2Y2NA 4NE6A 5B40D 3W99B 3P5JB 1KX5D 4H9RA 3KSYA 4H9RB 1HTAA 1AOID 1ID3D 5GSUD 5B2JC 1WWIA 3AZGC 3MGRC 4YS3C 5E5AC 4J8WC 3UT9D 4LD9D 5CPJD 5E5AD 3LJAD 3KUYA 3W98C 3KUYB 3KFUG 4YM6D 5GT0A 3MGQD 4AWLC 5CHLB 5GT0B 2CV5A 3W98D 2CV5B 3X1TA 5B24C 1M1AA 1U35D 1M1AB 3X1TB 3WKJD 4KGCD 3REHD 1M18A 5B24D 3FDDA 5B33A 3A1IA 1M18B 3AYWA 4CSRA 5B33B 2NZDC 3AYWB 4CSRB 4Z5TA 5AV9A 3AN2D 3B0DC 4EO5B 4Z5TB 5AV9B 5G49A 4QLCA 3AZFD 3AZHA 4QLCB 3AZHB 1P3BD 5GT3A 3LZ1D 3AZKC 4J8UC 5GT3B 3AZKD 3AZIB 4XZQD 3TU4D 1S32A 4KUDC 3VH5A 2Y2MA 4G91B 1TZYC 1S32B 1JFIA 4KUDD 5AVCA 1JFIB 1TZYD 5DNND 5AVCB 5JRGC 3KXBD 3MNNC 4ZUXA 4M6BA 2L5AA 1P3GD 2HIOA 5B2IA 4ZUXB 5B0ZB 3MNND 2HIOB 5B2IB 3AZJA 3B0BA 3C1BA 3NQUA 2YFWA 4NE3A 3UTBA 2HUEB 3C1BB 5B32B 3NQUB 2YFWB 3UTBB 3AZMA 3B6GA 3MVDD 3AZMB 4J8VD 5DNMC 3X1UC 3B6GB 1Z2CB 2DF4C 4WU8A 2F2AC 5BS7A 3REIC 3X1UD 5F99A 5B31C 5AV6D 2FFFB 5F99B 1M19A 3X1VA 4JJNA 4X23A 3MGSC 1M19B 3X1VB 3EG5B 5B0YD 4X23B 3WA9C 3UTAA 1P3OA 3AV2A 2PYOD 3W96B 5BNXA 3UTAB 3H0RC 3AV2B 3X1SC 1KX4B 2Y2IA 3RELD 4ZBJB 4H9PA 3X1SD 2AROC 3KWQD 3AZEA 3VH5W 1F66A 5AY8C 1P3LC 1P3MC 3AZEB 1F66B 5B40A 1P3PC 1KX5A 5B32D 3B0CT 1P3LD 5B40B 3REJC 1KX5B 5BT1D 3V9RA 1AOIA 1ID3A 5GSUA 3V9RB 1ID3B 5GSUB 3EPHA 3UT9A 4LD9A 5CPJA 1P3AC 5E5AA 1B6WA 3LJAA 3UT9B 3AZGB 2IO5C 4LD9B 5E5AB 5B32G 3VH6A 3LJAB 3MGPC 1P3KC 4YM6A 3MGQA 3H0LC 3REKC 4YM6B 3MGQB 3MGPD 1P3KD 3W98A 1P3IA 3A6ND 3W98B 3REKD 2LY8A 4XUJC 3LZ0C 1U35A 4AWLB 2J8PA 3WKJA 5KDMA 3REHA 1U35B 4KGCA 5B1LC 5B24A 3WKJB 5KDMB 3REHB 4KGCB 1BH9A 5B24B 2NQBC 3WTPC 3AN2A 2NQBD 4DRBA 4WU9C 3AN2B 3WTPD 4KHAA 3AZFA 5AV8C 4E44A 4WU9D 5CPIC 3B0DB 4KHAB 3AZFB 3AZNC 5B2JD 3AZGD 4R8PC 3MGRD 5CP6C 1P3BA 4YS3D 3LZ1A 1HQ3C 1P3BB 5CPID 3LZ1B 3AZND 4J8WD 5CP6D 3AZKA 2BYMA 1ZLAC 4XZQA 3W97C 3TU4A 3AZKB 3O62C 2BYMB 1BH8A 4XZQB 3TU4B 3W97D 1BH8B 3O62D 1TZYA 5DNNA 4KUDB 4WJ3C 1EQZC 1N1JA 3VH6W 1TZYB 5DNNB 3KXBA 1N1JB 4H9SC 1P3FC 2F8NK 3KXBB 1P3GA 1P3IC 2NZDD 1P3GB 3MNNB 3LELC 5GXQC 2Y2QA 3MVDA 3LELD 4J8VA 2FJ7C 3F6TA 5GXQD 4HGAC 3MVDB 4J8VB 3AZIA 4J8UD 2BG1A 5AV6A 4DQYB 2Y2JA 3X1UB 2BYKA 5AV6B 1BFMA 2BYKB 1KU5A 2VQRA 5B0YA 3AFAC 4H9OA 5B0YB 2PYOA 4H9OB 3AFAD 5BO0A 5C3IC 2PYOB 3RELA 5BO0B 4J8XC 5B0ZA 2ZY2A 4Z66C 3RELB 3KWQA 5JRGD 3X1SB 5GT0C 5B1MC 4J8XD 3KWQB 3B6FC 4Z66D 3AV1C 5B32A 2CV5C 5B1MD 3B6FD 3AV1D 4UPKA 1P3LB 1P3PB 1M18C 5B33C 3A1KA 2DQNC 2ZY3A 5DNMD 4Z5TC 3R45A 5AV9C 3REID 5B31D 2W8SA 3R45B 3WAAC 3MGPA 1P3KA 3W96A 2RVQC 4QLCC 3A6NA 3MGSD 3MGPB 2Y2LA 3REKA 3AZHC 1P3KB 1KX4A 2G5HC 3WAAD 4G92B 3A6NB 3WA9D 3REKB 5GT3C 2G5IC 2AROD 2CWEA 4G91C 1S32C 5AY8D 1P3MD 2NQBA 1KX3C 1P3PD 4WZSB 1ULYA 2NQBB 3WTPA 3REJD 5AVCC 1KX3D 3WTPB 5B2JA 3AZGA 3MGRA 4WU9B 4YS3A 4ZUXC 4H9NB 5B2JB 5CPIA 3MGRB 4YS3B 3AZNA 4J8WA 2HIOC 5AV8B 5CP6A 1P3AD 5CPIB 3AZNB 4J8WB 5CP6B 2HUEC 2XD5A 3AZJC 3C1BC 1A7WA 3AZJD 3W97A 4E45A 5CPKC 3O62A 3B6GC 1ZLAB 3W97B 2ZY5A 4UUZA 3O62B 4XUJD 3LZ0D 5CPKD 4WU8C 4UUZB 3C1CC 5BS7C 5B1LD 5F99C 4WU8D 5BNVA 3C1CD 3X1VC 2NZDA 4JJNC 4X23C 2F8NB 4H9SA 5BNVB 2NZDB 4JJND 3UTAC 1P3OC 3AV2C 4ZBJC 2Y2GA 3LELA 2ZY4A 2XD1A 5AV8D 3VH5T 2JCHA 3LELB 1PZRA 3NQJA 5GXQB 5AVBC 4R8PD 3AZEC 1HQ3D 4J8UA 3NQJB 1R4VA 5B40C 5AVBD 4HGAB 4J8UB 1ZLAD 1AOIC 1ID3C 5GSUC 4KUDA 1H3OA 2JSSA 3AFAA 3UT9C 1H3OB 5CPJC 4LD9C 3AFAB 3LJAC 1EQZD 3EPKA 2F8ND 5JRGA 5C3IB 4YM6C 3MNNA 3MGQC 4J8XA 3H0MC 1P3FD 2YFVA 5JRGB 4Z66A 4J8XB 3AZLC 1P34C 2YFVB 4Z66B 5B1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6F A;  3AV1 A;  1U35 C;  5B1M B;  3AZL D;  5FUG A;  1P34 D;  1P3I D;  3B6F B;  3WKJ C;  3AV1 B;  3REH C;  4KGC C;  4DRA A;  5FUG B;  5AV5 C;  2F8N G;  3W99 C;  5DNM A;  3X1U A;  5AV5 D;  2FJ7 D;  5DNM B;  3W99 D;  3REI A;  3AN2 C;  5B31 A;  3REI B;  5B31 B;  4CAY A;  3MGS A;  3AZF C;  4CAY B;  3WTP E;  3WA9 A;  3WAA A;  3MGS B;  1P3B C;  4NFT A;  4NE5 A;  3LZ1 C;  3WA9 B;  3WAA B;  5G49 B;  3KUY C;  3X1S A;  4WV4 B;  3KUY D;  4XZQ C;  3TU4 C;  2ARO A;  4Z2M G;  5AY8 A;  1P3L A;  5GT0 D;  2ARO B;  1P3M A;  1M1A C;  3X1T C;  5AY8 B;  1P3P A;  1WWS A;  2CV5 D;  1P3M B;  3REJ A;  3VH6 T;  1M1A D;  5DNN C;  3X1T D;  3B0C W;  1KX3 A;  3REJ B;  1KX3 B;  1TAF A;  3AYW C;  1M18 D;  3KXB C;  5B33 D;  2F8N H;  1TAF B;  4WNN A;  1P3G C;  4EO5 C;  3AYW D;  1P3A A;  4WNN B;  1B67 A;  1P3A B;  4Z5T D;  2IO5 B;  5AV9 D;  3MVD C;  3AZJ B;  4J8V C;  2RVQ D;  4QLC D;  3AZH D;  4XUJ A;  3LZ0 A;  5CPK A;  3AZI C;  4XUJ B;  3LZ0 B;  5GT3 D;  5CPK B;  5B1L A;  5B31 G;  5AV6 C;  3AZI D;  5B1L B;  3C1C A;  4WU8 B;  4Z2M H;  3C1C B;  5B0Y C;  4H9Q A;  1S32 D;  1F1E A;  4H9Q B;  2PYO C;  4WU9 A;  4JJN B;  4H9N A;  5AVC D;  3REL C;  5JA4 A;  5AV8 A;  5B0Z C;  1P3O B;  5JA4 B;  3KWQ C;  5B2I C;  4R8P A;  5BNX B;  4ZUX D;  1HQ3 A;  5B0Z D;  4R8P B;  5AVB A;  2HIO D;  1HQ3 B;  5B32 C;  5B2I D;  3UTB C;  4H9P B;  5BT1 C;  5AVB B;  3AZM C;  1ZLA A;  3C1B D;  3UTB D;  3AZM D;  3B6G D;  1AOI B;  1EQZ A;  2F8N A;  1M19 C;  1Q9C A;  1EQZ B;  5F99 D;  5CPJ B;  1P3F A;  1M19 D;  3X1V D;  3W96 C;  1P3F B;  4X23 D;  4G92 C;  3A6N C;  1KX4 C;  3AZL A;  3W96 D;  1P34 A;  3UTA D;  1P3O D;  1KX4 D;  3AV2 D;  3AZL B;  5GXQ A;  1P34 B;  1P3I B;  1F66 C;  2FJ7 A;  5AV5 A;  1KX5 C;  3AZE D;  5AV5 B;  1F66 D;  2FJ7 B;  3W99 A;  1BH9 B;  4NE6 A;  5B40 D;  3W99 B;  1KX5 D;  4H9R A;  3KSY A;  4H9R B;  1HTA A;  1AOI D;  1ID3 D;  5GSU D;  5B2J C;  1WWI A;  3AZG C;  3MGR C;  4YS3 C;  5E5A C;  4J8W C;  3UT9 D;  4LD9 D;  5CPJ D;  5E5A D;  3LJA D;  3KUY A;  3W98 C;  3KUY B;  4YM6 D;  5GT0 A;  3MGQ D;  4AWL C;  5CHL B;  5GT0 B;  2CV5 A;  3W98 D;  2CV5 B;  3X1T A;  5B24 C;  1M1A A;  1U35 D;  1M1A B;  3X1T B;  3WKJ D;  4KGC D;  3REH D;  1M18 A;  5B24 D;  5B33 A;  1M18 B;  3AYW A;  4CSR A;  5B33 B;  2NZD C;  3AYW B;  4CSR B;  4Z5T A;  5AV9 A;  3AN2 D;  3B0D C;  4EO5 B;  4Z5T B;  5AV9 B;  5G49 A;  4QLC A;  3AZF D;  3AZH A;  4QLC B;  3AZH B;  1P3B D;  5GT3 A;  3LZ1 D;  3AZK C;  4J8U C;  5GT3 B;  3AZK D;  3AZI B;  4XZQ D;  3TU4 D;  1S32 A;  4KUD C;  3VH5 A;  4G91 B;  1TZY C;  1S32 B;  1JFI A;  4KUD D;  5AVC A;  1JFI B;  1TZY D;  5DNN D;  5AVC B;  5JRG C;  3KXB D;  3MNN C;  4ZUX A;  4M6B A;  2L5A A;  1P3G D;  2HIO A;  5B2I A;  4ZUX B;  5B0Z B;  3MNN D;  2HIO B;  5B2I B;  3AZJ A;  3B0B A;  3C1B A;  3NQU A;  2YFW A;  4NE3 A;  3UTB A;  2HUE B;  3C1B B;  5B32 B;  3NQU B;  2YFW B;  3UTB B;  3AZM A;  3B6G A;  3MVD D;  3AZM B;  4J8V D;  5DNM C;  3X1U C;  3B6G B;  4WU8 A;  5BS7 A;  3REI C;  3X1U D;  5F99 A;  5B31 C;  5AV6 D;  5F99 B;  1M19 A;  3X1V A;  4JJN A;  4X23 A;  3MGS C;  1M19 B;  3X1V B;  5B0Y D;  3WA9 C;  4X23 B;  3UTA A;  1P3O A;  3AV2 A;  2PYO D;  3W96 B;  5BNX A;  3UTA B;  3X1S C;  3AV2 B;  1KX4 B;  3REL D;  4ZBJ B;  4H9P A;  3X1S D;  2ARO C;  3KWQ D;  3AZE A;  3VH5 W;  1F66 A;  5AY8 C;  1P3L C;  1P3M C;  3AZE B;  1F66 B;  5B40 A;  1P3P C;  1KX5 A;  5B32 D;  3B0C T;  1P3L D;  5B40 B;  3REJ C;  1KX5 B;  5BT1 D;  3V9R A;  1AOI A;  1ID3 A;  5GSU A;  3V9R B;  1ID3 B;  5GSU B;  3UT9 A;  4LD9 A;  5CPJ A;  1P3A C;  5E5A A;  1B6W A;  3LJA A;  3UT9 B;  3AZG B;  2IO5 C;  4LD9 B;  5E5A B;  5B32 G;  3VH6 A;  3LJA B;  3MGP C;  1P3K C;  4YM6 A;  3MGQ A;  3REK C;  4YM6 B;  3MGQ B;  3MGP D;  1P3K D;  3W98 A;  1P3I A;  3A6N D;  3W98 B;  3REK D;  2LY8 A;  4XUJ C;  3LZ0 C;  1U35 A;  4AWL B;  3WKJ A;  5KDM A;  3REH A;  1U35 B;  4KGC A;  5B1L C;  5B24 A;  3WKJ B;  5KDM B;  3REH B;  4KGC B;  1BH9 A;  5B24 B;  2NQB C;  3WTP C;  3AN2 A;  2NQB D;  4DRB A;  4WU9 C;  3AN2 B;  3WTP D;  4KHA A;  3AZF A;  5AV8 C;  4E44 A;  4WU9 D;  5CPI C;  3B0D B;  4KHA B;  3AZF B;  3AZN C;  5B2J D;  3AZG D;  4R8P C;  3MGR D;  5CP6 C;  1P3B A;  4YS3 D;  3LZ1 A;  1HQ3 C;  1P3B B;  5CPI D;  3LZ1 B;  3AZN D;  4J8W D;  5CP6 D;  3AZK A;  2BYM A;  1ZLA C;  4XZQ A;  3W97 C;  3TU4 A;  3AZK B;  3O62 C;  2BYM B;  1BH8 A;  4XZQ B;  3TU4 B;  3W97 D;  1BH8 B;  3O62 D;  1TZY A;  5DNN A;  4KUD B;  1EQZ C;  1N1J A;  3VH6 W;  1TZY B;  5DNN B;  3KXB A;  1N1J B;  4H9S C;  1P3F C;  2F8N K;  3KXB B;  1P3G A;  1P3I C;  2NZD D;  1P3G B;  3MNN B;  3LEL C;  5GXQ C;  3MVD A;  3LEL D;  4J8V A;  2FJ7 C;  5GXQ D;  4HGA C;  3MVD B;  4J8V B;  3AZI A;  4J8U D;  5AV6 A;  3X1U B;  2BYK A;  5AV6 B;  1BFM A;  2BYK B;  1KU5 A;  5B0Y A;  3AFA C;  4H9O A;  5B0Y B;  2PYO A;  4H9O B;  3AFA D;  5BO0 A;  5C3I C;  2PYO B;  3REL A;  5BO0 B;  4J8X C;  5B0Z A;  4Z66 C;  3REL B;  3KWQ A;  5JRG D;  3X1S B;  5GT0 C;  5B1M C;  4J8X D;  3KWQ B;  3B6F C;  4Z66 D;  3AV1 C;  5B32 A;  2CV5 C;  5B1M D;  3B6F D;  3AV1 D;  1P3L B;  1P3P B;  1M18 C;  5B33 C;  5DNM D;  4Z5T C;  3R45 A;  5AV9 C;  3REI D;  5B31 D;  3R45 B;  3WAA C;  3MGP A;  1P3K A;  3W96 A;  2RVQ C;  4QLC C;  3A6N A;  3MGS D;  3MGP B;  3AZH C;  3REK A;  1P3K B;  1KX4 A;  3WA9 D;  3WAA D;  4G92 B;  3A6N B;  3REK B;  5GT3 C;  2ARO D;  2CWE A;  4G91 C;  1S32 C;  5AY8 D;  1P3M D;  2NQB A;  1KX3 C;  1P3P D;  4WZS B;  1ULY A;  2NQB B;  3WTP A;  3REJ D;  5AVC C;  1KX3 D;  3WTP B;  5B2J A;  3AZG A;  3MGR A;  4WU9 B;  4YS3 A;  4ZUX C;  4H9N B;  5B2J B;  5CPI A;  3MGR B;  4YS3 B;  3AZN A;  4J8W A;  2HIO C;  5AV8 B;  5CP6 A;  1P3A D;  5CPI B;  3AZN B;  4J8W B;  5CP6 B;  2HUE C;  3AZJ C;  3C1B C;  1A7W A;  3AZJ D;  3W97 A;  4E45 A;  5CPK C;  3O62 A;  3B6G C;  1ZLA B;  3W97 B;  4UUZ A;  3O62 B;  4XUJ D;  3LZ0 D;  5CPK D;  4WU8 C;  4UUZ B;  3C1C C;  5BS7 C;  5B1L D;  5F99 C;  4WU8 D;  5BNV A;  3C1C D;  3X1V C;  2NZD A;  4JJN C;  4X23 C;  2F8N B;  4H9S A;  5BNV B;  2NZD B;  4JJN D;  3UTA C;  1P3O C;  3AV2 C;  4ZBJ C;  3LEL A;  5AV8 D;  3VH5 T;  3LEL B;  3NQJ A;  5GXQ B;  5AVB C;  4R8P D;  3AZE C;  1HQ3 D;  4J8U A;  3NQJ B;  1R4V A;  5B40 C;  5AVB D;  4HGA B;  4J8U B;  1ZLA D;  1AOI C;  1ID3 C;  5GSU C;  4KUD A;  1H3O A;  2JSS A;  3AFA A;  3UT9 C;  1H3O B;  5CPJ C;  4LD9 C;  3AFA B;  3LJA C;  1EQZ D;  2F8N D;  5JRG A;  5C3I B;  4YM6 C;  3MNN A;  3MGQ C;  4J8X A;  1P3F D;  2YFV A;  5JRG B;  4Z66 A;  4J8X B;  3AZL C;  1P34 C;  2YFV B;  4Z66 B;  5B1M A; 
#chains in the Genus database with same CATH topology
 3B6F A;  3AV1 A;  1U35 C;  5B1M B;  2Y2K A;  3AZL D;  5FUG A;  1P34 D;  1P3I D;  3B6F B;  3WKJ C;  3AV1 B;  3REH C;  4KGC C;  4DRA A;  5FUG B;  5AV5 C;  2F8N G;  3W99 C;  5DNM A;  3X1U A;  5AV5 D;  2FJ7 D;  5DNM B;  3W99 D;  3REI A;  3AN2 C;  5B31 A;  3REI B;  5B31 B;  4CAY A;  3MGS A;  3AZF C;  4CAY B;  3WTP E;  3WA9 A;  3WAA A;  3MGS B;  1P3B C;  2Y2H A;  4NFT A;  4NE5 A;  3LZ1 C;  3WA9 B;  3WAA B;  2UWX A;  5G49 B;  3KUY C;  3X1S A;  4WV4 B;  3KUY D;  4XZQ C;  3TU4 C;  2ARO A;  4Z2M G;  5AY8 A;  1P3L A;  5GT0 D;  2ARO B;  1P3M A;  1T3U A;  2ZM5 A;  1M1A C;  3X1T C;  5AY8 B;  1P3P A;  1WWS A;  2CV5 D;  1P3M B;  3REJ A;  1W2E A;  3VH6 T;  1M1A D;  5DNN C;  3X1T D;  3B0C W;  1KX3 A;  3REJ B;  1KX3 B;  1TAF A;  3AYW C;  1M18 D;  3KXB C;  5B33 D;  2F8N H;  1TAF B;  4WNN A;  1P3G C;  4EO5 C;  3AYW D;  1P3A A;  4WNN B;  1B67 A;  1P3A B;  4Z5T D;  2IO5 B;  5AV9 D;  3MVD C;  3AZJ B;  4J8V C;  2RVQ D;  4QLC D;  3AZH D;  3EPL A;  4XUJ A;  3LZ0 A;  5CPK A;  3AZI C;  4XUJ B;  3LZ0 B;  5GT3 D;  5CPK B;  5B1L A;  5B31 G;  5AV6 C;  3AZI D;  5B1L B;  3C1C A;  4WU8 B;  4Z2M H;  3C1C B;  2RIQ A;  5B0Y C;  4H9Q A;  1S32 D;  1F1E A;  4H9Q B;  2PYO C;  4WU9 A;  4JJN B;  3AL0 C;  4H9N A;  5AVC D;  3REL C;  5JA4 A;  5AV8 A;  5B0Z C;  1P3O B;  5JA4 B;  3KWQ C;  5B2I C;  4R8P A;  5BNX B;  4ZUX D;  1HQ3 A;  5B0Z D;  4R8P B;  3IP4 C;  5AVB A;  1HQ3 B;  2HIO D;  5B2I D;  5B32 C;  3UTB C;  4H9P B;  5AVB B;  5BT1 C;  3AZM C;  1ZLA A;  3C1B D;  2Y2O A;  3UTB D;  3AZM D;  3B6G D;  2JE5 A;  1AOI B;  1EQZ A;  3EPJ A;  2F8N A;  1M19 C;  1Q9C A;  2Y2P A;  1EQZ B;  5F99 D;  5CPJ B;  1P3F A;  1M19 D;  3X1V D;  3W96 C;  1P3F B;  4X23 D;  4G92 C;  3A6N C;  1KX4 C;  3AZL A;  3W96 D;  1P34 A;  3UTA D;  1P3O D;  1KX4 D;  3AV2 D;  3AZL B;  5GXQ A;  1P34 B;  1P3I B;  1F66 C;  2FJ7 A;  5AV5 A;  1KX5 C;  3AZE D;  5AV5 B;  1F66 D;  2FJ7 B;  3W99 A;  1BH9 B;  2Y2N A;  4NE6 A;  5B40 D;  3W99 B;  3P5J B;  1KX5 D;  4H9R A;  3KSY A;  4H9R B;  1HTA A;  1AOI D;  1ID3 D;  5GSU D;  5B2J C;  1WWI A;  3AZG C;  3MGR C;  4YS3 C;  5E5A C;  4J8W C;  3UT9 D;  4LD9 D;  5CPJ D;  5E5A D;  3LJA D;  3KUY A;  3W98 C;  3KUY B;  3KFU G;  4YM6 D;  5GT0 A;  3MGQ D;  4AWL C;  5CHL B;  5GT0 B;  2CV5 A;  3W98 D;  2CV5 B;  3X1T A;  5B24 C;  1M1A A;  1U35 D;  1M1A B;  3X1T B;  3WKJ D;  4KGC D;  3REH D;  1M18 A;  5B24 D;  3FDD A;  5B33 A;  3A1I A;  1M18 B;  3AYW A;  4CSR A;  5B33 B;  2NZD C;  3AYW B;  4CSR B;  4Z5T A;  5AV9 A;  3AN2 D;  3B0D C;  4EO5 B;  4Z5T B;  5AV9 B;  5G49 A;  4QLC A;  3AZF D;  3AZH A;  4QLC B;  3AZH B;  1P3B D;  5GT3 A;  3LZ1 D;  3AZK C;  4J8U C;  5GT3 B;  3AZK D;  3AZI B;  4XZQ D;  3TU4 D;  1S32 A;  4KUD C;  3VH5 A;  2Y2M A;  4G91 B;  1TZY C;  1S32 B;  1JFI A;  4KUD D;  5AVC A;  1JFI B;  1TZY D;  5DNN D;  5AVC B;  5JRG C;  3KXB D;  3MNN C;  4ZUX A;  4M6B A;  2L5A A;  1P3G D;  2HIO A;  5B2I A;  4ZUX B;  5B0Z B;  3MNN D;  2HIO B;  5B2I B;  3AZJ A;  3B0B A;  3C1B A;  3NQU A;  2YFW A;  4NE3 A;  3UTB A;  2HUE B;  3C1B B;  5B32 B;  3NQU B;  2YFW B;  3UTB B;  3AZM A;  3B6G A;  3MVD D;  3AZM B;  4J8V D;  5DNM C;  3X1U C;  3B6G B;  1Z2C B;  2DF4 C;  4WU8 A;  2F2A C;  5BS7 A;  3REI C;  3X1U D;  5F99 A;  5B31 C;  5AV6 D;  2FFF B;  5F99 B;  1M19 A;  3X1V A;  4JJN A;  4X23 A;  3MGS C;  1M19 B;  3X1V B;  3EG5 B;  5B0Y D;  4X23 B;  3WA9 C;  3UTA A;  1P3O A;  3AV2 A;  2PYO D;  3W96 B;  5BNX A;  3UTA B;  3H0R C;  3AV2 B;  3X1S C;  1KX4 B;  2Y2I A;  3REL D;  4ZBJ B;  4H9P A;  3X1S D;  2ARO C;  3KWQ D;  3AZE A;  3VH5 W;  1F66 A;  5AY8 C;  1P3L C;  1P3M C;  3AZE B;  1F66 B;  5B40 A;  1P3P C;  1KX5 A;  5B32 D;  3B0C T;  1P3L D;  5B40 B;  3REJ C;  1KX5 B;  5BT1 D;  3V9R A;  1AOI A;  1ID3 A;  5GSU A;  3V9R B;  1ID3 B;  5GSU B;  3EPH A;  3UT9 A;  4LD9 A;  5CPJ A;  1P3A C;  5E5A A;  1B6W A;  3LJA A;  3UT9 B;  3AZG B;  2IO5 C;  4LD9 B;  5E5A B;  5B32 G;  3VH6 A;  3LJA B;  3MGP C;  1P3K C;  4YM6 A;  3MGQ A;  3H0L C;  3REK C;  4YM6 B;  3MGQ B;  3MGP D;  1P3K D;  3W98 A;  1P3I A;  3A6N D;  3W98 B;  3REK D;  2LY8 A;  4XUJ C;  3LZ0 C;  1U35 A;  4AWL B;  2J8P A;  3WKJ A;  5KDM A;  3REH A;  1U35 B;  4KGC A;  5B1L C;  5B24 A;  3WKJ B;  5KDM B;  3REH B;  4KGC B;  1BH9 A;  5B24 B;  2NQB C;  3WTP C;  3AN2 A;  2NQB D;  4DRB A;  4WU9 C;  3AN2 B;  3WTP D;  4KHA A;  3AZF A;  5AV8 C;  4E44 A;  4WU9 D;  5CPI C;  3B0D B;  4KHA B;  3AZF B;  3AZN C;  5B2J D;  3AZG D;  4R8P C;  3MGR D;  5CP6 C;  1P3B A;  4YS3 D;  3LZ1 A;  1HQ3 C;  1P3B B;  5CPI D;  3LZ1 B;  3AZN D;  4J8W D;  5CP6 D;  3AZK A;  2BYM A;  1ZLA C;  4XZQ A;  3W97 C;  3TU4 A;  3AZK B;  3O62 C;  2BYM B;  1BH8 A;  4XZQ B;  3TU4 B;  3W97 D;  1BH8 B;  3O62 D;  1TZY A;  5DNN A;  4KUD B;  4WJ3 C;  1EQZ C;  1N1J A;  3VH6 W;  1TZY B;  5DNN B;  3KXB A;  1N1J B;  4H9S C;  1P3F C;  2F8N K;  3KXB B;  1P3G A;  1P3I C;  2NZD D;  1P3G B;  3MNN B;  3LEL C;  5GXQ C;  2Y2Q A;  3MVD A;  3LEL D;  4J8V A;  2FJ7 C;  3F6T A;  5GXQ D;  4HGA C;  3MVD B;  4J8V B;  3AZI A;  4J8U D;  2BG1 A;  5AV6 A;  4DQY B;  2Y2J A;  3X1U B;  2BYK A;  5AV6 B;  1BFM A;  2BYK B;  1KU5 A;  2VQR A;  5B0Y A;  3AFA C;  4H9O A;  5B0Y B;  2PYO A;  4H9O B;  3AFA D;  5BO0 A;  5C3I C;  2PYO B;  3REL A;  5BO0 B;  4J8X C;  5B0Z A;  2ZY2 A;  4Z66 C;  3REL B;  3KWQ A;  5JRG D;  3X1S B;  5GT0 C;  5B1M C;  4J8X D;  3KWQ B;  3B6F C;  4Z66 D;  3AV1 C;  5B32 A;  2CV5 C;  5B1M D;  3B6F D;  3AV1 D;  4UPK A;  1P3L B;  1P3P B;  1M18 C;  5B33 C;  3A1K A;  2DQN C;  2ZY3 A;  5DNM D;  4Z5T C;  3R45 A;  5AV9 C;  3REI D;  5B31 D;  2W8S A;  3R45 B;  3WAA C;  3MGP A;  1P3K A;  3W96 A;  2RVQ C;  4QLC C;  3A6N A;  3MGS D;  3MGP B;  2Y2L A;  3REK A;  3AZH C;  1P3K B;  1KX4 A;  2G5H C;  3WAA D;  4G92 B;  3A6N B;  3WA9 D;  3REK B;  5GT3 C;  2G5I C;  2ARO D;  2CWE A;  4G91 C;  1S32 C;  5AY8 D;  1P3M D;  2NQB A;  1KX3 C;  1P3P D;  4WZS B;  1ULY A;  2NQB B;  3WTP A;  3REJ D;  5AVC C;  1KX3 D;  3WTP B;  5B2J A;  3AZG A;  3MGR A;  4WU9 B;  4YS3 A;  4ZUX C;  4H9N B;  5B2J B;  5CPI A;  3MGR B;  4YS3 B;  3AZN A;  4J8W A;  2HIO C;  5AV8 B;  5CP6 A;  1P3A D;  5CPI B;  3AZN B;  4J8W B;  5CP6 B;  2HUE C;  2XD5 A;  3AZJ C;  3C1B C;  1A7W A;  3AZJ D;  3W97 A;  4E45 A;  5CPK C;  3O62 A;  3B6G C;  1ZLA B;  3W97 B;  2ZY5 A;  4UUZ A;  3O62 B;  4XUJ D;  3LZ0 D;  5CPK D;  4WU8 C;  4UUZ B;  3C1C C;  5BS7 C;  5B1L D;  5F99 C;  4WU8 D;  5BNV A;  3C1C D;  3X1V C;  2NZD A;  4JJN C;  4X23 C;  2F8N B;  4H9S A;  5BNV B;  2NZD B;  4JJN D;  3UTA C;  1P3O C;  3AV2 C;  4ZBJ C;  2Y2G A;  3LEL A;  2ZY4 A;  2XD1 A;  5AV8 D;  3VH5 T;  2JCH A;  3LEL B;  1PZR A;  3NQJ A;  5GXQ B;  5AVB C;  4R8P D;  3AZE C;  1HQ3 D;  4J8U A;  3NQJ B;  1R4V A;  5B40 C;  5AVB D;  4HGA B;  4J8U B;  1ZLA D;  1AOI C;  1ID3 C;  5GSU C;  4KUD A;  1H3O A;  2JSS A;  3AFA A;  3UT9 C;  1H3O B;  5CPJ C;  4LD9 C;  3AFA B;  3LJA C;  1EQZ D;  3EPK A;  2F8N D;  5JRG A;  5C3I B;  4YM6 C;  3MNN A;  3MGQ C;  4J8X A;  3H0M C;  1P3F D;  2YFV A;  5JRG B;  4Z66 A;  4J8X B;  3AZL C;  1P34 C;  2YFV B;  4Z66 B;  5B1M A; 
#chains in the Genus database with same CATH homology
 3B6F A;  3AV1 A;  1U35 C;  5B1M B;  2Y2K A;  3AZL D;  5FUG A;  1P34 D;  1P3I D;  3B6F B;  3WKJ C;  3AV1 B;  3REH C;  4KGC C;  4DRA A;  5FUG B;  5AV5 C;  2F8N G;  3W99 C;  5DNM A;  3X1U A;  5AV5 D;  2FJ7 D;  5DNM B;  3W99 D;  3REI A;  3AN2 C;  5B31 A;  3REI B;  5B31 B;  4CAY A;  3MGS A;  3AZF C;  4CAY B;  3WTP E;  3WA9 A;  3WAA A;  3MGS B;  1P3B C;  2Y2H A;  4NFT A;  4NE5 A;  3LZ1 C;  3WA9 B;  3WAA B;  2UWX A;  5G49 B;  3KUY C;  3X1S A;  4WV4 B;  3KUY D;  4XZQ C;  3TU4 C;  2ARO A;  4Z2M G;  5AY8 A;  1P3L A;  5GT0 D;  2ARO B;  1P3M A;  1T3U A;  2ZM5 A;  1M1A C;  3X1T C;  5AY8 B;  1P3P A;  1WWS A;  2CV5 D;  1P3M B;  3REJ A;  1W2E A;  3VH6 T;  1M1A D;  5DNN C;  3X1T D;  3B0C W;  1KX3 A;  3REJ B;  1KX3 B;  1TAF A;  3AYW C;  1M18 D;  3KXB C;  5B33 D;  2F8N H;  1TAF B;  4WNN A;  1P3G C;  4EO5 C;  3AYW D;  1P3A A;  4WNN B;  1B67 A;  1P3A B;  4Z5T D;  2IO5 B;  5AV9 D;  3MVD C;  3AZJ B;  4J8V C;  2RVQ D;  4QLC D;  3AZH D;  3EPL A;  4XUJ A;  3LZ0 A;  5CPK A;  3AZI C;  4XUJ B;  3LZ0 B;  5GT3 D;  5CPK B;  5B1L A;  5B31 G;  5AV6 C;  3AZI D;  5B1L B;  3C1C A;  4WU8 B;  4Z2M H;  3C1C B;  2RIQ A;  5B0Y C;  4H9Q A;  1S32 D;  1F1E A;  4H9Q B;  2PYO C;  4WU9 A;  4JJN B;  3AL0 C;  4H9N A;  5AVC D;  3REL C;  5JA4 A;  5AV8 A;  5B0Z C;  1P3O B;  5JA4 B;  3KWQ C;  5B2I C;  4R8P A;  5BNX B;  4ZUX D;  1HQ3 A;  5B0Z D;  4R8P B;  3IP4 C;  5AVB A;  1HQ3 B;  2HIO D;  5B2I D;  5B32 C;  3UTB C;  4H9P B;  5AVB B;  5BT1 C;  3AZM C;  1ZLA A;  3C1B D;  2Y2O A;  3UTB D;  3AZM D;  3B6G D;  2JE5 A;  1AOI B;  1EQZ A;  3EPJ A;  2F8N A;  1M19 C;  1Q9C A;  2Y2P A;  1EQZ B;  5F99 D;  5CPJ B;  1P3F A;  1M19 D;  3X1V D;  3W96 C;  1P3F B;  4X23 D;  4G92 C;  3A6N C;  1KX4 C;  3AZL A;  3W96 D;  1P34 A;  3UTA D;  1P3O D;  1KX4 D;  3AV2 D;  3AZL B;  5GXQ A;  1P34 B;  1P3I B;  1F66 C;  2FJ7 A;  5AV5 A;  1KX5 C;  3AZE D;  5AV5 B;  1F66 D;  2FJ7 B;  3W99 A;  1BH9 B;  2Y2N A;  4NE6 A;  5B40 D;  3W99 B;  3P5J B;  1KX5 D;  4H9R A;  3KSY A;  4H9R B;  1HTA A;  1AOI D;  1ID3 D;  5GSU D;  5B2J C;  1WWI A;  3AZG C;  3MGR C;  4YS3 C;  5E5A C;  4J8W C;  3UT9 D;  4LD9 D;  5CPJ D;  5E5A D;  3LJA D;  3KUY A;  3W98 C;  3KUY B;  3KFU G;  4YM6 D;  5GT0 A;  3MGQ D;  4AWL C;  5CHL B;  5GT0 B;  2CV5 A;  3W98 D;  2CV5 B;  3X1T A;  5B24 C;  1M1A A;  1U35 D;  1M1A B;  3X1T B;  3WKJ D;  4KGC D;  3REH D;  1M18 A;  5B24 D;  3FDD A;  5B33 A;  3A1I A;  1M18 B;  3AYW A;  4CSR A;  5B33 B;  2NZD C;  3AYW B;  4CSR B;  4Z5T A;  5AV9 A;  3AN2 D;  3B0D C;  4EO5 B;  4Z5T B;  5AV9 B;  5G49 A;  4QLC A;  3AZF D;  3AZH A;  4QLC B;  3AZH B;  1P3B D;  5GT3 A;  3LZ1 D;  3AZK C;  4J8U C;  5GT3 B;  3AZK D;  3AZI B;  4XZQ D;  3TU4 D;  1S32 A;  4KUD C;  3VH5 A;  2Y2M A;  4G91 B;  1TZY C;  1S32 B;  1JFI A;  4KUD D;  5AVC A;  1JFI B;  1TZY D;  5DNN D;  5AVC B;  5JRG C;  3KXB D;  3MNN C;  4ZUX A;  4M6B A;  2L5A A;  1P3G D;  2HIO A;  5B2I A;  4ZUX B;  5B0Z B;  3MNN D;  2HIO B;  5B2I B;  3AZJ A;  3B0B A;  3C1B A;  3NQU A;  2YFW A;  4NE3 A;  3UTB A;  2HUE B;  3C1B B;  5B32 B;  3NQU B;  2YFW B;  3UTB B;  3AZM A;  3B6G A;  3MVD D;  3AZM B;  4J8V D;  5DNM C;  3X1U C;  3B6G B;  1Z2C B;  2DF4 C;  4WU8 A;  2F2A C;  5BS7 A;  3REI C;  3X1U D;  5F99 A;  5B31 C;  5AV6 D;  2FFF B;  5F99 B;  1M19 A;  3X1V A;  4JJN A;  4X23 A;  3MGS C;  1M19 B;  3X1V B;  3EG5 B;  5B0Y D;  4X23 B;  3WA9 C;  3UTA A;  1P3O A;  3AV2 A;  2PYO D;  3W96 B;  5BNX A;  3UTA B;  3H0R C;  3AV2 B;  3X1S C;  1KX4 B;  2Y2I A;  3REL D;  4ZBJ B;  4H9P A;  3X1S D;  2ARO C;  3KWQ D;  3AZE A;  3VH5 W;  1F66 A;  5AY8 C;  1P3L C;  1P3M C;  3AZE B;  1F66 B;  5B40 A;  1P3P C;  1KX5 A;  5B32 D;  3B0C T;  1P3L D;  5B40 B;  3REJ C;  1KX5 B;  5BT1 D;  3V9R A;  1AOI A;  1ID3 A;  5GSU A;  3V9R B;  1ID3 B;  5GSU B;  3EPH A;  3UT9 A;  4LD9 A;  5CPJ A;  1P3A C;  5E5A A;  1B6W A;  3LJA A;  3UT9 B;  3AZG B;  2IO5 C;  4LD9 B;  5E5A B;  5B32 G;  3VH6 A;  3LJA B;  3MGP C;  1P3K C;  4YM6 A;  3MGQ A;  3H0L C;  3REK C;  4YM6 B;  3MGQ B;  3MGP D;  1P3K D;  3W98 A;  1P3I A;  3A6N D;  3W98 B;  3REK D;  2LY8 A;  4XUJ C;  3LZ0 C;  1U35 A;  4AWL B;  2J8P A;  3WKJ A;  5KDM A;  3REH A;  1U35 B;  4KGC A;  5B1L C;  5B24 A;  3WKJ B;  5KDM B;  3REH B;  4KGC B;  1BH9 A;  5B24 B;  2NQB C;  3WTP C;  3AN2 A;  2NQB D;  4DRB A;  4WU9 C;  3AN2 B;  3WTP D;  4KHA A;  3AZF A;  5AV8 C;  4E44 A;  4WU9 D;  5CPI C;  3B0D B;  4KHA B;  3AZF B;  3AZN C;  5B2J D;  3AZG D;  4R8P C;  3MGR D;  5CP6 C;  1P3B A;  4YS3 D;  3LZ1 A;  1HQ3 C;  1P3B B;  5CPI D;  3LZ1 B;  3AZN D;  4J8W D;  5CP6 D;  3AZK A;  2BYM A;  1ZLA C;  4XZQ A;  3W97 C;  3TU4 A;  3AZK B;  3O62 C;  2BYM B;  1BH8 A;  4XZQ B;  3TU4 B;  3W97 D;  1BH8 B;  3O62 D;  1TZY A;  5DNN A;  4KUD B;  4WJ3 C;  1EQZ C;  1N1J A;  3VH6 W;  1TZY B;  5DNN B;  3KXB A;  1N1J B;  4H9S C;  1P3F C;  2F8N K;  3KXB B;  1P3G A;  1P3I C;  2NZD D;  1P3G B;  3MNN B;  3LEL C;  5GXQ C;  2Y2Q A;  3MVD A;  3LEL D;  4J8V A;  2FJ7 C;  3F6T A;  5GXQ D;  4HGA C;  3MVD B;  4J8V B;  3AZI A;  4J8U D;  2BG1 A;  5AV6 A;  4DQY B;  2Y2J A;  3X1U B;  2BYK A;  5AV6 B;  1BFM A;  2BYK B;  1KU5 A;  2VQR A;  5B0Y A;  3AFA C;  4H9O A;  5B0Y B;  2PYO A;  4H9O B;  3AFA D;  5BO0 A;  5C3I C;  2PYO B;  3REL A;  5BO0 B;  4J8X C;  5B0Z A;  2ZY2 A;  4Z66 C;  3REL B;  3KWQ A;  5JRG D;  3X1S B;  5GT0 C;  5B1M C;  4J8X D;  3KWQ B;  3B6F C;  4Z66 D;  3AV1 C;  5B32 A;  2CV5 C;  5B1M D;  3B6F D;  3AV1 D;  4UPK A;  1P3L B;  1P3P B;  1M18 C;  5B33 C;  3A1K A;  2DQN C;  2ZY3 A;  5DNM D;  4Z5T C;  3R45 A;  5AV9 C;  3REI D;  5B31 D;  2W8S A;  3R45 B;  3WAA C;  3MGP A;  1P3K A;  3W96 A;  2RVQ C;  4QLC C;  3A6N A;  3MGS D;  3MGP B;  2Y2L A;  3REK A;  3AZH C;  1P3K B;  1KX4 A;  2G5H C;  3WAA D;  4G92 B;  3A6N B;  3WA9 D;  3REK B;  5GT3 C;  2G5I C;  2ARO D;  2CWE A;  4G91 C;  1S32 C;  5AY8 D;  1P3M D;  2NQB A;  1KX3 C;  1P3P D;  4WZS B;  1ULY A;  2NQB B;  3WTP A;  3REJ D;  5AVC C;  1KX3 D;  3WTP B;  5B2J A;  3AZG A;  3MGR A;  4WU9 B;  4YS3 A;  4ZUX C;  4H9N B;  5B2J B;  5CPI A;  3MGR B;  4YS3 B;  3AZN A;  4J8W A;  2HIO C;  5AV8 B;  5CP6 A;  1P3A D;  5CPI B;  3AZN B;  4J8W B;  5CP6 B;  2HUE C;  2XD5 A;  3AZJ C;  3C1B C;  1A7W A;  3AZJ D;  3W97 A;  4E45 A;  5CPK C;  3O62 A;  3B6G C;  1ZLA B;  3W97 B;  2ZY5 A;  4UUZ A;  3O62 B;  4XUJ D;  3LZ0 D;  5CPK D;  4WU8 C;  4UUZ B;  3C1C C;  5BS7 C;  5B1L D;  5F99 C;  4WU8 D;  5BNV A;  3C1C D;  3X1V C;  2NZD A;  4JJN C;  4X23 C;  2F8N B;  4H9S A;  5BNV B;  2NZD B;  4JJN D;  3UTA C;  1P3O C;  3AV2 C;  4ZBJ C;  2Y2G A;  3LEL A;  2ZY4 A;  2XD1 A;  5AV8 D;  3VH5 T;  2JCH A;  3LEL B;  1PZR A;  3NQJ A;  5GXQ B;  5AVB C;  4R8P D;  3AZE C;  1HQ3 D;  4J8U A;  3NQJ B;  1R4V A;  5B40 C;  5AVB D;  4HGA B;  4J8U B;  1ZLA D;  1AOI C;  1ID3 C;  5GSU C;  4KUD A;  1H3O A;  2JSS A;  3AFA A;  3UT9 C;  1H3O B;  5CPJ C;  4LD9 C;  3AFA B;  3LJA C;  1EQZ D;  3EPK A;  2F8N D;  5JRG A;  5C3I B;  4YM6 C;  3MNN A;  3MGQ C;  4J8X A;  3H0M C;  1P3F D;  2YFV A;  5JRG B;  4Z66 A;  4J8X B;  3AZL C;  1P34 C;  2YFV B;  4Z66 B;  5B1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...