3A6NA

The nucleosome containing a testis-specific histone variant, human h3t
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1t
publication title Structural basis of instability of the nucleosome containing a testis-specific histone variant, human H3T
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3a6nA00
3X1SD 4ZBJB 5F99D 5B2JB 1R4VA 1P3BB 5AV8C 5B32C 5CPJA 3LZ1C 3MGSC 3REHB 4J8WD 5DNNB 3KXBD 1P3AC 5B24D 5E5AC 1HTAA 3MGRD 3AV2B 3AV1C 3REKC 3LZ0B 2IO5C 2YFVA 1EQZD 3W97D 1WWIA 3UTBC 3AZLB 4KUDA 3WAAB 2PYOA 5B31C 4XZQC 3RELA 3NQUA 3W99D 1HQ3C 5GSUA 5CPJB 5GT3B 4WU9C 3AZND 4G91B 1S32D 3AZEA 3B6GB 3AZID 1BH9B 5DNMD 5AV6C 1TAFA 3AYWC 5GT0B 2YFVB 3MGPC 4YS3A 2JSSA 1P3FC 4KUDB 4WU8B 3B0BA 3MNNA 1P3BD 3W96C 2PYOB 1F66A 3V9RA 3AN2C 3RELB 5B2IC 4EO5C 1ZLAA 2BYKB 3AFAC 5BNVA 5AV9C 3AZFC 3AV2D 3AZEB 3LZ0D 2BYMA 4QLCA 1ID3D 3C1BA 2F8NK 3AZLD 1AOIC 1P3KA 3WAAD 3WTPD 3LJAA 2FJ7A 4YS3B 3MNNB 1M1AC 5CPJD 5B40A 5AV5A 1F66B 3V9RB 4Z66B 3AZJA 1ZLAB 5GXQC 3MGQA 3AZMA 4XUJB 5B1MB 2BYMB 4E44A 4QLCB 3AZHA 1M18C 2NZDC 5B1LA 4J8VC 4KUDD 1P3KB 4Z5TA 5BS7C 3AZGA 3LJAB 2AROA 2PYOD 5CP6C 1P3AB 3RELD 2F8NA 5GSUD 1P34C 5B40B 3AV1B 4NE3A 3WTPE 3LELC 4YM6C 3REJA 3AZED 1KX5A 5JRGA 3UTBB 3R45A 5CPKA 1M19C 5B33C 3AZHB 5B31B 5B1LB 4YS3D 1HQ3B 3O62C 3MNND 3AZGB 2AROB 3VH5T 1F66D 1ZLAD 2RVQD 5AY8A 3B6FA 5AV6B 3AYWB 3KUYC 5JRGB 4HGAC 4QLCD 4UUZA 4NFTA 3C1BD 3MGPB 1P3FB 3R45B 4H9RB 3A6NA 3W98A 4X23C 3C1CA 5B0YC 1KU5A 1P3KD 3X1TA 5CPKB 1P3IC 5B0ZC 3LJAD 2FJ7D 5B2JA 5AVBA 5B2IB 3WKJC 3REHA 4LD9A 5DNNA 5B40D 5AV9B 3AZFB 5AV5D 3MVDA 5AY8B 1AOIB 3B6FB 3TU4A 3MGQD 1P3PC 4UUZB 3AZHD 4J8XA 5B1LD 5C3IC 2NQBC 3A6NB 5BO0A 3W98B 1ULYA 1P3OC 4Z5TD 4JJNC 3AZGD 2AROD 4ZUXC 5AVBB 5BNXA 2F8ND 5GT3A 4LD9B 3B6GA 5GXQB 1BH9A 2HIOA 3REJD 1KX5D 5JRGD 3REIA 3X1UA 3MVDB 3TU4B 5GT0A 5CPKD 1P3MC 4H9SC 4J8XB 4WU8A 5BO0B 1KX3C 4WNNB 3VH6W 4KGCC 5BNXB 2BYKA 4H9PB 3X1VA 5AY8D 3B6FD 4M6BA 1P3LC 3AZKA 2HIOB 2F8NH 5CHLB 3WA9C 1M19B 5B33B 3REIB 3UT9C 5FUGA 3X1UB 1U35C 1KX4A 3A6ND 3W98D 3C1CD 3X1TD 3AZJC 1BFMA 4R8PA 3UTAC 5B2JD 5AVBD 3AZMC 3REHD 4J8UC 4LD9D 5CPIC 5DNND 3VH5A 4Z66A 3KSYA 1JFIA 1P3GA 1TZYC 4HGAB 3MVDD 3X1VB 3X1SC 5F99C 4XUJA 3AZKB 5B1MA 3TU4D 3KWQA 5B0YB 4H9OA 5AVCA 1P3IB 5FUGB 4J8WC 4J8XD 1KX4B 3KXBC 5AV8A 5B32A 2CV5B 3LZ1A 3MGSA 3WKJB 5B24C 4R8PB 1P3AA 3MGRC 5GT3D 4AWLB 1A7WA 5E5AA 1EQZC 3W97C 3AV1A 3REKA 3B6GD 2HIOD 1JFIB 1P3GB 1H3OA 3NQJA 3REID 3UTBA 4DRAA 3X1UD 3W99C 3KWQB 5GT0D 4H9OB 5AVCB 5B31A 4XZQA 3AZNC 1S32C 4WU8D 1HQ3A 5AV8B 5B32B 3LZ1B 3MGSB 3AZIC 4WU9A 5DNMC 4H9NA 5BT1D 5E5AB 3X1VD 3REKB 5AV6A 4ZBJC 3AYWA 3AZKD 1P3BC 2IO5B 1H3OB 2CWEA 3NQJB 3MGPA 1P3MB 1P3FA 4H9RA 1KX4D 2CV5D 3W96A 4XZQB 4R8PD 3AN2A 5B2IA 3AV2C 4KGCB 3LZ0C 4WU9B 3AFAA 1ID3C 5AV9A 3AZFA 4CAYB 3AZLC 1B67A 4Z66D 4H9NB 1P3GD 3WAAC 1Q9CA 3WTPC 4G92C 1AOIA 1U35B 4XUJD 5B1MD 3KWQD 5CPJC 5AVCD 4G91C 1M1AA 5AV8D 5B32D 3LZ1D 3MGSD 3W96B 4NE5A 4J8UB 5CPIB 3AN2B 1P3AD 4EO5B 3AFAB 5E5AD 5GXQA 3AV1D 3REKD 5F99B 4KUDC 1M18A 4WZSB 3UTBD 4J8VA 2NZDA 2PYOC 1BH8B 3KXBB 3RELC 5BS7A 5B24B 5GSUC 5B31D 5CP6A 4XZQD 3AZEC 1HQ3D 1M1AB 1P34A 4WV4B 4WU9D 1EQZB 3W97B 4WNNA 3LELA 4YM6A 1F1EA 5B31G 4H9PA 4CSRA 4YS3C 5AV6D 3AYWD 1M19A 5B33A 3MNNC 2LY8A 1M18B 3MGPD 4J8VB 2NZDB 2F8NG 1P3FD 1F66C 3O62A 3W96D 1ZLAC 2RVQC 5CP6B 3B0DC 5DNMB 3AN2D 5B2ID 1P34B 3AFAD 4QLCC 5AV9D 3C1BC 3AZFD 2HUEC 3LELB 4YM6B 3KUYA 1P3KC 3LJAC 1AOID 4DRBA 2FJ7C 4CSRB 4X23A 5B0YA 1P3IA 5B0ZA 5B40C 5AV5C 2CV5A 3O62B 1M1AD 3WKJA 1ID3B 3MGQC 3WTPB 4G92B 2L5AA 3AZHC 5GXQD 5B1LC 3KUYB 1P3PA 5G49A 1M18D 4Z5TC 2NZDD 4J8VD 3AZGC 2NQBA 2AROC 4X23B 1P3OA 3VH6T 5B0ZB 4JJNA 4ZUXA 5CP6D 4H9QA 3REJC 4KHAA 1KX5C 1N1JA 1P34D 5JRGC 3LELD 4YM6D 1WWSA 5CPKC 3NQUB 1P3PB 1M19D 5GSUB 4H9SA 5G49B 5B33D 1P3MA 5C3IB 2NQBB 3O62D 1KX3A 1P3OB 4JJNB 4ZUXB 5AY8C 4KGCA 3B6FC 4H9QB 4KHAB 1TAFB 1N1JB 4CAYA 4E45A 3WA9A 1P3LA 3A6NC 3KUYD 3W98C 3C1CC 3UT9A 3X1TC 1U35A 5AVBC 5B2JC 4X23D 5B0YD 3B0CW 1P3ID 5B0ZD 3REHC 3UTAA 4LD9C 5DNNC 3B0DB 5BNVB 1KX3B 3WKJD 3VH5W 4J8UA 5CPIA 3C1BB 3MVDC 2HUEB 1TZYA 3TU4C 4Z2MG 5KDMA 3X1SA 3WA9B 5F99A 4J8XC 1P3LB 2FJ7B 1P3PD 3UT9B 4J8WA 1BH8A 4NE6A 3KXBA 2NQBD 5AV5B 5B24A 1P3OD 5GT3C 3AZJB 4JJND 3MGRA 4ZUXD 3UTAB 3B6GC 2HIOC 3MGQB 3AZMB 3W97A 1EQZA 3REIC 4Z2MH 3X1UC 3B0CT 1TZYB 5GT0C 4Z5TB 5KDMB 5B32G 3X1SB 3W99A 4WU8C 2F8NB 1P3MD 3AZNA 4J8WB 1S32A 3AZIA 3REJB 1KX5B 1KX3D 5JA4A 3VH6A 5BT1C 5DNMA 3MGRB 3X1VC 2YFWA 4KGCD 3AZKC 3WA9D 1P3LD 1KX4C 1P3BA 2CV5C 3UT9D 1B6WA 1U35D 4R8PC 3W99B 3AZJD 4AWLC 3AZNB 3UTAD 3AV2A 1S32B 4Z66C 3LZ0A 3AZIB 3AZMD 1P3GC 1ID3A 5JA4B 4J8UD 3AZLA 5CPID 2YFWB 3WAAA 4XUJC 3WTPA 5B1MC 1TZYD 3KWQC 3C1CB 5AVCC 3X1TB
chains in the Genus database with same CATH superfamily
3X1SD 4ZBJB 5F99D 5B2JB 1R4VA 1P3BB 5AV8C 5B32C 5CPJA 3LZ1C 3MGSC 2W8SA 3A1IA 4J8WD 3REHB 5DNNB 3KXBD 1P3AC 5B24D 5E5AC 1HTAA 3MGRD 3AV2B 3AV1C 3REKC 3LZ0B 2IO5C 2YFVA 1EQZD 3W97D 1WWIA 3UTBC 3AZLB 4KUDA 3EG5B 3WAAB 2PYOA 5B31C 4XZQC 3RELA 3NQUA 3W99D 1HQ3C 5GSUA 5CPJB 5GT3B 4WU9C 3AZND 4G91B 1S32D 3AZEA 3B6GB 3AZID 1BH9B 5DNMD 2Y2QA 5AV6C 1TAFA 3AYWC 5GT0B 2YFVB 3MGPC 4YS3A 2JSSA 1P3FC 4KUDB 4WU8B 3B0BA 3MNNA 1P3BD 4WJ3C 3W96C 2PYOB 1F66A 3V9RA 3AN2C 3RELB 5B2IC 4EO5C 1ZLAA 2BYKB 3AFAC 5BNVA 5AV9C 3AZFC 3AV2D 3AZEB 3P5JB 3LZ0D 2BYMA 4QLCA 1ID3D 3C1BA 2F8NK 3EPJA 3AZLD 1AOIC 2ZY4A 1P3KA 3WAAD 3WTPD 3KFUG 3LJAA 2FJ7A 4YS3B 3EPHA 3MNNB 1M1AC 5CPJD 5B40A 5AV5A 1F66B 3V9RB 4Z66B 3AZJA 1ZLAB 2Y2IA 2Y2LA 5GXQC 3MGQA 3AZMA 4XUJB 1PZRA 5B1MB 2BYMB 4E44A 4QLCB 3AZHA 1M18C 2NZDC 5B1LA 4J8VC 4KUDD 1P3KB 4Z5TA 5BS7C 3AZGA 3LJAB 2AROA 2PYOD 5CP6C 1P3AB 3RELD 2F8NA 5GSUD 2G5IC 1P34C 5B40B 3AV1B 4NE3A 3WTPE 3LELC 4YM6C 3REJA 2G5HC 3AZED 1KX5A 2ZY3A 5JRGA 3UTBB 2Y2NA 3R45A 5CPKA 1M19C 5B33C 3AZHB 5B31B 5B1LB 4YS3D 1HQ3B 3O62C 3MNND 2Y2KA 3AZGB 2AROB 3VH5T 1F66D 1ZLAD 2RVQD 5AY8A 3B6FA 5AV6B 2ZY5A 3AYWB 3KUYC 5JRGB 4HGAC 4QLCD 4UUZA 4NFTA 3C1BD 3MGPB 1P3FB 3R45B 4H9RB 3A6NA 3W98A 4X23C 3C1CA 2ZY2A 5B0YC 1KU5A 1P3KD 3X1TA 5CPKB 1P3IC 5B0ZC 3LJAD 2FJ7D 5B2JA 5AVBA 5B2IB 3WKJC 3REHA 4LD9A 5DNNA 5B40D 5AV9B 3AZFB 5AV5D 2XD5A 3MVDA 5AY8B 1AOIB 3B6FB 3TU4A 3MGQD 3FDDA 1P3PC 4UUZB 3AZHD 4J8XA 5B1LD 5C3IC 2NQBC 3A6NB 5BO0A 3W98B 1ULYA 1P3OC 4Z5TD 3F6TA 4JJNC 3AZGD 2AROD 4ZUXC 5AVBB 5BNXA 2F8ND 5GT3A 4LD9B 3B6GA 5GXQB 1BH9A 2HIOA 3REJD 1KX5D 5JRGD 3REIA 3X1UA 3MVDB 3TU4B 5GT0A 5CPKD 1P3MC 4H9SC 4J8XB 4WU8A 5BO0B 1KX3C 4WNNB 3VH6W 4KGCC 5BNXB 2DQNC 2BYKA 4H9PB 3X1VA 5AY8D 3B6FD 4M6BA 1P3LC 3AZKA 2HIOB 2F8NH 5CHLB 3EPLA 3WA9C 1M19B 5B33B 3REIB 3UT9C 5FUGA 3X1UB 1U35C 1KX4A 3A6ND 3W98D 3C1CD 3X1TD 3AZJC 1BFMA 4R8PA 3UTAC 5B2JD 5AVBD 3AZMC 3REHD 2Y2HA 4J8UC 4LD9D 5CPIC 5DNND 3VH5A 4Z66A 3KSYA 1JFIA 1P3GA 2XD1A 1TZYC 4HGAB 3MVDD 3X1VB 3X1SC 5F99C 4XUJA 3AZKB 5B1MA 3TU4D 3KWQA 5B0YB 4H9OA 5AVCA 1P3IB 5FUGB 4J8WC 4J8XD 1KX4B 3KXBC 5AV8A 5B32A 2CV5B 3LZ1A 3MGSA 3WKJB 5B24C 4R8PB 1P3AA 3MGRC 5GT3D 4AWLB 1A7WA 5E5AA 1EQZC 3W97C 3AV1A 3REKA 3B6GD 1W2EA 2HIOD 2DF4C 1JFIB 1P3GB 1H3OA 3NQJA 3REID 3UTBA 4DRAA 3X1UD 3W99C 3KWQB 5GT0D 4H9OB 5AVCB 5B31A 3A1KA 4XZQA 3AZNC 1S32C 4WU8D 1HQ3A 5AV8B 5B32B 3LZ1B 3MGSB 2Y2PA 3AZIC 3H0RC 4WU9A 5DNMC 4H9NA 2Y2GA 5BT1D 5E5AB 3X1VD 3REKB 5AV6A 4ZBJC 3AYWA 3AZKD 1P3BC 2IO5B 1H3OB 2CWEA 3NQJB 3MGPA 1P3MB 1P3FA 4H9RA 1KX4D 2CV5D 3W96A 4XZQB 4R8PD 3AN2A 5B2IA 3AV2C 4KGCB 3LZ0C 4WU9B 3AFAA 1ID3C 5AV9A 3AZFA 4CAYB 3AZLC 1B67A 4Z66D 4H9NB 1P3GD 3WAAC 1Q9CA 3WTPC 4G92C 3AL0C 1AOIA 1U35B 4XUJD 5B1MD 3KWQD 5CPJC 5AVCD 4G91C 1M1AA 5AV8D 5B32D 3LZ1D 3MGSD 3W96B 4NE5A 4J8UB 5CPIB 3AN2B 1P3AD 4EO5B 3AFAB 5E5AD 5GXQA 3AV1D 3REKD 2BG1A 5F99B 4KUDC 1M18A 4WZSB 3UTBD 4J8VA 2NZDA 2PYOC 1BH8B 3KXBB 3RELC 5BS7A 5B24B 5GSUC 5B31D 5CP6A 4XZQD 3AZEC 1HQ3D 1M1AB 1P34A 4WV4B 4WU9D 1EQZB 3W97B 4WNNA 3LELA 4YM6A 1F1EA 5B31G 4H9PA 4CSRA 4YS3C 5AV6D 3AYWD 1M19A 5B33A 3MNNC 2LY8A 1M18B 3MGPD 4J8VB 2NZDB 2F8NG 1P3FD 1F66C 3O62A 3W96D 2Y2OA 1ZLAC 2RVQC 5CP6B 3B0DC 5DNMB 3AN2D 5B2ID 1P34B 3AFAD 4QLCC 5AV9D 3C1BC 3AZFD 2HUEC 3LELB 4YM6B 3KUYA 2JCHA 1P3KC 3LJAC 1AOID 4DRBA 2FJ7C 4CSRB 4X23A 5B0YA 1P3IA 5B0ZA 5B40C 5AV5C 2CV5A 3O62B 1M1AD 3WKJA 1ID3B 2RIQA 3MGQC 3WTPB 2UWXA 4G92B 2L5AA 3AZHC 5GXQD 5B1LC 3KUYB 1P3PA 5G49A 1M18D 4Z5TC 2NZDD 4J8VD 3AZGC 2NQBA 2AROC 4X23B 1P3OA 3VH6T 5B0ZB 4JJNA 4ZUXA 5CP6D 4H9QA 3REJC 4KHAA 1KX5C 1N1JA 1P34D 5JRGC 3LELD 4YM6D 1WWSA 5CPKC 3NQUB 1P3PB 1M19D 5GSUB 4H9SA 5G49B 5B33D 1P3MA 5C3IB 2NQBB 3O62D 1KX3A 1P3OB 4JJNB 4ZUXB 5AY8C 4KGCA 3B6FC 4H9QB 4KHAB 1TAFB 1N1JB 4CAYA 3H0MC 4E45A 3WA9A 1P3LA 3A6NC 3KUYD 3W98C 3C1CC 3UT9A 3X1TC 1U35A 5AVBC 5B2JC 4X23D 5B0YD 3B0CW 1P3ID 1T3UA 5B0ZD 3REHC 3UTAA 4LD9C 5DNNC 3B0DB 2J8PA 5BNVB 2FFFB 1KX3B 3WKJD 3VH5W 4J8UA 5CPIA 4DQYB 3C1BB 3MVDC 2HUEB 3IP4C 1TZYA 3TU4C 4Z2MG 5KDMA 3X1SA 3WA9B 5F99A 4J8XC 1P3LB 2FJ7B 2VQRA 1P3PD 3UT9B 4J8WA 1BH8A 4NE6A 3KXBA 2NQBD 5AV5B 5B24A 1P3OD 5GT3C 3AZJB 4JJND 3MGRA 4ZUXD 3UTAB 2JE5A 3B6GC 2HIOC 3MGQB 3AZMB 3W97A 1EQZA 3REIC 4Z2MH 3X1UC 3B0CT 2ZM5A 2Y2MA 1TZYB 5GT0C 4Z5TB 5KDMB 5B32G 3X1SB 3W99A 4WU8C 2F8NB 3EPKA 1P3MD 3AZNA 2F2AC 4J8WB 1S32A 3AZIA 3REJB 1KX5B 1KX3D 5JA4A 3VH6A 5BT1C 5DNMA 3MGRB 3X1VC 2YFWA 4KGCD 3H0LC 3AZKC 3WA9D 1P3LD 1KX4C 1P3BA 2CV5C 3UT9D 1B6WA 1U35D 4R8PC 3W99B 3AZJD 1Z2CB 4AWLC 3AZNB 4UPKA 3UTAD 3AV2A 1S32B 4Z66C 3LZ0A 3AZIB 3AZMD 1P3GC 1ID3A 5JA4B 4J8UD 2Y2JA 3AZLA 5CPID 2YFWB 3WAAA 4XUJC 3WTPA 5B1MC 1TZYD 3KWQC 3C1CB 5AVCC 3X1TB
chains in the Genus database with same CATH topology
3X1SD 4ZBJB 5F99D 5B2JB 1R4VA 1P3BB 5AV8C 5B32C 5CPJA 3LZ1C 3MGSC 2W8SA 3A1IA 4J8WD 3REHB 5DNNB 3KXBD 1P3AC 5B24D 5E5AC 1HTAA 3MGRD 3AV2B 3AV1C 3REKC 3LZ0B 2IO5C 2YFVA 1EQZD 3W97D 1WWIA 3UTBC 3AZLB 4KUDA 3EG5B 3WAAB 2PYOA 5B31C 4XZQC 3RELA 3NQUA 3W99D 1HQ3C 5GSUA 5CPJB 5GT3B 4WU9C 3AZND 4G91B 1S32D 3AZEA 3B6GB 3AZID 1BH9B 5DNMD 2Y2QA 5AV6C 1TAFA 3AYWC 5GT0B 2YFVB 3MGPC 4YS3A 2JSSA 1P3FC 4KUDB 4WU8B 3B0BA 3MNNA 1P3BD 4WJ3C 3W96C 2PYOB 1F66A 3V9RA 3AN2C 3RELB 5B2IC 4EO5C 1ZLAA 2BYKB 3AFAC 5BNVA 5AV9C 3AZFC 3AV2D 3AZEB 3P5JB 3LZ0D 2BYMA 4QLCA 1ID3D 3C1BA 2F8NK 3EPJA 3AZLD 1AOIC 2ZY4A 1P3KA 3WAAD 3WTPD 3KFUG 3LJAA 2FJ7A 4YS3B 3EPHA 3MNNB 1M1AC 5CPJD 5B40A 5AV5A 1F66B 3V9RB 4Z66B 3AZJA 1ZLAB 2Y2IA 2Y2LA 5GXQC 3MGQA 3AZMA 4XUJB 1PZRA 5B1MB 2BYMB 4E44A 4QLCB 3AZHA 1M18C 2NZDC 5B1LA 4J8VC 4KUDD 1P3KB 4Z5TA 5BS7C 3AZGA 3LJAB 2AROA 2PYOD 5CP6C 1P3AB 3RELD 2F8NA 5GSUD 2G5IC 1P34C 5B40B 3AV1B 4NE3A 3WTPE 3LELC 4YM6C 3REJA 2G5HC 3AZED 1KX5A 2ZY3A 5JRGA 3UTBB 2Y2NA 3R45A 5CPKA 1M19C 5B33C 3AZHB 5B31B 5B1LB 4YS3D 1HQ3B 3O62C 3MNND 2Y2KA 3AZGB 2AROB 3VH5T 1F66D 1ZLAD 2RVQD 5AY8A 3B6FA 5AV6B 2ZY5A 3AYWB 3KUYC 5JRGB 4HGAC 4QLCD 4UUZA 4NFTA 3C1BD 3MGPB 1P3FB 3R45B 4H9RB 3A6NA 3W98A 4X23C 3C1CA 2ZY2A 5B0YC 1KU5A 1P3KD 3X1TA 5CPKB 1P3IC 5B0ZC 3LJAD 2FJ7D 5B2JA 5AVBA 5B2IB 3WKJC 3REHA 4LD9A 5DNNA 5B40D 5AV9B 3AZFB 5AV5D 2XD5A 3MVDA 5AY8B 1AOIB 3B6FB 3TU4A 3MGQD 3FDDA 1P3PC 4UUZB 3AZHD 4J8XA 5B1LD 5C3IC 2NQBC 3A6NB 5BO0A 3W98B 1ULYA 1P3OC 4Z5TD 3F6TA 4JJNC 3AZGD 2AROD 4ZUXC 5AVBB 5BNXA 2F8ND 5GT3A 4LD9B 3B6GA 5GXQB 1BH9A 2HIOA 3REJD 1KX5D 5JRGD 3REIA 3X1UA 3MVDB 3TU4B 5GT0A 5CPKD 1P3MC 4H9SC 4J8XB 4WU8A 5BO0B 1KX3C 4WNNB 3VH6W 4KGCC 5BNXB 2DQNC 2BYKA 4H9PB 3X1VA 5AY8D 3B6FD 4M6BA 1P3LC 3AZKA 2HIOB 2F8NH 5CHLB 3EPLA 3WA9C 1M19B 5B33B 3REIB 3UT9C 5FUGA 3X1UB 1U35C 1KX4A 3A6ND 3W98D 3C1CD 3X1TD 3AZJC 1BFMA 4R8PA 3UTAC 5B2JD 5AVBD 3AZMC 3REHD 2Y2HA 4J8UC 4LD9D 5CPIC 5DNND 3VH5A 4Z66A 3KSYA 1JFIA 1P3GA 2XD1A 1TZYC 4HGAB 3MVDD 3X1VB 3X1SC 5F99C 4XUJA 3AZKB 5B1MA 3TU4D 3KWQA 5B0YB 4H9OA 5AVCA 1P3IB 5FUGB 4J8WC 4J8XD 1KX4B 3KXBC 5AV8A 5B32A 2CV5B 3LZ1A 3MGSA 3WKJB 5B24C 4R8PB 1P3AA 3MGRC 5GT3D 4AWLB 1A7WA 5E5AA 1EQZC 3W97C 3AV1A 3REKA 3B6GD 1W2EA 2HIOD 2DF4C 1JFIB 1P3GB 1H3OA 3NQJA 3REID 3UTBA 4DRAA 3X1UD 3W99C 3KWQB 5GT0D 4H9OB 5AVCB 5B31A 3A1KA 4XZQA 3AZNC 1S32C 4WU8D 1HQ3A 5AV8B 5B32B 3LZ1B 3MGSB 2Y2PA 3AZIC 3H0RC 4WU9A 5DNMC 4H9NA 2Y2GA 5BT1D 5E5AB 3X1VD 3REKB 5AV6A 4ZBJC 3AYWA 3AZKD 1P3BC 2IO5B 1H3OB 2CWEA 3NQJB 3MGPA 1P3MB 1P3FA 4H9RA 1KX4D 2CV5D 3W96A 4XZQB 4R8PD 3AN2A 5B2IA 3AV2C 4KGCB 3LZ0C 4WU9B 3AFAA 1ID3C 5AV9A 3AZFA 4CAYB 3AZLC 1B67A 4Z66D 4H9NB 1P3GD 3WAAC 1Q9CA 3WTPC 4G92C 3AL0C 1AOIA 1U35B 4XUJD 5B1MD 3KWQD 5CPJC 5AVCD 4G91C 1M1AA 5AV8D 5B32D 3LZ1D 3MGSD 3W96B 4NE5A 4J8UB 5CPIB 3AN2B 1P3AD 4EO5B 3AFAB 5E5AD 5GXQA 3AV1D 3REKD 2BG1A 5F99B 4KUDC 1M18A 4WZSB 3UTBD 4J8VA 2NZDA 2PYOC 1BH8B 3KXBB 3RELC 5BS7A 5B24B 5GSUC 5B31D 5CP6A 4XZQD 3AZEC 1HQ3D 1M1AB 1P34A 4WV4B 4WU9D 1EQZB 3W97B 4WNNA 3LELA 4YM6A 1F1EA 5B31G 4H9PA 4CSRA 4YS3C 5AV6D 3AYWD 1M19A 5B33A 3MNNC 2LY8A 1M18B 3MGPD 4J8VB 2NZDB 2F8NG 1P3FD 1F66C 3O62A 3W96D 2Y2OA 1ZLAC 2RVQC 5CP6B 3B0DC 5DNMB 3AN2D 5B2ID 1P34B 3AFAD 4QLCC 5AV9D 3C1BC 3AZFD 2HUEC 3LELB 4YM6B 3KUYA 2JCHA 1P3KC 3LJAC 1AOID 4DRBA 2FJ7C 4CSRB 4X23A 5B0YA 1P3IA 5B0ZA 5B40C 5AV5C 2CV5A 3O62B 1M1AD 3WKJA 1ID3B 2RIQA 3MGQC 3WTPB 2UWXA 4G92B 2L5AA 3AZHC 5GXQD 5B1LC 3KUYB 1P3PA 5G49A 1M18D 4Z5TC 2NZDD 4J8VD 3AZGC 2NQBA 2AROC 4X23B 1P3OA 3VH6T 5B0ZB 4JJNA 4ZUXA 5CP6D 4H9QA 3REJC 4KHAA 1KX5C 1N1JA 1P34D 5JRGC 3LELD 4YM6D 1WWSA 5CPKC 3NQUB 1P3PB 1M19D 5GSUB 4H9SA 5G49B 5B33D 1P3MA 5C3IB 2NQBB 3O62D 1KX3A 1P3OB 4JJNB 4ZUXB 5AY8C 4KGCA 3B6FC 4H9QB 4KHAB 1TAFB 1N1JB 4CAYA 3H0MC 4E45A 3WA9A 1P3LA 3A6NC 3KUYD 3W98C 3C1CC 3UT9A 3X1TC 1U35A 5AVBC 5B2JC 4X23D 5B0YD 3B0CW 1P3ID 1T3UA 5B0ZD 3REHC 3UTAA 4LD9C 5DNNC 3B0DB 2J8PA 5BNVB 2FFFB 1KX3B 3WKJD 3VH5W 4J8UA 5CPIA 4DQYB 3C1BB 3MVDC 2HUEB 3IP4C 1TZYA 3TU4C 4Z2MG 5KDMA 3X1SA 3WA9B 5F99A 4J8XC 1P3LB 2FJ7B 2VQRA 1P3PD 3UT9B 4J8WA 1BH8A 4NE6A 3KXBA 2NQBD 5AV5B 5B24A 1P3OD 5GT3C 3AZJB 4JJND 3MGRA 4ZUXD 3UTAB 2JE5A 3B6GC 2HIOC 3MGQB 3AZMB 3W97A 1EQZA 3REIC 4Z2MH 3X1UC 3B0CT 2ZM5A 2Y2MA 1TZYB 5GT0C 4Z5TB 5KDMB 5B32G 3X1SB 3W99A 4WU8C 2F8NB 3EPKA 1P3MD 3AZNA 2F2AC 4J8WB 1S32A 3AZIA 3REJB 1KX5B 1KX3D 5JA4A 3VH6A 5BT1C 5DNMA 3MGRB 3X1VC 2YFWA 4KGCD 3H0LC 3AZKC 3WA9D 1P3LD 1KX4C 1P3BA 2CV5C 3UT9D 1B6WA 1U35D 4R8PC 3W99B 3AZJD 1Z2CB 4AWLC 3AZNB 4UPKA 3UTAD 3AV2A 1S32B 4Z66C 3LZ0A 3AZIB 3AZMD 1P3GC 1ID3A 5JA4B 4J8UD 2Y2JA 3AZLA 5CPID 2YFWB 3WAAA 4XUJC 3WTPA 5B1MC 1TZYD 3KWQC 3C1CB 5AVCC 3X1TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1S D;  4ZBJ B;  5F99 D;  5B2J B;  1R4V A;  1P3B B;  5AV8 C;  5B32 C;  5CPJ A;  3LZ1 C;  3MGS C;  3REH B;  4J8W D;  5DNN B;  3KXB D;  1P3A C;  5B24 D;  5E5A C;  1HTA A;  3MGR D;  3AV2 B;  3AV1 C;  3REK C;  3LZ0 B;  2IO5 C;  2YFV A;  1EQZ D;  3W97 D;  1WWI A;  3UTB C;  3AZL B;  4KUD A;  3WAA B;  2PYO A;  5B31 C;  4XZQ C;  3REL A;  3NQU A;  3W99 D;  1HQ3 C;  5GSU A;  5CPJ B;  5GT3 B;  4WU9 C;  3AZN D;  4G91 B;  1S32 D;  3AZE A;  3B6G B;  3AZI D;  1BH9 B;  5DNM D;  5AV6 C;  1TAF A;  3AYW C;  5GT0 B;  2YFV B;  3MGP C;  4YS3 A;  2JSS A;  1P3F C;  4KUD B;  4WU8 B;  3B0B A;  3MNN A;  1P3B D;  3W96 C;  2PYO B;  1F66 A;  3V9R A;  3AN2 C;  3REL B;  5B2I C;  4EO5 C;  1ZLA A;  2BYK B;  3AFA C;  5BNV A;  5AV9 C;  3AZF C;  3AV2 D;  3AZE B;  3LZ0 D;  2BYM A;  4QLC A;  1ID3 D;  3C1B A;  2F8N K;  3AZL D;  1AOI C;  1P3K A;  3WAA D;  3WTP D;  3LJA A;  2FJ7 A;  4YS3 B;  3MNN B;  1M1A C;  5CPJ D;  5B40 A;  5AV5 A;  1F66 B;  3V9R B;  4Z66 B;  3AZJ A;  1ZLA B;  5GXQ C;  3MGQ A;  3AZM A;  4XUJ B;  5B1M B;  2BYM B;  4E44 A;  4QLC B;  3AZH A;  1M18 C;  2NZD C;  5B1L A;  4J8V C;  4KUD D;  1P3K B;  4Z5T A;  5BS7 C;  3AZG A;  3LJA B;  2ARO A;  2PYO D;  5CP6 C;  1P3A B;  3REL D;  2F8N A;  5GSU D;  1P34 C;  5B40 B;  3AV1 B;  4NE3 A;  3WTP E;  3LEL C;  4YM6 C;  3REJ A;  3AZE D;  1KX5 A;  5JRG A;  3UTB B;  3R45 A;  5CPK A;  1M19 C;  5B33 C;  3AZH B;  5B31 B;  5B1L B;  4YS3 D;  1HQ3 B;  3O62 C;  3MNN D;  3AZG B;  2ARO B;  3VH5 T;  1F66 D;  1ZLA D;  2RVQ D;  5AY8 A;  3B6F A;  5AV6 B;  3AYW B;  3KUY C;  5JRG B;  4HGA C;  4QLC D;  4UUZ A;  4NFT A;  3C1B D;  3MGP B;  1P3F B;  3R45 B;  4H9R B;  3A6N A;  3W98 A;  4X23 C;  3C1C A;  5B0Y C;  1KU5 A;  1P3K D;  3X1T A;  5CPK B;  1P3I C;  5B0Z C;  3LJA D;  2FJ7 D;  5B2J A;  5AVB A;  5B2I B;  3WKJ C;  3REH A;  4LD9 A;  5DNN A;  5B40 D;  5AV9 B;  3AZF B;  5AV5 D;  3MVD A;  5AY8 B;  1AOI B;  3B6F B;  3TU4 A;  3MGQ D;  1P3P C;  4UUZ B;  3AZH D;  4J8X A;  5B1L D;  5C3I C;  2NQB C;  3A6N B;  5BO0 A;  3W98 B;  1ULY A;  1P3O C;  4Z5T D;  4JJN C;  3AZG D;  2ARO D;  4ZUX C;  5AVB B;  5BNX A;  2F8N D;  5GT3 A;  4LD9 B;  3B6G A;  5GXQ B;  1BH9 A;  2HIO A;  3REJ D;  1KX5 D;  5JRG D;  3REI A;  3X1U A;  3MVD B;  3TU4 B;  5GT0 A;  5CPK D;  1P3M C;  4H9S C;  4J8X B;  4WU8 A;  5BO0 B;  1KX3 C;  4WNN B;  3VH6 W;  4KGC C;  5BNX B;  2BYK A;  4H9P B;  3X1V A;  5AY8 D;  3B6F D;  4M6B A;  1P3L C;  3AZK A;  2HIO B;  2F8N H;  5CHL B;  3WA9 C;  1M19 B;  5B33 B;  3REI B;  3UT9 C;  5FUG A;  3X1U B;  1U35 C;  1KX4 A;  3A6N D;  3W98 D;  3C1C D;  3X1T D;  3AZJ C;  1BFM A;  4R8P A;  3UTA C;  5B2J D;  5AVB D;  3AZM C;  3REH D;  4J8U C;  4LD9 D;  5CPI C;  5DNN D;  3VH5 A;  4Z66 A;  3KSY A;  1JFI A;  1P3G A;  1TZY C;  4HGA B;  3MVD D;  3X1V B;  3X1S C;  5F99 C;  4XUJ A;  3AZK B;  5B1M A;  3TU4 D;  3KWQ A;  5B0Y B;  4H9O A;  5AVC A;  1P3I B;  5FUG B;  4J8W C;  4J8X D;  1KX4 B;  3KXB C;  5AV8 A;  5B32 A;  2CV5 B;  3LZ1 A;  3MGS A;  3WKJ B;  5B24 C;  4R8P B;  1P3A A;  3MGR C;  5GT3 D;  4AWL B;  1A7W A;  5E5A A;  1EQZ C;  3W97 C;  3AV1 A;  3REK A;  3B6G D;  2HIO D;  1JFI B;  1P3G B;  1H3O A;  3NQJ A;  3REI D;  3UTB A;  4DRA A;  3X1U D;  3W99 C;  3KWQ B;  5GT0 D;  4H9O B;  5AVC B;  5B31 A;  4XZQ A;  3AZN C;  1S32 C;  4WU8 D;  1HQ3 A;  5AV8 B;  5B32 B;  3LZ1 B;  3MGS B;  3AZI C;  4WU9 A;  5DNM C;  4H9N A;  5BT1 D;  5E5A B;  3X1V D;  3REK B;  5AV6 A;  4ZBJ C;  3AYW A;  3AZK D;  1P3B C;  2IO5 B;  1H3O B;  2CWE A;  3NQJ B;  3MGP A;  1P3M B;  1P3F A;  4H9R A;  1KX4 D;  2CV5 D;  3W96 A;  4XZQ B;  4R8P D;  3AN2 A;  5B2I A;  3AV2 C;  4KGC B;  3LZ0 C;  4WU9 B;  3AFA A;  1ID3 C;  5AV9 A;  3AZF A;  4CAY B;  3AZL C;  1B67 A;  4Z66 D;  4H9N B;  1P3G D;  3WAA C;  1Q9C A;  3WTP C;  4G92 C;  1AOI A;  1U35 B;  4XUJ D;  5B1M D;  3KWQ D;  5CPJ C;  5AVC D;  4G91 C;  1M1A A;  5AV8 D;  5B32 D;  3LZ1 D;  3MGS D;  3W96 B;  4NE5 A;  4J8U B;  5CPI B;  3AN2 B;  1P3A D;  4EO5 B;  3AFA B;  5E5A D;  5GXQ A;  3AV1 D;  3REK D;  5F99 B;  4KUD C;  1M18 A;  4WZS B;  3UTB D;  4J8V A;  2NZD A;  2PYO C;  1BH8 B;  3KXB B;  3REL C;  5BS7 A;  5B24 B;  5GSU C;  5B31 D;  5CP6 A;  4XZQ D;  3AZE C;  1HQ3 D;  1M1A B;  1P34 A;  4WV4 B;  4WU9 D;  1EQZ B;  3W97 B;  4WNN A;  3LEL A;  4YM6 A;  1F1E A;  5B31 G;  4H9P A;  4CSR A;  4YS3 C;  5AV6 D;  3AYW D;  1M19 A;  5B33 A;  3MNN C;  2LY8 A;  1M18 B;  3MGP D;  4J8V B;  2NZD B;  2F8N G;  1P3F D;  1F66 C;  3O62 A;  3W96 D;  1ZLA C;  2RVQ C;  5CP6 B;  3B0D C;  5DNM B;  3AN2 D;  5B2I D;  1P34 B;  3AFA D;  4QLC C;  5AV9 D;  3C1B C;  3AZF D;  2HUE C;  3LEL B;  4YM6 B;  3KUY A;  1P3K C;  3LJA C;  1AOI D;  4DRB A;  2FJ7 C;  4CSR B;  4X23 A;  5B0Y A;  1P3I A;  5B0Z A;  5B40 C;  5AV5 C;  2CV5 A;  3O62 B;  1M1A D;  3WKJ A;  1ID3 B;  3MGQ C;  3WTP B;  4G92 B;  2L5A A;  3AZH C;  5GXQ D;  5B1L C;  3KUY B;  1P3P A;  5G49 A;  1M18 D;  4Z5T C;  2NZD D;  4J8V D;  3AZG C;  2NQB A;  2ARO C;  4X23 B;  1P3O A;  3VH6 T;  5B0Z B;  4JJN A;  4ZUX A;  5CP6 D;  4H9Q A;  3REJ C;  4KHA A;  1KX5 C;  1N1J A;  1P34 D;  5JRG C;  3LEL D;  4YM6 D;  1WWS A;  5CPK C;  3NQU B;  1P3P B;  1M19 D;  5GSU B;  4H9S A;  5G49 B;  5B33 D;  1P3M A;  5C3I B;  2NQB B;  3O62 D;  1KX3 A;  1P3O B;  4JJN B;  4ZUX B;  5AY8 C;  4KGC A;  3B6F C;  4H9Q B;  4KHA B;  1TAF B;  1N1J B;  4CAY A;  4E45 A;  3WA9 A;  1P3L A;  3A6N C;  3KUY D;  3W98 C;  3C1C C;  3UT9 A;  3X1T C;  1U35 A;  5AVB C;  5B2J C;  4X23 D;  5B0Y D;  3B0C W;  1P3I D;  5B0Z D;  3REH C;  3UTA A;  4LD9 C;  5DNN C;  3B0D B;  5BNV B;  1KX3 B;  3WKJ D;  3VH5 W;  4J8U A;  5CPI A;  3C1B B;  3MVD C;  2HUE B;  1TZY A;  3TU4 C;  4Z2M G;  5KDM A;  3X1S A;  3WA9 B;  5F99 A;  4J8X C;  1P3L B;  2FJ7 B;  1P3P D;  3UT9 B;  4J8W A;  1BH8 A;  4NE6 A;  3KXB A;  2NQB D;  5AV5 B;  5B24 A;  1P3O D;  5GT3 C;  3AZJ B;  4JJN D;  3MGR A;  4ZUX D;  3UTA B;  3B6G C;  2HIO C;  3MGQ B;  3AZM B;  3W97 A;  1EQZ A;  3REI C;  4Z2M H;  3X1U C;  3B0C T;  1TZY B;  5GT0 C;  4Z5T B;  5KDM B;  5B32 G;  3X1S B;  3W99 A;  4WU8 C;  2F8N B;  1P3M D;  3AZN A;  4J8W B;  1S32 A;  3AZI A;  3REJ B;  1KX5 B;  1KX3 D;  5JA4 A;  3VH6 A;  5BT1 C;  5DNM A;  3MGR B;  3X1V C;  2YFW A;  4KGC D;  3AZK C;  3WA9 D;  1P3L D;  1KX4 C;  1P3B A;  2CV5 C;  3UT9 D;  1B6W A;  1U35 D;  4R8P C;  3W99 B;  3AZJ D;  4AWL C;  3AZN B;  3UTA D;  3AV2 A;  1S32 B;  4Z66 C;  3LZ0 A;  3AZI B;  3AZM D;  1P3G C;  1ID3 A;  5JA4 B;  4J8U D;  3AZL A;  5CPI D;  2YFW B;  3WAA A;  4XUJ C;  3WTP A;  5B1M C;  1TZY D;  3KWQ C;  3C1C B;  5AVC C;  3X1T B; 
#chains in the Genus database with same CATH topology
 3X1S D;  4ZBJ B;  5F99 D;  5B2J B;  1R4V A;  1P3B B;  5AV8 C;  5B32 C;  5CPJ A;  3LZ1 C;  3MGS C;  2W8S A;  3A1I A;  4J8W D;  3REH B;  5DNN B;  3KXB D;  1P3A C;  5B24 D;  5E5A C;  1HTA A;  3MGR D;  3AV2 B;  3AV1 C;  3REK C;  3LZ0 B;  2IO5 C;  2YFV A;  1EQZ D;  3W97 D;  1WWI A;  3UTB C;  3AZL B;  4KUD A;  3EG5 B;  3WAA B;  2PYO A;  5B31 C;  4XZQ C;  3REL A;  3NQU A;  3W99 D;  1HQ3 C;  5GSU A;  5CPJ B;  5GT3 B;  4WU9 C;  3AZN D;  4G91 B;  1S32 D;  3AZE A;  3B6G B;  3AZI D;  1BH9 B;  5DNM D;  2Y2Q A;  5AV6 C;  1TAF A;  3AYW C;  5GT0 B;  2YFV B;  3MGP C;  4YS3 A;  2JSS A;  1P3F C;  4KUD B;  4WU8 B;  3B0B A;  3MNN A;  1P3B D;  4WJ3 C;  3W96 C;  2PYO B;  1F66 A;  3V9R A;  3AN2 C;  3REL B;  5B2I C;  4EO5 C;  1ZLA A;  2BYK B;  3AFA C;  5BNV A;  5AV9 C;  3AZF C;  3AV2 D;  3AZE B;  3P5J B;  3LZ0 D;  2BYM A;  4QLC A;  1ID3 D;  3C1B A;  2F8N K;  3EPJ A;  3AZL D;  1AOI C;  2ZY4 A;  1P3K A;  3WAA D;  3WTP D;  3KFU G;  3LJA A;  2FJ7 A;  4YS3 B;  3EPH A;  3MNN B;  1M1A C;  5CPJ D;  5B40 A;  5AV5 A;  1F66 B;  3V9R B;  4Z66 B;  3AZJ A;  1ZLA B;  2Y2I A;  2Y2L A;  5GXQ C;  3MGQ A;  3AZM A;  4XUJ B;  1PZR A;  5B1M B;  2BYM B;  4E44 A;  4QLC B;  3AZH A;  1M18 C;  2NZD C;  5B1L A;  4J8V C;  4KUD D;  1P3K B;  4Z5T A;  5BS7 C;  3AZG A;  3LJA B;  2ARO A;  2PYO D;  5CP6 C;  1P3A B;  3REL D;  2F8N A;  5GSU D;  2G5I C;  1P34 C;  5B40 B;  3AV1 B;  4NE3 A;  3WTP E;  3LEL C;  4YM6 C;  3REJ A;  2G5H C;  3AZE D;  1KX5 A;  2ZY3 A;  5JRG A;  3UTB B;  2Y2N A;  3R45 A;  5CPK A;  1M19 C;  5B33 C;  3AZH B;  5B31 B;  5B1L B;  4YS3 D;  1HQ3 B;  3O62 C;  3MNN D;  2Y2K A;  3AZG B;  2ARO B;  3VH5 T;  1F66 D;  1ZLA D;  2RVQ D;  5AY8 A;  3B6F A;  5AV6 B;  2ZY5 A;  3AYW B;  3KUY C;  5JRG B;  4HGA C;  4QLC D;  4UUZ A;  4NFT A;  3C1B D;  3MGP B;  1P3F B;  3R45 B;  4H9R B;  3A6N A;  3W98 A;  4X23 C;  3C1C A;  2ZY2 A;  5B0Y C;  1KU5 A;  1P3K D;  3X1T A;  5CPK B;  1P3I C;  5B0Z C;  3LJA D;  2FJ7 D;  5B2J A;  5AVB A;  5B2I B;  3WKJ C;  3REH A;  4LD9 A;  5DNN A;  5B40 D;  5AV9 B;  3AZF B;  5AV5 D;  2XD5 A;  3MVD A;  5AY8 B;  1AOI B;  3B6F B;  3TU4 A;  3MGQ D;  3FDD A;  1P3P C;  4UUZ B;  3AZH D;  4J8X A;  5B1L D;  5C3I C;  2NQB C;  3A6N B;  5BO0 A;  3W98 B;  1ULY A;  1P3O C;  4Z5T D;  3F6T A;  4JJN C;  3AZG D;  2ARO D;  4ZUX C;  5AVB B;  5BNX A;  2F8N D;  5GT3 A;  4LD9 B;  3B6G A;  5GXQ B;  1BH9 A;  2HIO A;  3REJ D;  1KX5 D;  5JRG D;  3REI A;  3X1U A;  3MVD B;  3TU4 B;  5GT0 A;  5CPK D;  1P3M C;  4H9S C;  4J8X B;  4WU8 A;  5BO0 B;  1KX3 C;  4WNN B;  3VH6 W;  4KGC C;  5BNX B;  2DQN C;  2BYK A;  4H9P B;  3X1V A;  5AY8 D;  3B6F D;  4M6B A;  1P3L C;  3AZK A;  2HIO B;  2F8N H;  5CHL B;  3EPL A;  3WA9 C;  1M19 B;  5B33 B;  3REI B;  3UT9 C;  5FUG A;  3X1U B;  1U35 C;  1KX4 A;  3A6N D;  3W98 D;  3C1C D;  3X1T D;  3AZJ C;  1BFM A;  4R8P A;  3UTA C;  5B2J D;  5AVB D;  3AZM C;  3REH D;  2Y2H A;  4J8U C;  4LD9 D;  5CPI C;  5DNN D;  3VH5 A;  4Z66 A;  3KSY A;  1JFI A;  1P3G A;  2XD1 A;  1TZY C;  4HGA B;  3MVD D;  3X1V B;  3X1S C;  5F99 C;  4XUJ A;  3AZK B;  5B1M A;  3TU4 D;  3KWQ A;  5B0Y B;  4H9O A;  5AVC A;  1P3I B;  5FUG B;  4J8W C;  4J8X D;  1KX4 B;  3KXB C;  5AV8 A;  5B32 A;  2CV5 B;  3LZ1 A;  3MGS A;  3WKJ B;  5B24 C;  4R8P B;  1P3A A;  3MGR C;  5GT3 D;  4AWL B;  1A7W A;  5E5A A;  1EQZ C;  3W97 C;  3AV1 A;  3REK A;  3B6G D;  1W2E A;  2HIO D;  2DF4 C;  1JFI B;  1P3G B;  1H3O A;  3NQJ A;  3REI D;  3UTB A;  4DRA A;  3X1U D;  3W99 C;  3KWQ B;  5GT0 D;  4H9O B;  5AVC B;  5B31 A;  3A1K A;  4XZQ A;  3AZN C;  1S32 C;  4WU8 D;  1HQ3 A;  5AV8 B;  5B32 B;  3LZ1 B;  3MGS B;  2Y2P A;  3AZI C;  3H0R C;  4WU9 A;  5DNM C;  4H9N A;  2Y2G A;  5BT1 D;  5E5A B;  3X1V D;  3REK B;  5AV6 A;  4ZBJ C;  3AYW A;  3AZK D;  1P3B C;  2IO5 B;  1H3O B;  2CWE A;  3NQJ B;  3MGP A;  1P3M B;  1P3F A;  4H9R A;  1KX4 D;  2CV5 D;  3W96 A;  4XZQ B;  4R8P D;  3AN2 A;  5B2I A;  3AV2 C;  4KGC B;  3LZ0 C;  4WU9 B;  3AFA A;  1ID3 C;  5AV9 A;  3AZF A;  4CAY B;  3AZL C;  1B67 A;  4Z66 D;  4H9N B;  1P3G D;  3WAA C;  1Q9C A;  3WTP C;  4G92 C;  3AL0 C;  1AOI A;  1U35 B;  4XUJ D;  5B1M D;  3KWQ D;  5CPJ C;  5AVC D;  4G91 C;  1M1A A;  5AV8 D;  5B32 D;  3LZ1 D;  3MGS D;  3W96 B;  4NE5 A;  4J8U B;  5CPI B;  3AN2 B;  1P3A D;  4EO5 B;  3AFA B;  5E5A D;  5GXQ A;  3AV1 D;  3REK D;  2BG1 A;  5F99 B;  4KUD C;  1M18 A;  4WZS B;  3UTB D;  4J8V A;  2NZD A;  2PYO C;  1BH8 B;  3KXB B;  3REL C;  5BS7 A;  5B24 B;  5GSU C;  5B31 D;  5CP6 A;  4XZQ D;  3AZE C;  1HQ3 D;  1M1A B;  1P34 A;  4WV4 B;  4WU9 D;  1EQZ B;  3W97 B;  4WNN A;  3LEL A;  4YM6 A;  1F1E A;  5B31 G;  4H9P A;  4CSR A;  4YS3 C;  5AV6 D;  3AYW D;  1M19 A;  5B33 A;  3MNN C;  2LY8 A;  1M18 B;  3MGP D;  4J8V B;  2NZD B;  2F8N G;  1P3F D;  1F66 C;  3O62 A;  3W96 D;  2Y2O A;  1ZLA C;  2RVQ C;  5CP6 B;  3B0D C;  5DNM B;  3AN2 D;  5B2I D;  1P34 B;  3AFA D;  4QLC C;  5AV9 D;  3C1B C;  3AZF D;  2HUE C;  3LEL B;  4YM6 B;  3KUY A;  2JCH A;  1P3K C;  3LJA C;  1AOI D;  4DRB A;  2FJ7 C;  4CSR B;  4X23 A;  5B0Y A;  1P3I A;  5B0Z A;  5B40 C;  5AV5 C;  2CV5 A;  3O62 B;  1M1A D;  3WKJ A;  1ID3 B;  2RIQ A;  3MGQ C;  3WTP B;  2UWX A;  4G92 B;  2L5A A;  3AZH C;  5GXQ D;  5B1L C;  3KUY B;  1P3P A;  5G49 A;  1M18 D;  4Z5T C;  2NZD D;  4J8V D;  3AZG C;  2NQB A;  2ARO C;  4X23 B;  1P3O A;  3VH6 T;  5B0Z B;  4JJN A;  4ZUX A;  5CP6 D;  4H9Q A;  3REJ C;  4KHA A;  1KX5 C;  1N1J A;  1P34 D;  5JRG C;  3LEL D;  4YM6 D;  1WWS A;  5CPK C;  3NQU B;  1P3P B;  1M19 D;  5GSU B;  4H9S A;  5G49 B;  5B33 D;  1P3M A;  5C3I B;  2NQB B;  3O62 D;  1KX3 A;  1P3O B;  4JJN B;  4ZUX B;  5AY8 C;  4KGC A;  3B6F C;  4H9Q B;  4KHA B;  1TAF B;  1N1J B;  4CAY A;  3H0M C;  4E45 A;  3WA9 A;  1P3L A;  3A6N C;  3KUY D;  3W98 C;  3C1C C;  3UT9 A;  3X1T C;  1U35 A;  5AVB C;  5B2J C;  4X23 D;  5B0Y D;  3B0C W;  1P3I D;  1T3U A;  5B0Z D;  3REH C;  3UTA A;  4LD9 C;  5DNN C;  3B0D B;  2J8P A;  5BNV B;  2FFF B;  1KX3 B;  3WKJ D;  3VH5 W;  4J8U A;  5CPI A;  4DQY B;  3C1B B;  3MVD C;  2HUE B;  3IP4 C;  1TZY A;  3TU4 C;  4Z2M G;  5KDM A;  3X1S A;  3WA9 B;  5F99 A;  4J8X C;  1P3L B;  2FJ7 B;  2VQR A;  1P3P D;  3UT9 B;  4J8W A;  1BH8 A;  4NE6 A;  3KXB A;  2NQB D;  5AV5 B;  5B24 A;  1P3O D;  5GT3 C;  3AZJ B;  4JJN D;  3MGR A;  4ZUX D;  3UTA B;  2JE5 A;  3B6G C;  2HIO C;  3MGQ B;  3AZM B;  3W97 A;  1EQZ A;  3REI C;  4Z2M H;  3X1U C;  3B0C T;  2ZM5 A;  2Y2M A;  1TZY B;  5GT0 C;  4Z5T B;  5KDM B;  5B32 G;  3X1S B;  3W99 A;  4WU8 C;  2F8N B;  3EPK A;  1P3M D;  3AZN A;  2F2A C;  4J8W B;  1S32 A;  3AZI A;  3REJ B;  1KX5 B;  1KX3 D;  5JA4 A;  3VH6 A;  5BT1 C;  5DNM A;  3MGR B;  3X1V C;  2YFW A;  4KGC D;  3H0L C;  3AZK C;  3WA9 D;  1P3L D;  1KX4 C;  1P3B A;  2CV5 C;  3UT9 D;  1B6W A;  1U35 D;  4R8P C;  3W99 B;  3AZJ D;  1Z2C B;  4AWL C;  3AZN B;  4UPK A;  3UTA D;  3AV2 A;  1S32 B;  4Z66 C;  3LZ0 A;  3AZI B;  3AZM D;  1P3G C;  1ID3 A;  5JA4 B;  4J8U D;  2Y2J A;  3AZL A;  5CPI D;  2YFW B;  3WAA A;  4XUJ C;  3WTP A;  5B1M C;  1TZY D;  3KWQ C;  3C1C B;  5AVC C;  3X1T B; 
#chains in the Genus database with same CATH homology
 3X1S D;  4ZBJ B;  5F99 D;  5B2J B;  1R4V A;  1P3B B;  5AV8 C;  5B32 C;  5CPJ A;  3LZ1 C;  3MGS C;  2W8S A;  3A1I A;  4J8W D;  3REH B;  5DNN B;  3KXB D;  1P3A C;  5B24 D;  5E5A C;  1HTA A;  3MGR D;  3AV2 B;  3AV1 C;  3REK C;  3LZ0 B;  2IO5 C;  2YFV A;  1EQZ D;  3W97 D;  1WWI A;  3UTB C;  3AZL B;  4KUD A;  3EG5 B;  3WAA B;  2PYO A;  5B31 C;  4XZQ C;  3REL A;  3NQU A;  3W99 D;  1HQ3 C;  5GSU A;  5CPJ B;  5GT3 B;  4WU9 C;  3AZN D;  4G91 B;  1S32 D;  3AZE A;  3B6G B;  3AZI D;  1BH9 B;  5DNM D;  2Y2Q A;  5AV6 C;  1TAF A;  3AYW C;  5GT0 B;  2YFV B;  3MGP C;  4YS3 A;  2JSS A;  1P3F C;  4KUD B;  4WU8 B;  3B0B A;  3MNN A;  1P3B D;  4WJ3 C;  3W96 C;  2PYO B;  1F66 A;  3V9R A;  3AN2 C;  3REL B;  5B2I C;  4EO5 C;  1ZLA A;  2BYK B;  3AFA C;  5BNV A;  5AV9 C;  3AZF C;  3AV2 D;  3AZE B;  3P5J B;  3LZ0 D;  2BYM A;  4QLC A;  1ID3 D;  3C1B A;  2F8N K;  3EPJ A;  3AZL D;  1AOI C;  2ZY4 A;  1P3K A;  3WAA D;  3WTP D;  3KFU G;  3LJA A;  2FJ7 A;  4YS3 B;  3EPH A;  3MNN B;  1M1A C;  5CPJ D;  5B40 A;  5AV5 A;  1F66 B;  3V9R B;  4Z66 B;  3AZJ A;  1ZLA B;  2Y2I A;  2Y2L A;  5GXQ C;  3MGQ A;  3AZM A;  4XUJ B;  1PZR A;  5B1M B;  2BYM B;  4E44 A;  4QLC B;  3AZH A;  1M18 C;  2NZD C;  5B1L A;  4J8V C;  4KUD D;  1P3K B;  4Z5T A;  5BS7 C;  3AZG A;  3LJA B;  2ARO A;  2PYO D;  5CP6 C;  1P3A B;  3REL D;  2F8N A;  5GSU D;  2G5I C;  1P34 C;  5B40 B;  3AV1 B;  4NE3 A;  3WTP E;  3LEL C;  4YM6 C;  3REJ A;  2G5H C;  3AZE D;  1KX5 A;  2ZY3 A;  5JRG A;  3UTB B;  2Y2N A;  3R45 A;  5CPK A;  1M19 C;  5B33 C;  3AZH B;  5B31 B;  5B1L B;  4YS3 D;  1HQ3 B;  3O62 C;  3MNN D;  2Y2K A;  3AZG B;  2ARO B;  3VH5 T;  1F66 D;  1ZLA D;  2RVQ D;  5AY8 A;  3B6F A;  5AV6 B;  2ZY5 A;  3AYW B;  3KUY C;  5JRG B;  4HGA C;  4QLC D;  4UUZ A;  4NFT A;  3C1B D;  3MGP B;  1P3F B;  3R45 B;  4H9R B;  3A6N A;  3W98 A;  4X23 C;  3C1C A;  2ZY2 A;  5B0Y C;  1KU5 A;  1P3K D;  3X1T A;  5CPK B;  1P3I C;  5B0Z C;  3LJA D;  2FJ7 D;  5B2J A;  5AVB A;  5B2I B;  3WKJ C;  3REH A;  4LD9 A;  5DNN A;  5B40 D;  5AV9 B;  3AZF B;  5AV5 D;  2XD5 A;  3MVD A;  5AY8 B;  1AOI B;  3B6F B;  3TU4 A;  3MGQ D;  3FDD A;  1P3P C;  4UUZ B;  3AZH D;  4J8X A;  5B1L D;  5C3I C;  2NQB C;  3A6N B;  5BO0 A;  3W98 B;  1ULY A;  1P3O C;  4Z5T D;  3F6T A;  4JJN C;  3AZG D;  2ARO D;  4ZUX C;  5AVB B;  5BNX A;  2F8N D;  5GT3 A;  4LD9 B;  3B6G A;  5GXQ B;  1BH9 A;  2HIO A;  3REJ D;  1KX5 D;  5JRG D;  3REI A;  3X1U A;  3MVD B;  3TU4 B;  5GT0 A;  5CPK D;  1P3M C;  4H9S C;  4J8X B;  4WU8 A;  5BO0 B;  1KX3 C;  4WNN B;  3VH6 W;  4KGC C;  5BNX B;  2DQN C;  2BYK A;  4H9P B;  3X1V A;  5AY8 D;  3B6F D;  4M6B A;  1P3L C;  3AZK A;  2HIO B;  2F8N H;  5CHL B;  3EPL A;  3WA9 C;  1M19 B;  5B33 B;  3REI B;  3UT9 C;  5FUG A;  3X1U B;  1U35 C;  1KX4 A;  3A6N D;  3W98 D;  3C1C D;  3X1T D;  3AZJ C;  1BFM A;  4R8P A;  3UTA C;  5B2J D;  5AVB D;  3AZM C;  3REH D;  2Y2H A;  4J8U C;  4LD9 D;  5CPI C;  5DNN D;  3VH5 A;  4Z66 A;  3KSY A;  1JFI A;  1P3G A;  2XD1 A;  1TZY C;  4HGA B;  3MVD D;  3X1V B;  3X1S C;  5F99 C;  4XUJ A;  3AZK B;  5B1M A;  3TU4 D;  3KWQ A;  5B0Y B;  4H9O A;  5AVC A;  1P3I B;  5FUG B;  4J8W C;  4J8X D;  1KX4 B;  3KXB C;  5AV8 A;  5B32 A;  2CV5 B;  3LZ1 A;  3MGS A;  3WKJ B;  5B24 C;  4R8P B;  1P3A A;  3MGR C;  5GT3 D;  4AWL B;  1A7W A;  5E5A A;  1EQZ C;  3W97 C;  3AV1 A;  3REK A;  3B6G D;  1W2E A;  2HIO D;  2DF4 C;  1JFI B;  1P3G B;  1H3O A;  3NQJ A;  3REI D;  3UTB A;  4DRA A;  3X1U D;  3W99 C;  3KWQ B;  5GT0 D;  4H9O B;  5AVC B;  5B31 A;  3A1K A;  4XZQ A;  3AZN C;  1S32 C;  4WU8 D;  1HQ3 A;  5AV8 B;  5B32 B;  3LZ1 B;  3MGS B;  2Y2P A;  3AZI C;  3H0R C;  4WU9 A;  5DNM C;  4H9N A;  2Y2G A;  5BT1 D;  5E5A B;  3X1V D;  3REK B;  5AV6 A;  4ZBJ C;  3AYW A;  3AZK D;  1P3B C;  2IO5 B;  1H3O B;  2CWE A;  3NQJ B;  3MGP A;  1P3M B;  1P3F A;  4H9R A;  1KX4 D;  2CV5 D;  3W96 A;  4XZQ B;  4R8P D;  3AN2 A;  5B2I A;  3AV2 C;  4KGC B;  3LZ0 C;  4WU9 B;  3AFA A;  1ID3 C;  5AV9 A;  3AZF A;  4CAY B;  3AZL C;  1B67 A;  4Z66 D;  4H9N B;  1P3G D;  3WAA C;  1Q9C A;  3WTP C;  4G92 C;  3AL0 C;  1AOI A;  1U35 B;  4XUJ D;  5B1M D;  3KWQ D;  5CPJ C;  5AVC D;  4G91 C;  1M1A A;  5AV8 D;  5B32 D;  3LZ1 D;  3MGS D;  3W96 B;  4NE5 A;  4J8U B;  5CPI B;  3AN2 B;  1P3A D;  4EO5 B;  3AFA B;  5E5A D;  5GXQ A;  3AV1 D;  3REK D;  2BG1 A;  5F99 B;  4KUD C;  1M18 A;  4WZS B;  3UTB D;  4J8V A;  2NZD A;  2PYO C;  1BH8 B;  3KXB B;  3REL C;  5BS7 A;  5B24 B;  5GSU C;  5B31 D;  5CP6 A;  4XZQ D;  3AZE C;  1HQ3 D;  1M1A B;  1P34 A;  4WV4 B;  4WU9 D;  1EQZ B;  3W97 B;  4WNN A;  3LEL A;  4YM6 A;  1F1E A;  5B31 G;  4H9P A;  4CSR A;  4YS3 C;  5AV6 D;  3AYW D;  1M19 A;  5B33 A;  3MNN C;  2LY8 A;  1M18 B;  3MGP D;  4J8V B;  2NZD B;  2F8N G;  1P3F D;  1F66 C;  3O62 A;  3W96 D;  2Y2O A;  1ZLA C;  2RVQ C;  5CP6 B;  3B0D C;  5DNM B;  3AN2 D;  5B2I D;  1P34 B;  3AFA D;  4QLC C;  5AV9 D;  3C1B C;  3AZF D;  2HUE C;  3LEL B;  4YM6 B;  3KUY A;  2JCH A;  1P3K C;  3LJA C;  1AOI D;  4DRB A;  2FJ7 C;  4CSR B;  4X23 A;  5B0Y A;  1P3I A;  5B0Z A;  5B40 C;  5AV5 C;  2CV5 A;  3O62 B;  1M1A D;  3WKJ A;  1ID3 B;  2RIQ A;  3MGQ C;  3WTP B;  2UWX A;  4G92 B;  2L5A A;  3AZH C;  5GXQ D;  5B1L C;  3KUY B;  1P3P A;  5G49 A;  1M18 D;  4Z5T C;  2NZD D;  4J8V D;  3AZG C;  2NQB A;  2ARO C;  4X23 B;  1P3O A;  3VH6 T;  5B0Z B;  4JJN A;  4ZUX A;  5CP6 D;  4H9Q A;  3REJ C;  4KHA A;  1KX5 C;  1N1J A;  1P34 D;  5JRG C;  3LEL D;  4YM6 D;  1WWS A;  5CPK C;  3NQU B;  1P3P B;  1M19 D;  5GSU B;  4H9S A;  5G49 B;  5B33 D;  1P3M A;  5C3I B;  2NQB B;  3O62 D;  1KX3 A;  1P3O B;  4JJN B;  4ZUX B;  5AY8 C;  4KGC A;  3B6F C;  4H9Q B;  4KHA B;  1TAF B;  1N1J B;  4CAY A;  3H0M C;  4E45 A;  3WA9 A;  1P3L A;  3A6N C;  3KUY D;  3W98 C;  3C1C C;  3UT9 A;  3X1T C;  1U35 A;  5AVB C;  5B2J C;  4X23 D;  5B0Y D;  3B0C W;  1P3I D;  1T3U A;  5B0Z D;  3REH C;  3UTA A;  4LD9 C;  5DNN C;  3B0D B;  2J8P A;  5BNV B;  2FFF B;  1KX3 B;  3WKJ D;  3VH5 W;  4J8U A;  5CPI A;  4DQY B;  3C1B B;  3MVD C;  2HUE B;  3IP4 C;  1TZY A;  3TU4 C;  4Z2M G;  5KDM A;  3X1S A;  3WA9 B;  5F99 A;  4J8X C;  1P3L B;  2FJ7 B;  2VQR A;  1P3P D;  3UT9 B;  4J8W A;  1BH8 A;  4NE6 A;  3KXB A;  2NQB D;  5AV5 B;  5B24 A;  1P3O D;  5GT3 C;  3AZJ B;  4JJN D;  3MGR A;  4ZUX D;  3UTA B;  2JE5 A;  3B6G C;  2HIO C;  3MGQ B;  3AZM B;  3W97 A;  1EQZ A;  3REI C;  4Z2M H;  3X1U C;  3B0C T;  2ZM5 A;  2Y2M A;  1TZY B;  5GT0 C;  4Z5T B;  5KDM B;  5B32 G;  3X1S B;  3W99 A;  4WU8 C;  2F8N B;  3EPK A;  1P3M D;  3AZN A;  2F2A C;  4J8W B;  1S32 A;  3AZI A;  3REJ B;  1KX5 B;  1KX3 D;  5JA4 A;  3VH6 A;  5BT1 C;  5DNM A;  3MGR B;  3X1V C;  2YFW A;  4KGC D;  3H0L C;  3AZK C;  3WA9 D;  1P3L D;  1KX4 C;  1P3B A;  2CV5 C;  3UT9 D;  1B6W A;  1U35 D;  4R8P C;  3W99 B;  3AZJ D;  1Z2C B;  4AWL C;  3AZN B;  4UPK A;  3UTA D;  3AV2 A;  1S32 B;  4Z66 C;  3LZ0 A;  3AZI B;  3AZM D;  1P3G C;  1ID3 A;  5JA4 B;  4J8U D;  2Y2J A;  3AZL A;  5CPI D;  2YFW B;  3WAA A;  4XUJ C;  3WTP A;  5B1M C;  1TZY D;  3KWQ C;  3C1C B;  5AVC C;  3X1T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...