1M1AA

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146 Base Pair DNA Fragment
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 30
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m1aA00
5B1LC 5AVBB 5DNMC 3B0CW 3KUYA 3VH6W 5F99D 1EQZC 5B33B 3B6FA 1P3AB 3W99A 5B2IB 3LELC 2F8NK 3W96B 2AROD 5F99A 3AZFD 4NE5A 5BT1C 4WNNA 2CWEA 5AVCB 5B1LB 4R8PD 1F66C 2AROA 2BYMB 3AZFA 3VH6A 3AZLD 3KUYB 4EO5C 4HGAC 3KWQD 1ZLAC 4ZBJB 5B40D 4R8PA 2PYOD 4WZSB 4J8WD 3A6ND 3V9RA 3W99B 5AV5B 3REHD 2HIOB 3AZLA 4JJNC 2HUEB 3KWQA 3REJC 1KX3D 3X1UC 1B6WA 4WNNB 1M18C 5B40A 2PYOA 3B0DB 5JA4A 4J8WA 3A6NA 3NQJB 4J8VD 3B6GC 3REHA 4KGCC 1M19C 4EO5B 3AZFB 1KX4D 1KX3A 4ZUXC 4YM6D 3KSYA 5B0YD 4H9QA 4R8PB 4Z66A 4JJNB 3V9RB 1KX4A 5GSUD 4YM6A 5B0YA 3WTPD 2CV5C 5BNXA 2NQBD 3AYWD 3AN2D 3B6GB 5JA4B 4J8WB 3A6NB 3REHB 5GSUA 4AWLC 4ZUXB 3REKC 5BNVB 2FJ7D 3WTPA 3R45B 3AZID 4WU8D 2NQBA 3AYWA 5CPIA 3MGPD 5B31C 3MVDB 2NZDC 4XUJD 1P3KC 1ID3B 1BH9A 4Z66B 2FJ7A 3AFAC 3AV1C 4WU8A 3AZIA 5DNNC 5B0YB 3MGPA 5BNXB 4XUJA 3LJAC 2F8NG 3UT9C 4J8UC 3AZKD 3AZGB 3AZND 5GSUB 1P3LB 5GT0B 3AYWB 5CPIB 3X1TC 1P3KB 2BYKA 3AV2D 3LZ0C 3AZKA 3AZNA 5CPKC 2FJ7B 1KX5C 5B1MB 4H9SC 1P3MC 3WAAD 5E5AD 5AV9D 3LJAB 3MGPB 3AV2A 5B32D 4XUJB 4J8UB 5AY8B 3WAAA 5E5AA 5AV9A 1P3GC 1TZYC 5B32A 2BYKB 3W97D 3AZKB 1KX5B 4WU9D 4KUDC 1P3MB 3X1VC 3UTAB 3VH5A 4YS3C 3W97A 4XZQC 4WU9A 4X23B 1P3ID 5GXQB 3WAAB 5AV9B 5JRGC 3WKJC 3REID 5B32B 5G49A 5B24D 1Q9CA 5KDMA 5B0ZA 3X1VB 1A7WA 3REIA 4YS3B 5CPJC 5CP6B 5B24A 3AZJD 3W97B 5B33C 1P3AC 4G92C 1AOIB 1P3FD 3AZJA 5G49B 3TU4C 5AVCC 1P34D 5GT3B 1P3FA 5B0ZB 4WV4B 1P3OD 1TAFB 1ULYA 5CPJB 1M1AD 5AV8A 3REIB 4UUZB 3KUYC 5B24B 5B31G 1HQ3B 1F1EA 4G92B 1P34A 4ZBJC 3B6FC 1M1AA 3W99C 5AV5C 2HIOC 1R4VA 2HUEC 5F99C 3TU4B 1EQZD 3B0DC 4QLCD 4H9RA 3B0BA 5FUGA 1H3OA 3AZFC 5AV8B 3LELD 1WWIA 3O62D 1EQZA 3B6FB 4QLCA 4R8PC 1F66D 3LELA 5F99B 3AZLC 1WWSA 3O62A 3KWQC 5AV6D 5B40C 3KXBD 2LY8A 4H9RB 3A6NC 4J8WC 1ZLAD 2AROB 3REHC 5FUGB 3UTBD 4Z5TD 1KX3C 4H9NA 5AV6A 3KXBA 4J8VA 3REJD 3X1UD 1M18D 3MVDC 3AZMD 1P3PD 1ID3C 3UTBA 3AZLB 4Z66C 3WTPE 1KX4C 1HTAA 4Z5TA 4KGCD 3KWQB 3O62B 5BO0A 3MNND 5B0YC 5B40B 3REJA 3WA9D 2PYOB 3X1UA 1M18A 3AZMA 1P3PA 1P3BD 3MGRD 3AZGC 1P3LC 5GSUC 1KX3B 4KGCA 3MNNA 3WTPC 3AN2A 3WA9A 4H9NB 3AZED 5GT0C 1KU5A 4H9QB 5AV6B 5CPIC 3KXBB 4J8VB 3AYWC 1P3BA 3MGRA 1KX4B 3UTBB 4YM6B 4H9PA 2FJ7C 5B1MC 3AZEA 3AZIC 3MGPC 1P3PB 4XUJC 4E45A 5B31D 5AY8C 3WTPB 3MNNB 4LD9D 3AFAD 3AV1D 2NQBB 3AN2B 3WA9B 3C1BD 1JFIA 5DNND 1BH9B 5B31A 3AZKC 3UT9D 4LD9A 4G91C 4H9PB 4WU8B 1N1JA 3AFAA 3AZIB 3AV1A 3C1BA 5DNNA 3UTAC 5CHLB 3X1TD 3UT9A 4X23C 3LZ1D 5GXQC 3WAAC 5E5AC 5AV9C 3W98D 1JFIB 5B32C 3AZNB 4G91B 4CSRA 3LZ1A 2RVQD 3W98A 4NE6A 3AV2B 3X1SD 1P3GD 1TZYD 5CP6C 4J8XD 3W97C 4WU9C 5E5AB 1AOIC 3X1SA 1P3GA 5B2JD 1TZYA 4Z2MH 3C1CD 4J8XA 1P3IA 4XZQD 3LZ1B 3MGSD 5BS7A 5GT3C 5B0ZC 4DRAA 3W98B 5B2JA 1U35D 3C1CA 3REIC 4WU9B 3WKJD 5B24C 4XZQA 1HQ3C 1S32D 3MGSA 3RELD 3AZHD 1U35A 3MGQD 5AVBD 3WKJA 4H9OA 4J8XB 3AZJC 1S32A 3RELA 4KHAA 5KDMB 3NQUA 1P3IB 2F8ND 5B33D 3AZHA 2YFVA 3MGQA 5AVBA 1BH8A 5B2ID 5AV8C 3W96D 2IO5C 2F8NA 5B33A 4Z2MG 3MGSB 1P3OA 5AVCD 5B1LD 1U35B 3W96A 5B2IA 5DNMD 3AZJB 4H9OB 1S32B 3RELB 4KHAB 3NQUB 5C3IB 1P3FB 5B1LA 3AZHB 2YFVB 3MGQB 2AROC 5DNMA 2IO5B 3W99D 2BYMA 1BH8B 5AV5D 2HIOD 5BT1D 1P34B 4QLCC 4NE3A 2F8NB 1P3OB 1M1AB 5AV5A 2HIOA 3O62C 2PYOC 1F66A 3NQJA 1H3OB 5DNMB 4JJND 5B32G 1EQZB 4QLCB 5AV6C 1ZLAA 3KXBC 4J8VC 3B6GD 3LELB 3UTBC 4JJNA 1M19D 4YM6C 4Z5TC 4ZUXD 1F66B 3AZMC 1P3PC 3B6GA 3VH5T 1M19A 3MVDD 1ID3D 4Z66D 4ZUXA 3MNNC 5BNVA 2NQBC 3R45A 4HGAB 3AN2C 2F8NH 2CV5D 3WA9C 1ZLAB 1P3BC 4E44A 3MVDA 3MGRC 1ID3A 4Z5TB 4WU8C 5BO0B 3REKD 3AZGD 1P3LD 3REJB 2CV5A 3X1UB 3AZEC 1M18B 3AZMB 5GT0D 5CPID 2NZDD 1P3KD 2L5AA 4KGCB 1M19B 3REKA 3AZGA 1P3LA 4DRBA 5B1MD 1P3BB 5GT0A 2NZDA 3LJAD 1P3KA 3MGRB 3AZNC 4J8UD 4CAYA 4LD9C 5AY8D 3AZEB 5B1MA 3C1BC 2CV5B 3AV2C 3LJAA 3LZ0D 4J8UA 4AWLB 2JSSA 5AY8A 3REKB 5CPKD 1KX5D 1P3MD 3X1TA 5B31B 3LZ0A 3UTAD 2NZDB 5CPKA 4LD9B 1KX5A 3AFAB 3LZ1C 1N1JB 3AV1B 1BFMA 4CAYB 4H9SA 3C1BB 4X23D 1P3MA 5DNNB 3B0CT 3W98C 5GXQD 3VH6T 4NFTA 3UTAA 3UT9B 3VH5W 4KUDD 4X23A 2RVQC 3X1VD 5GXQA 3X1SC 3X1TB 4YS3D 3LZ0B 4J8XC 4CSRB 5CP6D 4KUDA 5CPKB 1P3IC 2YFWA 3X1VA 5BS7C 1AOID 5JRGD 5B2JC 3C1CC 4YS3A 5CP6A 3MGSC 3X1SB 5JRGA 1U35C 5GT3D 1P3GB 5B0ZD 1TZYB 1AOIA 5CPJD 1S32C 3RELC 4KUDB 5C3IC 1P3FC 1HQ3D 2YFWB 1P3AD 3AZHC 5GT3A 5B2JB 3MGQC 3C1CB 1TAFA 5CPJA 5AVBC 1B67A 4UUZA 4XZQB 1P34C 3TU4D 1HQ3A 4M6BA 1P3AA 1P3OC 1M1AC 5JRGB 3WKJB 3W96C 5B2IC 3KUYD 5AV8D 3TU4A 5AVCA 3B6FD
chains in the Genus database with same CATH superfamily
5B1LC 1Z2CB 5AVBB 5DNMC 3B0CW 3KUYA 3VH6W 5F99D 1EQZC 5B33B 3B6FA 1P3AB 1W2EA 3W99A 5B2IB 3LELC 2F8NK 3W96B 2AROD 5F99A 3AZFD 4NE5A 5BT1C 4WNNA 2CWEA 5AVCB 5B1LB 4R8PD 1F66C 2AROA 2BYMB 3AZFA 3VH6A 3AZLD 3KUYB 4EO5C 4HGAC 3KWQD 1ZLAC 4ZBJB 2RIQA 2Y2HA 5B40D 4R8PA 4WZSB 2PYOD 4J8WD 3A6ND 3V9RA 3W99B 5AV5B 3REHD 2HIOB 3AZLA 4JJNC 2HUEB 3KWQA 3REJC 1KX3D 3X1UC 1B6WA 4WNNB 1M18C 5B40A 2PYOA 3B0DB 5JA4A 4J8WA 2G5HC 3A6NA 3NQJB 4J8VD 3B6GC 3REHA 4KGCC 1M19C 4EO5B 3AZFB 1KX4D 1KX3A 4ZUXC 4YM6D 3KSYA 5B0YD 4H9QA 4R8PB 4Z66A 4JJNB 3V9RB 1KX4A 5GSUD 4YM6A 5B0YA 3WTPD 2CV5C 5BNXA 2NQBD 3AYWD 3AN2D 3B6GB 5JA4B 4J8WB 3A6NB 3REHB 5GSUA 4AWLC 4ZUXB 3REKC 5BNVB 2FJ7D 3WTPA 3R45B 3AZID 4WU8D 2NQBA 3AYWA 5CPIA 3MGPD 5B31C 3MVDB 2NZDC 4XUJD 1P3KC 1ID3B 1BH9A 4Z66B 2FJ7A 3AFAC 3AV1C 4WU8A 3AZIA 5DNNC 5B0YB 3MGPA 5BNXB 4XUJA 3LJAC 2F8NG 3UT9C 4J8UC 3AZKD 3AZGB 3AZND 5GSUB 1P3LB 5GT0B 3A1IA 3AYWB 5CPIB 3X1TC 1P3KB 2FFFB 2BYKA 3AV2D 3LZ0C 3AZKA 3AZNA 5CPKC 2FJ7B 1KX5C 5B1MB 4DQYB 2Y2LA 4H9SC 1P3MC 3WAAD 5E5AD 5AV9D 3LJAB 3MGPB 3AV2A 5B32D 4XUJB 4J8UB 4WJ3C 5AY8B 3WAAA 5E5AA 5AV9A 1P3GC 1TZYC 5B32A 2BYKB 3W97D 3AZKB 1KX5B 4WU9D 4KUDC 1P3MB 3X1VC 2Y2IA 3UTAB 3VH5A 4YS3C 3W97A 4XZQC 4WU9A 4X23B 3H0RC 1P3ID 5GXQB 3WAAB 5AV9B 5JRGC 3WKJC 3REID 5B32B 2Y2KA 5G49A 5B24D 1Q9CA 5KDMA 5B0ZA 3X1VB 1A7WA 3REIA 4YS3B 5CPJC 2ZM5A 5CP6B 5B24A 3AZJD 3W97B 5B33C 1P3AC 4G92C 1AOIB 1P3FD 3AZJA 5G49B 3TU4C 5AVCC 1P34D 5GT3B 1P3FA 5B0ZB 4WV4B 3AL0C 1P3OD 1TAFB 1ULYA 5CPJB 1M1AD 5AV8A 3REIB 4UUZB 3KUYC 5B24B 5B31G 1HQ3B 1F1EA 4G92B 1P34A 4ZBJC 3B6FC 1M1AA 3W99C 5AV5C 2HIOC 1R4VA 2XD1A 2HUEC 5F99C 3TU4B 1EQZD 3B0DC 4QLCD 4H9RA 3B0BA 5FUGA 1H3OA 2W8SA 3AZFC 5AV8B 3LELD 1WWIA 3O62D 2Y2PA 1EQZA 3B6FB 4QLCA 4R8PC 1F66D 3LELA 5F99B 3AZLC 1WWSA 3O62A 3KWQC 5AV6D 5B40C 3KXBD 2LY8A 4H9RB 3A6NC 4J8WC 1ZLAD 2AROB 3REHC 5FUGB 3UTBD 2DF4C 4Z5TD 3IP4C 4H9NA 1KX3C 5AV6A 3KXBA 4J8VA 3REJD 3X1UD 1M18D 3MVDC 3AZMD 1P3PD 1ID3C 2ZY2A 3UTBA 3AZLB 4Z66C 3WTPE 1KX4C 1HTAA 4Z5TA 4KGCD 3KWQB 3O62B 5BO0A 3MNND 5B0YC 5B40B 3REJA 3WA9D 2PYOB 3X1UA 1M18A 3AZMA 1P3PA 1P3BD 3P5JB 3MGRD 3AZGC 1P3LC 5GSUC 1KX3B 4KGCA 3MNNA 3WTPC 3AN2A 3WA9A 4H9NB 3AZED 5GT0C 1KU5A 4H9QB 5AV6B 5CPIC 3KXBB 4J8VB 3AYWC 1P3BA 3MGRA 1KX4B 3UTBB 4YM6B 4H9PA 2FJ7C 3EPHA 5B1MC 3AZEA 3AZIC 3MGPC 1P3PB 4XUJC 4E45A 5B31D 5AY8C 3WTPB 3MNNB 4LD9D 3AFAD 3AV1D 2NQBB 2Y2OA 3AN2B 3WA9B 3C1BD 1JFIA 5DNND 1BH9B 5B31A 3EPKA 1T3UA 3AZKC 3UT9D 4LD9A 4G91C 4H9PB 4WU8B 1N1JA 3AFAA 3AZIB 3AV1A 3C1BA 5DNNA 3UTAC 2DQNC 5CHLB 3X1TD 3UT9A 4X23C 3LZ1D 5GXQC 3WAAC 5E5AC 5AV9C 3W98D 1JFIB 5B32C 3AZNB 3H0LC 4G91B 4CSRA 3LZ1A 2RVQD 3W98A 4NE6A 3AV2B 3X1SD 2XD5A 1P3GD 1TZYD 5CP6C 4J8XD 3W97C 4WU9C 2ZY5A 5E5AB 1AOIC 3X1SA 3F6TA 1P3GA 5B2JD 1TZYA 4Z2MH 3C1CD 4J8XA 1P3IA 4XZQD 3LZ1B 3MGSD 5BS7A 5GT3C 5B0ZC 4DRAA 3W98B 5B2JA 1U35D 3C1CA 3REIC 4WU9B 3WKJD 5B24C 4XZQA 1HQ3C 1S32D 3MGSA 3RELD 2ZY3A 3AZHD 1U35A 3MGQD 4UPKA 5AVBD 3WKJA 4H9OA 4J8XB 3AZJC 1S32A 3RELA 4KHAA 2JCHA 2VQRA 3NQUA 5KDMB 1P3IB 2F8ND 5B33D 3AZHA 2YFVA 3MGQA 2G5IC 5AVBA 1BH8A 5B2ID 5AV8C 3W96D 2IO5C 2F8NA 5B33A 4Z2MG 3MGSB 1P3OA 5AVCD 5B1LD 1U35B 3W96A 5B2IA 5DNMD 3AZJB 4H9OB 1S32B 3RELB 2Y2JA 4KHAB 3NQUB 5C3IB 1P3FB 5B1LA 3AZHB 2YFVB 3A1KA 3MGQB 2AROC 5DNMA 2IO5B 3W99D 2BYMA 1BH8B 5AV5D 2HIOD 5BT1D 1P34B 4QLCC 4NE3A 2F8NB 1P3OB 1M1AB 5AV5A 2HIOA 3O62C 2PYOC 1F66A 3NQJA 1H3OB 5DNMB 4JJND 5B32G 1EQZB 4QLCB 5AV6C 1ZLAA 3KXBC 4J8VC 3B6GD 3LELB 3UTBC 4JJNA 1M19D 4YM6C 4Z5TC 4ZUXD 1F66B 3AZMC 1P3PC 3B6GA 3VH5T 1M19A 3MVDD 1ID3D 2Y2MA 4ZUXA 2Y2GA 5BNVA 4Z66D 3MNNC 2NQBC 3R45A 2F2AC 4HGAB 3AN2C 2CV5D 2F8NH 3WA9C 1ZLAB 1P3BC 4E44A 3MVDA 3MGRC 1ID3A 4Z5TB 4WU8C 5BO0B 3REKD 3AZGD 1P3LD 3REJB 2CV5A 3X1UB 3AZEC 1M18B 3AZMB 5GT0D 5CPID 2NZDD 1P3KD 2L5AA 4KGCB 1M19B 3REKA 3AZGA 1P3LA 4DRBA 5B1MD 1P3BB 5GT0A 2NZDA 3LJAD 1P3KA 3MGRB 3AZNC 4J8UD 4CAYA 3EPLA 4LD9C 5AY8D 3AZEB 5B1MA 3C1BC 2CV5B 3AV2C 2Y2QA 3LJAA 3LZ0D 4J8UA 4AWLB 2JSSA 5AY8A 3REKB 5CPKD 1KX5D 3KFUG 1P3MD 1PZRA 3X1TA 2UWXA 5B31B 3EG5B 3LZ0A 3UTAD 2NZDB 2BG1A 5CPKA 4LD9B 1KX5A 3AFAB 3LZ1C 1N1JB 3EPJA 3AV1B 4CAYB 1BFMA 4H9SA 3C1BB 4X23D 1P3MA 5DNNB 3B0CT 3W98C 5GXQD 3VH6T 4NFTA 3UTAA 3UT9B 2Y2NA 3VH5W 4KUDD 4X23A 2RVQC 3X1VD 5GXQA 3X1SC 3X1TB 4YS3D 3LZ0B 4J8XC 4CSRB 5CP6D 4KUDA 5CPKB 1P3IC 2YFWA 3X1VA 5BS7C 1AOID 5JRGD 5B2JC 3C1CC 4YS3A 5CP6A 2JE5A 3FDDA 3MGSC 3X1SB 5JRGA 1U35C 5GT3D 1P3GB 5B0ZD 1TZYB 1AOIA 5CPJD 1S32C 3RELC 4KUDB 5C3IC 1P3FC 1HQ3D 2YFWB 1P3AD 3AZHC 5GT3A 5B2JB 3MGQC 3C1CB 1TAFA 5CPJA 5AVBC 1B67A 4UUZA 4XZQB 3H0MC 1P34C 3TU4D 1HQ3A 4M6BA 1P3AA 1P3OC 1M1AC 5JRGB 2ZY4A 3WKJB 3W96C 5B2IC 2J8PA 3KUYD 5AV8D 3TU4A 5AVCA 3B6FD
chains in the Genus database with same CATH topology
5B1LC 1Z2CB 5AVBB 5DNMC 3B0CW 3KUYA 3VH6W 5F99D 1EQZC 5B33B 3B6FA 1P3AB 1W2EA 3W99A 5B2IB 3LELC 2F8NK 3W96B 2AROD 5F99A 3AZFD 4NE5A 5BT1C 4WNNA 2CWEA 5AVCB 5B1LB 4R8PD 1F66C 2AROA 2BYMB 3AZFA 3VH6A 3AZLD 3KUYB 4EO5C 4HGAC 3KWQD 1ZLAC 4ZBJB 2RIQA 2Y2HA 5B40D 4R8PA 4WZSB 2PYOD 4J8WD 3A6ND 3V9RA 3W99B 5AV5B 3REHD 2HIOB 3AZLA 4JJNC 2HUEB 3KWQA 3REJC 1KX3D 3X1UC 1B6WA 4WNNB 1M18C 5B40A 2PYOA 3B0DB 5JA4A 4J8WA 2G5HC 3A6NA 3NQJB 4J8VD 3B6GC 3REHA 4KGCC 1M19C 4EO5B 3AZFB 1KX4D 1KX3A 4ZUXC 4YM6D 3KSYA 5B0YD 4H9QA 4R8PB 4Z66A 4JJNB 3V9RB 1KX4A 5GSUD 4YM6A 5B0YA 3WTPD 2CV5C 5BNXA 2NQBD 3AYWD 3AN2D 3B6GB 5JA4B 4J8WB 3A6NB 3REHB 5GSUA 4AWLC 4ZUXB 3REKC 5BNVB 2FJ7D 3WTPA 3R45B 3AZID 4WU8D 2NQBA 3AYWA 5CPIA 3MGPD 5B31C 3MVDB 2NZDC 4XUJD 1P3KC 1ID3B 1BH9A 4Z66B 2FJ7A 3AFAC 3AV1C 4WU8A 3AZIA 5DNNC 5B0YB 3MGPA 5BNXB 4XUJA 3LJAC 2F8NG 3UT9C 4J8UC 3AZKD 3AZGB 3AZND 5GSUB 1P3LB 5GT0B 3A1IA 3AYWB 5CPIB 3X1TC 1P3KB 2FFFB 2BYKA 3AV2D 3LZ0C 3AZKA 3AZNA 5CPKC 2FJ7B 1KX5C 5B1MB 4DQYB 2Y2LA 4H9SC 1P3MC 3WAAD 5E5AD 5AV9D 3LJAB 3MGPB 3AV2A 5B32D 4XUJB 4J8UB 4WJ3C 5AY8B 3WAAA 5E5AA 5AV9A 1P3GC 1TZYC 5B32A 2BYKB 3W97D 3AZKB 1KX5B 4WU9D 4KUDC 1P3MB 3X1VC 2Y2IA 3UTAB 3VH5A 4YS3C 3W97A 4XZQC 4WU9A 4X23B 3H0RC 1P3ID 5GXQB 3WAAB 5AV9B 5JRGC 3WKJC 3REID 5B32B 2Y2KA 5G49A 5B24D 1Q9CA 5KDMA 5B0ZA 3X1VB 1A7WA 3REIA 4YS3B 5CPJC 2ZM5A 5CP6B 5B24A 3AZJD 3W97B 5B33C 1P3AC 4G92C 1AOIB 1P3FD 3AZJA 5G49B 3TU4C 5AVCC 1P34D 5GT3B 1P3FA 5B0ZB 4WV4B 3AL0C 1P3OD 1TAFB 1ULYA 5CPJB 1M1AD 5AV8A 3REIB 4UUZB 3KUYC 5B24B 5B31G 1HQ3B 1F1EA 4G92B 1P34A 4ZBJC 3B6FC 1M1AA 3W99C 5AV5C 2HIOC 1R4VA 2XD1A 2HUEC 5F99C 3TU4B 1EQZD 3B0DC 4QLCD 4H9RA 3B0BA 5FUGA 1H3OA 2W8SA 3AZFC 5AV8B 3LELD 1WWIA 3O62D 2Y2PA 1EQZA 3B6FB 4QLCA 4R8PC 1F66D 3LELA 5F99B 3AZLC 1WWSA 3O62A 3KWQC 5AV6D 5B40C 3KXBD 2LY8A 4H9RB 3A6NC 4J8WC 1ZLAD 2AROB 3REHC 5FUGB 3UTBD 2DF4C 4Z5TD 3IP4C 4H9NA 1KX3C 5AV6A 3KXBA 4J8VA 3REJD 3X1UD 1M18D 3MVDC 3AZMD 1P3PD 1ID3C 2ZY2A 3UTBA 3AZLB 4Z66C 3WTPE 1KX4C 1HTAA 4Z5TA 4KGCD 3KWQB 3O62B 5BO0A 3MNND 5B0YC 5B40B 3REJA 3WA9D 2PYOB 3X1UA 1M18A 3AZMA 1P3PA 1P3BD 3P5JB 3MGRD 3AZGC 1P3LC 5GSUC 1KX3B 4KGCA 3MNNA 3WTPC 3AN2A 3WA9A 4H9NB 3AZED 5GT0C 1KU5A 4H9QB 5AV6B 5CPIC 3KXBB 4J8VB 3AYWC 1P3BA 3MGRA 1KX4B 3UTBB 4YM6B 4H9PA 2FJ7C 3EPHA 5B1MC 3AZEA 3AZIC 3MGPC 1P3PB 4XUJC 4E45A 5B31D 5AY8C 3WTPB 3MNNB 4LD9D 3AFAD 3AV1D 2NQBB 2Y2OA 3AN2B 3WA9B 3C1BD 1JFIA 5DNND 1BH9B 5B31A 3EPKA 1T3UA 3AZKC 3UT9D 4LD9A 4G91C 4H9PB 4WU8B 1N1JA 3AFAA 3AZIB 3AV1A 3C1BA 5DNNA 3UTAC 2DQNC 5CHLB 3X1TD 3UT9A 4X23C 3LZ1D 5GXQC 3WAAC 5E5AC 5AV9C 3W98D 1JFIB 5B32C 3AZNB 3H0LC 4G91B 4CSRA 3LZ1A 2RVQD 3W98A 4NE6A 3AV2B 3X1SD 2XD5A 1P3GD 1TZYD 5CP6C 4J8XD 3W97C 4WU9C 2ZY5A 5E5AB 1AOIC 3X1SA 3F6TA 1P3GA 5B2JD 1TZYA 4Z2MH 3C1CD 4J8XA 1P3IA 4XZQD 3LZ1B 3MGSD 5BS7A 5GT3C 5B0ZC 4DRAA 3W98B 5B2JA 1U35D 3C1CA 3REIC 4WU9B 3WKJD 5B24C 4XZQA 1HQ3C 1S32D 3MGSA 3RELD 2ZY3A 3AZHD 1U35A 3MGQD 4UPKA 5AVBD 3WKJA 4H9OA 4J8XB 3AZJC 1S32A 3RELA 4KHAA 2JCHA 2VQRA 3NQUA 5KDMB 1P3IB 2F8ND 5B33D 3AZHA 2YFVA 3MGQA 2G5IC 5AVBA 1BH8A 5B2ID 5AV8C 3W96D 2IO5C 2F8NA 5B33A 4Z2MG 3MGSB 1P3OA 5AVCD 5B1LD 1U35B 3W96A 5B2IA 5DNMD 3AZJB 4H9OB 1S32B 3RELB 2Y2JA 4KHAB 3NQUB 5C3IB 1P3FB 5B1LA 3AZHB 2YFVB 3A1KA 3MGQB 2AROC 5DNMA 2IO5B 3W99D 2BYMA 1BH8B 5AV5D 2HIOD 5BT1D 1P34B 4QLCC 4NE3A 2F8NB 1P3OB 1M1AB 5AV5A 2HIOA 3O62C 2PYOC 1F66A 3NQJA 1H3OB 5DNMB 4JJND 5B32G 1EQZB 4QLCB 5AV6C 1ZLAA 3KXBC 4J8VC 3B6GD 3LELB 3UTBC 4JJNA 1M19D 4YM6C 4Z5TC 4ZUXD 1F66B 3AZMC 1P3PC 3B6GA 3VH5T 1M19A 3MVDD 1ID3D 2Y2MA 4ZUXA 2Y2GA 5BNVA 4Z66D 3MNNC 2NQBC 3R45A 2F2AC 4HGAB 3AN2C 2CV5D 2F8NH 3WA9C 1ZLAB 1P3BC 4E44A 3MVDA 3MGRC 1ID3A 4Z5TB 4WU8C 5BO0B 3REKD 3AZGD 1P3LD 3REJB 2CV5A 3X1UB 3AZEC 1M18B 3AZMB 5GT0D 5CPID 2NZDD 1P3KD 2L5AA 4KGCB 1M19B 3REKA 3AZGA 1P3LA 4DRBA 5B1MD 1P3BB 5GT0A 2NZDA 3LJAD 1P3KA 3MGRB 3AZNC 4J8UD 4CAYA 3EPLA 4LD9C 5AY8D 3AZEB 5B1MA 3C1BC 2CV5B 3AV2C 2Y2QA 3LJAA 3LZ0D 4J8UA 4AWLB 2JSSA 5AY8A 3REKB 5CPKD 1KX5D 3KFUG 1P3MD 1PZRA 3X1TA 2UWXA 5B31B 3EG5B 3LZ0A 3UTAD 2NZDB 2BG1A 5CPKA 4LD9B 1KX5A 3AFAB 3LZ1C 1N1JB 3EPJA 3AV1B 4CAYB 1BFMA 4H9SA 3C1BB 4X23D 1P3MA 5DNNB 3B0CT 3W98C 5GXQD 3VH6T 4NFTA 3UTAA 3UT9B 2Y2NA 3VH5W 4KUDD 4X23A 2RVQC 3X1VD 5GXQA 3X1SC 3X1TB 4YS3D 3LZ0B 4J8XC 4CSRB 5CP6D 4KUDA 5CPKB 1P3IC 2YFWA 3X1VA 5BS7C 1AOID 5JRGD 5B2JC 3C1CC 4YS3A 5CP6A 2JE5A 3FDDA 3MGSC 3X1SB 5JRGA 1U35C 5GT3D 1P3GB 5B0ZD 1TZYB 1AOIA 5CPJD 1S32C 3RELC 4KUDB 5C3IC 1P3FC 1HQ3D 2YFWB 1P3AD 3AZHC 5GT3A 5B2JB 3MGQC 3C1CB 1TAFA 5CPJA 5AVBC 1B67A 4UUZA 4XZQB 3H0MC 1P34C 3TU4D 1HQ3A 4M6BA 1P3AA 1P3OC 1M1AC 5JRGB 2ZY4A 3WKJB 3W96C 5B2IC 2J8PA 3KUYD 5AV8D 3TU4A 5AVCA 3B6FD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1L C;  5AVB B;  5DNM C;  3B0C W;  3KUY A;  3VH6 W;  5F99 D;  1EQZ C;  5B33 B;  3B6F A;  1P3A B;  3W99 A;  5B2I B;  3LEL C;  2F8N K;  3W96 B;  2ARO D;  5F99 A;  3AZF D;  4NE5 A;  5BT1 C;  4WNN A;  2CWE A;  5AVC B;  5B1L B;  4R8P D;  1F66 C;  2ARO A;  2BYM B;  3AZF A;  3VH6 A;  3AZL D;  3KUY B;  4EO5 C;  4HGA C;  3KWQ D;  1ZLA C;  4ZBJ B;  5B40 D;  4R8P A;  2PYO D;  4WZS B;  4J8W D;  3A6N D;  3V9R A;  3W99 B;  5AV5 B;  3REH D;  2HIO B;  3AZL A;  4JJN C;  2HUE B;  3KWQ A;  3REJ C;  1KX3 D;  3X1U C;  1B6W A;  4WNN B;  1M18 C;  5B40 A;  2PYO A;  3B0D B;  5JA4 A;  4J8W A;  3A6N A;  3NQJ B;  4J8V D;  3B6G C;  3REH A;  4KGC C;  1M19 C;  4EO5 B;  3AZF B;  1KX4 D;  1KX3 A;  4ZUX C;  4YM6 D;  3KSY A;  5B0Y D;  4H9Q A;  4R8P B;  4Z66 A;  4JJN B;  3V9R B;  1KX4 A;  5GSU D;  4YM6 A;  5B0Y A;  3WTP D;  2CV5 C;  5BNX A;  2NQB D;  3AYW D;  3AN2 D;  3B6G B;  5JA4 B;  4J8W B;  3A6N B;  3REH B;  5GSU A;  4AWL C;  4ZUX B;  3REK C;  5BNV B;  2FJ7 D;  3WTP A;  3R45 B;  3AZI D;  4WU8 D;  2NQB A;  3AYW A;  5CPI A;  3MGP D;  5B31 C;  3MVD B;  2NZD C;  4XUJ D;  1P3K C;  1ID3 B;  1BH9 A;  4Z66 B;  2FJ7 A;  3AFA C;  3AV1 C;  4WU8 A;  3AZI A;  5DNN C;  5B0Y B;  3MGP A;  5BNX B;  4XUJ A;  3LJA C;  2F8N G;  3UT9 C;  4J8U C;  3AZK D;  3AZG B;  3AZN D;  5GSU B;  1P3L B;  5GT0 B;  3AYW B;  5CPI B;  3X1T C;  1P3K B;  2BYK A;  3AV2 D;  3LZ0 C;  3AZK A;  3AZN A;  5CPK C;  2FJ7 B;  1KX5 C;  5B1M B;  4H9S C;  1P3M C;  3WAA D;  5E5A D;  5AV9 D;  3LJA B;  3MGP B;  3AV2 A;  5B32 D;  4XUJ B;  4J8U B;  5AY8 B;  3WAA A;  5E5A A;  5AV9 A;  1P3G C;  1TZY C;  5B32 A;  2BYK B;  3W97 D;  3AZK B;  1KX5 B;  4WU9 D;  4KUD C;  1P3M B;  3X1V C;  3UTA B;  3VH5 A;  4YS3 C;  3W97 A;  4XZQ C;  4WU9 A;  4X23 B;  1P3I D;  5GXQ B;  3WAA B;  5AV9 B;  5JRG C;  3WKJ C;  3REI D;  5B32 B;  5G49 A;  5B24 D;  1Q9C A;  5KDM A;  5B0Z A;  3X1V B;  1A7W A;  3REI A;  4YS3 B;  5CPJ C;  5CP6 B;  5B24 A;  3AZJ D;  3W97 B;  5B33 C;  1P3A C;  4G92 C;  1AOI B;  1P3F D;  3AZJ A;  5G49 B;  3TU4 C;  5AVC C;  1P34 D;  5GT3 B;  1P3F A;  5B0Z B;  4WV4 B;  1P3O D;  1TAF B;  1ULY A;  5CPJ B;  1M1A D;  5AV8 A;  3REI B;  4UUZ B;  3KUY C;  5B24 B;  5B31 G;  1HQ3 B;  1F1E A;  4G92 B;  1P34 A;  4ZBJ C;  3B6F C;  1M1A A;  3W99 C;  5AV5 C;  2HIO C;  1R4V A;  2HUE C;  5F99 C;  3TU4 B;  1EQZ D;  3B0D C;  4QLC D;  4H9R A;  3B0B A;  5FUG A;  1H3O A;  3AZF C;  5AV8 B;  3LEL D;  1WWI A;  3O62 D;  1EQZ A;  3B6F B;  4QLC A;  4R8P C;  1F66 D;  3LEL A;  5F99 B;  3AZL C;  1WWS A;  3O62 A;  3KWQ C;  5AV6 D;  5B40 C;  3KXB D;  2LY8 A;  4H9R B;  3A6N C;  4J8W C;  1ZLA D;  2ARO B;  3REH C;  5FUG B;  3UTB D;  4Z5T D;  1KX3 C;  4H9N A;  5AV6 A;  3KXB A;  4J8V A;  3REJ D;  3X1U D;  1M18 D;  3MVD C;  3AZM D;  1P3P D;  1ID3 C;  3UTB A;  3AZL B;  4Z66 C;  3WTP E;  1KX4 C;  1HTA A;  4Z5T A;  4KGC D;  3KWQ B;  3O62 B;  5BO0 A;  3MNN D;  5B0Y C;  5B40 B;  3REJ A;  3WA9 D;  2PYO B;  3X1U A;  1M18 A;  3AZM A;  1P3P A;  1P3B D;  3MGR D;  3AZG C;  1P3L C;  5GSU C;  1KX3 B;  4KGC A;  3MNN A;  3WTP C;  3AN2 A;  3WA9 A;  4H9N B;  3AZE D;  5GT0 C;  1KU5 A;  4H9Q B;  5AV6 B;  5CPI C;  3KXB B;  4J8V B;  3AYW C;  1P3B A;  3MGR A;  1KX4 B;  3UTB B;  4YM6 B;  4H9P A;  2FJ7 C;  5B1M C;  3AZE A;  3AZI C;  3MGP C;  1P3P B;  4XUJ C;  4E45 A;  5B31 D;  5AY8 C;  3WTP B;  3MNN B;  4LD9 D;  3AFA D;  3AV1 D;  2NQB B;  3AN2 B;  3WA9 B;  3C1B D;  1JFI A;  5DNN D;  1BH9 B;  5B31 A;  3AZK C;  3UT9 D;  4LD9 A;  4G91 C;  4H9P B;  4WU8 B;  1N1J A;  3AFA A;  3AZI B;  3AV1 A;  3C1B A;  5DNN A;  3UTA C;  5CHL B;  3X1T D;  3UT9 A;  4X23 C;  3LZ1 D;  5GXQ C;  3WAA C;  5E5A C;  5AV9 C;  3W98 D;  1JFI B;  5B32 C;  3AZN B;  4G91 B;  4CSR A;  3LZ1 A;  2RVQ D;  3W98 A;  4NE6 A;  3AV2 B;  3X1S D;  1P3G D;  1TZY D;  5CP6 C;  4J8X D;  3W97 C;  4WU9 C;  5E5A B;  1AOI C;  3X1S A;  1P3G A;  5B2J D;  1TZY A;  4Z2M H;  3C1C D;  4J8X A;  1P3I A;  4XZQ D;  3LZ1 B;  3MGS D;  5BS7 A;  5GT3 C;  5B0Z C;  4DRA A;  3W98 B;  5B2J A;  1U35 D;  3C1C A;  3REI C;  4WU9 B;  3WKJ D;  5B24 C;  4XZQ A;  1HQ3 C;  1S32 D;  3MGS A;  3REL D;  3AZH D;  1U35 A;  3MGQ D;  5AVB D;  3WKJ A;  4H9O A;  4J8X B;  3AZJ C;  1S32 A;  3REL A;  4KHA A;  5KDM B;  3NQU A;  1P3I B;  2F8N D;  5B33 D;  3AZH A;  2YFV A;  3MGQ A;  5AVB A;  1BH8 A;  5B2I D;  5AV8 C;  3W96 D;  2IO5 C;  2F8N A;  5B33 A;  4Z2M G;  3MGS B;  1P3O A;  5AVC D;  5B1L D;  1U35 B;  3W96 A;  5B2I A;  5DNM D;  3AZJ B;  4H9O B;  1S32 B;  3REL B;  4KHA B;  3NQU B;  5C3I B;  1P3F B;  5B1L A;  3AZH B;  2YFV B;  3MGQ B;  2ARO C;  5DNM A;  2IO5 B;  3W99 D;  2BYM A;  1BH8 B;  5AV5 D;  2HIO D;  5BT1 D;  1P34 B;  4QLC C;  4NE3 A;  2F8N B;  1P3O B;  1M1A B;  5AV5 A;  2HIO A;  3O62 C;  2PYO C;  1F66 A;  3NQJ A;  1H3O B;  5DNM B;  4JJN D;  5B32 G;  1EQZ B;  4QLC B;  5AV6 C;  1ZLA A;  3KXB C;  4J8V C;  3B6G D;  3LEL B;  3UTB C;  4JJN A;  1M19 D;  4YM6 C;  4Z5T C;  4ZUX D;  1F66 B;  3AZM C;  1P3P C;  3B6G A;  3VH5 T;  1M19 A;  3MVD D;  1ID3 D;  4Z66 D;  4ZUX A;  3MNN C;  5BNV A;  2NQB C;  3R45 A;  4HGA B;  3AN2 C;  2F8N H;  2CV5 D;  3WA9 C;  1ZLA B;  1P3B C;  4E44 A;  3MVD A;  3MGR C;  1ID3 A;  4Z5T B;  4WU8 C;  5BO0 B;  3REK D;  3AZG D;  1P3L D;  3REJ B;  2CV5 A;  3X1U B;  3AZE C;  1M18 B;  3AZM B;  5GT0 D;  5CPI D;  2NZD D;  1P3K D;  2L5A A;  4KGC B;  1M19 B;  3REK A;  3AZG A;  1P3L A;  4DRB A;  5B1M D;  1P3B B;  5GT0 A;  2NZD A;  3LJA D;  1P3K A;  3MGR B;  3AZN C;  4J8U D;  4CAY A;  4LD9 C;  5AY8 D;  3AZE B;  5B1M A;  3C1B C;  2CV5 B;  3AV2 C;  3LJA A;  3LZ0 D;  4J8U A;  4AWL B;  2JSS A;  5AY8 A;  3REK B;  5CPK D;  1KX5 D;  1P3M D;  3X1T A;  5B31 B;  3LZ0 A;  3UTA D;  2NZD B;  5CPK A;  4LD9 B;  1KX5 A;  3AFA B;  3LZ1 C;  1N1J B;  3AV1 B;  1BFM A;  4CAY B;  4H9S A;  3C1B B;  4X23 D;  1P3M A;  5DNN B;  3B0C T;  3W98 C;  5GXQ D;  3VH6 T;  4NFT A;  3UTA A;  3UT9 B;  3VH5 W;  4KUD D;  4X23 A;  2RVQ C;  3X1V D;  5GXQ A;  3X1S C;  3X1T B;  4YS3 D;  3LZ0 B;  4J8X C;  4CSR B;  5CP6 D;  4KUD A;  5CPK B;  1P3I C;  2YFW A;  3X1V A;  5BS7 C;  1AOI D;  5JRG D;  5B2J C;  3C1C C;  4YS3 A;  5CP6 A;  3MGS C;  3X1S B;  5JRG A;  1U35 C;  5GT3 D;  1P3G B;  5B0Z D;  1TZY B;  1AOI A;  5CPJ D;  1S32 C;  3REL C;  4KUD B;  5C3I C;  1P3F C;  1HQ3 D;  2YFW B;  1P3A D;  3AZH C;  5GT3 A;  5B2J B;  3MGQ C;  3C1C B;  1TAF A;  5CPJ A;  5AVB C;  1B67 A;  4UUZ A;  4XZQ B;  1P34 C;  3TU4 D;  1HQ3 A;  4M6B A;  1P3A A;  1P3O C;  1M1A C;  5JRG B;  3WKJ B;  3W96 C;  5B2I C;  3KUY D;  5AV8 D;  3TU4 A;  5AVC A;  3B6F D; 
#chains in the Genus database with same CATH topology
 5B1L C;  1Z2C B;  5AVB B;  5DNM C;  3B0C W;  3KUY A;  3VH6 W;  5F99 D;  1EQZ C;  5B33 B;  3B6F A;  1P3A B;  1W2E A;  3W99 A;  5B2I B;  3LEL C;  2F8N K;  3W96 B;  2ARO D;  5F99 A;  3AZF D;  4NE5 A;  5BT1 C;  4WNN A;  2CWE A;  5AVC B;  5B1L B;  4R8P D;  1F66 C;  2ARO A;  2BYM B;  3AZF A;  3VH6 A;  3AZL D;  3KUY B;  4EO5 C;  4HGA C;  3KWQ D;  1ZLA C;  4ZBJ B;  2RIQ A;  2Y2H A;  5B40 D;  4R8P A;  4WZS B;  2PYO D;  4J8W D;  3A6N D;  3V9R A;  3W99 B;  5AV5 B;  3REH D;  2HIO B;  3AZL A;  4JJN C;  2HUE B;  3KWQ A;  3REJ C;  1KX3 D;  3X1U C;  1B6W A;  4WNN B;  1M18 C;  5B40 A;  2PYO A;  3B0D B;  5JA4 A;  4J8W A;  2G5H C;  3A6N A;  3NQJ B;  4J8V D;  3B6G C;  3REH A;  4KGC C;  1M19 C;  4EO5 B;  3AZF B;  1KX4 D;  1KX3 A;  4ZUX C;  4YM6 D;  3KSY A;  5B0Y D;  4H9Q A;  4R8P B;  4Z66 A;  4JJN B;  3V9R B;  1KX4 A;  5GSU D;  4YM6 A;  5B0Y A;  3WTP D;  2CV5 C;  5BNX A;  2NQB D;  3AYW D;  3AN2 D;  3B6G B;  5JA4 B;  4J8W B;  3A6N B;  3REH B;  5GSU A;  4AWL C;  4ZUX B;  3REK C;  5BNV B;  2FJ7 D;  3WTP A;  3R45 B;  3AZI D;  4WU8 D;  2NQB A;  3AYW A;  5CPI A;  3MGP D;  5B31 C;  3MVD B;  2NZD C;  4XUJ D;  1P3K C;  1ID3 B;  1BH9 A;  4Z66 B;  2FJ7 A;  3AFA C;  3AV1 C;  4WU8 A;  3AZI A;  5DNN C;  5B0Y B;  3MGP A;  5BNX B;  4XUJ A;  3LJA C;  2F8N G;  3UT9 C;  4J8U C;  3AZK D;  3AZG B;  3AZN D;  5GSU B;  1P3L B;  5GT0 B;  3A1I A;  3AYW B;  5CPI B;  3X1T C;  1P3K B;  2FFF B;  2BYK A;  3AV2 D;  3LZ0 C;  3AZK A;  3AZN A;  5CPK C;  2FJ7 B;  1KX5 C;  5B1M B;  4DQY B;  2Y2L A;  4H9S C;  1P3M C;  3WAA D;  5E5A D;  5AV9 D;  3LJA B;  3MGP B;  3AV2 A;  5B32 D;  4XUJ B;  4J8U B;  4WJ3 C;  5AY8 B;  3WAA A;  5E5A A;  5AV9 A;  1P3G C;  1TZY C;  5B32 A;  2BYK B;  3W97 D;  3AZK B;  1KX5 B;  4WU9 D;  4KUD C;  1P3M B;  3X1V C;  2Y2I A;  3UTA B;  3VH5 A;  4YS3 C;  3W97 A;  4XZQ C;  4WU9 A;  4X23 B;  3H0R C;  1P3I D;  5GXQ B;  3WAA B;  5AV9 B;  5JRG C;  3WKJ C;  3REI D;  5B32 B;  2Y2K A;  5G49 A;  5B24 D;  1Q9C A;  5KDM A;  5B0Z A;  3X1V B;  1A7W A;  3REI A;  4YS3 B;  5CPJ C;  2ZM5 A;  5CP6 B;  5B24 A;  3AZJ D;  3W97 B;  5B33 C;  1P3A C;  4G92 C;  1AOI B;  1P3F D;  3AZJ A;  5G49 B;  3TU4 C;  5AVC C;  1P34 D;  5GT3 B;  1P3F A;  5B0Z B;  4WV4 B;  3AL0 C;  1P3O D;  1TAF B;  1ULY A;  5CPJ B;  1M1A D;  5AV8 A;  3REI B;  4UUZ B;  3KUY C;  5B24 B;  5B31 G;  1HQ3 B;  1F1E A;  4G92 B;  1P34 A;  4ZBJ C;  3B6F C;  1M1A A;  3W99 C;  5AV5 C;  2HIO C;  1R4V A;  2XD1 A;  2HUE C;  5F99 C;  3TU4 B;  1EQZ D;  3B0D C;  4QLC D;  4H9R A;  3B0B A;  5FUG A;  1H3O A;  2W8S A;  3AZF C;  5AV8 B;  3LEL D;  1WWI A;  3O62 D;  2Y2P A;  1EQZ A;  3B6F B;  4QLC A;  4R8P C;  1F66 D;  3LEL A;  5F99 B;  3AZL C;  1WWS A;  3O62 A;  3KWQ C;  5AV6 D;  5B40 C;  3KXB D;  2LY8 A;  4H9R B;  3A6N C;  4J8W C;  1ZLA D;  2ARO B;  3REH C;  5FUG B;  3UTB D;  2DF4 C;  4Z5T D;  3IP4 C;  4H9N A;  1KX3 C;  5AV6 A;  3KXB A;  4J8V A;  3REJ D;  3X1U D;  1M18 D;  3MVD C;  3AZM D;  1P3P D;  1ID3 C;  2ZY2 A;  3UTB A;  3AZL B;  4Z66 C;  3WTP E;  1KX4 C;  1HTA A;  4Z5T A;  4KGC D;  3KWQ B;  3O62 B;  5BO0 A;  3MNN D;  5B0Y C;  5B40 B;  3REJ A;  3WA9 D;  2PYO B;  3X1U A;  1M18 A;  3AZM A;  1P3P A;  1P3B D;  3P5J B;  3MGR D;  3AZG C;  1P3L C;  5GSU C;  1KX3 B;  4KGC A;  3MNN A;  3WTP C;  3AN2 A;  3WA9 A;  4H9N B;  3AZE D;  5GT0 C;  1KU5 A;  4H9Q B;  5AV6 B;  5CPI C;  3KXB B;  4J8V B;  3AYW C;  1P3B A;  3MGR A;  1KX4 B;  3UTB B;  4YM6 B;  4H9P A;  2FJ7 C;  3EPH A;  5B1M C;  3AZE A;  3AZI C;  3MGP C;  1P3P B;  4XUJ C;  4E45 A;  5B31 D;  5AY8 C;  3WTP B;  3MNN B;  4LD9 D;  3AFA D;  3AV1 D;  2NQB B;  2Y2O A;  3AN2 B;  3WA9 B;  3C1B D;  1JFI A;  5DNN D;  1BH9 B;  5B31 A;  3EPK A;  1T3U A;  3AZK C;  3UT9 D;  4LD9 A;  4G91 C;  4H9P B;  4WU8 B;  1N1J A;  3AFA A;  3AZI B;  3AV1 A;  3C1B A;  5DNN A;  3UTA C;  2DQN C;  5CHL B;  3X1T D;  3UT9 A;  4X23 C;  3LZ1 D;  5GXQ C;  3WAA C;  5E5A C;  5AV9 C;  3W98 D;  1JFI B;  5B32 C;  3AZN B;  3H0L C;  4G91 B;  4CSR A;  3LZ1 A;  2RVQ D;  3W98 A;  4NE6 A;  3AV2 B;  3X1S D;  2XD5 A;  1P3G D;  1TZY D;  5CP6 C;  4J8X D;  3W97 C;  4WU9 C;  2ZY5 A;  5E5A B;  1AOI C;  3X1S A;  3F6T A;  1P3G A;  5B2J D;  1TZY A;  4Z2M H;  3C1C D;  4J8X A;  1P3I A;  4XZQ D;  3LZ1 B;  3MGS D;  5BS7 A;  5GT3 C;  5B0Z C;  4DRA A;  3W98 B;  5B2J A;  1U35 D;  3C1C A;  3REI C;  4WU9 B;  3WKJ D;  5B24 C;  4XZQ A;  1HQ3 C;  1S32 D;  3MGS A;  3REL D;  2ZY3 A;  3AZH D;  1U35 A;  3MGQ D;  4UPK A;  5AVB D;  3WKJ A;  4H9O A;  4J8X B;  3AZJ C;  1S32 A;  3REL A;  4KHA A;  2JCH A;  2VQR A;  3NQU A;  5KDM B;  1P3I B;  2F8N D;  5B33 D;  3AZH A;  2YFV A;  3MGQ A;  2G5I C;  5AVB A;  1BH8 A;  5B2I D;  5AV8 C;  3W96 D;  2IO5 C;  2F8N A;  5B33 A;  4Z2M G;  3MGS B;  1P3O A;  5AVC D;  5B1L D;  1U35 B;  3W96 A;  5B2I A;  5DNM D;  3AZJ B;  4H9O B;  1S32 B;  3REL B;  2Y2J A;  4KHA B;  3NQU B;  5C3I B;  1P3F B;  5B1L A;  3AZH B;  2YFV B;  3A1K A;  3MGQ B;  2ARO C;  5DNM A;  2IO5 B;  3W99 D;  2BYM A;  1BH8 B;  5AV5 D;  2HIO D;  5BT1 D;  1P34 B;  4QLC C;  4NE3 A;  2F8N B;  1P3O B;  1M1A B;  5AV5 A;  2HIO A;  3O62 C;  2PYO C;  1F66 A;  3NQJ A;  1H3O B;  5DNM B;  4JJN D;  5B32 G;  1EQZ B;  4QLC B;  5AV6 C;  1ZLA A;  3KXB C;  4J8V C;  3B6G D;  3LEL B;  3UTB C;  4JJN A;  1M19 D;  4YM6 C;  4Z5T C;  4ZUX D;  1F66 B;  3AZM C;  1P3P C;  3B6G A;  3VH5 T;  1M19 A;  3MVD D;  1ID3 D;  2Y2M A;  4ZUX A;  2Y2G A;  5BNV A;  4Z66 D;  3MNN C;  2NQB C;  3R45 A;  2F2A C;  4HGA B;  3AN2 C;  2CV5 D;  2F8N H;  3WA9 C;  1ZLA B;  1P3B C;  4E44 A;  3MVD A;  3MGR C;  1ID3 A;  4Z5T B;  4WU8 C;  5BO0 B;  3REK D;  3AZG D;  1P3L D;  3REJ B;  2CV5 A;  3X1U B;  3AZE C;  1M18 B;  3AZM B;  5GT0 D;  5CPI D;  2NZD D;  1P3K D;  2L5A A;  4KGC B;  1M19 B;  3REK A;  3AZG A;  1P3L A;  4DRB A;  5B1M D;  1P3B B;  5GT0 A;  2NZD A;  3LJA D;  1P3K A;  3MGR B;  3AZN C;  4J8U D;  4CAY A;  3EPL A;  4LD9 C;  5AY8 D;  3AZE B;  5B1M A;  3C1B C;  2CV5 B;  3AV2 C;  2Y2Q A;  3LJA A;  3LZ0 D;  4J8U A;  4AWL B;  2JSS A;  5AY8 A;  3REK B;  5CPK D;  1KX5 D;  3KFU G;  1P3M D;  1PZR A;  3X1T A;  2UWX A;  5B31 B;  3EG5 B;  3LZ0 A;  3UTA D;  2NZD B;  2BG1 A;  5CPK A;  4LD9 B;  1KX5 A;  3AFA B;  3LZ1 C;  1N1J B;  3EPJ A;  3AV1 B;  4CAY B;  1BFM A;  4H9S A;  3C1B B;  4X23 D;  1P3M A;  5DNN B;  3B0C T;  3W98 C;  5GXQ D;  3VH6 T;  4NFT A;  3UTA A;  3UT9 B;  2Y2N A;  3VH5 W;  4KUD D;  4X23 A;  2RVQ C;  3X1V D;  5GXQ A;  3X1S C;  3X1T B;  4YS3 D;  3LZ0 B;  4J8X C;  4CSR B;  5CP6 D;  4KUD A;  5CPK B;  1P3I C;  2YFW A;  3X1V A;  5BS7 C;  1AOI D;  5JRG D;  5B2J C;  3C1C C;  4YS3 A;  5CP6 A;  2JE5 A;  3FDD A;  3MGS C;  3X1S B;  5JRG A;  1U35 C;  5GT3 D;  1P3G B;  5B0Z D;  1TZY B;  1AOI A;  5CPJ D;  1S32 C;  3REL C;  4KUD B;  5C3I C;  1P3F C;  1HQ3 D;  2YFW B;  1P3A D;  3AZH C;  5GT3 A;  5B2J B;  3MGQ C;  3C1C B;  1TAF A;  5CPJ A;  5AVB C;  1B67 A;  4UUZ A;  4XZQ B;  3H0M C;  1P34 C;  3TU4 D;  1HQ3 A;  4M6B A;  1P3A A;  1P3O C;  1M1A C;  5JRG B;  2ZY4 A;  3WKJ B;  3W96 C;  5B2I C;  2J8P A;  3KUY D;  5AV8 D;  3TU4 A;  5AVC A;  3B6F D; 
#chains in the Genus database with same CATH homology
 5B1L C;  1Z2C B;  5AVB B;  5DNM C;  3B0C W;  3KUY A;  3VH6 W;  5F99 D;  1EQZ C;  5B33 B;  3B6F A;  1P3A B;  1W2E A;  3W99 A;  5B2I B;  3LEL C;  2F8N K;  3W96 B;  2ARO D;  5F99 A;  3AZF D;  4NE5 A;  5BT1 C;  4WNN A;  2CWE A;  5AVC B;  5B1L B;  4R8P D;  1F66 C;  2ARO A;  2BYM B;  3AZF A;  3VH6 A;  3AZL D;  3KUY B;  4EO5 C;  4HGA C;  3KWQ D;  1ZLA C;  4ZBJ B;  2RIQ A;  2Y2H A;  5B40 D;  4R8P A;  4WZS B;  2PYO D;  4J8W D;  3A6N D;  3V9R A;  3W99 B;  5AV5 B;  3REH D;  2HIO B;  3AZL A;  4JJN C;  2HUE B;  3KWQ A;  3REJ C;  1KX3 D;  3X1U C;  1B6W A;  4WNN B;  1M18 C;  5B40 A;  2PYO A;  3B0D B;  5JA4 A;  4J8W A;  2G5H C;  3A6N A;  3NQJ B;  4J8V D;  3B6G C;  3REH A;  4KGC C;  1M19 C;  4EO5 B;  3AZF B;  1KX4 D;  1KX3 A;  4ZUX C;  4YM6 D;  3KSY A;  5B0Y D;  4H9Q A;  4R8P B;  4Z66 A;  4JJN B;  3V9R B;  1KX4 A;  5GSU D;  4YM6 A;  5B0Y A;  3WTP D;  2CV5 C;  5BNX A;  2NQB D;  3AYW D;  3AN2 D;  3B6G B;  5JA4 B;  4J8W B;  3A6N B;  3REH B;  5GSU A;  4AWL C;  4ZUX B;  3REK C;  5BNV B;  2FJ7 D;  3WTP A;  3R45 B;  3AZI D;  4WU8 D;  2NQB A;  3AYW A;  5CPI A;  3MGP D;  5B31 C;  3MVD B;  2NZD C;  4XUJ D;  1P3K C;  1ID3 B;  1BH9 A;  4Z66 B;  2FJ7 A;  3AFA C;  3AV1 C;  4WU8 A;  3AZI A;  5DNN C;  5B0Y B;  3MGP A;  5BNX B;  4XUJ A;  3LJA C;  2F8N G;  3UT9 C;  4J8U C;  3AZK D;  3AZG B;  3AZN D;  5GSU B;  1P3L B;  5GT0 B;  3A1I A;  3AYW B;  5CPI B;  3X1T C;  1P3K B;  2FFF B;  2BYK A;  3AV2 D;  3LZ0 C;  3AZK A;  3AZN A;  5CPK C;  2FJ7 B;  1KX5 C;  5B1M B;  4DQY B;  2Y2L A;  4H9S C;  1P3M C;  3WAA D;  5E5A D;  5AV9 D;  3LJA B;  3MGP B;  3AV2 A;  5B32 D;  4XUJ B;  4J8U B;  4WJ3 C;  5AY8 B;  3WAA A;  5E5A A;  5AV9 A;  1P3G C;  1TZY C;  5B32 A;  2BYK B;  3W97 D;  3AZK B;  1KX5 B;  4WU9 D;  4KUD C;  1P3M B;  3X1V C;  2Y2I A;  3UTA B;  3VH5 A;  4YS3 C;  3W97 A;  4XZQ C;  4WU9 A;  4X23 B;  3H0R C;  1P3I D;  5GXQ B;  3WAA B;  5AV9 B;  5JRG C;  3WKJ C;  3REI D;  5B32 B;  2Y2K A;  5G49 A;  5B24 D;  1Q9C A;  5KDM A;  5B0Z A;  3X1V B;  1A7W A;  3REI A;  4YS3 B;  5CPJ C;  2ZM5 A;  5CP6 B;  5B24 A;  3AZJ D;  3W97 B;  5B33 C;  1P3A C;  4G92 C;  1AOI B;  1P3F D;  3AZJ A;  5G49 B;  3TU4 C;  5AVC C;  1P34 D;  5GT3 B;  1P3F A;  5B0Z B;  4WV4 B;  3AL0 C;  1P3O D;  1TAF B;  1ULY A;  5CPJ B;  1M1A D;  5AV8 A;  3REI B;  4UUZ B;  3KUY C;  5B24 B;  5B31 G;  1HQ3 B;  1F1E A;  4G92 B;  1P34 A;  4ZBJ C;  3B6F C;  1M1A A;  3W99 C;  5AV5 C;  2HIO C;  1R4V A;  2XD1 A;  2HUE C;  5F99 C;  3TU4 B;  1EQZ D;  3B0D C;  4QLC D;  4H9R A;  3B0B A;  5FUG A;  1H3O A;  2W8S A;  3AZF C;  5AV8 B;  3LEL D;  1WWI A;  3O62 D;  2Y2P A;  1EQZ A;  3B6F B;  4QLC A;  4R8P C;  1F66 D;  3LEL A;  5F99 B;  3AZL C;  1WWS A;  3O62 A;  3KWQ C;  5AV6 D;  5B40 C;  3KXB D;  2LY8 A;  4H9R B;  3A6N C;  4J8W C;  1ZLA D;  2ARO B;  3REH C;  5FUG B;  3UTB D;  2DF4 C;  4Z5T D;  3IP4 C;  4H9N A;  1KX3 C;  5AV6 A;  3KXB A;  4J8V A;  3REJ D;  3X1U D;  1M18 D;  3MVD C;  3AZM D;  1P3P D;  1ID3 C;  2ZY2 A;  3UTB A;  3AZL B;  4Z66 C;  3WTP E;  1KX4 C;  1HTA A;  4Z5T A;  4KGC D;  3KWQ B;  3O62 B;  5BO0 A;  3MNN D;  5B0Y C;  5B40 B;  3REJ A;  3WA9 D;  2PYO B;  3X1U A;  1M18 A;  3AZM A;  1P3P A;  1P3B D;  3P5J B;  3MGR D;  3AZG C;  1P3L C;  5GSU C;  1KX3 B;  4KGC A;  3MNN A;  3WTP C;  3AN2 A;  3WA9 A;  4H9N B;  3AZE D;  5GT0 C;  1KU5 A;  4H9Q B;  5AV6 B;  5CPI C;  3KXB B;  4J8V B;  3AYW C;  1P3B A;  3MGR A;  1KX4 B;  3UTB B;  4YM6 B;  4H9P A;  2FJ7 C;  3EPH A;  5B1M C;  3AZE A;  3AZI C;  3MGP C;  1P3P B;  4XUJ C;  4E45 A;  5B31 D;  5AY8 C;  3WTP B;  3MNN B;  4LD9 D;  3AFA D;  3AV1 D;  2NQB B;  2Y2O A;  3AN2 B;  3WA9 B;  3C1B D;  1JFI A;  5DNN D;  1BH9 B;  5B31 A;  3EPK A;  1T3U A;  3AZK C;  3UT9 D;  4LD9 A;  4G91 C;  4H9P B;  4WU8 B;  1N1J A;  3AFA A;  3AZI B;  3AV1 A;  3C1B A;  5DNN A;  3UTA C;  2DQN C;  5CHL B;  3X1T D;  3UT9 A;  4X23 C;  3LZ1 D;  5GXQ C;  3WAA C;  5E5A C;  5AV9 C;  3W98 D;  1JFI B;  5B32 C;  3AZN B;  3H0L C;  4G91 B;  4CSR A;  3LZ1 A;  2RVQ D;  3W98 A;  4NE6 A;  3AV2 B;  3X1S D;  2XD5 A;  1P3G D;  1TZY D;  5CP6 C;  4J8X D;  3W97 C;  4WU9 C;  2ZY5 A;  5E5A B;  1AOI C;  3X1S A;  3F6T A;  1P3G A;  5B2J D;  1TZY A;  4Z2M H;  3C1C D;  4J8X A;  1P3I A;  4XZQ D;  3LZ1 B;  3MGS D;  5BS7 A;  5GT3 C;  5B0Z C;  4DRA A;  3W98 B;  5B2J A;  1U35 D;  3C1C A;  3REI C;  4WU9 B;  3WKJ D;  5B24 C;  4XZQ A;  1HQ3 C;  1S32 D;  3MGS A;  3REL D;  2ZY3 A;  3AZH D;  1U35 A;  3MGQ D;  4UPK A;  5AVB D;  3WKJ A;  4H9O A;  4J8X B;  3AZJ C;  1S32 A;  3REL A;  4KHA A;  2JCH A;  2VQR A;  3NQU A;  5KDM B;  1P3I B;  2F8N D;  5B33 D;  3AZH A;  2YFV A;  3MGQ A;  2G5I C;  5AVB A;  1BH8 A;  5B2I D;  5AV8 C;  3W96 D;  2IO5 C;  2F8N A;  5B33 A;  4Z2M G;  3MGS B;  1P3O A;  5AVC D;  5B1L D;  1U35 B;  3W96 A;  5B2I A;  5DNM D;  3AZJ B;  4H9O B;  1S32 B;  3REL B;  2Y2J A;  4KHA B;  3NQU B;  5C3I B;  1P3F B;  5B1L A;  3AZH B;  2YFV B;  3A1K A;  3MGQ B;  2ARO C;  5DNM A;  2IO5 B;  3W99 D;  2BYM A;  1BH8 B;  5AV5 D;  2HIO D;  5BT1 D;  1P34 B;  4QLC C;  4NE3 A;  2F8N B;  1P3O B;  1M1A B;  5AV5 A;  2HIO A;  3O62 C;  2PYO C;  1F66 A;  3NQJ A;  1H3O B;  5DNM B;  4JJN D;  5B32 G;  1EQZ B;  4QLC B;  5AV6 C;  1ZLA A;  3KXB C;  4J8V C;  3B6G D;  3LEL B;  3UTB C;  4JJN A;  1M19 D;  4YM6 C;  4Z5T C;  4ZUX D;  1F66 B;  3AZM C;  1P3P C;  3B6G A;  3VH5 T;  1M19 A;  3MVD D;  1ID3 D;  2Y2M A;  4ZUX A;  2Y2G A;  5BNV A;  4Z66 D;  3MNN C;  2NQB C;  3R45 A;  2F2A C;  4HGA B;  3AN2 C;  2CV5 D;  2F8N H;  3WA9 C;  1ZLA B;  1P3B C;  4E44 A;  3MVD A;  3MGR C;  1ID3 A;  4Z5T B;  4WU8 C;  5BO0 B;  3REK D;  3AZG D;  1P3L D;  3REJ B;  2CV5 A;  3X1U B;  3AZE C;  1M18 B;  3AZM B;  5GT0 D;  5CPI D;  2NZD D;  1P3K D;  2L5A A;  4KGC B;  1M19 B;  3REK A;  3AZG A;  1P3L A;  4DRB A;  5B1M D;  1P3B B;  5GT0 A;  2NZD A;  3LJA D;  1P3K A;  3MGR B;  3AZN C;  4J8U D;  4CAY A;  3EPL A;  4LD9 C;  5AY8 D;  3AZE B;  5B1M A;  3C1B C;  2CV5 B;  3AV2 C;  2Y2Q A;  3LJA A;  3LZ0 D;  4J8U A;  4AWL B;  2JSS A;  5AY8 A;  3REK B;  5CPK D;  1KX5 D;  3KFU G;  1P3M D;  1PZR A;  3X1T A;  2UWX A;  5B31 B;  3EG5 B;  3LZ0 A;  3UTA D;  2NZD B;  2BG1 A;  5CPK A;  4LD9 B;  1KX5 A;  3AFA B;  3LZ1 C;  1N1J B;  3EPJ A;  3AV1 B;  4CAY B;  1BFM A;  4H9S A;  3C1B B;  4X23 D;  1P3M A;  5DNN B;  3B0C T;  3W98 C;  5GXQ D;  3VH6 T;  4NFT A;  3UTA A;  3UT9 B;  2Y2N A;  3VH5 W;  4KUD D;  4X23 A;  2RVQ C;  3X1V D;  5GXQ A;  3X1S C;  3X1T B;  4YS3 D;  3LZ0 B;  4J8X C;  4CSR B;  5CP6 D;  4KUD A;  5CPK B;  1P3I C;  2YFW A;  3X1V A;  5BS7 C;  1AOI D;  5JRG D;  5B2J C;  3C1C C;  4YS3 A;  5CP6 A;  2JE5 A;  3FDD A;  3MGS C;  3X1S B;  5JRG A;  1U35 C;  5GT3 D;  1P3G B;  5B0Z D;  1TZY B;  1AOI A;  5CPJ D;  1S32 C;  3REL C;  4KUD B;  5C3I C;  1P3F C;  1HQ3 D;  2YFW B;  1P3A D;  3AZH C;  5GT3 A;  5B2J B;  3MGQ C;  3C1C B;  1TAF A;  5CPJ A;  5AVB C;  1B67 A;  4UUZ A;  4XZQ B;  3H0M C;  1P34 C;  3TU4 D;  1HQ3 A;  4M6B A;  1P3A A;  1P3O C;  1M1A C;  5JRG B;  2ZY4 A;  3WKJ B;  3W96 C;  5B2I C;  2J8P A;  3KUY D;  5AV8 D;  3TU4 A;  5AVC A;  3B6F D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...