5AV8D

Human nucleosome core particle
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
97
structure length
97
Chain Sequence
RKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 97
sequence length 97
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av8D00
3KWQA 3LZ0B 3AZMC 5AY8A 5B31B 1M18A 5GT0D 3MVDC 3X1UC 5B2IA 4WZSB 3AFAB 1KU5A 3B0DB 3AZKD 1P3MC 4H9RA 3REKD 5C3IB 3RELA 5B1LB 1BH9A 5BT1D 1KX4A 3AZJA 1P3KB 2CV5A 3C1BB 5AV8D 1KX3C 5F99C 5KDMA 3TU4C 4ZUXB 3AYWA 3LZ0A 1EQZC 4Z5TB 3A6ND 3B0BA 3UTAB 5E5AB 4H9QB 5DNNB 3X1UD 4JJNC 5AV5A 5B1LA 4J8VB 1WWSA 3UT9C 2AROC 1P3KA 3AZEB 3C1BA 1P3PB 2NQBA 3W97B 3X1SC 1KX3D 1BFMA 4ZUXA 3TU4D 1HQ3C 5B1MD 4Z5TA 3W96C 3AV2D 3UTAA 5E5AA 5FUGA 2PYOB 3LJAB 5DNNA 4Z2MH 3VH6W 5B24B 1P3AD 4NFTA 4J8VA 3LZ1B 1P3GB 1M19B 3AZEA 1P3PA 3W97A 1P3OA 3MGSC 4KUDB 5BS7A 3X1SD 1M1AB 5CPKC 5AVBB 1P34B 1P3FD 2PYOA 3LJAA 1TZYC 3AYWC 4KHAA 3KWQD 4H9OB 1P3LB 3MGQB 3NQJB 5AY8D 5B24A 1M18D 4HGAC 5B32B 4AWLB 5B2ID 3UTBC 3WA9C 1P3GA 1M19A 1F66B 1JFIA 4X23A 5C3IC 5AV5C 5B1LC 3LELC 1M1AA 3KSYA 4E44A 4KUDA 3RELD 3VH6T 3VH5W 1P3KC 5AVBA 2RVQD 4R8PB 1KX4D 2NQBC 3AZJD 3AZNC 3WTPB 2CV5D 5AV9C 5CPJC 4DRBA 5B0YC 3AZIA 4J8UC 3B6FC 4H9OA 4Z5TC 5B33A 3LZ0D 3AYWD 1P3LA 3NQJA 3REHA 1N1JB 5CP6C 5B32A 4ZBJC 1F66A 5B2JA 4H9SC 3AZHB 4J8WC 3R45A 4XZQB 2HIOA 2IO5B 5B1LD 5AV5D 5GT3B 4YM6B 3C1CB 3AN2A 1ID3B 1H3OB 1P3PC 1P3KD 3WTPA 3C1BD 1P3OC 2NQBD 5GXQB 1ULYA 4ZUXD 5BNVB 3X1TB 4EO5B 4Z5TD 3AZKC 3VH5T 2PYOC 3REKC 1N1JA 3UTAD 5E5AD 3WKJA 5B40B 5DNND 1HTAA 5AV8C 4J8WD 5B0ZB 4YM6A 5GT3A 4J8XC 4J8VD 2JSSA 1P3GC 1M19C 2NZDA 1H3OA 4LD9B 2YFVA 4X23C 3AZED 3X1VB 3A6NC 1P3PD 3REIB 3W97D 1P3OD 4KUDC 5GXQA 3X1TA 3AZFB 5DNMB 3KXBA 5BO0A 3V9RB 3AZIC 2BYMA 2PYOD 5B40A 5GSUB 4WU9B 5B33C 4WU8B 3REHC 5B24D 2LY8A 1U35B 5B0ZA 4YS3B 1P3IB 1R4VA 4J8XD 5B2JC 1P3GD 5B1MC 1M19D 4LD9A 2HUEB 3X1VA 1B6WA 4X23D 3REIA 3AV2C 2HIOC 4KUDD 3AN2C 5B31A 1M1AD 2F8NB 5AVBD 3WTPC 3AFAA 3V9RA 3B0CW 3MGRB 3REJB 4QLCB 1P3AC 3AZID 1ZLAB 3W98B 3AV1B 4G91C 5B33D 4WU8A 1P3LD 3W99B 4XUJB 3REHD 3WKJC 1U35A 4Z2MG 4YS3A 1P3IA 5B32D 1KX5B 1F66D 5B2JD 1TAFB 4Z66B 3MNNB 2HIOD 5GT3C 1P3FC 5G49B 2F8NA 2NZDC 3AN2D 2YFWB 4H9QA 3KWQC 3WTPE 3WTPD 2BYKB 5AY8C 1S32B 1M18C 3REJA 1ZLAA 3AZGB 2FJ7B 3W98A 5AVCB 4EO5C 5B2IC 3KXBC 1P3BB 3W99A 3MGPB 1AOIB 4XUJA 3WKJD 1KX5A 3RELC 4G92B 2RVQC 5GT0B 1KX4C 1TAFA 3AZJC 5JRGB 2CV5C 4KGCB 3WAAB 4YM6D 5GT3D 2YFWA 4LD9C 2NZDD 3LZ0C 5CPIB 2BYKA 1S32A 5B31C 2FJ7A 5GXQD 3AZGA 5AVCA 3AZLB 3O62B 3X1TD 3LZ1A 3AFAC 1P3BA 3B0DC 3MGPA 3KXBD 1AOIA 5B40D 4H9NB 3AZMB 5JRGA 3C1BC 3MVDB 1P34A 1P3IC 5AV6B 4KGCA 3WAAA 1P3MB 4ZUXC 2HUEC 5CPIA 4LD9D 3X1VD 3REID 3MGQA 3UTAC 5E5AC 5B31D 3AZLA 5DNNC 3O62A 1KX3B 5F99B 3AFAD 5JA4B 1EQZB 4J8VC 3AZMA 4R8PA 3AZEC 4WU8D 3MVDA 3W97C 4CSRB 5AV6A 1U35D 5BS7C 3VH6A 4YS3D 1P3ID 1P3MA 4JJNB 3LJAC 3UT9B 2AROB 2F8ND 5F99A 3X1SB 1S32C 3AZHA 5B24C 1HQ3B 4E45A 5AVCC 3REJD 5JA4A 4XZQA 1EQZA 1ZLAD 3W98D 3LZ1C 3C1CA 1ID3A 3W96B 3W99D 4CSRA 4XUJD 1M1AC 5AVBC 5BNVA 4JJNA 1P34C 3WAAC 4H9PB 5B31G 2AROA 3UT9A 4UUZB 3LJAD 4NE5A 3MGSB 1Q9CA 3VH5A 5CHLB 1P3LC 3MGQC 1S32D 1HQ3A 2FJ7D 3AZGD 5CPKB 5AVCD 5B32C 4AWLC 3KUYB 3W96A 3LZ1D 1P3BD 1F66C 3MGPD 4NE3A 1AOID 1TZYB 3AYWB 4R8PC 5JRGD 3AZFA 4NE6A 5DNMA 4HGAB 5AV6C 3UTBB 4H9PA 1P34D 3WA9B 4KGCD 3WAAD 2F8NG 4UUZA 4WU9A 1A7WA 5GSUA 3MGSA 5CPID 3B6GB 5AV5B 3LELB 3MGQD 5CPKA 3AZLD 3O62D 3KUYA 3AZNB 2NQBB 5AV9B 5CPJB 3AZHC 2F8NH 5B0YB 1TZYA 4J8UB 4XZQC 3B6FB 2IO5C 4YM6C 3C1CC 1ID3C 3AZMD 2CWEA 5FUGB 4M6BA 4R8PD 5CP6B 3MVDD 3UTBA 4ZBJB 5GXQC 5AV6D 3WA9A 3MGRA 1P3MD 4QLCA 4J8WB 3AV1A 3X1TC 3B6GA 3LELA 5B40C 3AZNA 1P3OB 5AV9A 3B0CT 5CPJA 5F99D 5B0YA 3AZHD 4J8UA 4Z66A 3B6FA 1EQZD 4XZQD 5B0ZC 3MNNA 3AZKB 5G49A 3C1CD 1ID3D 3REKB 5CP6A 3X1VC 3REIC 4KHAB 4H9SA 4J8WA 5AV8B 3AZFC 4JJND 5DNMC 4J8XB 1JFIB 4WU9C 5GSUC 3UT9D 2AROD 4X23B 3A6NB 5B32G 4WU8C 5GT0A 1HQ3D 1U35C 3X1UB 3KUYC 4YS3C 3AZKA 5B0ZD 3W96D 3REKA 3AZIB 5BNXB 5B33B 5AV8A 3REHB 3AZFD 4J8XA 5DNMD 3NQUB 3TU4B 3MGRC 5B2JB 4QLCC 3REJC 5B1MB 1ZLAC 3W98C 3AV1C 4WU9D 5GSUD 3R45B 3A6NA 3B6GC 4H9NA 3AV2B 2HIOB 3MGSD 3W99C 3AN2B 4XUJC 5CPKD 3X1UA 1KX5C 3KUYD 1P3AB 4Z66C 1TZYD 5BNXA 3MNNC 1BH8B 4G91B 4DRAA 3WKJB 1KX3A 4CAYB 3NQUA 3UTBD 3TU4A 2FJ7C 3AZGC 5B1MA 3WA9D 2F8NK 3MGRD 4QLCD 3AV1D 3AV2A 3B6GD 1P3BC 4WNNB 3LELD 3MGPC 1P3FB 2NZDB 1AOIC 4WV4B 2YFVB 3KWQB 3AZND 4G92C 1KX5D 5AV9D 5AY8B 5CPJD 5GT0C 1P3AA 1B67A 5B0YD 5JRGC 1M18B 4J8UD 4Z66D 1F1EA 2L5AA 5B2IB 3B6FD 1BH8A 3KXBB 4KGCC 5BO0B 3MNND 2BYMB 4H9RB 5CPIC 4CAYA 3X1SA 5CP6D 3RELB 5BT1C 1WWIA 1BH9B 1KX4B 3AZLC 3O62C 3AZJB 2CV5B 4WNNA 1P3FA 5KDMB
chains in the Genus database with same CATH superfamily
3KWQA 2G5HC 3LZ0B 3AZMC 2Y2GA 5AY8A 5B31B 1M18A 5GT0D 3MVDC 3X1UC 5B2IA 4WZSB 3AFAB 1KU5A 3B0DB 3AZKD 1P3MC 4H9RA 3REKD 5C3IB 3RELA 5B1LB 1BH9A 5BT1D 1KX4A 3AZJA 1P3KB 2CV5A 3C1BB 5AV8D 1KX3C 5F99C 5KDMA 3TU4C 2Y2IA 4ZUXB 3AYWA 2Y2MA 3LZ0A 1EQZC 2Y2QA 4Z5TB 3A6ND 3B0BA 3UTAB 5E5AB 4H9QB 5DNNB 3X1UD 4JJNC 5AV5A 5B1LA 4J8VB 1WWSA 3UT9C 2AROC 1P3KA 3AZEB 3C1BA 1P3PB 2NQBA 3W97B 3X1SC 1KX3D 1BFMA 4ZUXA 3TU4D 1HQ3C 5B1MD 4Z5TA 3W96C 3AV2D 3UTAA 5E5AA 5FUGA 2PYOB 3LJAB 5DNNA 2FFFB 4Z2MH 3VH6W 5B24B 1P3AD 4NFTA 4J8VA 3LZ1B 1P3GB 1M19B 3AZEA 1P3PA 3W97A 1P3OA 3MGSC 2Y2LA 5BS7A 3X1SD 1M1AB 4KUDB 5CPKC 5AVBB 3EG5B 1P34B 1P3FD 2PYOA 3LJAA 1TZYC 3AYWC 3EPHA 4KHAA 3KWQD 4H9OB 1P3LB 3MGQB 3NQJB 5AY8D 5B24A 1M18D 4HGAC 5B32B 4AWLB 5B2ID 3UTBC 2UWXA 1P3GA 1M19A 1F66B 1JFIA 3WA9C 4X23A 5C3IC 5AV5C 5B1LC 3H0LC 3LELC 3KSYA 4E44A 1M1AA 3RELD 4KUDA 3VH6T 3VH5W 1P3KC 5AVBA 2RVQD 4R8PB 1KX4D 2NQBC 3AZJD 3AZNC 3WTPB 2CV5D 5AV9C 5CPJC 4DRBA 5B0YC 3AZIA 4J8UC 3B6FC 4H9OA 4Z5TC 5B33A 3LZ0D 3AYWD 1P3LA 3NQJA 3REHA 1N1JB 5CP6C 5B32A 1PZRA 4ZBJC 1F66A 5B2JA 4H9SC 3AZHB 4J8WC 3R45A 4XZQB 2HIOA 2IO5B 5B1LD 5AV5D 5GT3B 4YM6B 3C1CB 3AN2A 1ID3B 3F6TA 1H3OB 2JCHA 1P3KD 4DQYB 1P3PC 3WTPA 3C1BD 1P3OC 2NQBD 5GXQB 1ULYA 4ZUXD 2Y2OA 5BNVB 3X1TB 4EO5B 4Z5TD 3AZKC 3VH5T 2PYOC 3REKC 1N1JA 3UTAD 5E5AD 3WKJA 5B40B 5DNND 2ZY4A 3IP4C 1HTAA 5AV8C 4J8WD 3P5JB 5B0ZB 5GT3A 4YM6A 4J8XC 2JSSA 4J8VD 1P3GC 1M19C 2NZDA 1H3OA 4LD9B 2YFVA 4X23C 3AZED 3X1VB 3A6NC 1P3PD 3REIB 3W97D 1P3OD 4KUDC 5GXQA 2VQRA 3X1TA 3AZFB 5DNMB 3KXBA 3KFUG 5BO0A 3V9RB 3AZIC 2BYMA 2PYOD 5B40A 5GSUB 4WU9B 5B33C 3EPKA 4WU8B 3REHC 5B24D 2LY8A 1U35B 5B0ZA 4YS3B 1P3IB 1R4VA 4J8XD 5B2JC 1P3GD 5B1MC 1M19D 4LD9A 2HUEB 3X1VA 1B6WA 4X23D 3REIA 3AV2C 2HIOC 4KUDD 3AN2C 5B31A 1M1AD 2F8NB 5AVBD 3WTPC 3AFAA 3V9RA 3B0CW 3MGRB 3REJB 4QLCB 1P3AC 3AZID 1ZLAB 3W98B 3AV1B 3EPJA 4G91C 5B33D 4WU8A 1P3LD 3W99B 4XUJB 3REHD 3WKJC 1U35A 4Z2MG 4YS3A 1P3IA 5B32D 1KX5B 1F66D 5B2JD 1TAFB 4Z66B 3MNNB 2HIOD 5GT3C 1P3FC 5G49B 2F8NA 2NZDC 3AN2D 2YFWB 4H9QA 3KWQC 3WTPE 3WTPD 2BYKB 5AY8C 1S32B 1M18C 3REJA 1ZLAA 3AZGB 2FJ7B 3W98A 3H0RC 5AVCB 4EO5C 5B2IC 3KXBC 1P3BB 3W99A 3MGPB 1AOIB 4XUJA 3WKJD 1KX5A 3RELC 4G92B 2ZY5A 2RVQC 2Y2PA 5GT0B 1KX4C 1TAFA 2DF4C 5JRGB 3AZJC 2CV5C 3EPLA 4KGCB 3WAAB 4YM6D 5GT3D 2YFWA 4LD9C 2NZDD 3LZ0C 5CPIB 2DQNC 2BYKA 1S32A 5B31C 2FJ7A 5GXQD 4UPKA 3AZGA 5AVCA 3AZLB 3O62B 3X1TD 3LZ1A 3AFAC 1P3BA 3B0DC 3MGPA 3KXBD 1AOIA 3FDDA 5B40D 4H9NB 3AZMB 5JRGA 3C1BC 3MVDB 1P34A 1P3IC 5AV6B 4KGCA 3WAAA 1P3MB 4ZUXC 2HUEC 5CPIA 4LD9D 3X1VD 3REID 1T3UA 3MGQA 3UTAC 5E5AC 5B31D 3AZLA 5DNNC 3O62A 3H0MC 2RIQA 1KX3B 5F99B 3AFAD 3A1IA 5JA4B 1EQZB 4J8VC 3AZMA 4R8PA 3AZEC 4WU8D 1W2EA 3MVDA 3W97C 4CSRB 5AV6A 1U35D 5BS7C 3VH6A 4YS3D 1P3ID 1P3MA 4JJNB 3LJAC 3UT9B 2AROB 2F8ND 5F99A 3X1SB 1S32C 3AZHA 5B24C 1HQ3B 4E45A 5AVCC 3REJD 5JA4A 4XZQA 1EQZA 1ZLAD 3W98D 3LZ1C 3C1CA 1ID3A 3W96B 4WJ3C 3W99D 1Z2CB 4CSRA 4XUJD 2F2AC 3AL0C 1M1AC 5AVBC 2J8PA 5BNVA 4JJNA 1P34C 3WAAC 4H9PB 5B31G 2AROA 3UT9A 4UUZB 3LJAD 4NE5A 3MGSB 1Q9CA 3VH5A 5CHLB 1P3LC 3MGQC 1S32D 1HQ3A 2FJ7D 3AZGD 5CPKB 5AVCD 5B32C 4AWLC 3KUYB 3W96A 3LZ1D 1P3BD 1F66C 3MGPD 4NE3A 1AOID 1TZYB 3AYWB 4R8PC 2Y2KA 5JRGD 3AZFA 4NE6A 5DNMA 5AV6C 4HGAB 3UTBB 4H9PA 1P34D 3WA9B 4KGCD 3WAAD 2F8NG 4UUZA 2Y2NA 1A7WA 5GSUA 4WU9A 3MGSA 5CPID 3B6GB 5AV5B 3LELB 3MGQD 5CPKA 3AZLD 3O62D 3KUYA 3AZNB 2NQBB 5AV9B 5CPJB 3AZHC 2F8NH 5B0YB 1TZYA 4J8UB 4XZQC 3B6FB 2IO5C 4YM6C 3C1CC 1ID3C 3AZMD 2CWEA 5FUGB 4M6BA 4R8PD 5CP6B 3MVDD 3UTBA 2Y2HA 4ZBJB 5GXQC 5AV6D 3WA9A 3MGRA 1P3MD 4QLCA 4J8WB 3AV1A 3X1TC 2Y2JA 3B6GA 3LELA 5B40C 3AZNA 1P3OB 5AV9A 3B0CT 2G5IC 2XD5A 5CPJA 5F99D 5B0YA 3AZHD 4J8UA 4Z66A 3B6FA 2BG1A 1EQZD 4XZQD 5B0ZC 3MNNA 3AZKB 5G49A 3C1CD 1ID3D 3REKB 5CP6A 3X1VC 3REIC 4KHAB 4H9SA 4J8WA 5AV8B 3AZFC 4JJND 5DNMC 4J8XB 1JFIB 4WU9C 5GSUC 3UT9D 2AROD 4X23B 3A6NB 5B32G 4WU8C 5GT0A 1HQ3D 3A1KA 1U35C 3X1UB 3KUYC 4YS3C 3AZKA 5B0ZD 3W96D 3REKA 3AZIB 5BNXB 5B33B 5AV8A 3REHB 2ZY2A 3AZFD 4J8XA 5DNMD 3NQUB 3TU4B 3MGRC 5B2JB 4QLCC 3REJC 5B1MB 1ZLAC 3W98C 3AV1C 4WU9D 5GSUD 3R45B 3A6NA 3B6GC 4H9NA 3AV2B 2HIOB 3MGSD 3W99C 3AN2B 4XUJC 5CPKD 2XD1A 3X1UA 1KX5C 3KUYD 1P3AB 4Z66C 1TZYD 5BNXA 3MNNC 1BH8B 4G91B 4DRAA 3WKJB 1KX3A 4CAYB 3NQUA 3UTBD 3TU4A 2FJ7C 3AZGC 5B1MA 3WA9D 2F8NK 3MGRD 4QLCD 3AV1D 3AV2A 3B6GD 1P3BC 4WNNB 3LELD 3MGPC 1P3FB 2NZDB 1AOIC 4WV4B 2YFVB 3KWQB 3AZND 4G92C 1KX5D 5AV9D 5AY8B 5CPJD 5GT0C 1P3AA 1B67A 5B0YD 5JRGC 2ZM5A 1M18B 4J8UD 4Z66D 1F1EA 2L5AA 5B2IB 3B6FD 1BH8A 3KXBB 4KGCC 2W8SA 5BO0B 3MNND 2ZY3A 2BYMB 2JE5A 4H9RB 5CPIC 4CAYA 3X1SA 5CP6D 3RELB 5BT1C 1WWIA 1BH9B 1KX4B 3AZLC 3O62C 3AZJB 2CV5B 4WNNA 1P3FA 5KDMB
chains in the Genus database with same CATH topology
3KWQA 2G5HC 3LZ0B 3AZMC 2Y2GA 5AY8A 5B31B 1M18A 5GT0D 3MVDC 3X1UC 5B2IA 4WZSB 3AFAB 1KU5A 3B0DB 3AZKD 1P3MC 4H9RA 3REKD 5C3IB 3RELA 5B1LB 1BH9A 5BT1D 1KX4A 3AZJA 1P3KB 2CV5A 3C1BB 5AV8D 1KX3C 5F99C 5KDMA 3TU4C 2Y2IA 4ZUXB 3AYWA 2Y2MA 3LZ0A 1EQZC 2Y2QA 4Z5TB 3A6ND 3B0BA 3UTAB 5E5AB 4H9QB 5DNNB 3X1UD 4JJNC 5AV5A 5B1LA 4J8VB 1WWSA 3UT9C 2AROC 1P3KA 3AZEB 3C1BA 1P3PB 2NQBA 3W97B 3X1SC 1KX3D 1BFMA 4ZUXA 3TU4D 1HQ3C 5B1MD 4Z5TA 3W96C 3AV2D 3UTAA 5E5AA 5FUGA 2PYOB 3LJAB 5DNNA 2FFFB 4Z2MH 3VH6W 5B24B 1P3AD 4NFTA 4J8VA 3LZ1B 1P3GB 1M19B 3AZEA 1P3PA 3W97A 1P3OA 3MGSC 2Y2LA 5BS7A 3X1SD 1M1AB 4KUDB 5CPKC 5AVBB 3EG5B 1P34B 1P3FD 2PYOA 3LJAA 1TZYC 3AYWC 3EPHA 4KHAA 3KWQD 4H9OB 1P3LB 3MGQB 3NQJB 5AY8D 5B24A 1M18D 4HGAC 5B32B 4AWLB 5B2ID 3UTBC 2UWXA 1P3GA 1M19A 1F66B 1JFIA 3WA9C 4X23A 5C3IC 5AV5C 5B1LC 3H0LC 3LELC 3KSYA 4E44A 1M1AA 3RELD 4KUDA 3VH6T 3VH5W 1P3KC 5AVBA 2RVQD 4R8PB 1KX4D 2NQBC 3AZJD 3AZNC 3WTPB 2CV5D 5AV9C 5CPJC 4DRBA 5B0YC 3AZIA 4J8UC 3B6FC 4H9OA 4Z5TC 5B33A 3LZ0D 3AYWD 1P3LA 3NQJA 3REHA 1N1JB 5CP6C 5B32A 1PZRA 4ZBJC 1F66A 5B2JA 4H9SC 3AZHB 4J8WC 3R45A 4XZQB 2HIOA 2IO5B 5B1LD 5AV5D 5GT3B 4YM6B 3C1CB 3AN2A 1ID3B 3F6TA 1H3OB 2JCHA 1P3KD 4DQYB 1P3PC 3WTPA 3C1BD 1P3OC 2NQBD 5GXQB 1ULYA 4ZUXD 2Y2OA 5BNVB 3X1TB 4EO5B 4Z5TD 3AZKC 3VH5T 2PYOC 3REKC 1N1JA 3UTAD 5E5AD 3WKJA 5B40B 5DNND 2ZY4A 3IP4C 1HTAA 5AV8C 4J8WD 3P5JB 5B0ZB 5GT3A 4YM6A 4J8XC 2JSSA 4J8VD 1P3GC 1M19C 2NZDA 1H3OA 4LD9B 2YFVA 4X23C 3AZED 3X1VB 3A6NC 1P3PD 3REIB 3W97D 1P3OD 4KUDC 5GXQA 2VQRA 3X1TA 3AZFB 5DNMB 3KXBA 3KFUG 5BO0A 3V9RB 3AZIC 2BYMA 2PYOD 5B40A 5GSUB 4WU9B 5B33C 3EPKA 4WU8B 3REHC 5B24D 2LY8A 1U35B 5B0ZA 4YS3B 1P3IB 1R4VA 4J8XD 5B2JC 1P3GD 5B1MC 1M19D 4LD9A 2HUEB 3X1VA 1B6WA 4X23D 3REIA 3AV2C 2HIOC 4KUDD 3AN2C 5B31A 1M1AD 2F8NB 5AVBD 3WTPC 3AFAA 3V9RA 3B0CW 3MGRB 3REJB 4QLCB 1P3AC 3AZID 1ZLAB 3W98B 3AV1B 3EPJA 4G91C 5B33D 4WU8A 1P3LD 3W99B 4XUJB 3REHD 3WKJC 1U35A 4Z2MG 4YS3A 1P3IA 5B32D 1KX5B 1F66D 5B2JD 1TAFB 4Z66B 3MNNB 2HIOD 5GT3C 1P3FC 5G49B 2F8NA 2NZDC 3AN2D 2YFWB 4H9QA 3KWQC 3WTPE 3WTPD 2BYKB 5AY8C 1S32B 1M18C 3REJA 1ZLAA 3AZGB 2FJ7B 3W98A 3H0RC 5AVCB 4EO5C 5B2IC 3KXBC 1P3BB 3W99A 3MGPB 1AOIB 4XUJA 3WKJD 1KX5A 3RELC 4G92B 2ZY5A 2RVQC 2Y2PA 5GT0B 1KX4C 1TAFA 2DF4C 5JRGB 3AZJC 2CV5C 3EPLA 4KGCB 3WAAB 4YM6D 5GT3D 2YFWA 4LD9C 2NZDD 3LZ0C 5CPIB 2DQNC 2BYKA 1S32A 5B31C 2FJ7A 5GXQD 4UPKA 3AZGA 5AVCA 3AZLB 3O62B 3X1TD 3LZ1A 3AFAC 1P3BA 3B0DC 3MGPA 3KXBD 1AOIA 3FDDA 5B40D 4H9NB 3AZMB 5JRGA 3C1BC 3MVDB 1P34A 1P3IC 5AV6B 4KGCA 3WAAA 1P3MB 4ZUXC 2HUEC 5CPIA 4LD9D 3X1VD 3REID 1T3UA 3MGQA 3UTAC 5E5AC 5B31D 3AZLA 5DNNC 3O62A 3H0MC 2RIQA 1KX3B 5F99B 3AFAD 3A1IA 5JA4B 1EQZB 4J8VC 3AZMA 4R8PA 3AZEC 4WU8D 1W2EA 3MVDA 3W97C 4CSRB 5AV6A 1U35D 5BS7C 3VH6A 4YS3D 1P3ID 1P3MA 4JJNB 3LJAC 3UT9B 2AROB 2F8ND 5F99A 3X1SB 1S32C 3AZHA 5B24C 1HQ3B 4E45A 5AVCC 3REJD 5JA4A 4XZQA 1EQZA 1ZLAD 3W98D 3LZ1C 3C1CA 1ID3A 3W96B 4WJ3C 3W99D 1Z2CB 4CSRA 4XUJD 2F2AC 3AL0C 1M1AC 5AVBC 2J8PA 5BNVA 4JJNA 1P34C 3WAAC 4H9PB 5B31G 2AROA 3UT9A 4UUZB 3LJAD 4NE5A 3MGSB 1Q9CA 3VH5A 5CHLB 1P3LC 3MGQC 1S32D 1HQ3A 2FJ7D 3AZGD 5CPKB 5AVCD 5B32C 4AWLC 3KUYB 3W96A 3LZ1D 1P3BD 1F66C 3MGPD 4NE3A 1AOID 1TZYB 3AYWB 4R8PC 2Y2KA 5JRGD 3AZFA 4NE6A 5DNMA 5AV6C 4HGAB 3UTBB 4H9PA 1P34D 3WA9B 4KGCD 3WAAD 2F8NG 4UUZA 2Y2NA 1A7WA 5GSUA 4WU9A 3MGSA 5CPID 3B6GB 5AV5B 3LELB 3MGQD 5CPKA 3AZLD 3O62D 3KUYA 3AZNB 2NQBB 5AV9B 5CPJB 3AZHC 2F8NH 5B0YB 1TZYA 4J8UB 4XZQC 3B6FB 2IO5C 4YM6C 3C1CC 1ID3C 3AZMD 2CWEA 5FUGB 4M6BA 4R8PD 5CP6B 3MVDD 3UTBA 2Y2HA 4ZBJB 5GXQC 5AV6D 3WA9A 3MGRA 1P3MD 4QLCA 4J8WB 3AV1A 3X1TC 2Y2JA 3B6GA 3LELA 5B40C 3AZNA 1P3OB 5AV9A 3B0CT 2G5IC 2XD5A 5CPJA 5F99D 5B0YA 3AZHD 4J8UA 4Z66A 3B6FA 2BG1A 1EQZD 4XZQD 5B0ZC 3MNNA 3AZKB 5G49A 3C1CD 1ID3D 3REKB 5CP6A 3X1VC 3REIC 4KHAB 4H9SA 4J8WA 5AV8B 3AZFC 4JJND 5DNMC 4J8XB 1JFIB 4WU9C 5GSUC 3UT9D 2AROD 4X23B 3A6NB 5B32G 4WU8C 5GT0A 1HQ3D 3A1KA 1U35C 3X1UB 3KUYC 4YS3C 3AZKA 5B0ZD 3W96D 3REKA 3AZIB 5BNXB 5B33B 5AV8A 3REHB 2ZY2A 3AZFD 4J8XA 5DNMD 3NQUB 3TU4B 3MGRC 5B2JB 4QLCC 3REJC 5B1MB 1ZLAC 3W98C 3AV1C 4WU9D 5GSUD 3R45B 3A6NA 3B6GC 4H9NA 3AV2B 2HIOB 3MGSD 3W99C 3AN2B 4XUJC 5CPKD 2XD1A 3X1UA 1KX5C 3KUYD 1P3AB 4Z66C 1TZYD 5BNXA 3MNNC 1BH8B 4G91B 4DRAA 3WKJB 1KX3A 4CAYB 3NQUA 3UTBD 3TU4A 2FJ7C 3AZGC 5B1MA 3WA9D 2F8NK 3MGRD 4QLCD 3AV1D 3AV2A 3B6GD 1P3BC 4WNNB 3LELD 3MGPC 1P3FB 2NZDB 1AOIC 4WV4B 2YFVB 3KWQB 3AZND 4G92C 1KX5D 5AV9D 5AY8B 5CPJD 5GT0C 1P3AA 1B67A 5B0YD 5JRGC 2ZM5A 1M18B 4J8UD 4Z66D 1F1EA 2L5AA 5B2IB 3B6FD 1BH8A 3KXBB 4KGCC 2W8SA 5BO0B 3MNND 2ZY3A 2BYMB 2JE5A 4H9RB 5CPIC 4CAYA 3X1SA 5CP6D 3RELB 5BT1C 1WWIA 1BH9B 1KX4B 3AZLC 3O62C 3AZJB 2CV5B 4WNNA 1P3FA 5KDMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWQ A;  3LZ0 B;  3AZM C;  5AY8 A;  5B31 B;  1M18 A;  5GT0 D;  3MVD C;  3X1U C;  5B2I A;  4WZS B;  3AFA B;  1KU5 A;  3B0D B;  3AZK D;  1P3M C;  4H9R A;  3REK D;  5C3I B;  3REL A;  5B1L B;  1BH9 A;  5BT1 D;  1KX4 A;  3AZJ A;  1P3K B;  2CV5 A;  3C1B B;  5AV8 D;  1KX3 C;  5F99 C;  5KDM A;  3TU4 C;  4ZUX B;  3AYW A;  3LZ0 A;  1EQZ C;  4Z5T B;  3A6N D;  3B0B A;  3UTA B;  5E5A B;  4H9Q B;  5DNN B;  3X1U D;  4JJN C;  5AV5 A;  5B1L A;  4J8V B;  1WWS A;  3UT9 C;  2ARO C;  1P3K A;  3AZE B;  3C1B A;  1P3P B;  2NQB A;  3W97 B;  3X1S C;  1KX3 D;  1BFM A;  4ZUX A;  3TU4 D;  1HQ3 C;  5B1M D;  4Z5T A;  3W96 C;  3AV2 D;  3UTA A;  5E5A A;  5FUG A;  2PYO B;  3LJA B;  5DNN A;  4Z2M H;  3VH6 W;  5B24 B;  1P3A D;  4NFT A;  4J8V A;  3LZ1 B;  1P3G B;  1M19 B;  3AZE A;  1P3P A;  3W97 A;  1P3O A;  3MGS C;  4KUD B;  5BS7 A;  3X1S D;  1M1A B;  5CPK C;  5AVB B;  1P34 B;  1P3F D;  2PYO A;  3LJA A;  1TZY C;  3AYW C;  4KHA A;  3KWQ D;  4H9O B;  1P3L B;  3MGQ B;  3NQJ B;  5AY8 D;  5B24 A;  1M18 D;  4HGA C;  5B32 B;  4AWL B;  5B2I D;  3UTB C;  3WA9 C;  1P3G A;  1M19 A;  1F66 B;  1JFI A;  4X23 A;  5C3I C;  5AV5 C;  5B1L C;  3LEL C;  1M1A A;  3KSY A;  4E44 A;  4KUD A;  3REL D;  3VH6 T;  3VH5 W;  1P3K C;  5AVB A;  2RVQ D;  4R8P B;  1KX4 D;  2NQB C;  3AZJ D;  3AZN C;  3WTP B;  2CV5 D;  5AV9 C;  5CPJ C;  4DRB A;  5B0Y C;  3AZI A;  4J8U C;  3B6F C;  4H9O A;  4Z5T C;  5B33 A;  3LZ0 D;  3AYW D;  1P3L A;  3NQJ A;  3REH A;  1N1J B;  5CP6 C;  5B32 A;  4ZBJ C;  1F66 A;  5B2J A;  4H9S C;  3AZH B;  4J8W C;  3R45 A;  4XZQ B;  2HIO A;  2IO5 B;  5B1L D;  5AV5 D;  5GT3 B;  4YM6 B;  3C1C B;  3AN2 A;  1ID3 B;  1H3O B;  1P3P C;  1P3K D;  3WTP A;  3C1B D;  1P3O C;  2NQB D;  5GXQ B;  1ULY A;  4ZUX D;  5BNV B;  3X1T B;  4EO5 B;  4Z5T D;  3AZK C;  3VH5 T;  2PYO C;  3REK C;  1N1J A;  3UTA D;  5E5A D;  3WKJ A;  5B40 B;  5DNN D;  1HTA A;  5AV8 C;  4J8W D;  5B0Z B;  4YM6 A;  5GT3 A;  4J8X C;  4J8V D;  2JSS A;  1P3G C;  1M19 C;  2NZD A;  1H3O A;  4LD9 B;  2YFV A;  4X23 C;  3AZE D;  3X1V B;  3A6N C;  1P3P D;  3REI B;  3W97 D;  1P3O D;  4KUD C;  5GXQ A;  3X1T A;  3AZF B;  5DNM B;  3KXB A;  5BO0 A;  3V9R B;  3AZI C;  2BYM A;  2PYO D;  5B40 A;  5GSU B;  4WU9 B;  5B33 C;  4WU8 B;  3REH C;  5B24 D;  2LY8 A;  1U35 B;  5B0Z A;  4YS3 B;  1P3I B;  1R4V A;  4J8X D;  5B2J C;  1P3G D;  5B1M C;  1M19 D;  4LD9 A;  2HUE B;  3X1V A;  1B6W A;  4X23 D;  3REI A;  3AV2 C;  2HIO C;  4KUD D;  3AN2 C;  5B31 A;  1M1A D;  2F8N B;  5AVB D;  3WTP C;  3AFA A;  3V9R A;  3B0C W;  3MGR B;  3REJ B;  4QLC B;  1P3A C;  3AZI D;  1ZLA B;  3W98 B;  3AV1 B;  4G91 C;  5B33 D;  4WU8 A;  1P3L D;  3W99 B;  4XUJ B;  3REH D;  3WKJ C;  1U35 A;  4Z2M G;  4YS3 A;  1P3I A;  5B32 D;  1KX5 B;  1F66 D;  5B2J D;  1TAF B;  4Z66 B;  3MNN B;  2HIO D;  5GT3 C;  1P3F C;  5G49 B;  2F8N A;  2NZD C;  3AN2 D;  2YFW B;  4H9Q A;  3KWQ C;  3WTP E;  3WTP D;  2BYK B;  5AY8 C;  1S32 B;  1M18 C;  3REJ A;  1ZLA A;  3AZG B;  2FJ7 B;  3W98 A;  5AVC B;  4EO5 C;  5B2I C;  3KXB C;  1P3B B;  3W99 A;  3MGP B;  1AOI B;  4XUJ A;  3WKJ D;  1KX5 A;  3REL C;  4G92 B;  2RVQ C;  5GT0 B;  1KX4 C;  1TAF A;  3AZJ C;  5JRG B;  2CV5 C;  4KGC B;  3WAA B;  4YM6 D;  5GT3 D;  2YFW A;  4LD9 C;  2NZD D;  3LZ0 C;  5CPI B;  2BYK A;  1S32 A;  5B31 C;  2FJ7 A;  5GXQ D;  3AZG A;  5AVC A;  3AZL B;  3O62 B;  3X1T D;  3LZ1 A;  3AFA C;  1P3B A;  3B0D C;  3MGP A;  3KXB D;  1AOI A;  5B40 D;  4H9N B;  3AZM B;  5JRG A;  3C1B C;  3MVD B;  1P34 A;  1P3I C;  5AV6 B;  4KGC A;  3WAA A;  1P3M B;  4ZUX C;  2HUE C;  5CPI A;  4LD9 D;  3X1V D;  3REI D;  3MGQ A;  3UTA C;  5E5A C;  5B31 D;  3AZL A;  5DNN C;  3O62 A;  1KX3 B;  5F99 B;  3AFA D;  5JA4 B;  1EQZ B;  4J8V C;  3AZM A;  4R8P A;  3AZE C;  4WU8 D;  3MVD A;  3W97 C;  4CSR B;  5AV6 A;  1U35 D;  5BS7 C;  3VH6 A;  4YS3 D;  1P3I D;  1P3M A;  4JJN B;  3LJA C;  3UT9 B;  2ARO B;  2F8N D;  5F99 A;  3X1S B;  1S32 C;  3AZH A;  5B24 C;  1HQ3 B;  4E45 A;  5AVC C;  3REJ D;  5JA4 A;  4XZQ A;  1EQZ A;  1ZLA D;  3W98 D;  3LZ1 C;  3C1C A;  1ID3 A;  3W96 B;  3W99 D;  4CSR A;  4XUJ D;  1M1A C;  5AVB C;  5BNV A;  4JJN A;  1P34 C;  3WAA C;  4H9P B;  5B31 G;  2ARO A;  3UT9 A;  4UUZ B;  3LJA D;  4NE5 A;  3MGS B;  1Q9C A;  3VH5 A;  5CHL B;  1P3L C;  3MGQ C;  1S32 D;  1HQ3 A;  2FJ7 D;  3AZG D;  5CPK B;  5AVC D;  5B32 C;  4AWL C;  3KUY B;  3W96 A;  3LZ1 D;  1P3B D;  1F66 C;  3MGP D;  4NE3 A;  1AOI D;  1TZY B;  3AYW B;  4R8P C;  5JRG D;  3AZF A;  4NE6 A;  5DNM A;  4HGA B;  5AV6 C;  3UTB B;  4H9P A;  1P34 D;  3WA9 B;  4KGC D;  3WAA D;  2F8N G;  4UUZ A;  4WU9 A;  1A7W A;  5GSU A;  3MGS A;  5CPI D;  3B6G B;  5AV5 B;  3LEL B;  3MGQ D;  5CPK A;  3AZL D;  3O62 D;  3KUY A;  3AZN B;  2NQB B;  5AV9 B;  5CPJ B;  3AZH C;  2F8N H;  5B0Y B;  1TZY A;  4J8U B;  4XZQ C;  3B6F B;  2IO5 C;  4YM6 C;  3C1C C;  1ID3 C;  3AZM D;  2CWE A;  5FUG B;  4M6B A;  4R8P D;  5CP6 B;  3MVD D;  3UTB A;  4ZBJ B;  5GXQ C;  5AV6 D;  3WA9 A;  3MGR A;  1P3M D;  4QLC A;  4J8W B;  3AV1 A;  3X1T C;  3B6G A;  3LEL A;  5B40 C;  3AZN A;  1P3O B;  5AV9 A;  3B0C T;  5CPJ A;  5F99 D;  5B0Y A;  3AZH D;  4J8U A;  4Z66 A;  3B6F A;  1EQZ D;  4XZQ D;  5B0Z C;  3MNN A;  3AZK B;  5G49 A;  3C1C D;  1ID3 D;  3REK B;  5CP6 A;  3X1V C;  3REI C;  4KHA B;  4H9S A;  4J8W A;  5AV8 B;  3AZF C;  4JJN D;  5DNM C;  4J8X B;  1JFI B;  4WU9 C;  5GSU C;  3UT9 D;  2ARO D;  4X23 B;  3A6N B;  5B32 G;  4WU8 C;  5GT0 A;  1HQ3 D;  1U35 C;  3X1U B;  3KUY C;  4YS3 C;  3AZK A;  5B0Z D;  3W96 D;  3REK A;  3AZI B;  5BNX B;  5B33 B;  5AV8 A;  3REH B;  3AZF D;  4J8X A;  5DNM D;  3NQU B;  3TU4 B;  3MGR C;  5B2J B;  4QLC C;  3REJ C;  5B1M B;  1ZLA C;  3W98 C;  3AV1 C;  4WU9 D;  5GSU D;  3R45 B;  3A6N A;  3B6G C;  4H9N A;  3AV2 B;  2HIO B;  3MGS D;  3W99 C;  3AN2 B;  4XUJ C;  5CPK D;  3X1U A;  1KX5 C;  3KUY D;  1P3A B;  4Z66 C;  1TZY D;  5BNX A;  3MNN C;  1BH8 B;  4G91 B;  4DRA A;  3WKJ B;  1KX3 A;  4CAY B;  3NQU A;  3UTB D;  3TU4 A;  2FJ7 C;  3AZG C;  5B1M A;  3WA9 D;  2F8N K;  3MGR D;  4QLC D;  3AV1 D;  3AV2 A;  3B6G D;  1P3B C;  4WNN B;  3LEL D;  3MGP C;  1P3F B;  2NZD B;  1AOI C;  4WV4 B;  2YFV B;  3KWQ B;  3AZN D;  4G92 C;  1KX5 D;  5AV9 D;  5AY8 B;  5CPJ D;  5GT0 C;  1P3A A;  1B67 A;  5B0Y D;  5JRG C;  1M18 B;  4J8U D;  4Z66 D;  1F1E A;  2L5A A;  5B2I B;  3B6F D;  1BH8 A;  3KXB B;  4KGC C;  5BO0 B;  3MNN D;  2BYM B;  4H9R B;  5CPI C;  4CAY A;  3X1S A;  5CP6 D;  3REL B;  5BT1 C;  1WWI A;  1BH9 B;  1KX4 B;  3AZL C;  3O62 C;  3AZJ B;  2CV5 B;  4WNN A;  1P3F A;  5KDM B; 
#chains in the Genus database with same CATH topology
 3KWQ A;  2G5H C;  3LZ0 B;  3AZM C;  2Y2G A;  5AY8 A;  5B31 B;  1M18 A;  5GT0 D;  3MVD C;  3X1U C;  5B2I A;  4WZS B;  3AFA B;  1KU5 A;  3B0D B;  3AZK D;  1P3M C;  4H9R A;  3REK D;  5C3I B;  3REL A;  5B1L B;  1BH9 A;  5BT1 D;  1KX4 A;  3AZJ A;  1P3K B;  2CV5 A;  3C1B B;  5AV8 D;  1KX3 C;  5F99 C;  5KDM A;  3TU4 C;  2Y2I A;  4ZUX B;  3AYW A;  2Y2M A;  3LZ0 A;  1EQZ C;  2Y2Q A;  4Z5T B;  3A6N D;  3B0B A;  3UTA B;  5E5A B;  4H9Q B;  5DNN B;  3X1U D;  4JJN C;  5AV5 A;  5B1L A;  4J8V B;  1WWS A;  3UT9 C;  2ARO C;  1P3K A;  3AZE B;  3C1B A;  1P3P B;  2NQB A;  3W97 B;  3X1S C;  1KX3 D;  1BFM A;  4ZUX A;  3TU4 D;  1HQ3 C;  5B1M D;  4Z5T A;  3W96 C;  3AV2 D;  3UTA A;  5E5A A;  5FUG A;  2PYO B;  3LJA B;  5DNN A;  2FFF B;  4Z2M H;  3VH6 W;  5B24 B;  1P3A D;  4NFT A;  4J8V A;  3LZ1 B;  1P3G B;  1M19 B;  3AZE A;  1P3P A;  3W97 A;  1P3O A;  3MGS C;  2Y2L A;  5BS7 A;  3X1S D;  1M1A B;  4KUD B;  5CPK C;  5AVB B;  3EG5 B;  1P34 B;  1P3F D;  2PYO A;  3LJA A;  1TZY C;  3AYW C;  3EPH A;  4KHA A;  3KWQ D;  4H9O B;  1P3L B;  3MGQ B;  3NQJ B;  5AY8 D;  5B24 A;  1M18 D;  4HGA C;  5B32 B;  4AWL B;  5B2I D;  3UTB C;  2UWX A;  1P3G A;  1M19 A;  1F66 B;  1JFI A;  3WA9 C;  4X23 A;  5C3I C;  5AV5 C;  5B1L C;  3H0L C;  3LEL C;  3KSY A;  4E44 A;  1M1A A;  3REL D;  4KUD A;  3VH6 T;  3VH5 W;  1P3K C;  5AVB A;  2RVQ D;  4R8P B;  1KX4 D;  2NQB C;  3AZJ D;  3AZN C;  3WTP B;  2CV5 D;  5AV9 C;  5CPJ C;  4DRB A;  5B0Y C;  3AZI A;  4J8U C;  3B6F C;  4H9O A;  4Z5T C;  5B33 A;  3LZ0 D;  3AYW D;  1P3L A;  3NQJ A;  3REH A;  1N1J B;  5CP6 C;  5B32 A;  1PZR A;  4ZBJ C;  1F66 A;  5B2J A;  4H9S C;  3AZH B;  4J8W C;  3R45 A;  4XZQ B;  2HIO A;  2IO5 B;  5B1L D;  5AV5 D;  5GT3 B;  4YM6 B;  3C1C B;  3AN2 A;  1ID3 B;  3F6T A;  1H3O B;  2JCH A;  1P3K D;  4DQY B;  1P3P C;  3WTP A;  3C1B D;  1P3O C;  2NQB D;  5GXQ B;  1ULY A;  4ZUX D;  2Y2O A;  5BNV B;  3X1T B;  4EO5 B;  4Z5T D;  3AZK C;  3VH5 T;  2PYO C;  3REK C;  1N1J A;  3UTA D;  5E5A D;  3WKJ A;  5B40 B;  5DNN D;  2ZY4 A;  3IP4 C;  1HTA A;  5AV8 C;  4J8W D;  3P5J B;  5B0Z B;  5GT3 A;  4YM6 A;  4J8X C;  2JSS A;  4J8V D;  1P3G C;  1M19 C;  2NZD A;  1H3O A;  4LD9 B;  2YFV A;  4X23 C;  3AZE D;  3X1V B;  3A6N C;  1P3P D;  3REI B;  3W97 D;  1P3O D;  4KUD C;  5GXQ A;  2VQR A;  3X1T A;  3AZF B;  5DNM B;  3KXB A;  3KFU G;  5BO0 A;  3V9R B;  3AZI C;  2BYM A;  2PYO D;  5B40 A;  5GSU B;  4WU9 B;  5B33 C;  3EPK A;  4WU8 B;  3REH C;  5B24 D;  2LY8 A;  1U35 B;  5B0Z A;  4YS3 B;  1P3I B;  1R4V A;  4J8X D;  5B2J C;  1P3G D;  5B1M C;  1M19 D;  4LD9 A;  2HUE B;  3X1V A;  1B6W A;  4X23 D;  3REI A;  3AV2 C;  2HIO C;  4KUD D;  3AN2 C;  5B31 A;  1M1A D;  2F8N B;  5AVB D;  3WTP C;  3AFA A;  3V9R A;  3B0C W;  3MGR B;  3REJ B;  4QLC B;  1P3A C;  3AZI D;  1ZLA B;  3W98 B;  3AV1 B;  3EPJ A;  4G91 C;  5B33 D;  4WU8 A;  1P3L D;  3W99 B;  4XUJ B;  3REH D;  3WKJ C;  1U35 A;  4Z2M G;  4YS3 A;  1P3I A;  5B32 D;  1KX5 B;  1F66 D;  5B2J D;  1TAF B;  4Z66 B;  3MNN B;  2HIO D;  5GT3 C;  1P3F C;  5G49 B;  2F8N A;  2NZD C;  3AN2 D;  2YFW B;  4H9Q A;  3KWQ C;  3WTP E;  3WTP D;  2BYK B;  5AY8 C;  1S32 B;  1M18 C;  3REJ A;  1ZLA A;  3AZG B;  2FJ7 B;  3W98 A;  3H0R C;  5AVC B;  4EO5 C;  5B2I C;  3KXB C;  1P3B B;  3W99 A;  3MGP B;  1AOI B;  4XUJ A;  3WKJ D;  1KX5 A;  3REL C;  4G92 B;  2ZY5 A;  2RVQ C;  2Y2P A;  5GT0 B;  1KX4 C;  1TAF A;  2DF4 C;  5JRG B;  3AZJ C;  2CV5 C;  3EPL A;  4KGC B;  3WAA B;  4YM6 D;  5GT3 D;  2YFW A;  4LD9 C;  2NZD D;  3LZ0 C;  5CPI B;  2DQN C;  2BYK A;  1S32 A;  5B31 C;  2FJ7 A;  5GXQ D;  4UPK A;  3AZG A;  5AVC A;  3AZL B;  3O62 B;  3X1T D;  3LZ1 A;  3AFA C;  1P3B A;  3B0D C;  3MGP A;  3KXB D;  1AOI A;  3FDD A;  5B40 D;  4H9N B;  3AZM B;  5JRG A;  3C1B C;  3MVD B;  1P34 A;  1P3I C;  5AV6 B;  4KGC A;  3WAA A;  1P3M B;  4ZUX C;  2HUE C;  5CPI A;  4LD9 D;  3X1V D;  3REI D;  1T3U A;  3MGQ A;  3UTA C;  5E5A C;  5B31 D;  3AZL A;  5DNN C;  3O62 A;  3H0M C;  2RIQ A;  1KX3 B;  5F99 B;  3AFA D;  3A1I A;  5JA4 B;  1EQZ B;  4J8V C;  3AZM A;  4R8P A;  3AZE C;  4WU8 D;  1W2E A;  3MVD A;  3W97 C;  4CSR B;  5AV6 A;  1U35 D;  5BS7 C;  3VH6 A;  4YS3 D;  1P3I D;  1P3M A;  4JJN B;  3LJA C;  3UT9 B;  2ARO B;  2F8N D;  5F99 A;  3X1S B;  1S32 C;  3AZH A;  5B24 C;  1HQ3 B;  4E45 A;  5AVC C;  3REJ D;  5JA4 A;  4XZQ A;  1EQZ A;  1ZLA D;  3W98 D;  3LZ1 C;  3C1C A;  1ID3 A;  3W96 B;  4WJ3 C;  3W99 D;  1Z2C B;  4CSR A;  4XUJ D;  2F2A C;  3AL0 C;  1M1A C;  5AVB C;  2J8P A;  5BNV A;  4JJN A;  1P34 C;  3WAA C;  4H9P B;  5B31 G;  2ARO A;  3UT9 A;  4UUZ B;  3LJA D;  4NE5 A;  3MGS B;  1Q9C A;  3VH5 A;  5CHL B;  1P3L C;  3MGQ C;  1S32 D;  1HQ3 A;  2FJ7 D;  3AZG D;  5CPK B;  5AVC D;  5B32 C;  4AWL C;  3KUY B;  3W96 A;  3LZ1 D;  1P3B D;  1F66 C;  3MGP D;  4NE3 A;  1AOI D;  1TZY B;  3AYW B;  4R8P C;  2Y2K A;  5JRG D;  3AZF A;  4NE6 A;  5DNM A;  5AV6 C;  4HGA B;  3UTB B;  4H9P A;  1P34 D;  3WA9 B;  4KGC D;  3WAA D;  2F8N G;  4UUZ A;  2Y2N A;  1A7W A;  5GSU A;  4WU9 A;  3MGS A;  5CPI D;  3B6G B;  5AV5 B;  3LEL B;  3MGQ D;  5CPK A;  3AZL D;  3O62 D;  3KUY A;  3AZN B;  2NQB B;  5AV9 B;  5CPJ B;  3AZH C;  2F8N H;  5B0Y B;  1TZY A;  4J8U B;  4XZQ C;  3B6F B;  2IO5 C;  4YM6 C;  3C1C C;  1ID3 C;  3AZM D;  2CWE A;  5FUG B;  4M6B A;  4R8P D;  5CP6 B;  3MVD D;  3UTB A;  2Y2H A;  4ZBJ B;  5GXQ C;  5AV6 D;  3WA9 A;  3MGR A;  1P3M D;  4QLC A;  4J8W B;  3AV1 A;  3X1T C;  2Y2J A;  3B6G A;  3LEL A;  5B40 C;  3AZN A;  1P3O B;  5AV9 A;  3B0C T;  2G5I C;  2XD5 A;  5CPJ A;  5F99 D;  5B0Y A;  3AZH D;  4J8U A;  4Z66 A;  3B6F A;  2BG1 A;  1EQZ D;  4XZQ D;  5B0Z C;  3MNN A;  3AZK B;  5G49 A;  3C1C D;  1ID3 D;  3REK B;  5CP6 A;  3X1V C;  3REI C;  4KHA B;  4H9S A;  4J8W A;  5AV8 B;  3AZF C;  4JJN D;  5DNM C;  4J8X B;  1JFI B;  4WU9 C;  5GSU C;  3UT9 D;  2ARO D;  4X23 B;  3A6N B;  5B32 G;  4WU8 C;  5GT0 A;  1HQ3 D;  3A1K A;  1U35 C;  3X1U B;  3KUY C;  4YS3 C;  3AZK A;  5B0Z D;  3W96 D;  3REK A;  3AZI B;  5BNX B;  5B33 B;  5AV8 A;  3REH B;  2ZY2 A;  3AZF D;  4J8X A;  5DNM D;  3NQU B;  3TU4 B;  3MGR C;  5B2J B;  4QLC C;  3REJ C;  5B1M B;  1ZLA C;  3W98 C;  3AV1 C;  4WU9 D;  5GSU D;  3R45 B;  3A6N A;  3B6G C;  4H9N A;  3AV2 B;  2HIO B;  3MGS D;  3W99 C;  3AN2 B;  4XUJ C;  5CPK D;  2XD1 A;  3X1U A;  1KX5 C;  3KUY D;  1P3A B;  4Z66 C;  1TZY D;  5BNX A;  3MNN C;  1BH8 B;  4G91 B;  4DRA A;  3WKJ B;  1KX3 A;  4CAY B;  3NQU A;  3UTB D;  3TU4 A;  2FJ7 C;  3AZG C;  5B1M A;  3WA9 D;  2F8N K;  3MGR D;  4QLC D;  3AV1 D;  3AV2 A;  3B6G D;  1P3B C;  4WNN B;  3LEL D;  3MGP C;  1P3F B;  2NZD B;  1AOI C;  4WV4 B;  2YFV B;  3KWQ B;  3AZN D;  4G92 C;  1KX5 D;  5AV9 D;  5AY8 B;  5CPJ D;  5GT0 C;  1P3A A;  1B67 A;  5B0Y D;  5JRG C;  2ZM5 A;  1M18 B;  4J8U D;  4Z66 D;  1F1E A;  2L5A A;  5B2I B;  3B6F D;  1BH8 A;  3KXB B;  4KGC C;  2W8S A;  5BO0 B;  3MNN D;  2ZY3 A;  2BYM B;  2JE5 A;  4H9R B;  5CPI C;  4CAY A;  3X1S A;  5CP6 D;  3REL B;  5BT1 C;  1WWI A;  1BH9 B;  1KX4 B;  3AZL C;  3O62 C;  3AZJ B;  2CV5 B;  4WNN A;  1P3F A;  5KDM B; 
#chains in the Genus database with same CATH homology
 3KWQ A;  2G5H C;  3LZ0 B;  3AZM C;  2Y2G A;  5AY8 A;  5B31 B;  1M18 A;  5GT0 D;  3MVD C;  3X1U C;  5B2I A;  4WZS B;  3AFA B;  1KU5 A;  3B0D B;  3AZK D;  1P3M C;  4H9R A;  3REK D;  5C3I B;  3REL A;  5B1L B;  1BH9 A;  5BT1 D;  1KX4 A;  3AZJ A;  1P3K B;  2CV5 A;  3C1B B;  5AV8 D;  1KX3 C;  5F99 C;  5KDM A;  3TU4 C;  2Y2I A;  4ZUX B;  3AYW A;  2Y2M A;  3LZ0 A;  1EQZ C;  2Y2Q A;  4Z5T B;  3A6N D;  3B0B A;  3UTA B;  5E5A B;  4H9Q B;  5DNN B;  3X1U D;  4JJN C;  5AV5 A;  5B1L A;  4J8V B;  1WWS A;  3UT9 C;  2ARO C;  1P3K A;  3AZE B;  3C1B A;  1P3P B;  2NQB A;  3W97 B;  3X1S C;  1KX3 D;  1BFM A;  4ZUX A;  3TU4 D;  1HQ3 C;  5B1M D;  4Z5T A;  3W96 C;  3AV2 D;  3UTA A;  5E5A A;  5FUG A;  2PYO B;  3LJA B;  5DNN A;  2FFF B;  4Z2M H;  3VH6 W;  5B24 B;  1P3A D;  4NFT A;  4J8V A;  3LZ1 B;  1P3G B;  1M19 B;  3AZE A;  1P3P A;  3W97 A;  1P3O A;  3MGS C;  2Y2L A;  5BS7 A;  3X1S D;  1M1A B;  4KUD B;  5CPK C;  5AVB B;  3EG5 B;  1P34 B;  1P3F D;  2PYO A;  3LJA A;  1TZY C;  3AYW C;  3EPH A;  4KHA A;  3KWQ D;  4H9O B;  1P3L B;  3MGQ B;  3NQJ B;  5AY8 D;  5B24 A;  1M18 D;  4HGA C;  5B32 B;  4AWL B;  5B2I D;  3UTB C;  2UWX A;  1P3G A;  1M19 A;  1F66 B;  1JFI A;  3WA9 C;  4X23 A;  5C3I C;  5AV5 C;  5B1L C;  3H0L C;  3LEL C;  3KSY A;  4E44 A;  1M1A A;  3REL D;  4KUD A;  3VH6 T;  3VH5 W;  1P3K C;  5AVB A;  2RVQ D;  4R8P B;  1KX4 D;  2NQB C;  3AZJ D;  3AZN C;  3WTP B;  2CV5 D;  5AV9 C;  5CPJ C;  4DRB A;  5B0Y C;  3AZI A;  4J8U C;  3B6F C;  4H9O A;  4Z5T C;  5B33 A;  3LZ0 D;  3AYW D;  1P3L A;  3NQJ A;  3REH A;  1N1J B;  5CP6 C;  5B32 A;  1PZR A;  4ZBJ C;  1F66 A;  5B2J A;  4H9S C;  3AZH B;  4J8W C;  3R45 A;  4XZQ B;  2HIO A;  2IO5 B;  5B1L D;  5AV5 D;  5GT3 B;  4YM6 B;  3C1C B;  3AN2 A;  1ID3 B;  3F6T A;  1H3O B;  2JCH A;  1P3K D;  4DQY B;  1P3P C;  3WTP A;  3C1B D;  1P3O C;  2NQB D;  5GXQ B;  1ULY A;  4ZUX D;  2Y2O A;  5BNV B;  3X1T B;  4EO5 B;  4Z5T D;  3AZK C;  3VH5 T;  2PYO C;  3REK C;  1N1J A;  3UTA D;  5E5A D;  3WKJ A;  5B40 B;  5DNN D;  2ZY4 A;  3IP4 C;  1HTA A;  5AV8 C;  4J8W D;  3P5J B;  5B0Z B;  5GT3 A;  4YM6 A;  4J8X C;  2JSS A;  4J8V D;  1P3G C;  1M19 C;  2NZD A;  1H3O A;  4LD9 B;  2YFV A;  4X23 C;  3AZE D;  3X1V B;  3A6N C;  1P3P D;  3REI B;  3W97 D;  1P3O D;  4KUD C;  5GXQ A;  2VQR A;  3X1T A;  3AZF B;  5DNM B;  3KXB A;  3KFU G;  5BO0 A;  3V9R B;  3AZI C;  2BYM A;  2PYO D;  5B40 A;  5GSU B;  4WU9 B;  5B33 C;  3EPK A;  4WU8 B;  3REH C;  5B24 D;  2LY8 A;  1U35 B;  5B0Z A;  4YS3 B;  1P3I B;  1R4V A;  4J8X D;  5B2J C;  1P3G D;  5B1M C;  1M19 D;  4LD9 A;  2HUE B;  3X1V A;  1B6W A;  4X23 D;  3REI A;  3AV2 C;  2HIO C;  4KUD D;  3AN2 C;  5B31 A;  1M1A D;  2F8N B;  5AVB D;  3WTP C;  3AFA A;  3V9R A;  3B0C W;  3MGR B;  3REJ B;  4QLC B;  1P3A C;  3AZI D;  1ZLA B;  3W98 B;  3AV1 B;  3EPJ A;  4G91 C;  5B33 D;  4WU8 A;  1P3L D;  3W99 B;  4XUJ B;  3REH D;  3WKJ C;  1U35 A;  4Z2M G;  4YS3 A;  1P3I A;  5B32 D;  1KX5 B;  1F66 D;  5B2J D;  1TAF B;  4Z66 B;  3MNN B;  2HIO D;  5GT3 C;  1P3F C;  5G49 B;  2F8N A;  2NZD C;  3AN2 D;  2YFW B;  4H9Q A;  3KWQ C;  3WTP E;  3WTP D;  2BYK B;  5AY8 C;  1S32 B;  1M18 C;  3REJ A;  1ZLA A;  3AZG B;  2FJ7 B;  3W98 A;  3H0R C;  5AVC B;  4EO5 C;  5B2I C;  3KXB C;  1P3B B;  3W99 A;  3MGP B;  1AOI B;  4XUJ A;  3WKJ D;  1KX5 A;  3REL C;  4G92 B;  2ZY5 A;  2RVQ C;  2Y2P A;  5GT0 B;  1KX4 C;  1TAF A;  2DF4 C;  5JRG B;  3AZJ C;  2CV5 C;  3EPL A;  4KGC B;  3WAA B;  4YM6 D;  5GT3 D;  2YFW A;  4LD9 C;  2NZD D;  3LZ0 C;  5CPI B;  2DQN C;  2BYK A;  1S32 A;  5B31 C;  2FJ7 A;  5GXQ D;  4UPK A;  3AZG A;  5AVC A;  3AZL B;  3O62 B;  3X1T D;  3LZ1 A;  3AFA C;  1P3B A;  3B0D C;  3MGP A;  3KXB D;  1AOI A;  3FDD A;  5B40 D;  4H9N B;  3AZM B;  5JRG A;  3C1B C;  3MVD B;  1P34 A;  1P3I C;  5AV6 B;  4KGC A;  3WAA A;  1P3M B;  4ZUX C;  2HUE C;  5CPI A;  4LD9 D;  3X1V D;  3REI D;  1T3U A;  3MGQ A;  3UTA C;  5E5A C;  5B31 D;  3AZL A;  5DNN C;  3O62 A;  3H0M C;  2RIQ A;  1KX3 B;  5F99 B;  3AFA D;  3A1I A;  5JA4 B;  1EQZ B;  4J8V C;  3AZM A;  4R8P A;  3AZE C;  4WU8 D;  1W2E A;  3MVD A;  3W97 C;  4CSR B;  5AV6 A;  1U35 D;  5BS7 C;  3VH6 A;  4YS3 D;  1P3I D;  1P3M A;  4JJN B;  3LJA C;  3UT9 B;  2ARO B;  2F8N D;  5F99 A;  3X1S B;  1S32 C;  3AZH A;  5B24 C;  1HQ3 B;  4E45 A;  5AVC C;  3REJ D;  5JA4 A;  4XZQ A;  1EQZ A;  1ZLA D;  3W98 D;  3LZ1 C;  3C1C A;  1ID3 A;  3W96 B;  4WJ3 C;  3W99 D;  1Z2C B;  4CSR A;  4XUJ D;  2F2A C;  3AL0 C;  1M1A C;  5AVB C;  2J8P A;  5BNV A;  4JJN A;  1P34 C;  3WAA C;  4H9P B;  5B31 G;  2ARO A;  3UT9 A;  4UUZ B;  3LJA D;  4NE5 A;  3MGS B;  1Q9C A;  3VH5 A;  5CHL B;  1P3L C;  3MGQ C;  1S32 D;  1HQ3 A;  2FJ7 D;  3AZG D;  5CPK B;  5AVC D;  5B32 C;  4AWL C;  3KUY B;  3W96 A;  3LZ1 D;  1P3B D;  1F66 C;  3MGP D;  4NE3 A;  1AOI D;  1TZY B;  3AYW B;  4R8P C;  2Y2K A;  5JRG D;  3AZF A;  4NE6 A;  5DNM A;  5AV6 C;  4HGA B;  3UTB B;  4H9P A;  1P34 D;  3WA9 B;  4KGC D;  3WAA D;  2F8N G;  4UUZ A;  2Y2N A;  1A7W A;  5GSU A;  4WU9 A;  3MGS A;  5CPI D;  3B6G B;  5AV5 B;  3LEL B;  3MGQ D;  5CPK A;  3AZL D;  3O62 D;  3KUY A;  3AZN B;  2NQB B;  5AV9 B;  5CPJ B;  3AZH C;  2F8N H;  5B0Y B;  1TZY A;  4J8U B;  4XZQ C;  3B6F B;  2IO5 C;  4YM6 C;  3C1C C;  1ID3 C;  3AZM D;  2CWE A;  5FUG B;  4M6B A;  4R8P D;  5CP6 B;  3MVD D;  3UTB A;  2Y2H A;  4ZBJ B;  5GXQ C;  5AV6 D;  3WA9 A;  3MGR A;  1P3M D;  4QLC A;  4J8W B;  3AV1 A;  3X1T C;  2Y2J A;  3B6G A;  3LEL A;  5B40 C;  3AZN A;  1P3O B;  5AV9 A;  3B0C T;  2G5I C;  2XD5 A;  5CPJ A;  5F99 D;  5B0Y A;  3AZH D;  4J8U A;  4Z66 A;  3B6F A;  2BG1 A;  1EQZ D;  4XZQ D;  5B0Z C;  3MNN A;  3AZK B;  5G49 A;  3C1C D;  1ID3 D;  3REK B;  5CP6 A;  3X1V C;  3REI C;  4KHA B;  4H9S A;  4J8W A;  5AV8 B;  3AZF C;  4JJN D;  5DNM C;  4J8X B;  1JFI B;  4WU9 C;  5GSU C;  3UT9 D;  2ARO D;  4X23 B;  3A6N B;  5B32 G;  4WU8 C;  5GT0 A;  1HQ3 D;  3A1K A;  1U35 C;  3X1U B;  3KUY C;  4YS3 C;  3AZK A;  5B0Z D;  3W96 D;  3REK A;  3AZI B;  5BNX B;  5B33 B;  5AV8 A;  3REH B;  2ZY2 A;  3AZF D;  4J8X A;  5DNM D;  3NQU B;  3TU4 B;  3MGR C;  5B2J B;  4QLC C;  3REJ C;  5B1M B;  1ZLA C;  3W98 C;  3AV1 C;  4WU9 D;  5GSU D;  3R45 B;  3A6N A;  3B6G C;  4H9N A;  3AV2 B;  2HIO B;  3MGS D;  3W99 C;  3AN2 B;  4XUJ C;  5CPK D;  2XD1 A;  3X1U A;  1KX5 C;  3KUY D;  1P3A B;  4Z66 C;  1TZY D;  5BNX A;  3MNN C;  1BH8 B;  4G91 B;  4DRA A;  3WKJ B;  1KX3 A;  4CAY B;  3NQU A;  3UTB D;  3TU4 A;  2FJ7 C;  3AZG C;  5B1M A;  3WA9 D;  2F8N K;  3MGR D;  4QLC D;  3AV1 D;  3AV2 A;  3B6G D;  1P3B C;  4WNN B;  3LEL D;  3MGP C;  1P3F B;  2NZD B;  1AOI C;  4WV4 B;  2YFV B;  3KWQ B;  3AZN D;  4G92 C;  1KX5 D;  5AV9 D;  5AY8 B;  5CPJ D;  5GT0 C;  1P3A A;  1B67 A;  5B0Y D;  5JRG C;  2ZM5 A;  1M18 B;  4J8U D;  4Z66 D;  1F1E A;  2L5A A;  5B2I B;  3B6F D;  1BH8 A;  3KXB B;  4KGC C;  2W8S A;  5BO0 B;  3MNN D;  2ZY3 A;  2BYM B;  2JE5 A;  4H9R B;  5CPI C;  4CAY A;  3X1S A;  5CP6 D;  3REL B;  5BT1 C;  1WWI A;  1BH9 B;  1KX4 B;  3AZL C;  3O62 C;  3AZJ B;  2CV5 B;  4WNN A;  1P3F A;  5KDM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...