5AV8A

Human nucleosome core particle
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
b'KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 33
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av8A00
4J8VB 4XZQD 3AZEA 4WU9B 4R8PD 2IO5B 5CPIA 5B33D 1HQ3B 3B0CW 5AV5B 3LZ0C 1P3GA 1ZLAC 3REKA 2BYMB 5JRGC 5B32B 5B24C 5FUGB 1H3OB 4KUDB 4Z5TA 2CV5A 3VH6A 5AY8D 4NE6A 4DRAA 5AVCC 5F99C 3UTBD 1AOID 5DNMA 3AFAC 1P3LB 3MGQB 5GXQD 5KDMA 1F66A 1ID3D 4QLCB 3AZHA 3WAAA 1S32A 4AWLC 3LELC 3MGPA 5BS7A 4KGCD 5CP6D 3O62A 4J8VC 2F8ND 2AROB 1KX5D 5B40B 5B31D 4WZSB 4J8XC 3KWQB 2HIOA 4M6BA 4EO5B 3W98C 2IO5C 4YM6B 1P3OA 1HQ3C 3AZJD 5AV5C 3AZLD 4CSRB 1P3AC 3C1BA 1P3PA 5G49B 5B0YC 1M1AD 3X1UC 3UTAC 4XUJB 5GT3B 3A6ND 4KUDC 1TAFA 5AV9D 3AZEC 1M18B 4ZUXA 3B6FB 3REID 1EQZD 5GSUD 1P3MB 1P3GC 3AZMA 3REKC 3W96B 3VH6T 3AZFD 5B2JB 3B6GB 4UUZA 3KXBA 2CV5C 4J8UD 5AV8D 4J8WB 1U35D 4R8PA 5B33A 1WWIA 4YS3B 2AROC 5B40C 5CPKD 2FJ7D 4NE3A 4EO5C 1F66C 3LJAD 3REHB 4YM6C 3RELD 5JA4A 3WAAC 1S32C 5AV6B 1TZYD 3MNND 3MGPC 5DNND 5BT1D 1P3BD 1P3IB 3MGSD 5GT3C 1N1JA 3B6FC 1M18C 3UTBA 1AOIA 2PYOD 3X1SD 5GXQA 3AV1B 3C1BC 5B0ZD 5GT0B 4WNNA 3LZ1D 1JFIB 1P3MC 4WU8D 5B32D 5CPJB 5B1MB 4KGCA 5CP6A 5AVBD 3B6GC 2NZDB 1BH8B 4CAYA 2F8NA 4ZUXC 5B2ID 2F8NH 1B67A 5B31A 1KU5A 4J8WC 4YS3C 3AZLA 3MGQD 4LD9D 3AZMC 3NQUB 3REHC 3KUYD 3TU4D 1M1AA 3X1VB 3KXBC 1M19D 3WA9B 3A6NA 3AYWD 2NQBD 1P3KD 5AV9A 3W97D 3REIA 5B33C 1EQZA 3W99D 1P3IC 1BH9B 5GSUA 1P3FD 5GT0C 5CPJC 4NE5A 5B1MC 4J8UA 5AV8A 4JJND 1U35A 3X1TD 1P34D 3V9RB 5BNXB 4H9NA 1Q9CA 5CPKA 1AOIC 2FJ7A 5GXQC 3LJAA 4H9OA 3UT9B 4J8XB 1KX3A 3WTPD 3RELA 3W98B 4H9PB 3MVDD 3REJB 3AN2A 1TZYA 3MNNA 1P3AB 3AZGD 4Z66B 3X1VC 5DNNA 3VH5T 5B0YB 3X1UB 1P3BA 3UTAB 3WA9C 3MGSA 4X23A 2PYOA 3AZLC 3AZEB 3X1SA 5CPIB 5E5AD 3AN2B 2YFWA 5B0ZA 1R4VA 3LZ1A 1M1AC 4WU8A 1P3GB 5B1LD 5B32G 3REKB 5AVBA 3WKJD 5AV9C 5B2IA 5BNVA 4Z5TB 2CV5B 3B0DB 3MGRD 3AZKD 4LD9A 3KUYA 3UT9C 3TU4A 5DNMB 1F66B 5KDMB 3REJC 3AZHB 1WWSA 3WAAB 1M19A 1S32B 4Z66C 3AYWA 2NQBA 1P3KA 1U35C 3MGPB 3W97A 3W99A 5CPKC 2FJ7C 3O62B 4H9QA 3LJAC 1P3FA 1KX3C 2CWEA 2HIOB 3LZ0D 1ULYA 5CPIC 3AN2C 1P3OB 1TZYC 4KHAA 3C1BB 1P3PB 1ZLAD 4G91B 3C1CD 5JRGD 5B24D 3X1TA 4X23C 1P34A 3AV2D 3AZNA 4XZQA 1TAFB 4Z5TC 3B0DC 4ZUXB 4G92B 5AVCD 5F99D 3WTPA 3AZID 3MVDA 3AFAD 1KX4D 4WU8C 5DNMC 3AZMB 3AZGA 3AZHC 3LELD 3AZNB 4UUZB 3KXBB 5BS7C 4J8VD 4R8PB 5AY8A 4H9SA 5E5AA 5B33B 3O62C 3W98D 1A7WA 4WU9D 3KUYC 3TU4C 1HQ3D 5AV5D 2HIOC 5BO0A 1P3OC 5JA4B 5B1LA 1ID3A 1M19C 1P3PC 3NQJA 3WKJA 2NQBC 3X1UD 4G91C 3W99C 4HGAB 5AY8B 3MGRA 4KUDD 4WV4B 1N1JB 1P3FC 3AZKA 4G92C 3R45A 3UTBB 1KX5A 1AOIB 5GXQB 3AZJA 1P3LD 3VH6W 3REKD 4WNNB 4QLCD 2YFVA 4KGCB 5CP6B 3AZNC 2BYKA 4CAYB 4XZQC 2F8NB 4Z2MG 5B31B 2HUEC 2AROD 3LZ0A 4R8PC 5B40D 3KWQD 3AZLB 4YM6D 3B0CT 1ZLAA 3AZGC 1M1AB 3C1CA 5B24A 5JRGA 3AZFA 3AV2A 3A6NB 4DRBA 4XUJD 5AV9B 4H9RA 4HGAC 5AY8C 5GT3D 5E5AC 5AVCA 3REIB 1EQZB 3B6FD 1M18D 5F99A 3AZIA 3AFAA 1KX4A 5GSUB 3UTBC 3C1BD 5B1LC 2RVQD 1ID3C 1P3MD 1B6WA 3AZFB 3LELA 3WKJC 3W96D 5B2JD 4J8UB 3B6GD 5CHLB 4J8VA 4KGCC 5CP6C 5AV8B 1U35B 3AZKC 4J8WD 4WU9A 4H9NB 5CPKB 5B31C 1KX5C 2FJ7B 1HQ3A 4YS3D 5AV5A 3LJAB 4H9OB 3AZJC 1KX3B 3RELB 3REHD 1TZYB 1F1EA 2L5AA 3MNNB 5AV6D 2JSSA 2BYMA 3KXBD 5B32A 5DNNB 5FUGA 1H3OA 4KUDA 1P3BB 3MGSB 3A6NC 4X23B 1P3ID 3REIC 2PYOB 1EQZC 3X1SB 1P3LA 5GSUC 2YFWB 5B0ZB 5C3IB 3MGQA 3AV1D 3LZ1B 4QLCA 3C1CC 4WU8B 5GT0D 3AZFC 5CPJD 5B1MD 5AVBB 3AV2C 4J8UC 2NZDD 5B2IB 5BNVB 5AV8C 2AROA 3AZIC 5B40A 1KX4C 3KWQA 4YM6A 4LD9B 4CSRA 3KUYB 3TU4B 3RELC 5G49A 3VH5W 3X1VD 3MNNC 1M19B 3AYWB 2NQBB 5DNNC 4XUJA 1P3KB 3WA9D 3W97B 5GT3A 5BT1C 1P3BC 1M18A 4WU9C 3MGSC 4JJNA 3B6FA 3W99B 2LY8A 4H9QB 2PYOC 1P3FB 3X1SC 1P3MA 5B0ZC 4KHAB 5C3IC 3LZ1C 3W96A 5B2JA 5B32C 3B6GA 4E44A 5AVBC 4JJNB 3X1TB 1P34B 4J8WA 5B2IC 4XZQB 4YS3A 1P3LC 2HUEB 3WTPB 3MGQC 3REHA 3UT9D 3MVDB 4QLCC 4J8XD 2F8NK 4LD9C 3REJD 5AV6A 3AZGB 1HTAA 1P3AD 4Z66D 5B0YD 3WTPE 3AYWC 1P3KC 3UTAD 1P3IA 3W97C 3KWQC 5E5AB 1KX3D 3AZED 5CPID 3AN2D 3AV1A 5BO0B 5GT0A 1JFIA 5B1LB 1ID3B 5CPJA 5B1MA 3NQJB 1P3GD 3WKJB 4XUJC 2NZDA 1BH8A 4X23D 3KSYA 4JJNC 3MGRB 4ZBJB 3X1TC 1P34C 4Z5TD 2CV5D 3AZKB 4Z2MH 1KX5B 2RVQC 3R45B 3WTPC 3NQUA 3MVDC 3W96C 5DNMD 3AZJB 5B2JC 4NFTA 1F66D 3X1VA 3AZHD 2YFVB 3WAAD 3WA9A 1S32D 2F8NG 3VH5A 3MGPD 2BYKB 5B31G 1BH9A 3O62D 1BFMA 3LZ0B 4H9SC 2HIOD 4E45A 1P3OD 5AV6C 1ZLAB 1P3PD 3C1CB 3B0BA 5JRGB 5B24B 3AV2B 3V9RA 4H9RB 5BNXA 3MGRC 4ZBJC 5AVCB 5F99B 4ZUXD 3AZIB 3UT9A 3AV1C 4J8XA 3AFAB 1KX4B 3W98A 4H9PA 3REJA 1P3AA 4AWLB 3LELB 3AZMD 4Z66A 5B0YA 2NZDC 3X1UA 3UTAA 3AZND
chains in the Genus database with same CATH superfamily
4J8VB 4XZQD 1T3UA 3AZEA 4WU9B 4R8PD 2IO5B 5CPIA 5B33D 1HQ3B 3B0CW 5AV5B 3LZ0C 1P3GA 1ZLAC 3REKA 2BYMB 3A1IA 5JRGC 5B32B 5B24C 5FUGB 1H3OB 4KUDB 4Z5TA 2CV5A 3VH6A 3KFUG 5AY8D 4NE6A 4DRAA 5AVCC 5F99C 3UTBD 1AOID 5DNMA 3AFAC 1P3LB 3MGQB 5GXQD 5KDMA 1F66A 3AL0C 1ID3D 4QLCB 3AZHA 3WAAA 1S32A 4AWLC 3LELC 3MGPA 5BS7A 4KGCD 5CP6D 3EPKA 3O62A 4J8VC 2F8ND 2AROB 1KX5D 5B40B 5B31D 4WZSB 4J8XC 3KWQB 2HIOA 4M6BA 1Z2CB 4EO5B 2IO5C 4YM6B 1P3OA 1HQ3C 3AZJD 5AV5C 3AZLD 4CSRB 1P3AC 3H0RC 3C1BA 1P3PA 5G49B 5B0YC 1M1AD 3X1UC 2XD5A 3UTAC 4DQYB 4XUJB 5GT3B 3A6ND 4KUDC 1TAFA 5AV9D 3AZEC 1M18B 4ZUXA 3B6FB 3REID 1EQZD 2Y2JA 5GSUD 1P3MB 1P3GC 3AZMA 2RIQA 3REKC 3W96B 3VH6T 3AZFD 5B2JB 3B6GB 4UUZA 3KXBA 2CV5C 4J8UD 5AV8D 4J8WB 1U35D 4R8PA 2F2AC 1WWIA 5B33A 4YS3B 2AROC 5B40C 5CPKD 2FJ7D 4NE3A 4EO5C 1F66C 3FDDA 3LJAD 4YM6C 3REHB 3RELD 5JA4A 3WAAC 1S32C 5AV6B 1TZYD 3MNND 3MGPC 5DNND 5BT1D 1P3BD 1P3IB 3MGSD 5GT3C 1N1JA 3B6FC 1M18C 2BG1A 3UTBA 1AOIA 2PYOD 3X1SD 5GXQA 3AV1B 3C1BC 5B0ZD 5GT0B 4WNNA 3LZ1D 1JFIB 1P3MC 4WU8D 5B32D 5CPJB 5B1MB 4KGCA 5CP6A 5AVBD 2Y2HA 3B6GC 1BH8B 4CAYA 2NZDB 2F8NA 4ZUXC 5B2ID 2F8NH 1B67A 5B31A 1KU5A 4J8WC 4YS3C 3AZLA 3MGQD 4LD9D 3AZMC 3NQUB 3REHC 3KUYD 3TU4D 1M1AA 3X1VB 3KXBC 1M19D 3WA9B 3A6NA 3AYWD 2NQBD 1P3KD 5AV9A 3EG5B 3W97D 2DF4C 3REIA 5B33C 1EQZA 3W99D 1P3IC 1BH9B 5GSUA 1P3FD 5GT0C 5CPJC 4NE5A 5B1MC 4J8UA 5AV8A 4JJND 1U35A 3X1TD 1P34D 3V9RB 5BNXB 4H9NA 1Q9CA 5CPKA 1AOIC 2FJ7A 5GXQC 3LJAA 4H9OA 3UT9B 4J8XB 1KX3A 3WTPD 3RELA 3W98B 4H9PB 3MVDD 3REJB 2Y2NA 3AN2A 1TZYA 3MNNA 1P3AB 3AZGD 4Z66B 3X1VC 5DNNA 3VH5T 5B0YB 3X1UB 1P3BA 3UTAB 3WA9C 3MGSA 4X23A 2ZY5A 2ZY4A 2PYOA 3AZLC 3AZEB 3X1SA 5CPIB 5E5AD 3AN2B 2YFWA 5B0ZA 1R4VA 3LZ1A 1M1AC 4WU8A 1P3GB 5B1LD 5B32G 3REKB 5AVBA 3WKJD 5AV9C 5B2IA 5BNVA 4Z5TB 2CV5B 3B0DB 3MGRD 2UWXA 3AZKD 4LD9A 3KUYA 3UT9C 3TU4A 5DNMB 1F66B 5KDMB 3REJC 3AZHB 1WWSA 3WAAB 1M19A 1S32B 4Z66C 3AYWA 2NQBA 1P3KA 1U35C 3MGPB 3W97A 3W99A 5CPKC 2FJ7C 3O62B 4H9QA 3LJAC 1P3FA 1KX3C 2CWEA 2HIOB 3LZ0D 1ULYA 5CPIC 3AN2C 1P3OB 1TZYC 2Y2PA 4KHAA 3C1BB 1P3PB 1ZLAD 2ZM5A 4G91B 3C1CD 5JRGD 5B24D 3X1TA 4X23C 1P34A 3AV2D 3AZNA 4XZQA 1TAFB 4Z5TC 3B0DC 4ZUXB 4G92B 5AVCD 2VQRA 2DQNC 5F99D 3WTPA 3AZID 3MVDA 3AFAD 1KX4D 4WU8C 5DNMC 2FFFB 2W8SA 3AZGA 3AZMB 2Y2KA 3AZHC 3LELD 2Y2GA 3AZNB 4UUZB 3KXBB 5BS7C 4J8VD 2Y2QA 4R8PB 5AY8A 4H9SA 5E5AA 5B33B 3O62C 3W98D 1A7WA 4WU9D 3KUYC 3TU4C 3H0MC 1HQ3D 5AV5D 2HIOC 5BO0A 1P3OC 5JA4B 5B1LA 1ID3A 1M19C 1P3PC 3NQJA 3WKJA 2NQBC 3X1UD 4G91C 3W99C 4HGAB 5AY8B 3MGRA 4KUDD 4WV4B 1N1JB 1P3FC 3AZKA 4G92C 3R45A 3UTBB 1KX5A 1AOIB 5GXQB 3AZJA 1P3LD 3VH6W 3REKD 4WNNB 4QLCD 2YFVA 4KGCB 5CP6B 3AZNC 2BYKA 4CAYB 4XZQC 2F8NB 4Z2MG 5B31B 2HUEC 2AROD 3LZ0A 4R8PC 5B40D 3KWQD 3AZLB 4YM6D 2G5IC 3B0CT 1ZLAA 3AZGC 1M1AB 3C1CA 5B24A 5JRGA 3IP4C 3AZFA 3AV2A 3A6NB 4DRBA 4XUJD 5AV9B 4H9RA 4HGAC 5AY8C 5GT3D 5E5AC 5AVCA 3REIB 1EQZB 3B6FD 1M18D 5F99A 3AZIA 3AFAA 1KX4A 5GSUB 3UTBC 3C1BD 5B1LC 2RVQD 1ID3C 1P3MD 1B6WA 3AZFB 3LELA 3WKJC 3W96D 2Y2OA 5B2JD 4J8UB 3B6GD 5CHLB 4J8VA 4KGCC 5CP6C 5AV8B 1U35B 3AZKC 4J8WD 4WU9A 4H9NB 5CPKB 5B31C 1KX5C 2FJ7B 1HQ3A 4YS3D 5AV5A 3LJAB 4H9OB 3AZJC 1KX3B 3RELB 3REHD 2XD1A 1TZYB 1F1EA 2L5AA 3MNNB 5AV6D 2JSSA 2BYMA 3KXBD 5B32A 5DNNB 5FUGA 1H3OA 4KUDA 1P3BB 3MGSB 3A6NC 4X23B 1P3ID 3W98C 3REIC 4UPKA 1EQZC 2PYOB 3X1SB 1P3LA 5GSUC 2YFWB 5B0ZB 5C3IB 3MGQA 3AV1D 3LZ1B 4QLCA 3C1CC 4WU8B 5GT0D 3AZFC 5CPJD 5B1MD 5AVBB 3AV2C 3EPLA 4J8UC 2NZDD 5B2IB 5BNVB 5AV8C 2AROA 3AZIC 2G5HC 5B40A 1KX4C 3KWQA 4YM6A 4LD9B 4CSRA 3KUYB 3TU4B 3RELC 5G49A 3VH5W 3X1VD 3MNNC 1M19B 3AYWB 2NQBB 5DNNC 4XUJA 1P3KB 3WA9D 3W97B 5GT3A 5BT1C 1P3BC 1M18A 4WU9C 3MGSC 4JJNA 3B6FA 3W99B 2LY8A 4H9QB 2PYOC 1P3FB 3X1SC 1P3MA 5B0ZC 4KHAB 5C3IC 3LZ1C 3W96A 5B2JA 2ZY2A 5B32C 3B6GA 4E44A 5AVBC 4JJNB 3X1TB 1P34B 3EPHA 4J8WA 5B2IC 4XZQB 4YS3A 1P3LC 2HUEB 3WTPB 3MGQC 3REHA 3UT9D 3MVDB 4QLCC 4J8XD 2F8NK 4LD9C 3REJD 5AV6A 3AZGB 1HTAA 1P3AD 1W2EA 4Z66D 5B0YD 3WTPE 3AYWC 3F6TA 3UTAD 1P3IA 1P3KC 3W97C 3KWQC 5E5AB 1KX3D 3AZED 5CPID 3AN2D 3AV1A 5BO0B 5GT0A 1JFIA 5B1LB 1ID3B 5CPJA 5B1MA 3NQJB 1P3GD 3WKJB 4XUJC 4WJ3C 2NZDA 1BH8A 4X23D 3KSYA 4JJNC 3MGRB 4ZBJB 3X1TC 1P34C 4Z5TD 2CV5D 3AZKB 3EPJA 4Z2MH 1KX5B 2RVQC 3R45B 3WTPC 3NQUA 3MVDC 3W96C 5DNMD 3AZJB 5B2JC 4NFTA 1F66D 3X1VA 3AZHD 2YFVB 3WAAD 3WA9A 1S32D 2F8NG 3P5JB 3VH5A 3MGPD 2BYKB 2Y2IA 3A1KA 5B31G 1BH9A 3O62D 1BFMA 3LZ0B 4H9SC 2HIOD 3H0LC 4E45A 1P3OD 5AV6C 1ZLAB 2Y2MA 1P3PD 3C1CB 1PZRA 3B0BA 5JRGB 5B24B 2J8PA 3AV2B 3V9RA 4H9RB 5BNXA 3MGRC 4ZBJC 5AVCB 5F99B 4ZUXD 3AZIB 3UT9A 3AV1C 4J8XA 3AFAB 1KX4B 3W98A 2JE5A 4H9PA 3REJA 1P3AA 2ZY3A 2JCHA 3LELB 4AWLB 4Z66A 3AZMD 5B0YA 2Y2LA 2NZDC 3X1UA 3UTAA 3AZND
chains in the Genus database with same CATH topology
4J8VB 4XZQD 1T3UA 3AZEA 4WU9B 4R8PD 2IO5B 5CPIA 5B33D 1HQ3B 3B0CW 5AV5B 3LZ0C 1P3GA 1ZLAC 3REKA 2BYMB 3A1IA 5JRGC 5B32B 5B24C 5FUGB 1H3OB 4KUDB 4Z5TA 2CV5A 3VH6A 3KFUG 5AY8D 4NE6A 4DRAA 5AVCC 5F99C 3UTBD 1AOID 5DNMA 3AFAC 1P3LB 3MGQB 5GXQD 5KDMA 1F66A 3AL0C 1ID3D 4QLCB 3AZHA 3WAAA 1S32A 4AWLC 3LELC 3MGPA 5BS7A 4KGCD 5CP6D 3EPKA 3O62A 4J8VC 2F8ND 2AROB 1KX5D 5B40B 5B31D 4WZSB 4J8XC 3KWQB 2HIOA 4M6BA 1Z2CB 4EO5B 2IO5C 4YM6B 1P3OA 1HQ3C 3AZJD 5AV5C 3AZLD 4CSRB 1P3AC 3H0RC 3C1BA 1P3PA 5G49B 5B0YC 1M1AD 3X1UC 2XD5A 3UTAC 4DQYB 4XUJB 5GT3B 3A6ND 4KUDC 1TAFA 5AV9D 3AZEC 1M18B 4ZUXA 3B6FB 3REID 1EQZD 2Y2JA 5GSUD 1P3MB 1P3GC 3AZMA 2RIQA 3REKC 3W96B 3VH6T 3AZFD 5B2JB 3B6GB 4UUZA 3KXBA 2CV5C 4J8UD 5AV8D 4J8WB 1U35D 4R8PA 2F2AC 1WWIA 5B33A 4YS3B 2AROC 5B40C 5CPKD 2FJ7D 4NE3A 4EO5C 1F66C 3FDDA 3LJAD 4YM6C 3REHB 3RELD 5JA4A 3WAAC 1S32C 5AV6B 1TZYD 3MNND 3MGPC 5DNND 5BT1D 1P3BD 1P3IB 3MGSD 5GT3C 1N1JA 3B6FC 1M18C 2BG1A 3UTBA 1AOIA 2PYOD 3X1SD 5GXQA 3AV1B 3C1BC 5B0ZD 5GT0B 4WNNA 3LZ1D 1JFIB 1P3MC 4WU8D 5B32D 5CPJB 5B1MB 4KGCA 5CP6A 5AVBD 2Y2HA 3B6GC 1BH8B 4CAYA 2NZDB 2F8NA 4ZUXC 5B2ID 2F8NH 1B67A 5B31A 1KU5A 4J8WC 4YS3C 3AZLA 3MGQD 4LD9D 3AZMC 3NQUB 3REHC 3KUYD 3TU4D 1M1AA 3X1VB 3KXBC 1M19D 3WA9B 3A6NA 3AYWD 2NQBD 1P3KD 5AV9A 3EG5B 3W97D 2DF4C 3REIA 5B33C 1EQZA 3W99D 1P3IC 1BH9B 5GSUA 1P3FD 5GT0C 5CPJC 4NE5A 5B1MC 4J8UA 5AV8A 4JJND 1U35A 3X1TD 1P34D 3V9RB 5BNXB 4H9NA 1Q9CA 5CPKA 1AOIC 2FJ7A 5GXQC 3LJAA 4H9OA 3UT9B 4J8XB 1KX3A 3WTPD 3RELA 3W98B 4H9PB 3MVDD 3REJB 2Y2NA 3AN2A 1TZYA 3MNNA 1P3AB 3AZGD 4Z66B 3X1VC 5DNNA 3VH5T 5B0YB 3X1UB 1P3BA 3UTAB 3WA9C 3MGSA 4X23A 2ZY5A 2ZY4A 2PYOA 3AZLC 3AZEB 3X1SA 5CPIB 5E5AD 3AN2B 2YFWA 5B0ZA 1R4VA 3LZ1A 1M1AC 4WU8A 1P3GB 5B1LD 5B32G 3REKB 5AVBA 3WKJD 5AV9C 5B2IA 5BNVA 4Z5TB 2CV5B 3B0DB 3MGRD 2UWXA 3AZKD 4LD9A 3KUYA 3UT9C 3TU4A 5DNMB 1F66B 5KDMB 3REJC 3AZHB 1WWSA 3WAAB 1M19A 1S32B 4Z66C 3AYWA 2NQBA 1P3KA 1U35C 3MGPB 3W97A 3W99A 5CPKC 2FJ7C 3O62B 4H9QA 3LJAC 1P3FA 1KX3C 2CWEA 2HIOB 3LZ0D 1ULYA 5CPIC 3AN2C 1P3OB 1TZYC 2Y2PA 4KHAA 3C1BB 1P3PB 1ZLAD 2ZM5A 4G91B 3C1CD 5JRGD 5B24D 3X1TA 4X23C 1P34A 3AV2D 3AZNA 4XZQA 1TAFB 4Z5TC 3B0DC 4ZUXB 4G92B 5AVCD 2VQRA 2DQNC 5F99D 3WTPA 3AZID 3MVDA 3AFAD 1KX4D 4WU8C 5DNMC 2FFFB 2W8SA 3AZGA 3AZMB 2Y2KA 3AZHC 3LELD 2Y2GA 3AZNB 4UUZB 3KXBB 5BS7C 4J8VD 2Y2QA 4R8PB 5AY8A 4H9SA 5E5AA 5B33B 3O62C 3W98D 1A7WA 4WU9D 3KUYC 3TU4C 3H0MC 1HQ3D 5AV5D 2HIOC 5BO0A 1P3OC 5JA4B 5B1LA 1ID3A 1M19C 1P3PC 3NQJA 3WKJA 2NQBC 3X1UD 4G91C 3W99C 4HGAB 5AY8B 3MGRA 4KUDD 4WV4B 1N1JB 1P3FC 3AZKA 4G92C 3R45A 3UTBB 1KX5A 1AOIB 5GXQB 3AZJA 1P3LD 3VH6W 3REKD 4WNNB 4QLCD 2YFVA 4KGCB 5CP6B 3AZNC 2BYKA 4CAYB 4XZQC 2F8NB 4Z2MG 5B31B 2HUEC 2AROD 3LZ0A 4R8PC 5B40D 3KWQD 3AZLB 4YM6D 2G5IC 3B0CT 1ZLAA 3AZGC 1M1AB 3C1CA 5B24A 5JRGA 3IP4C 3AZFA 3AV2A 3A6NB 4DRBA 4XUJD 5AV9B 4H9RA 4HGAC 5AY8C 5GT3D 5E5AC 5AVCA 3REIB 1EQZB 3B6FD 1M18D 5F99A 3AZIA 3AFAA 1KX4A 5GSUB 3UTBC 3C1BD 5B1LC 2RVQD 1ID3C 1P3MD 1B6WA 3AZFB 3LELA 3WKJC 3W96D 2Y2OA 5B2JD 4J8UB 3B6GD 5CHLB 4J8VA 4KGCC 5CP6C 5AV8B 1U35B 3AZKC 4J8WD 4WU9A 4H9NB 5CPKB 5B31C 1KX5C 2FJ7B 1HQ3A 4YS3D 5AV5A 3LJAB 4H9OB 3AZJC 1KX3B 3RELB 3REHD 2XD1A 1TZYB 1F1EA 2L5AA 3MNNB 5AV6D 2JSSA 2BYMA 3KXBD 5B32A 5DNNB 5FUGA 1H3OA 4KUDA 1P3BB 3MGSB 3A6NC 4X23B 1P3ID 3W98C 3REIC 4UPKA 1EQZC 2PYOB 3X1SB 1P3LA 5GSUC 2YFWB 5B0ZB 5C3IB 3MGQA 3AV1D 3LZ1B 4QLCA 3C1CC 4WU8B 5GT0D 3AZFC 5CPJD 5B1MD 5AVBB 3AV2C 3EPLA 4J8UC 2NZDD 5B2IB 5BNVB 5AV8C 2AROA 3AZIC 2G5HC 5B40A 1KX4C 3KWQA 4YM6A 4LD9B 4CSRA 3KUYB 3TU4B 3RELC 5G49A 3VH5W 3X1VD 3MNNC 1M19B 3AYWB 2NQBB 5DNNC 4XUJA 1P3KB 3WA9D 3W97B 5GT3A 5BT1C 1P3BC 1M18A 4WU9C 3MGSC 4JJNA 3B6FA 3W99B 2LY8A 4H9QB 2PYOC 1P3FB 3X1SC 1P3MA 5B0ZC 4KHAB 5C3IC 3LZ1C 3W96A 5B2JA 2ZY2A 5B32C 3B6GA 4E44A 5AVBC 4JJNB 3X1TB 1P34B 3EPHA 4J8WA 5B2IC 4XZQB 4YS3A 1P3LC 2HUEB 3WTPB 3MGQC 3REHA 3UT9D 3MVDB 4QLCC 4J8XD 2F8NK 4LD9C 3REJD 5AV6A 3AZGB 1HTAA 1P3AD 1W2EA 4Z66D 5B0YD 3WTPE 3AYWC 3F6TA 3UTAD 1P3IA 1P3KC 3W97C 3KWQC 5E5AB 1KX3D 3AZED 5CPID 3AN2D 3AV1A 5BO0B 5GT0A 1JFIA 5B1LB 1ID3B 5CPJA 5B1MA 3NQJB 1P3GD 3WKJB 4XUJC 4WJ3C 2NZDA 1BH8A 4X23D 3KSYA 4JJNC 3MGRB 4ZBJB 3X1TC 1P34C 4Z5TD 2CV5D 3AZKB 3EPJA 4Z2MH 1KX5B 2RVQC 3R45B 3WTPC 3NQUA 3MVDC 3W96C 5DNMD 3AZJB 5B2JC 4NFTA 1F66D 3X1VA 3AZHD 2YFVB 3WAAD 3WA9A 1S32D 2F8NG 3P5JB 3VH5A 3MGPD 2BYKB 2Y2IA 3A1KA 5B31G 1BH9A 3O62D 1BFMA 3LZ0B 4H9SC 2HIOD 3H0LC 4E45A 1P3OD 5AV6C 1ZLAB 2Y2MA 1P3PD 3C1CB 1PZRA 3B0BA 5JRGB 5B24B 2J8PA 3AV2B 3V9RA 4H9RB 5BNXA 3MGRC 4ZBJC 5AVCB 5F99B 4ZUXD 3AZIB 3UT9A 3AV1C 4J8XA 3AFAB 1KX4B 3W98A 2JE5A 4H9PA 3REJA 1P3AA 2ZY3A 2JCHA 3LELB 4AWLB 4Z66A 3AZMD 5B0YA 2Y2LA 2NZDC 3X1UA 3UTAA 3AZND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8V B;  4XZQ D;  3AZE A;  4WU9 B;  4R8P D;  2IO5 B;  5CPI A;  5B33 D;  1HQ3 B;  3B0C W;  5AV5 B;  3LZ0 C;  1P3G A;  1ZLA C;  3REK A;  2BYM B;  5JRG C;  5B32 B;  5B24 C;  5FUG B;  1H3O B;  4KUD B;  4Z5T A;  2CV5 A;  3VH6 A;  5AY8 D;  4NE6 A;  4DRA A;  5AVC C;  5F99 C;  3UTB D;  1AOI D;  5DNM A;  3AFA C;  1P3L B;  3MGQ B;  5GXQ D;  5KDM A;  1F66 A;  1ID3 D;  4QLC B;  3AZH A;  3WAA A;  1S32 A;  4AWL C;  3LEL C;  3MGP A;  5BS7 A;  4KGC D;  5CP6 D;  3O62 A;  4J8V C;  2F8N D;  2ARO B;  1KX5 D;  5B40 B;  5B31 D;  4WZS B;  4J8X C;  3KWQ B;  2HIO A;  4M6B A;  4EO5 B;  3W98 C;  2IO5 C;  4YM6 B;  1P3O A;  1HQ3 C;  3AZJ D;  5AV5 C;  3AZL D;  4CSR B;  1P3A C;  3C1B A;  1P3P A;  5G49 B;  5B0Y C;  1M1A D;  3X1U C;  3UTA C;  4XUJ B;  5GT3 B;  3A6N D;  4KUD C;  1TAF A;  5AV9 D;  3AZE C;  1M18 B;  4ZUX A;  3B6F B;  3REI D;  1EQZ D;  5GSU D;  1P3M B;  1P3G C;  3AZM A;  3REK C;  3W96 B;  3VH6 T;  3AZF D;  5B2J B;  3B6G B;  4UUZ A;  3KXB A;  2CV5 C;  4J8U D;  5AV8 D;  4J8W B;  1U35 D;  4R8P A;  5B33 A;  1WWI A;  4YS3 B;  2ARO C;  5B40 C;  5CPK D;  2FJ7 D;  4NE3 A;  4EO5 C;  1F66 C;  3LJA D;  3REH B;  4YM6 C;  3REL D;  5JA4 A;  3WAA C;  1S32 C;  5AV6 B;  1TZY D;  3MNN D;  3MGP C;  5DNN D;  5BT1 D;  1P3B D;  1P3I B;  3MGS D;  5GT3 C;  1N1J A;  3B6F C;  1M18 C;  3UTB A;  1AOI A;  2PYO D;  3X1S D;  5GXQ A;  3AV1 B;  3C1B C;  5B0Z D;  5GT0 B;  4WNN A;  3LZ1 D;  1JFI B;  1P3M C;  4WU8 D;  5B32 D;  5CPJ B;  5B1M B;  4KGC A;  5CP6 A;  5AVB D;  3B6G C;  2NZD B;  1BH8 B;  4CAY A;  2F8N A;  4ZUX C;  5B2I D;  2F8N H;  1B67 A;  5B31 A;  1KU5 A;  4J8W C;  4YS3 C;  3AZL A;  3MGQ D;  4LD9 D;  3AZM C;  3NQU B;  3REH C;  3KUY D;  3TU4 D;  1M1A A;  3X1V B;  3KXB C;  1M19 D;  3WA9 B;  3A6N A;  3AYW D;  2NQB D;  1P3K D;  5AV9 A;  3W97 D;  3REI A;  5B33 C;  1EQZ A;  3W99 D;  1P3I C;  1BH9 B;  5GSU A;  1P3F D;  5GT0 C;  5CPJ C;  4NE5 A;  5B1M C;  4J8U A;  5AV8 A;  4JJN D;  1U35 A;  3X1T D;  1P34 D;  3V9R B;  5BNX B;  4H9N A;  1Q9C A;  5CPK A;  1AOI C;  2FJ7 A;  5GXQ C;  3LJA A;  4H9O A;  3UT9 B;  4J8X B;  1KX3 A;  3WTP D;  3REL A;  3W98 B;  4H9P B;  3MVD D;  3REJ B;  3AN2 A;  1TZY A;  3MNN A;  1P3A B;  3AZG D;  4Z66 B;  3X1V C;  5DNN A;  3VH5 T;  5B0Y B;  3X1U B;  1P3B A;  3UTA B;  3WA9 C;  3MGS A;  4X23 A;  2PYO A;  3AZL C;  3AZE B;  3X1S A;  5CPI B;  5E5A D;  3AN2 B;  2YFW A;  5B0Z A;  1R4V A;  3LZ1 A;  1M1A C;  4WU8 A;  1P3G B;  5B1L D;  5B32 G;  3REK B;  5AVB A;  3WKJ D;  5AV9 C;  5B2I A;  5BNV A;  4Z5T B;  2CV5 B;  3B0D B;  3MGR D;  3AZK D;  4LD9 A;  3KUY A;  3UT9 C;  3TU4 A;  5DNM B;  1F66 B;  5KDM B;  3REJ C;  3AZH B;  1WWS A;  3WAA B;  1M19 A;  1S32 B;  4Z66 C;  3AYW A;  2NQB A;  1P3K A;  1U35 C;  3MGP B;  3W97 A;  3W99 A;  5CPK C;  2FJ7 C;  3O62 B;  4H9Q A;  3LJA C;  1P3F A;  1KX3 C;  2CWE A;  2HIO B;  3LZ0 D;  1ULY A;  5CPI C;  3AN2 C;  1P3O B;  1TZY C;  4KHA A;  3C1B B;  1P3P B;  1ZLA D;  4G91 B;  3C1C D;  5JRG D;  5B24 D;  3X1T A;  4X23 C;  1P34 A;  3AV2 D;  3AZN A;  4XZQ A;  1TAF B;  4Z5T C;  3B0D C;  4ZUX B;  4G92 B;  5AVC D;  5F99 D;  3WTP A;  3AZI D;  3MVD A;  3AFA D;  1KX4 D;  4WU8 C;  5DNM C;  3AZM B;  3AZG A;  3AZH C;  3LEL D;  3AZN B;  4UUZ B;  3KXB B;  5BS7 C;  4J8V D;  4R8P B;  5AY8 A;  4H9S A;  5E5A A;  5B33 B;  3O62 C;  3W98 D;  1A7W A;  4WU9 D;  3KUY C;  3TU4 C;  1HQ3 D;  5AV5 D;  2HIO C;  5BO0 A;  1P3O C;  5JA4 B;  5B1L A;  1ID3 A;  1M19 C;  1P3P C;  3NQJ A;  3WKJ A;  2NQB C;  3X1U D;  4G91 C;  3W99 C;  4HGA B;  5AY8 B;  3MGR A;  4KUD D;  4WV4 B;  1N1J B;  1P3F C;  3AZK A;  4G92 C;  3R45 A;  3UTB B;  1KX5 A;  1AOI B;  5GXQ B;  3AZJ A;  1P3L D;  3VH6 W;  3REK D;  4WNN B;  4QLC D;  2YFV A;  4KGC B;  5CP6 B;  3AZN C;  2BYK A;  4CAY B;  4XZQ C;  2F8N B;  4Z2M G;  5B31 B;  2HUE C;  2ARO D;  3LZ0 A;  4R8P C;  5B40 D;  3KWQ D;  3AZL B;  4YM6 D;  3B0C T;  1ZLA A;  3AZG C;  1M1A B;  3C1C A;  5B24 A;  5JRG A;  3AZF A;  3AV2 A;  3A6N B;  4DRB A;  4XUJ D;  5AV9 B;  4H9R A;  4HGA C;  5AY8 C;  5GT3 D;  5E5A C;  5AVC A;  3REI B;  1EQZ B;  3B6F D;  1M18 D;  5F99 A;  3AZI A;  3AFA A;  1KX4 A;  5GSU B;  3UTB C;  3C1B D;  5B1L C;  2RVQ D;  1ID3 C;  1P3M D;  1B6W A;  3AZF B;  3LEL A;  3WKJ C;  3W96 D;  5B2J D;  4J8U B;  3B6G D;  5CHL B;  4J8V A;  4KGC C;  5CP6 C;  5AV8 B;  1U35 B;  3AZK C;  4J8W D;  4WU9 A;  4H9N B;  5CPK B;  5B31 C;  1KX5 C;  2FJ7 B;  1HQ3 A;  4YS3 D;  5AV5 A;  3LJA B;  4H9O B;  3AZJ C;  1KX3 B;  3REL B;  3REH D;  1TZY B;  1F1E A;  2L5A A;  3MNN B;  5AV6 D;  2JSS A;  2BYM A;  3KXB D;  5B32 A;  5DNN B;  5FUG A;  1H3O A;  4KUD A;  1P3B B;  3MGS B;  3A6N C;  4X23 B;  1P3I D;  3REI C;  2PYO B;  1EQZ C;  3X1S B;  1P3L A;  5GSU C;  2YFW B;  5B0Z B;  5C3I B;  3MGQ A;  3AV1 D;  3LZ1 B;  4QLC A;  3C1C C;  4WU8 B;  5GT0 D;  3AZF C;  5CPJ D;  5B1M D;  5AVB B;  3AV2 C;  4J8U C;  2NZD D;  5B2I B;  5BNV B;  5AV8 C;  2ARO A;  3AZI C;  5B40 A;  1KX4 C;  3KWQ A;  4YM6 A;  4LD9 B;  4CSR A;  3KUY B;  3TU4 B;  3REL C;  5G49 A;  3VH5 W;  3X1V D;  3MNN C;  1M19 B;  3AYW B;  2NQB B;  5DNN C;  4XUJ A;  1P3K B;  3WA9 D;  3W97 B;  5GT3 A;  5BT1 C;  1P3B C;  1M18 A;  4WU9 C;  3MGS C;  4JJN A;  3B6F A;  3W99 B;  2LY8 A;  4H9Q B;  2PYO C;  1P3F B;  3X1S C;  1P3M A;  5B0Z C;  4KHA B;  5C3I C;  3LZ1 C;  3W96 A;  5B2J A;  5B32 C;  3B6G A;  4E44 A;  5AVB C;  4JJN B;  3X1T B;  1P34 B;  4J8W A;  5B2I C;  4XZQ B;  4YS3 A;  1P3L C;  2HUE B;  3WTP B;  3MGQ C;  3REH A;  3UT9 D;  3MVD B;  4QLC C;  4J8X D;  2F8N K;  4LD9 C;  3REJ D;  5AV6 A;  3AZG B;  1HTA A;  1P3A D;  4Z66 D;  5B0Y D;  3WTP E;  3AYW C;  1P3K C;  3UTA D;  1P3I A;  3W97 C;  3KWQ C;  5E5A B;  1KX3 D;  3AZE D;  5CPI D;  3AN2 D;  3AV1 A;  5BO0 B;  5GT0 A;  1JFI A;  5B1L B;  1ID3 B;  5CPJ A;  5B1M A;  3NQJ B;  1P3G D;  3WKJ B;  4XUJ C;  2NZD A;  1BH8 A;  4X23 D;  3KSY A;  4JJN C;  3MGR B;  4ZBJ B;  3X1T C;  1P34 C;  4Z5T D;  2CV5 D;  3AZK B;  4Z2M H;  1KX5 B;  2RVQ C;  3R45 B;  3WTP C;  3NQU A;  3MVD C;  3W96 C;  5DNM D;  3AZJ B;  5B2J C;  4NFT A;  1F66 D;  3X1V A;  3AZH D;  2YFV B;  3WAA D;  3WA9 A;  1S32 D;  2F8N G;  3VH5 A;  3MGP D;  2BYK B;  5B31 G;  1BH9 A;  3O62 D;  1BFM A;  3LZ0 B;  4H9S C;  2HIO D;  4E45 A;  1P3O D;  5AV6 C;  1ZLA B;  1P3P D;  3C1C B;  3B0B A;  5JRG B;  5B24 B;  3AV2 B;  3V9R A;  4H9R B;  5BNX A;  3MGR C;  4ZBJ C;  5AVC B;  5F99 B;  4ZUX D;  3AZI B;  3UT9 A;  3AV1 C;  4J8X A;  3AFA B;  1KX4 B;  3W98 A;  4H9P A;  3REJ A;  1P3A A;  4AWL B;  3LEL B;  3AZM D;  4Z66 A;  5B0Y A;  2NZD C;  3X1U A;  3UTA A;  3AZN D; 
#chains in the Genus database with same CATH topology
 4J8V B;  4XZQ D;  1T3U A;  3AZE A;  4WU9 B;  4R8P D;  2IO5 B;  5CPI A;  5B33 D;  1HQ3 B;  3B0C W;  5AV5 B;  3LZ0 C;  1P3G A;  1ZLA C;  3REK A;  2BYM B;  3A1I A;  5JRG C;  5B32 B;  5B24 C;  5FUG B;  1H3O B;  4KUD B;  4Z5T A;  2CV5 A;  3VH6 A;  3KFU G;  5AY8 D;  4NE6 A;  4DRA A;  5AVC C;  5F99 C;  3UTB D;  1AOI D;  5DNM A;  3AFA C;  1P3L B;  3MGQ B;  5GXQ D;  5KDM A;  1F66 A;  3AL0 C;  1ID3 D;  4QLC B;  3AZH A;  3WAA A;  1S32 A;  4AWL C;  3LEL C;  3MGP A;  5BS7 A;  4KGC D;  5CP6 D;  3EPK A;  3O62 A;  4J8V C;  2F8N D;  2ARO B;  1KX5 D;  5B40 B;  5B31 D;  4WZS B;  4J8X C;  3KWQ B;  2HIO A;  4M6B A;  1Z2C B;  4EO5 B;  2IO5 C;  4YM6 B;  1P3O A;  1HQ3 C;  3AZJ D;  5AV5 C;  3AZL D;  4CSR B;  1P3A C;  3H0R C;  3C1B A;  1P3P A;  5G49 B;  5B0Y C;  1M1A D;  3X1U C;  2XD5 A;  3UTA C;  4DQY B;  4XUJ B;  5GT3 B;  3A6N D;  4KUD C;  1TAF A;  5AV9 D;  3AZE C;  1M18 B;  4ZUX A;  3B6F B;  3REI D;  1EQZ D;  2Y2J A;  5GSU D;  1P3M B;  1P3G C;  3AZM A;  2RIQ A;  3REK C;  3W96 B;  3VH6 T;  3AZF D;  5B2J B;  3B6G B;  4UUZ A;  3KXB A;  2CV5 C;  4J8U D;  5AV8 D;  4J8W B;  1U35 D;  4R8P A;  2F2A C;  1WWI A;  5B33 A;  4YS3 B;  2ARO C;  5B40 C;  5CPK D;  2FJ7 D;  4NE3 A;  4EO5 C;  1F66 C;  3FDD A;  3LJA D;  4YM6 C;  3REH B;  3REL D;  5JA4 A;  3WAA C;  1S32 C;  5AV6 B;  1TZY D;  3MNN D;  3MGP C;  5DNN D;  5BT1 D;  1P3B D;  1P3I B;  3MGS D;  5GT3 C;  1N1J A;  3B6F C;  1M18 C;  2BG1 A;  3UTB A;  1AOI A;  2PYO D;  3X1S D;  5GXQ A;  3AV1 B;  3C1B C;  5B0Z D;  5GT0 B;  4WNN A;  3LZ1 D;  1JFI B;  1P3M C;  4WU8 D;  5B32 D;  5CPJ B;  5B1M B;  4KGC A;  5CP6 A;  5AVB D;  2Y2H A;  3B6G C;  1BH8 B;  4CAY A;  2NZD B;  2F8N A;  4ZUX C;  5B2I D;  2F8N H;  1B67 A;  5B31 A;  1KU5 A;  4J8W C;  4YS3 C;  3AZL A;  3MGQ D;  4LD9 D;  3AZM C;  3NQU B;  3REH C;  3KUY D;  3TU4 D;  1M1A A;  3X1V B;  3KXB C;  1M19 D;  3WA9 B;  3A6N A;  3AYW D;  2NQB D;  1P3K D;  5AV9 A;  3EG5 B;  3W97 D;  2DF4 C;  3REI A;  5B33 C;  1EQZ A;  3W99 D;  1P3I C;  1BH9 B;  5GSU A;  1P3F D;  5GT0 C;  5CPJ C;  4NE5 A;  5B1M C;  4J8U A;  5AV8 A;  4JJN D;  1U35 A;  3X1T D;  1P34 D;  3V9R B;  5BNX B;  4H9N A;  1Q9C A;  5CPK A;  1AOI C;  2FJ7 A;  5GXQ C;  3LJA A;  4H9O A;  3UT9 B;  4J8X B;  1KX3 A;  3WTP D;  3REL A;  3W98 B;  4H9P B;  3MVD D;  3REJ B;  2Y2N A;  3AN2 A;  1TZY A;  3MNN A;  1P3A B;  3AZG D;  4Z66 B;  3X1V C;  5DNN A;  3VH5 T;  5B0Y B;  3X1U B;  1P3B A;  3UTA B;  3WA9 C;  3MGS A;  4X23 A;  2ZY5 A;  2ZY4 A;  2PYO A;  3AZL C;  3AZE B;  3X1S A;  5CPI B;  5E5A D;  3AN2 B;  2YFW A;  5B0Z A;  1R4V A;  3LZ1 A;  1M1A C;  4WU8 A;  1P3G B;  5B1L D;  5B32 G;  3REK B;  5AVB A;  3WKJ D;  5AV9 C;  5B2I A;  5BNV A;  4Z5T B;  2CV5 B;  3B0D B;  3MGR D;  2UWX A;  3AZK D;  4LD9 A;  3KUY A;  3UT9 C;  3TU4 A;  5DNM B;  1F66 B;  5KDM B;  3REJ C;  3AZH B;  1WWS A;  3WAA B;  1M19 A;  1S32 B;  4Z66 C;  3AYW A;  2NQB A;  1P3K A;  1U35 C;  3MGP B;  3W97 A;  3W99 A;  5CPK C;  2FJ7 C;  3O62 B;  4H9Q A;  3LJA C;  1P3F A;  1KX3 C;  2CWE A;  2HIO B;  3LZ0 D;  1ULY A;  5CPI C;  3AN2 C;  1P3O B;  1TZY C;  2Y2P A;  4KHA A;  3C1B B;  1P3P B;  1ZLA D;  2ZM5 A;  4G91 B;  3C1C D;  5JRG D;  5B24 D;  3X1T A;  4X23 C;  1P34 A;  3AV2 D;  3AZN A;  4XZQ A;  1TAF B;  4Z5T C;  3B0D C;  4ZUX B;  4G92 B;  5AVC D;  2VQR A;  2DQN C;  5F99 D;  3WTP A;  3AZI D;  3MVD A;  3AFA D;  1KX4 D;  4WU8 C;  5DNM C;  2FFF B;  2W8S A;  3AZG A;  3AZM B;  2Y2K A;  3AZH C;  3LEL D;  2Y2G A;  3AZN B;  4UUZ B;  3KXB B;  5BS7 C;  4J8V D;  2Y2Q A;  4R8P B;  5AY8 A;  4H9S A;  5E5A A;  5B33 B;  3O62 C;  3W98 D;  1A7W A;  4WU9 D;  3KUY C;  3TU4 C;  3H0M C;  1HQ3 D;  5AV5 D;  2HIO C;  5BO0 A;  1P3O C;  5JA4 B;  5B1L A;  1ID3 A;  1M19 C;  1P3P C;  3NQJ A;  3WKJ A;  2NQB C;  3X1U D;  4G91 C;  3W99 C;  4HGA B;  5AY8 B;  3MGR A;  4KUD D;  4WV4 B;  1N1J B;  1P3F C;  3AZK A;  4G92 C;  3R45 A;  3UTB B;  1KX5 A;  1AOI B;  5GXQ B;  3AZJ A;  1P3L D;  3VH6 W;  3REK D;  4WNN B;  4QLC D;  2YFV A;  4KGC B;  5CP6 B;  3AZN C;  2BYK A;  4CAY B;  4XZQ C;  2F8N B;  4Z2M G;  5B31 B;  2HUE C;  2ARO D;  3LZ0 A;  4R8P C;  5B40 D;  3KWQ D;  3AZL B;  4YM6 D;  2G5I C;  3B0C T;  1ZLA A;  3AZG C;  1M1A B;  3C1C A;  5B24 A;  5JRG A;  3IP4 C;  3AZF A;  3AV2 A;  3A6N B;  4DRB A;  4XUJ D;  5AV9 B;  4H9R A;  4HGA C;  5AY8 C;  5GT3 D;  5E5A C;  5AVC A;  3REI B;  1EQZ B;  3B6F D;  1M18 D;  5F99 A;  3AZI A;  3AFA A;  1KX4 A;  5GSU B;  3UTB C;  3C1B D;  5B1L C;  2RVQ D;  1ID3 C;  1P3M D;  1B6W A;  3AZF B;  3LEL A;  3WKJ C;  3W96 D;  2Y2O A;  5B2J D;  4J8U B;  3B6G D;  5CHL B;  4J8V A;  4KGC C;  5CP6 C;  5AV8 B;  1U35 B;  3AZK C;  4J8W D;  4WU9 A;  4H9N B;  5CPK B;  5B31 C;  1KX5 C;  2FJ7 B;  1HQ3 A;  4YS3 D;  5AV5 A;  3LJA B;  4H9O B;  3AZJ C;  1KX3 B;  3REL B;  3REH D;  2XD1 A;  1TZY B;  1F1E A;  2L5A A;  3MNN B;  5AV6 D;  2JSS A;  2BYM A;  3KXB D;  5B32 A;  5DNN B;  5FUG A;  1H3O A;  4KUD A;  1P3B B;  3MGS B;  3A6N C;  4X23 B;  1P3I D;  3W98 C;  3REI C;  4UPK A;  1EQZ C;  2PYO B;  3X1S B;  1P3L A;  5GSU C;  2YFW B;  5B0Z B;  5C3I B;  3MGQ A;  3AV1 D;  3LZ1 B;  4QLC A;  3C1C C;  4WU8 B;  5GT0 D;  3AZF C;  5CPJ D;  5B1M D;  5AVB B;  3AV2 C;  3EPL A;  4J8U C;  2NZD D;  5B2I B;  5BNV B;  5AV8 C;  2ARO A;  3AZI C;  2G5H C;  5B40 A;  1KX4 C;  3KWQ A;  4YM6 A;  4LD9 B;  4CSR A;  3KUY B;  3TU4 B;  3REL C;  5G49 A;  3VH5 W;  3X1V D;  3MNN C;  1M19 B;  3AYW B;  2NQB B;  5DNN C;  4XUJ A;  1P3K B;  3WA9 D;  3W97 B;  5GT3 A;  5BT1 C;  1P3B C;  1M18 A;  4WU9 C;  3MGS C;  4JJN A;  3B6F A;  3W99 B;  2LY8 A;  4H9Q B;  2PYO C;  1P3F B;  3X1S C;  1P3M A;  5B0Z C;  4KHA B;  5C3I C;  3LZ1 C;  3W96 A;  5B2J A;  2ZY2 A;  5B32 C;  3B6G A;  4E44 A;  5AVB C;  4JJN B;  3X1T B;  1P34 B;  3EPH A;  4J8W A;  5B2I C;  4XZQ B;  4YS3 A;  1P3L C;  2HUE B;  3WTP B;  3MGQ C;  3REH A;  3UT9 D;  3MVD B;  4QLC C;  4J8X D;  2F8N K;  4LD9 C;  3REJ D;  5AV6 A;  3AZG B;  1HTA A;  1P3A D;  1W2E A;  4Z66 D;  5B0Y D;  3WTP E;  3AYW C;  3F6T A;  3UTA D;  1P3I A;  1P3K C;  3W97 C;  3KWQ C;  5E5A B;  1KX3 D;  3AZE D;  5CPI D;  3AN2 D;  3AV1 A;  5BO0 B;  5GT0 A;  1JFI A;  5B1L B;  1ID3 B;  5CPJ A;  5B1M A;  3NQJ B;  1P3G D;  3WKJ B;  4XUJ C;  4WJ3 C;  2NZD A;  1BH8 A;  4X23 D;  3KSY A;  4JJN C;  3MGR B;  4ZBJ B;  3X1T C;  1P34 C;  4Z5T D;  2CV5 D;  3AZK B;  3EPJ A;  4Z2M H;  1KX5 B;  2RVQ C;  3R45 B;  3WTP C;  3NQU A;  3MVD C;  3W96 C;  5DNM D;  3AZJ B;  5B2J C;  4NFT A;  1F66 D;  3X1V A;  3AZH D;  2YFV B;  3WAA D;  3WA9 A;  1S32 D;  2F8N G;  3P5J B;  3VH5 A;  3MGP D;  2BYK B;  2Y2I A;  3A1K A;  5B31 G;  1BH9 A;  3O62 D;  1BFM A;  3LZ0 B;  4H9S C;  2HIO D;  3H0L C;  4E45 A;  1P3O D;  5AV6 C;  1ZLA B;  2Y2M A;  1P3P D;  3C1C B;  1PZR A;  3B0B A;  5JRG B;  5B24 B;  2J8P A;  3AV2 B;  3V9R A;  4H9R B;  5BNX A;  3MGR C;  4ZBJ C;  5AVC B;  5F99 B;  4ZUX D;  3AZI B;  3UT9 A;  3AV1 C;  4J8X A;  3AFA B;  1KX4 B;  3W98 A;  2JE5 A;  4H9P A;  3REJ A;  1P3A A;  2ZY3 A;  2JCH A;  3LEL B;  4AWL B;  4Z66 A;  3AZM D;  5B0Y A;  2Y2L A;  2NZD C;  3X1U A;  3UTA A;  3AZN D; 
#chains in the Genus database with same CATH homology
 4J8V B;  4XZQ D;  1T3U A;  3AZE A;  4WU9 B;  4R8P D;  2IO5 B;  5CPI A;  5B33 D;  1HQ3 B;  3B0C W;  5AV5 B;  3LZ0 C;  1P3G A;  1ZLA C;  3REK A;  2BYM B;  3A1I A;  5JRG C;  5B32 B;  5B24 C;  5FUG B;  1H3O B;  4KUD B;  4Z5T A;  2CV5 A;  3VH6 A;  3KFU G;  5AY8 D;  4NE6 A;  4DRA A;  5AVC C;  5F99 C;  3UTB D;  1AOI D;  5DNM A;  3AFA C;  1P3L B;  3MGQ B;  5GXQ D;  5KDM A;  1F66 A;  3AL0 C;  1ID3 D;  4QLC B;  3AZH A;  3WAA A;  1S32 A;  4AWL C;  3LEL C;  3MGP A;  5BS7 A;  4KGC D;  5CP6 D;  3EPK A;  3O62 A;  4J8V C;  2F8N D;  2ARO B;  1KX5 D;  5B40 B;  5B31 D;  4WZS B;  4J8X C;  3KWQ B;  2HIO A;  4M6B A;  1Z2C B;  4EO5 B;  2IO5 C;  4YM6 B;  1P3O A;  1HQ3 C;  3AZJ D;  5AV5 C;  3AZL D;  4CSR B;  1P3A C;  3H0R C;  3C1B A;  1P3P A;  5G49 B;  5B0Y C;  1M1A D;  3X1U C;  2XD5 A;  3UTA C;  4DQY B;  4XUJ B;  5GT3 B;  3A6N D;  4KUD C;  1TAF A;  5AV9 D;  3AZE C;  1M18 B;  4ZUX A;  3B6F B;  3REI D;  1EQZ D;  2Y2J A;  5GSU D;  1P3M B;  1P3G C;  3AZM A;  2RIQ A;  3REK C;  3W96 B;  3VH6 T;  3AZF D;  5B2J B;  3B6G B;  4UUZ A;  3KXB A;  2CV5 C;  4J8U D;  5AV8 D;  4J8W B;  1U35 D;  4R8P A;  2F2A C;  1WWI A;  5B33 A;  4YS3 B;  2ARO C;  5B40 C;  5CPK D;  2FJ7 D;  4NE3 A;  4EO5 C;  1F66 C;  3FDD A;  3LJA D;  4YM6 C;  3REH B;  3REL D;  5JA4 A;  3WAA C;  1S32 C;  5AV6 B;  1TZY D;  3MNN D;  3MGP C;  5DNN D;  5BT1 D;  1P3B D;  1P3I B;  3MGS D;  5GT3 C;  1N1J A;  3B6F C;  1M18 C;  2BG1 A;  3UTB A;  1AOI A;  2PYO D;  3X1S D;  5GXQ A;  3AV1 B;  3C1B C;  5B0Z D;  5GT0 B;  4WNN A;  3LZ1 D;  1JFI B;  1P3M C;  4WU8 D;  5B32 D;  5CPJ B;  5B1M B;  4KGC A;  5CP6 A;  5AVB D;  2Y2H A;  3B6G C;  1BH8 B;  4CAY A;  2NZD B;  2F8N A;  4ZUX C;  5B2I D;  2F8N H;  1B67 A;  5B31 A;  1KU5 A;  4J8W C;  4YS3 C;  3AZL A;  3MGQ D;  4LD9 D;  3AZM C;  3NQU B;  3REH C;  3KUY D;  3TU4 D;  1M1A A;  3X1V B;  3KXB C;  1M19 D;  3WA9 B;  3A6N A;  3AYW D;  2NQB D;  1P3K D;  5AV9 A;  3EG5 B;  3W97 D;  2DF4 C;  3REI A;  5B33 C;  1EQZ A;  3W99 D;  1P3I C;  1BH9 B;  5GSU A;  1P3F D;  5GT0 C;  5CPJ C;  4NE5 A;  5B1M C;  4J8U A;  5AV8 A;  4JJN D;  1U35 A;  3X1T D;  1P34 D;  3V9R B;  5BNX B;  4H9N A;  1Q9C A;  5CPK A;  1AOI C;  2FJ7 A;  5GXQ C;  3LJA A;  4H9O A;  3UT9 B;  4J8X B;  1KX3 A;  3WTP D;  3REL A;  3W98 B;  4H9P B;  3MVD D;  3REJ B;  2Y2N A;  3AN2 A;  1TZY A;  3MNN A;  1P3A B;  3AZG D;  4Z66 B;  3X1V C;  5DNN A;  3VH5 T;  5B0Y B;  3X1U B;  1P3B A;  3UTA B;  3WA9 C;  3MGS A;  4X23 A;  2ZY5 A;  2ZY4 A;  2PYO A;  3AZL C;  3AZE B;  3X1S A;  5CPI B;  5E5A D;  3AN2 B;  2YFW A;  5B0Z A;  1R4V A;  3LZ1 A;  1M1A C;  4WU8 A;  1P3G B;  5B1L D;  5B32 G;  3REK B;  5AVB A;  3WKJ D;  5AV9 C;  5B2I A;  5BNV A;  4Z5T B;  2CV5 B;  3B0D B;  3MGR D;  2UWX A;  3AZK D;  4LD9 A;  3KUY A;  3UT9 C;  3TU4 A;  5DNM B;  1F66 B;  5KDM B;  3REJ C;  3AZH B;  1WWS A;  3WAA B;  1M19 A;  1S32 B;  4Z66 C;  3AYW A;  2NQB A;  1P3K A;  1U35 C;  3MGP B;  3W97 A;  3W99 A;  5CPK C;  2FJ7 C;  3O62 B;  4H9Q A;  3LJA C;  1P3F A;  1KX3 C;  2CWE A;  2HIO B;  3LZ0 D;  1ULY A;  5CPI C;  3AN2 C;  1P3O B;  1TZY C;  2Y2P A;  4KHA A;  3C1B B;  1P3P B;  1ZLA D;  2ZM5 A;  4G91 B;  3C1C D;  5JRG D;  5B24 D;  3X1T A;  4X23 C;  1P34 A;  3AV2 D;  3AZN A;  4XZQ A;  1TAF B;  4Z5T C;  3B0D C;  4ZUX B;  4G92 B;  5AVC D;  2VQR A;  2DQN C;  5F99 D;  3WTP A;  3AZI D;  3MVD A;  3AFA D;  1KX4 D;  4WU8 C;  5DNM C;  2FFF B;  2W8S A;  3AZG A;  3AZM B;  2Y2K A;  3AZH C;  3LEL D;  2Y2G A;  3AZN B;  4UUZ B;  3KXB B;  5BS7 C;  4J8V D;  2Y2Q A;  4R8P B;  5AY8 A;  4H9S A;  5E5A A;  5B33 B;  3O62 C;  3W98 D;  1A7W A;  4WU9 D;  3KUY C;  3TU4 C;  3H0M C;  1HQ3 D;  5AV5 D;  2HIO C;  5BO0 A;  1P3O C;  5JA4 B;  5B1L A;  1ID3 A;  1M19 C;  1P3P C;  3NQJ A;  3WKJ A;  2NQB C;  3X1U D;  4G91 C;  3W99 C;  4HGA B;  5AY8 B;  3MGR A;  4KUD D;  4WV4 B;  1N1J B;  1P3F C;  3AZK A;  4G92 C;  3R45 A;  3UTB B;  1KX5 A;  1AOI B;  5GXQ B;  3AZJ A;  1P3L D;  3VH6 W;  3REK D;  4WNN B;  4QLC D;  2YFV A;  4KGC B;  5CP6 B;  3AZN C;  2BYK A;  4CAY B;  4XZQ C;  2F8N B;  4Z2M G;  5B31 B;  2HUE C;  2ARO D;  3LZ0 A;  4R8P C;  5B40 D;  3KWQ D;  3AZL B;  4YM6 D;  2G5I C;  3B0C T;  1ZLA A;  3AZG C;  1M1A B;  3C1C A;  5B24 A;  5JRG A;  3IP4 C;  3AZF A;  3AV2 A;  3A6N B;  4DRB A;  4XUJ D;  5AV9 B;  4H9R A;  4HGA C;  5AY8 C;  5GT3 D;  5E5A C;  5AVC A;  3REI B;  1EQZ B;  3B6F D;  1M18 D;  5F99 A;  3AZI A;  3AFA A;  1KX4 A;  5GSU B;  3UTB C;  3C1B D;  5B1L C;  2RVQ D;  1ID3 C;  1P3M D;  1B6W A;  3AZF B;  3LEL A;  3WKJ C;  3W96 D;  2Y2O A;  5B2J D;  4J8U B;  3B6G D;  5CHL B;  4J8V A;  4KGC C;  5CP6 C;  5AV8 B;  1U35 B;  3AZK C;  4J8W D;  4WU9 A;  4H9N B;  5CPK B;  5B31 C;  1KX5 C;  2FJ7 B;  1HQ3 A;  4YS3 D;  5AV5 A;  3LJA B;  4H9O B;  3AZJ C;  1KX3 B;  3REL B;  3REH D;  2XD1 A;  1TZY B;  1F1E A;  2L5A A;  3MNN B;  5AV6 D;  2JSS A;  2BYM A;  3KXB D;  5B32 A;  5DNN B;  5FUG A;  1H3O A;  4KUD A;  1P3B B;  3MGS B;  3A6N C;  4X23 B;  1P3I D;  3W98 C;  3REI C;  4UPK A;  1EQZ C;  2PYO B;  3X1S B;  1P3L A;  5GSU C;  2YFW B;  5B0Z B;  5C3I B;  3MGQ A;  3AV1 D;  3LZ1 B;  4QLC A;  3C1C C;  4WU8 B;  5GT0 D;  3AZF C;  5CPJ D;  5B1M D;  5AVB B;  3AV2 C;  3EPL A;  4J8U C;  2NZD D;  5B2I B;  5BNV B;  5AV8 C;  2ARO A;  3AZI C;  2G5H C;  5B40 A;  1KX4 C;  3KWQ A;  4YM6 A;  4LD9 B;  4CSR A;  3KUY B;  3TU4 B;  3REL C;  5G49 A;  3VH5 W;  3X1V D;  3MNN C;  1M19 B;  3AYW B;  2NQB B;  5DNN C;  4XUJ A;  1P3K B;  3WA9 D;  3W97 B;  5GT3 A;  5BT1 C;  1P3B C;  1M18 A;  4WU9 C;  3MGS C;  4JJN A;  3B6F A;  3W99 B;  2LY8 A;  4H9Q B;  2PYO C;  1P3F B;  3X1S C;  1P3M A;  5B0Z C;  4KHA B;  5C3I C;  3LZ1 C;  3W96 A;  5B2J A;  2ZY2 A;  5B32 C;  3B6G A;  4E44 A;  5AVB C;  4JJN B;  3X1T B;  1P34 B;  3EPH A;  4J8W A;  5B2I C;  4XZQ B;  4YS3 A;  1P3L C;  2HUE B;  3WTP B;  3MGQ C;  3REH A;  3UT9 D;  3MVD B;  4QLC C;  4J8X D;  2F8N K;  4LD9 C;  3REJ D;  5AV6 A;  3AZG B;  1HTA A;  1P3A D;  1W2E A;  4Z66 D;  5B0Y D;  3WTP E;  3AYW C;  3F6T A;  3UTA D;  1P3I A;  1P3K C;  3W97 C;  3KWQ C;  5E5A B;  1KX3 D;  3AZE D;  5CPI D;  3AN2 D;  3AV1 A;  5BO0 B;  5GT0 A;  1JFI A;  5B1L B;  1ID3 B;  5CPJ A;  5B1M A;  3NQJ B;  1P3G D;  3WKJ B;  4XUJ C;  4WJ3 C;  2NZD A;  1BH8 A;  4X23 D;  3KSY A;  4JJN C;  3MGR B;  4ZBJ B;  3X1T C;  1P34 C;  4Z5T D;  2CV5 D;  3AZK B;  3EPJ A;  4Z2M H;  1KX5 B;  2RVQ C;  3R45 B;  3WTP C;  3NQU A;  3MVD C;  3W96 C;  5DNM D;  3AZJ B;  5B2J C;  4NFT A;  1F66 D;  3X1V A;  3AZH D;  2YFV B;  3WAA D;  3WA9 A;  1S32 D;  2F8N G;  3P5J B;  3VH5 A;  3MGP D;  2BYK B;  2Y2I A;  3A1K A;  5B31 G;  1BH9 A;  3O62 D;  1BFM A;  3LZ0 B;  4H9S C;  2HIO D;  3H0L C;  4E45 A;  1P3O D;  5AV6 C;  1ZLA B;  2Y2M A;  1P3P D;  3C1C B;  1PZR A;  3B0B A;  5JRG B;  5B24 B;  2J8P A;  3AV2 B;  3V9R A;  4H9R B;  5BNX A;  3MGR C;  4ZBJ C;  5AVC B;  5F99 B;  4ZUX D;  3AZI B;  3UT9 A;  3AV1 C;  4J8X A;  3AFA B;  1KX4 B;  3W98 A;  2JE5 A;  4H9P A;  3REJ A;  1P3A A;  2ZY3 A;  2JCH A;  3LEL B;  4AWL B;  4Z66 A;  3AZM D;  5B0Y A;  2Y2L A;  2NZD C;  3X1U A;  3UTA A;  3AZN D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...