5AV8A

Human nucleosome core particle
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av8A00
3AZJD 3A6NC 5B33D 1ID3A 5B2JD 5F99B 3REJD 5JRGC 5GXQA 2HIOB 3UTAA 3AZHD 3W99A 4YM6A 4XUJA 5GSUA 4KUDC 5AV5B 3AZED 1KU5A 1ZLAD 3WAAA 2FJ7D 3B6FD 3AYWD 4LD9D 4KHAB 1P3GA 5FUGB 3UT9B 5B0ZC 4NE6A 3W96A 4WU8D 3AZMD 1N1JB 4JJNC 5CPJA 3AV1D 5B31B 1P3AB 4ZUXA 3REHA 1TZYD 5C3IC 3AN2B 5B1LB 3MGRB 3B6GD 3LZ1C 5AVBD 3REKC 4HGAC 2PYOA 3MGSA 1P3LB 5AV6B 4QLCD 4YS3D 2AROC 1HTAA 2NQBA 1F66D 5AV8A 2F8NB 1EQZA 3KXBD 3X1VC 3C1CB 5B2IC 1ID3D 5CHLB 3AZIB 1M18A 2CV5C 1P3BC 5GXQD 3REIA 3MNNA 5B0YC 3UTAD 3W99D 3B0CW 4YM6D 4XUJD 5GSUD 3AFAB 1B6WA 4H9RA 3UTBB 1P3MA 1M19A 3KUYB 3WAAD 1KX3B 3WA9A 3W97B 4J8VC 1P3KA 2IO5C 3AZLB 2YFVA 1P3GD 3X1TA 5B32C 1BFMA 4H9SC 3LELB 3W96D 4H9OA 4WNNA 5E5AC 4J8XA 5CPJD 1U35B 3REHD 1KX5C 5GT3C 3MGPC 4H9QB 1TAFA 3AZGA 1BH9A 1P3IA 5DNMB 3WKJB 1P3OC 1P3FB 3RELA 2PYOD 3A6NB 5CPKB 3MGSD 5JRGB 4KGCA 2NQBD 5B31G 4Z5TC 4KUDB 2NZDA 5AV8D 1P34B 3AZFC 1EQZD 3X1UC 4J8UC 5DNNA 5B24A 3AZNC 1M18D 5BNVB 3NQUA 3AZJC 4X23C 4H9NB 5BO0A 3REID 5B33C 1F1EA 3REJC 1A7WA 3LJAB 5B0ZB 3AZHC 4JJNB 2F8NG 3V9RB 5B2JA 3WA9D 5GT0A 1WWSA 2FJ7C 5C3IB 4DRAA 4LD9C 3AZEA 1ZLAA 1AOIA 3WTPE 4J8XD 3LZ1B 3REKB 4DRBA 3AZIC 4WU8C 4HGAB 5AV9D 5BS7C 5CP6A 5KDMA 3MVDC 5CPIA 2AROB 3AZGD 1TZYC 2BYMB 4G92C 1P3ID 5B40C 4NFTA 3AZMA 3X1VB 3KUYC 3RELD 3AV1A 4Z2MG 5AVBC 1P3BB 4CAYB 4KGCD 5B0YB 2NZDD 1BH8A 1F66C 3B6GA 5DNND 5B24D 4UUZA 4J8VB 5BNXB 1ID3C 2IO5B 5B32B 5DNMC 3WKJC 3KXBA 3UTAC 4YM6C 5E5AB 4XUJC 5CPKC 3VH6W 5GT0D 4R8PA 1S32A 3O62A 3WAAC 2L5AA 1KX5B 5GT3B 3MGPB 2JSSA 1P34C 2YFWA 1AOID 1P3GC 1P3OB 1M1AA 1H3OA 5CP6D 3WTPA 5CPJC 5CPID 4ZUXC 3REHC 3LJAC 3AZKA 4Z5TB 3KSYA 4XZQB 1JFIB 3AZFB 5B31D 3X1UB 4J8UB 5AY8B 1R4VA 4NE3A 3AZNB 1HQ3A 3AZJB 4X23B 5B33B 1KX4A 3MGRD 3MGSC 3REJB 2NQBC 5JA4B 4CSRB 3AZHB 5G49B 3AV2A 1EQZC 2FJ7B 3B6FB 2BYKB 3MGQA 3AYWB 4LD9B 3MNNC 3KWQA 4WU8B 4R8PD 1S32D 3O62D 3MVDB 1P3MC 1M19C 3WA9C 3UTBD 1TZYB 1P3KC 4G92B 5B40B 1KX3D 4AWLC 4G91C 5B32G 3TU4A 3X1TC 1M1AD 3R45B 4J8XC 5B1MA 5AVBB 3WTPD 3NQJA 3X1SA 3W98A 3AZKD 4QLCB 4YS3B 4Z66A 4J8WA 1F66B 3AZGC 1P3IC 2F8NH 5AV9A 1HQ3D 1ID3B 1KX4D 1P3FD 5B2IA 5GXQB 4KGCC 3UTAB 3W99B 4YM6B 5GSUB 5BT1D 4XUJB 4WU9A 2CV5A 4H9PA 1P3PA 3AV2D 1Q9CA 5DNNC 3WAAB 3C1BA 3MGQD 4XZQC 3KWQD 1P3GB 5AY8C 3W96B 4Z2MH 3AZND 3VH6T 5CPJB 5B0ZD 5B2JC 5GT0C 5AVCA 4ZUXB 3REHB 3LZ0A 5F99A 3TU4D 3AZEC 1ZLAC 4E44A 2HIOA 1AOIC 4WV4B 5B1MD 5AV5A 3X1SD 3B6FC 5CP6C 3MGSB 3AYWC 3W98D 3REKD 5CPIC 2NQBB 4Z66D 4J8WD 4KHAA 5AV8B 1EQZB 3AZMC 5FUGA 3UT9A 3AV1C 1M18B 1N1JA 3X1VD 5B2ID 3VH5T 3REIB 3MNNB 5B31A 1P3AA 2CV5D 4WU9D 1P3BD 4H9RB 1P3PD 3B6GC 5B0YD 3AN2A 5B1LA 1P3MB 1M19B 4NE5A 3MGRA 3WA9B 3C1BD 4QLCC 4YS3C 4E45A 1P3KB 2YFVB 4AWLB 4G91B 3X1TB 5AV6A 1P3LA 3KXBC 4H9OB 4WNNB 4J8XB 5B32D 2F8NA 5AVCD 3C1CA 1S32C 5GXQC 2LY8A 3O62C 3LZ0D 3W99C 3AZIA 5GSUC 5F99D 1TAFB 3AZGB 1BH9B 1P3IB 2HIOD 1KX5D 5AV5D 3RELB 1M1AC 3AFAA 3UTBA 1P3OD 3WTPC 3KUYA 4KGCB 1KX3A 3W97A 2RVQD 3W96C 2NZDB 3AZLA 3UT9D 5DNNB 3LELA 5B24B 3NQUB 1HQ3C 4J8UD 3B0DC 5BO0B 1KX4C 1U35A 1P3AD 4X23D 1ULYA 4H9QA 5BT1C 3AN2D 5B1LD 2PYOC 3AV2C 5DNMA 3VH5W 3WKJA 5B2JB 5GT0B 1P3FA 2HUEC 3A6NA 5CPKA 3MGQC 1P3LD 5AV8C 3AZEB 5AV6D 5JRGA 1ZLAB 1AOIB 3KWQC 4KUDA 1P34A 2F8ND 1M18C 5CP6B 3C1CD 5KDMB 3REIC 5CPIB 3AZID 5BNVA 4H9NA 3MVDD 3AZMB 3TU4C 3LJAA 5B0ZA 3AV1B 3AFAD 5B40D 5B1MC 4JJNA 3KUYD 3X1SC 3V9RA 3W98C 3W97D 4Z66C 4J8WC 3AZLD 1BH8B 3B6GB 3LELD 4M6BA 5AV9C 4UUZB 3LZ1A 3REKA 4EO5C 2CWEA 1U35D 3B0BA 2AROA 3KXBB 3RELC 4WU9C 2BYMA 1P3PC 5DNMD 3WKJD 4R8PB 3X1VA 1S32B 3O62B 3A6ND 5CPKD 3C1BC 2NZDC 1P3BA 2YFWB 5JRGD 4CAYA 5B0YA 4KUDD 5B24C 1M1AB 1P34D 1H3OB 3WTPB 5AVCC 3AZKB 3LZ0C 4J8VA 5BNXA 5F99C 4ZUXD 5B32A 3LJAD 2HIOC 4H9SA 5E5AA 5AV5C 1HQ3B 4JJND 3B0DB 4ZBJB 1KX4B 1KX5A 5GT3A 3MGPA 2RVQC 2PYOB 3AV2B 1P3OA 3UT9C 3LZ1D 2HUEB 3MGQB 2AROD 5B31C 3KWQB 1B67A 1P3AC 4Z5TA 4XZQA 1JFIA 3VH6A 3MNND 3AZFA 4WZSB 3X1UA 4J8UA 3AN2C 5B1LC 5AY8A 3MGRC 3AZNA 3AZJA 4X23A 1P3MD 1M19D 5B33A 2F8NK 1P3LC 3TU4B 5AV6C 3REJA 5JA4A 4CSRA 1P3KD 1WWIA 3AZHA 5B1MB 5G49A 3X1TD 3NQJB 3X1SB 3C1CC 3W98B 4J8VD 2FJ7A 4Z66B 4J8WB 3B6FA 2BYKA 3AYWA 4LD9A 5AV9B 4R8PC 5E5AD 3AFAC 4EO5B 4WU8A 3UTBC 3VH5A 5BS7A 3MVDA 5B2IB 1KX3C 5GT3D 3MGPD 3W97C 2CV5B 4WU9B 1TZYA 4H9PB 1P3PB 5B40A 3AZLC 3LELC 3R45A 3AZKC 3C1BB 5AVBA 1U35C 4Z5TD 4QLCA 4XZQD 4YS3A 3AZFD 1F66A 3X1UD 4ZBJC 5AY8D 3B0CT 5AVCB 1P3FC 3LZ0B
chains in the Genus database with same CATH superfamily
3AZJD 3A6NC 5B33D 1ID3A 5B2JD 3EG5B 5F99B 3REJD 5JRGC 5GXQA 2HIOB 3EPJA 3UTAA 3AZHD 3W99A 4YM6A 4XUJA 5GSUA 4KUDC 5AV5B 3AZED 1KU5A 1ZLAD 1T3UA 2FJ7D 3WAAA 3B6FD 3AYWD 4LD9D 4KHAB 3F6TA 1P3GA 5FUGB 3UT9B 5B0ZC 4NE6A 3W96A 4WU8D 3AZMD 1N1JB 4JJNC 5CPJA 3AV1D 5B31B 1P3AB 4ZUXA 3REHA 1TZYD 5C3IC 2Y2OA 3AN2B 2VQRA 5B1LB 3MGRB 3B6GD 3LZ1C 5AVBD 3REKC 4HGAC 2PYOA 3MGSA 1P3LB 5AV6B 4QLCD 4YS3D 2AROC 1HTAA 2NQBA 2G5HC 1F66D 5AV8A 2F8NB 1EQZA 3KXBD 3X1VC 3C1CB 5B2IC 1ID3D 5CHLB 3AZIB 1M18A 2CV5C 1P3BC 5GXQD 3REIA 3MNNA 5B0YC 3UTAD 3W99D 3B0CW 4YM6D 4XUJD 5GSUD 3AFAB 1B6WA 4H9RA 3UTBB 1P3MA 1M19A 3KUYB 3WAAD 1KX3B 3WA9A 3W97B 4J8VC 1P3KA 2IO5C 3AZLB 2YFVA 1P3GD 3X1TA 5B32C 1BFMA 4H9SC 3LELB 3W96D 4H9OA 2XD1A 4WNNA 5E5AC 4J8XA 5CPJD 1U35B 3REHD 1KX5C 5GT3C 3MGPC 4H9QB 1TAFA 3AZGA 1BH9A 1P3IA 5DNMB 3WKJB 1P3OC 1P3FB 3RELA 2PYOD 3A6NB 5CPKB 2Y2KA 3MGSD 5JRGB 4KGCA 2NQBD 5B31G 4Z5TC 4KUDB 2NZDA 5AV8D 1P34B 3AZFC 1EQZD 3X1UC 4J8UC 5DNNA 5B24A 3AZNC 1M18D 5BNVB 3NQUA 3AZJC 4X23C 4H9NB 5BO0A 3REID 5B33C 1F1EA 3REJC 1A7WA 3LJAB 5B0ZB 3AZHC 4JJNB 2F8NG 3V9RB 5B2JA 2XD5A 3WA9D 5GT0A 1WWSA 2FJ7C 5C3IB 4DRAA 4LD9C 3AZEA 1PZRA 1ZLAA 1AOIA 3WTPE 4J8XD 3LZ1B 3REKB 4DRBA 3AZIC 4WU8C 4HGAB 5AV9D 5BS7C 5CP6A 5KDMA 3MVDC 5CPIA 2AROB 3AZGD 1TZYC 2BYMB 2Y2IA 4G92C 1P3ID 5B40C 4NFTA 3AZMA 3X1VB 3KUYC 3RELD 3AV1A 4Z2MG 3FDDA 5AVBC 3IP4C 1P3BB 4CAYB 4KGCD 5B0YB 2Y2JA 2NZDD 2Y2PA 1BH8A 1F66C 3B6GA 5DNND 5B24D 2ZY2A 4UUZA 4J8VB 5BNXB 1ID3C 2IO5B 5B32B 5DNMC 3WKJC 3KXBA 3UTAC 4YM6C 5E5AB 4XUJC 5CPKC 3VH6W 5GT0D 4R8PA 3AL0C 1S32A 3O62A 3WAAC 1W2EA 2L5AA 1KX5B 5GT3B 3MGPB 2JSSA 1P34C 2YFWA 1AOID 1P3GC 2DF4C 1P3OB 1M1AA 1H3OA 5CP6D 3WTPA 5CPJC 5CPID 3H0MC 4ZUXC 3REHC 3LJAC 3AZKA 4Z5TB 3KSYA 4XZQB 1JFIB 3AZFB 5B31D 3X1UB 4J8UB 5AY8B 1R4VA 4NE3A 3AZNB 1HQ3A 3AZJB 4X23B 5B33B 1KX4A 3MGRD 3MGSC 3REJB 2NQBC 5JA4B 4CSRB 3AZHB 5G49B 3AV2A 1EQZC 2FJ7B 2UWXA 3B6FB 2BYKB 3MGQA 3AYWB 4LD9B 3MNNC 4WJ3C 3KWQA 4WU8B 4R8PD 1S32D 3O62D 3MVDB 1P3MC 1M19C 3WA9C 3UTBD 3A1IA 3KFUG 1TZYB 1P3KC 4G92B 5B40B 1KX3D 4AWLC 4G91C 5B32G 3TU4A 3X1TC 1M1AD 2F2AC 3R45B 4J8XC 5B1MA 5AVBB 3WTPD 4DQYB 3NQJA 3X1SA 3W98A 3AZKD 4QLCB 4YS3B 4Z66A 4J8WA 1F66B 3AZGC 1P3IC 2F8NH 5AV9A 1HQ3D 1ID3B 1KX4D 1P3FD 5B2IA 5GXQB 4KGCC 3UTAB 3W99B 4YM6B 5GSUB 5BT1D 4XUJB 4WU9A 2CV5A 4H9PA 1P3PA 3AV2D 1Q9CA 5DNNC 3WAAB 3C1BA 3MGQD 4XZQC 3KWQD 1P3GB 5AY8C 3W96B 4Z2MH 3AZND 3EPKA 3VH6T 5CPJB 5B0ZD 5B2JC 5GT0C 5AVCA 4ZUXB 3REHB 3LZ0A 5F99A 3TU4D 3AZEC 1ZLAC 4E44A 2HIOA 2DQNC 1AOIC 4WV4B 2Y2QA 5B1MD 5AV5A 3X1SD 3B6FC 5CP6C 3MGSB 3AYWC 3W98D 3REKD 5CPIC 2NQBB 4Z66D 4J8WD 4KHAA 5AV8B 1EQZB 3AZMC 5FUGA 3UT9A 3AV1C 1Z2CB 1M18B 1N1JA 3X1VD 5B2ID 3VH5T 3REIB 3MNNB 5B31A 1P3AA 2CV5D 4WU9D 1P3BD 4H9RB 1P3PD 3B6GC 5B0YD 3AN2A 5B1LA 1P3MB 1M19B 4NE5A 3MGRA 3WA9B 3C1BD 4QLCC 4YS3C 4E45A 1P3KB 2YFVB 4AWLB 4G91B 3X1TB 5AV6A 1P3LA 3KXBC 4H9OB 4WNNB 4J8XB 5B32D 2F8NA 5AVCD 3C1CA 1S32C 5GXQC 2LY8A 3O62C 3LZ0D 3W99C 3AZIA 5GSUC 5F99D 1TAFB 3AZGB 1BH9B 1P3IB 2HIOD 1KX5D 2FFFB 5AV5D 3RELB 1M1AC 3AFAA 2ZM5A 3UTBA 1P3OD 3WTPC 3KUYA 4KGCB 1KX3A 3W97A 2RVQD 3W96C 2NZDB 3AZLA 3UT9D 5DNNB 3LELA 2JCHA 5B24B 3NQUB 1HQ3C 4J8UD 3B0DC 5BO0B 1KX4C 1U35A 1P3AD 4X23D 1ULYA 4H9QA 5BT1C 3AN2D 5B1LD 2PYOC 2J8PA 5DNMA 3VH5W 3AV2C 5B2JB 3WKJA 5GT0B 1P3FA 2HUEC 3A6NA 5CPKA 3MGQC 1P3LD 5AV8C 3AZEB 5AV6D 5JRGA 1ZLAB 1AOIB 3KWQC 4KUDA 1P34A 2F8ND 1M18C 5CP6B 3C1CD 5KDMB 3REIC 5CPIB 3AZID 5BNVA 4H9NA 3MVDD 3AZMB 3TU4C 2JE5A 3LJAA 5B0ZA 3AV1B 3AFAD 5B40D 5B1MC 4JJNA 3KUYD 3X1SC 3V9RA 3W98C 3W97D 4Z66C 4J8WC 3AZLD 1BH8B 3B6GB 3LELD 4M6BA 5AV9C 4UUZB 3LZ1A 3REKA 4EO5C 2CWEA 1U35D 3B0BA 2AROA 3H0RC 3KXBB 3H0LC 2ZY5A 3RELC 4WU9C 2BYMA 1P3PC 5DNMD 3WKJD 4R8PB 3X1VA 1S32B 2ZY4A 3O62B 3A6ND 5CPKD 2Y2LA 3C1BC 2NZDC 1P3BA 2YFWB 5JRGD 4CAYA 5B0YA 4KUDD 5B24C 1M1AB 1P34D 1H3OB 2W8SA 3WTPB 2BG1A 5AVCC 3AZKB 3LZ0C 3EPLA 5BNXA 4J8VA 5F99C 2Y2NA 4ZUXD 5B32A 3LJAD 2HIOC 4H9SA 5E5AA 5AV5C 1HQ3B 4JJND 3B0DB 4ZBJB 1KX4B 2RIQA 1KX5A 5GT3A 3MGPA 2RVQC 2ZY3A 2PYOB 3AV2B 1P3OA 3UT9C 3LZ1D 2HUEB 3MGQB 2AROD 5B31C 3KWQB 1B67A 1P3AC 4UPKA 4Z5TA 4XZQA 1JFIA 3VH6A 3MNND 3AZFA 4WZSB 3X1UA 2G5IC 4J8UA 5B1LC 3AN2C 5AY8A 3MGRC 3AZNA 3AZJA 4X23A 1P3MD 1M19D 5B33A 2F8NK 1P3LC 3TU4B 5AV6C 3REJA 5JA4A 4CSRA 1P3KD 1WWIA 3AZHA 5B1MB 5G49A 3X1TD 3NQJB 3X1SB 3C1CC 3W98B 2Y2MA 2Y2GA 4J8VD 2Y2HA 2FJ7A 4Z66B 4J8WB 3B6FA 2BYKA 3EPHA 3AYWA 4LD9A 5AV9B 4R8PC 5E5AD 3AFAC 4EO5B 4WU8A 3UTBC 3VH5A 5BS7A 3A1KA 3MVDA 5B2IB 1KX3C 5GT3D 3MGPD 3W97C 2CV5B 4WU9B 1TZYA 4H9PB 1P3PB 5B40A 3AZLC 3LELC 3R45A 3AZKC 3P5JB 3C1BB 5AVBA 1U35C 4Z5TD 4QLCA 4XZQD 4YS3A 3AZFD 1F66A 3X1UD 4ZBJC 5AY8D 3B0CT 5AVCB 1P3FC 3LZ0B
chains in the Genus database with same CATH topology
3AZJD 3A6NC 5B33D 1ID3A 5B2JD 3EG5B 5F99B 3REJD 5JRGC 5GXQA 2HIOB 3EPJA 3UTAA 3AZHD 3W99A 4YM6A 4XUJA 5GSUA 4KUDC 5AV5B 3AZED 1KU5A 1ZLAD 1T3UA 2FJ7D 3WAAA 3B6FD 3AYWD 4LD9D 4KHAB 3F6TA 1P3GA 5FUGB 3UT9B 5B0ZC 4NE6A 3W96A 4WU8D 3AZMD 1N1JB 4JJNC 5CPJA 3AV1D 5B31B 1P3AB 4ZUXA 3REHA 1TZYD 5C3IC 2Y2OA 3AN2B 2VQRA 5B1LB 3MGRB 3B6GD 3LZ1C 5AVBD 3REKC 4HGAC 2PYOA 3MGSA 1P3LB 5AV6B 4QLCD 4YS3D 2AROC 1HTAA 2NQBA 2G5HC 1F66D 5AV8A 2F8NB 1EQZA 3KXBD 3X1VC 3C1CB 5B2IC 1ID3D 5CHLB 3AZIB 1M18A 2CV5C 1P3BC 5GXQD 3REIA 3MNNA 5B0YC 3UTAD 3W99D 3B0CW 4YM6D 4XUJD 5GSUD 3AFAB 1B6WA 4H9RA 3UTBB 1P3MA 1M19A 3KUYB 3WAAD 1KX3B 3WA9A 3W97B 4J8VC 1P3KA 2IO5C 3AZLB 2YFVA 1P3GD 3X1TA 5B32C 1BFMA 4H9SC 3LELB 3W96D 4H9OA 2XD1A 4WNNA 5E5AC 4J8XA 5CPJD 1U35B 3REHD 1KX5C 5GT3C 3MGPC 4H9QB 1TAFA 3AZGA 1BH9A 1P3IA 5DNMB 3WKJB 1P3OC 1P3FB 3RELA 2PYOD 3A6NB 5CPKB 2Y2KA 3MGSD 5JRGB 4KGCA 2NQBD 5B31G 4Z5TC 4KUDB 2NZDA 5AV8D 1P34B 3AZFC 1EQZD 3X1UC 4J8UC 5DNNA 5B24A 3AZNC 1M18D 5BNVB 3NQUA 3AZJC 4X23C 4H9NB 5BO0A 3REID 5B33C 1F1EA 3REJC 1A7WA 3LJAB 5B0ZB 3AZHC 4JJNB 2F8NG 3V9RB 5B2JA 2XD5A 3WA9D 5GT0A 1WWSA 2FJ7C 5C3IB 4DRAA 4LD9C 3AZEA 1PZRA 1ZLAA 1AOIA 3WTPE 4J8XD 3LZ1B 3REKB 4DRBA 3AZIC 4WU8C 4HGAB 5AV9D 5BS7C 5CP6A 5KDMA 3MVDC 5CPIA 2AROB 3AZGD 1TZYC 2BYMB 2Y2IA 4G92C 1P3ID 5B40C 4NFTA 3AZMA 3X1VB 3KUYC 3RELD 3AV1A 4Z2MG 3FDDA 5AVBC 3IP4C 1P3BB 4CAYB 4KGCD 5B0YB 2Y2JA 2NZDD 2Y2PA 1BH8A 1F66C 3B6GA 5DNND 5B24D 2ZY2A 4UUZA 4J8VB 5BNXB 1ID3C 2IO5B 5B32B 5DNMC 3WKJC 3KXBA 3UTAC 4YM6C 5E5AB 4XUJC 5CPKC 3VH6W 5GT0D 4R8PA 3AL0C 1S32A 3O62A 3WAAC 1W2EA 2L5AA 1KX5B 5GT3B 3MGPB 2JSSA 1P34C 2YFWA 1AOID 1P3GC 2DF4C 1P3OB 1M1AA 1H3OA 5CP6D 3WTPA 5CPJC 5CPID 3H0MC 4ZUXC 3REHC 3LJAC 3AZKA 4Z5TB 3KSYA 4XZQB 1JFIB 3AZFB 5B31D 3X1UB 4J8UB 5AY8B 1R4VA 4NE3A 3AZNB 1HQ3A 3AZJB 4X23B 5B33B 1KX4A 3MGRD 3MGSC 3REJB 2NQBC 5JA4B 4CSRB 3AZHB 5G49B 3AV2A 1EQZC 2FJ7B 2UWXA 3B6FB 2BYKB 3MGQA 3AYWB 4LD9B 3MNNC 4WJ3C 3KWQA 4WU8B 4R8PD 1S32D 3O62D 3MVDB 1P3MC 1M19C 3WA9C 3UTBD 3A1IA 3KFUG 1TZYB 1P3KC 4G92B 5B40B 1KX3D 4AWLC 4G91C 5B32G 3TU4A 3X1TC 1M1AD 2F2AC 3R45B 4J8XC 5B1MA 5AVBB 3WTPD 4DQYB 3NQJA 3X1SA 3W98A 3AZKD 4QLCB 4YS3B 4Z66A 4J8WA 1F66B 3AZGC 1P3IC 2F8NH 5AV9A 1HQ3D 1ID3B 1KX4D 1P3FD 5B2IA 5GXQB 4KGCC 3UTAB 3W99B 4YM6B 5GSUB 5BT1D 4XUJB 4WU9A 2CV5A 4H9PA 1P3PA 3AV2D 1Q9CA 5DNNC 3WAAB 3C1BA 3MGQD 4XZQC 3KWQD 1P3GB 5AY8C 3W96B 4Z2MH 3AZND 3EPKA 3VH6T 5CPJB 5B0ZD 5B2JC 5GT0C 5AVCA 4ZUXB 3REHB 3LZ0A 5F99A 3TU4D 3AZEC 1ZLAC 4E44A 2HIOA 2DQNC 1AOIC 4WV4B 2Y2QA 5B1MD 5AV5A 3X1SD 3B6FC 5CP6C 3MGSB 3AYWC 3W98D 3REKD 5CPIC 2NQBB 4Z66D 4J8WD 4KHAA 5AV8B 1EQZB 3AZMC 5FUGA 3UT9A 3AV1C 1Z2CB 1M18B 1N1JA 3X1VD 5B2ID 3VH5T 3REIB 3MNNB 5B31A 1P3AA 2CV5D 4WU9D 1P3BD 4H9RB 1P3PD 3B6GC 5B0YD 3AN2A 5B1LA 1P3MB 1M19B 4NE5A 3MGRA 3WA9B 3C1BD 4QLCC 4YS3C 4E45A 1P3KB 2YFVB 4AWLB 4G91B 3X1TB 5AV6A 1P3LA 3KXBC 4H9OB 4WNNB 4J8XB 5B32D 2F8NA 5AVCD 3C1CA 1S32C 5GXQC 2LY8A 3O62C 3LZ0D 3W99C 3AZIA 5GSUC 5F99D 1TAFB 3AZGB 1BH9B 1P3IB 2HIOD 1KX5D 2FFFB 5AV5D 3RELB 1M1AC 3AFAA 2ZM5A 3UTBA 1P3OD 3WTPC 3KUYA 4KGCB 1KX3A 3W97A 2RVQD 3W96C 2NZDB 3AZLA 3UT9D 5DNNB 3LELA 2JCHA 5B24B 3NQUB 1HQ3C 4J8UD 3B0DC 5BO0B 1KX4C 1U35A 1P3AD 4X23D 1ULYA 4H9QA 5BT1C 3AN2D 5B1LD 2PYOC 2J8PA 5DNMA 3VH5W 3AV2C 5B2JB 3WKJA 5GT0B 1P3FA 2HUEC 3A6NA 5CPKA 3MGQC 1P3LD 5AV8C 3AZEB 5AV6D 5JRGA 1ZLAB 1AOIB 3KWQC 4KUDA 1P34A 2F8ND 1M18C 5CP6B 3C1CD 5KDMB 3REIC 5CPIB 3AZID 5BNVA 4H9NA 3MVDD 3AZMB 3TU4C 2JE5A 3LJAA 5B0ZA 3AV1B 3AFAD 5B40D 5B1MC 4JJNA 3KUYD 3X1SC 3V9RA 3W98C 3W97D 4Z66C 4J8WC 3AZLD 1BH8B 3B6GB 3LELD 4M6BA 5AV9C 4UUZB 3LZ1A 3REKA 4EO5C 2CWEA 1U35D 3B0BA 2AROA 3H0RC 3KXBB 3H0LC 2ZY5A 3RELC 4WU9C 2BYMA 1P3PC 5DNMD 3WKJD 4R8PB 3X1VA 1S32B 2ZY4A 3O62B 3A6ND 5CPKD 2Y2LA 3C1BC 2NZDC 1P3BA 2YFWB 5JRGD 4CAYA 5B0YA 4KUDD 5B24C 1M1AB 1P34D 1H3OB 2W8SA 3WTPB 2BG1A 5AVCC 3AZKB 3LZ0C 3EPLA 5BNXA 4J8VA 5F99C 2Y2NA 4ZUXD 5B32A 3LJAD 2HIOC 4H9SA 5E5AA 5AV5C 1HQ3B 4JJND 3B0DB 4ZBJB 1KX4B 2RIQA 1KX5A 5GT3A 3MGPA 2RVQC 2ZY3A 2PYOB 3AV2B 1P3OA 3UT9C 3LZ1D 2HUEB 3MGQB 2AROD 5B31C 3KWQB 1B67A 1P3AC 4UPKA 4Z5TA 4XZQA 1JFIA 3VH6A 3MNND 3AZFA 4WZSB 3X1UA 2G5IC 4J8UA 5B1LC 3AN2C 5AY8A 3MGRC 3AZNA 3AZJA 4X23A 1P3MD 1M19D 5B33A 2F8NK 1P3LC 3TU4B 5AV6C 3REJA 5JA4A 4CSRA 1P3KD 1WWIA 3AZHA 5B1MB 5G49A 3X1TD 3NQJB 3X1SB 3C1CC 3W98B 2Y2MA 2Y2GA 4J8VD 2Y2HA 2FJ7A 4Z66B 4J8WB 3B6FA 2BYKA 3EPHA 3AYWA 4LD9A 5AV9B 4R8PC 5E5AD 3AFAC 4EO5B 4WU8A 3UTBC 3VH5A 5BS7A 3A1KA 3MVDA 5B2IB 1KX3C 5GT3D 3MGPD 3W97C 2CV5B 4WU9B 1TZYA 4H9PB 1P3PB 5B40A 3AZLC 3LELC 3R45A 3AZKC 3P5JB 3C1BB 5AVBA 1U35C 4Z5TD 4QLCA 4XZQD 4YS3A 3AZFD 1F66A 3X1UD 4ZBJC 5AY8D 3B0CT 5AVCB 1P3FC 3LZ0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZJ D;  3A6N C;  5B33 D;  1ID3 A;  5B2J D;  5F99 B;  3REJ D;  5JRG C;  5GXQ A;  2HIO B;  3UTA A;  3AZH D;  3W99 A;  4YM6 A;  4XUJ A;  5GSU A;  4KUD C;  5AV5 B;  3AZE D;  1KU5 A;  1ZLA D;  3WAA A;  2FJ7 D;  3B6F D;  3AYW D;  4LD9 D;  4KHA B;  1P3G A;  5FUG B;  3UT9 B;  5B0Z C;  4NE6 A;  3W96 A;  4WU8 D;  3AZM D;  1N1J B;  4JJN C;  5CPJ A;  3AV1 D;  5B31 B;  1P3A B;  4ZUX A;  3REH A;  1TZY D;  5C3I C;  3AN2 B;  5B1L B;  3MGR B;  3B6G D;  3LZ1 C;  5AVB D;  3REK C;  4HGA C;  2PYO A;  3MGS A;  1P3L B;  5AV6 B;  4QLC D;  4YS3 D;  2ARO C;  1HTA A;  2NQB A;  1F66 D;  5AV8 A;  2F8N B;  1EQZ A;  3KXB D;  3X1V C;  3C1C B;  5B2I C;  1ID3 D;  5CHL B;  3AZI B;  1M18 A;  2CV5 C;  1P3B C;  5GXQ D;  3REI A;  3MNN A;  5B0Y C;  3UTA D;  3W99 D;  3B0C W;  4YM6 D;  4XUJ D;  5GSU D;  3AFA B;  1B6W A;  4H9R A;  3UTB B;  1P3M A;  1M19 A;  3KUY B;  3WAA D;  1KX3 B;  3WA9 A;  3W97 B;  4J8V C;  1P3K A;  2IO5 C;  3AZL B;  2YFV A;  1P3G D;  3X1T A;  5B32 C;  1BFM A;  4H9S C;  3LEL B;  3W96 D;  4H9O A;  4WNN A;  5E5A C;  4J8X A;  5CPJ D;  1U35 B;  3REH D;  1KX5 C;  5GT3 C;  3MGP C;  4H9Q B;  1TAF A;  3AZG A;  1BH9 A;  1P3I A;  5DNM B;  3WKJ B;  1P3O C;  1P3F B;  3REL A;  2PYO D;  3A6N B;  5CPK B;  3MGS D;  5JRG B;  4KGC A;  2NQB D;  5B31 G;  4Z5T C;  4KUD B;  2NZD A;  5AV8 D;  1P34 B;  3AZF C;  1EQZ D;  3X1U C;  4J8U C;  5DNN A;  5B24 A;  3AZN C;  1M18 D;  5BNV B;  3NQU A;  3AZJ C;  4X23 C;  4H9N B;  5BO0 A;  3REI D;  5B33 C;  1F1E A;  3REJ C;  1A7W A;  3LJA B;  5B0Z B;  3AZH C;  4JJN B;  2F8N G;  3V9R B;  5B2J A;  3WA9 D;  5GT0 A;  1WWS A;  2FJ7 C;  5C3I B;  4DRA A;  4LD9 C;  3AZE A;  1ZLA A;  1AOI A;  3WTP E;  4J8X D;  3LZ1 B;  3REK B;  4DRB A;  3AZI C;  4WU8 C;  4HGA B;  5AV9 D;  5BS7 C;  5CP6 A;  5KDM A;  3MVD C;  5CPI A;  2ARO B;  3AZG D;  1TZY C;  2BYM B;  4G92 C;  1P3I D;  5B40 C;  4NFT A;  3AZM A;  3X1V B;  3KUY C;  3REL D;  3AV1 A;  4Z2M G;  5AVB C;  1P3B B;  4CAY B;  4KGC D;  5B0Y B;  2NZD D;  1BH8 A;  1F66 C;  3B6G A;  5DNN D;  5B24 D;  4UUZ A;  4J8V B;  5BNX B;  1ID3 C;  2IO5 B;  5B32 B;  5DNM C;  3WKJ C;  3KXB A;  3UTA C;  4YM6 C;  5E5A B;  4XUJ C;  5CPK C;  3VH6 W;  5GT0 D;  4R8P A;  1S32 A;  3O62 A;  3WAA C;  2L5A A;  1KX5 B;  5GT3 B;  3MGP B;  2JSS A;  1P34 C;  2YFW A;  1AOI D;  1P3G C;  1P3O B;  1M1A A;  1H3O A;  5CP6 D;  3WTP A;  5CPJ C;  5CPI D;  4ZUX C;  3REH C;  3LJA C;  3AZK A;  4Z5T B;  3KSY A;  4XZQ B;  1JFI B;  3AZF B;  5B31 D;  3X1U B;  4J8U B;  5AY8 B;  1R4V A;  4NE3 A;  3AZN B;  1HQ3 A;  3AZJ B;  4X23 B;  5B33 B;  1KX4 A;  3MGR D;  3MGS C;  3REJ B;  2NQB C;  5JA4 B;  4CSR B;  3AZH B;  5G49 B;  3AV2 A;  1EQZ C;  2FJ7 B;  3B6F B;  2BYK B;  3MGQ A;  3AYW B;  4LD9 B;  3MNN C;  3KWQ A;  4WU8 B;  4R8P D;  1S32 D;  3O62 D;  3MVD B;  1P3M C;  1M19 C;  3WA9 C;  3UTB D;  1TZY B;  1P3K C;  4G92 B;  5B40 B;  1KX3 D;  4AWL C;  4G91 C;  5B32 G;  3TU4 A;  3X1T C;  1M1A D;  3R45 B;  4J8X C;  5B1M A;  5AVB B;  3WTP D;  3NQJ A;  3X1S A;  3W98 A;  3AZK D;  4QLC B;  4YS3 B;  4Z66 A;  4J8W A;  1F66 B;  3AZG C;  1P3I C;  2F8N H;  5AV9 A;  1HQ3 D;  1ID3 B;  1KX4 D;  1P3F D;  5B2I A;  5GXQ B;  4KGC C;  3UTA B;  3W99 B;  4YM6 B;  5GSU B;  5BT1 D;  4XUJ B;  4WU9 A;  2CV5 A;  4H9P A;  1P3P A;  3AV2 D;  1Q9C A;  5DNN C;  3WAA B;  3C1B A;  3MGQ D;  4XZQ C;  3KWQ D;  1P3G B;  5AY8 C;  3W96 B;  4Z2M H;  3AZN D;  3VH6 T;  5CPJ B;  5B0Z D;  5B2J C;  5GT0 C;  5AVC A;  4ZUX B;  3REH B;  3LZ0 A;  5F99 A;  3TU4 D;  3AZE C;  1ZLA C;  4E44 A;  2HIO A;  1AOI C;  4WV4 B;  5B1M D;  5AV5 A;  3X1S D;  3B6F C;  5CP6 C;  3MGS B;  3AYW C;  3W98 D;  3REK D;  5CPI C;  2NQB B;  4Z66 D;  4J8W D;  4KHA A;  5AV8 B;  1EQZ B;  3AZM C;  5FUG A;  3UT9 A;  3AV1 C;  1M18 B;  1N1J A;  3X1V D;  5B2I D;  3VH5 T;  3REI B;  3MNN B;  5B31 A;  1P3A A;  2CV5 D;  4WU9 D;  1P3B D;  4H9R B;  1P3P D;  3B6G C;  5B0Y D;  3AN2 A;  5B1L A;  1P3M B;  1M19 B;  4NE5 A;  3MGR A;  3WA9 B;  3C1B D;  4QLC C;  4YS3 C;  4E45 A;  1P3K B;  2YFV B;  4AWL B;  4G91 B;  3X1T B;  5AV6 A;  1P3L A;  3KXB C;  4H9O B;  4WNN B;  4J8X B;  5B32 D;  2F8N A;  5AVC D;  3C1C A;  1S32 C;  5GXQ C;  2LY8 A;  3O62 C;  3LZ0 D;  3W99 C;  3AZI A;  5GSU C;  5F99 D;  1TAF B;  3AZG B;  1BH9 B;  1P3I B;  2HIO D;  1KX5 D;  5AV5 D;  3REL B;  1M1A C;  3AFA A;  3UTB A;  1P3O D;  3WTP C;  3KUY A;  4KGC B;  1KX3 A;  3W97 A;  2RVQ D;  3W96 C;  2NZD B;  3AZL A;  3UT9 D;  5DNN B;  3LEL A;  5B24 B;  3NQU B;  1HQ3 C;  4J8U D;  3B0D C;  5BO0 B;  1KX4 C;  1U35 A;  1P3A D;  4X23 D;  1ULY A;  4H9Q A;  5BT1 C;  3AN2 D;  5B1L D;  2PYO C;  3AV2 C;  5DNM A;  3VH5 W;  3WKJ A;  5B2J B;  5GT0 B;  1P3F A;  2HUE C;  3A6N A;  5CPK A;  3MGQ C;  1P3L D;  5AV8 C;  3AZE B;  5AV6 D;  5JRG A;  1ZLA B;  1AOI B;  3KWQ C;  4KUD A;  1P34 A;  2F8N D;  1M18 C;  5CP6 B;  3C1C D;  5KDM B;  3REI C;  5CPI B;  3AZI D;  5BNV A;  4H9N A;  3MVD D;  3AZM B;  3TU4 C;  3LJA A;  5B0Z A;  3AV1 B;  3AFA D;  5B40 D;  5B1M C;  4JJN A;  3KUY D;  3X1S C;  3V9R A;  3W98 C;  3W97 D;  4Z66 C;  4J8W C;  3AZL D;  1BH8 B;  3B6G B;  3LEL D;  4M6B A;  5AV9 C;  4UUZ B;  3LZ1 A;  3REK A;  4EO5 C;  2CWE A;  1U35 D;  3B0B A;  2ARO A;  3KXB B;  3REL C;  4WU9 C;  2BYM A;  1P3P C;  5DNM D;  3WKJ D;  4R8P B;  3X1V A;  1S32 B;  3O62 B;  3A6N D;  5CPK D;  3C1B C;  2NZD C;  1P3B A;  2YFW B;  5JRG D;  4CAY A;  5B0Y A;  4KUD D;  5B24 C;  1M1A B;  1P34 D;  1H3O B;  3WTP B;  5AVC C;  3AZK B;  3LZ0 C;  4J8V A;  5BNX A;  5F99 C;  4ZUX D;  5B32 A;  3LJA D;  2HIO C;  4H9S A;  5E5A A;  5AV5 C;  1HQ3 B;  4JJN D;  3B0D B;  4ZBJ B;  1KX4 B;  1KX5 A;  5GT3 A;  3MGP A;  2RVQ C;  2PYO B;  3AV2 B;  1P3O A;  3UT9 C;  3LZ1 D;  2HUE B;  3MGQ B;  2ARO D;  5B31 C;  3KWQ B;  1B67 A;  1P3A C;  4Z5T A;  4XZQ A;  1JFI A;  3VH6 A;  3MNN D;  3AZF A;  4WZS B;  3X1U A;  4J8U A;  3AN2 C;  5B1L C;  5AY8 A;  3MGR C;  3AZN A;  3AZJ A;  4X23 A;  1P3M D;  1M19 D;  5B33 A;  2F8N K;  1P3L C;  3TU4 B;  5AV6 C;  3REJ A;  5JA4 A;  4CSR A;  1P3K D;  1WWI A;  3AZH A;  5B1M B;  5G49 A;  3X1T D;  3NQJ B;  3X1S B;  3C1C C;  3W98 B;  4J8V D;  2FJ7 A;  4Z66 B;  4J8W B;  3B6F A;  2BYK A;  3AYW A;  4LD9 A;  5AV9 B;  4R8P C;  5E5A D;  3AFA C;  4EO5 B;  4WU8 A;  3UTB C;  3VH5 A;  5BS7 A;  3MVD A;  5B2I B;  1KX3 C;  5GT3 D;  3MGP D;  3W97 C;  2CV5 B;  4WU9 B;  1TZY A;  4H9P B;  1P3P B;  5B40 A;  3AZL C;  3LEL C;  3R45 A;  3AZK C;  3C1B B;  5AVB A;  1U35 C;  4Z5T D;  4QLC A;  4XZQ D;  4YS3 A;  3AZF D;  1F66 A;  3X1U D;  4ZBJ C;  5AY8 D;  3B0C T;  5AVC B;  1P3F C;  3LZ0 B; 
#chains in the Genus database with same CATH topology
 3AZJ D;  3A6N C;  5B33 D;  1ID3 A;  5B2J D;  3EG5 B;  5F99 B;  3REJ D;  5JRG C;  5GXQ A;  2HIO B;  3EPJ A;  3UTA A;  3AZH D;  3W99 A;  4YM6 A;  4XUJ A;  5GSU A;  4KUD C;  5AV5 B;  3AZE D;  1KU5 A;  1ZLA D;  1T3U A;  2FJ7 D;  3WAA A;  3B6F D;  3AYW D;  4LD9 D;  4KHA B;  3F6T A;  1P3G A;  5FUG B;  3UT9 B;  5B0Z C;  4NE6 A;  3W96 A;  4WU8 D;  3AZM D;  1N1J B;  4JJN C;  5CPJ A;  3AV1 D;  5B31 B;  1P3A B;  4ZUX A;  3REH A;  1TZY D;  5C3I C;  2Y2O A;  3AN2 B;  2VQR A;  5B1L B;  3MGR B;  3B6G D;  3LZ1 C;  5AVB D;  3REK C;  4HGA C;  2PYO A;  3MGS A;  1P3L B;  5AV6 B;  4QLC D;  4YS3 D;  2ARO C;  1HTA A;  2NQB A;  2G5H C;  1F66 D;  5AV8 A;  2F8N B;  1EQZ A;  3KXB D;  3X1V C;  3C1C B;  5B2I C;  1ID3 D;  5CHL B;  3AZI B;  1M18 A;  2CV5 C;  1P3B C;  5GXQ D;  3REI A;  3MNN A;  5B0Y C;  3UTA D;  3W99 D;  3B0C W;  4YM6 D;  4XUJ D;  5GSU D;  3AFA B;  1B6W A;  4H9R A;  3UTB B;  1P3M A;  1M19 A;  3KUY B;  3WAA D;  1KX3 B;  3WA9 A;  3W97 B;  4J8V C;  1P3K A;  2IO5 C;  3AZL B;  2YFV A;  1P3G D;  3X1T A;  5B32 C;  1BFM A;  4H9S C;  3LEL B;  3W96 D;  4H9O A;  2XD1 A;  4WNN A;  5E5A C;  4J8X A;  5CPJ D;  1U35 B;  3REH D;  1KX5 C;  5GT3 C;  3MGP C;  4H9Q B;  1TAF A;  3AZG A;  1BH9 A;  1P3I A;  5DNM B;  3WKJ B;  1P3O C;  1P3F B;  3REL A;  2PYO D;  3A6N B;  5CPK B;  2Y2K A;  3MGS D;  5JRG B;  4KGC A;  2NQB D;  5B31 G;  4Z5T C;  4KUD B;  2NZD A;  5AV8 D;  1P34 B;  3AZF C;  1EQZ D;  3X1U C;  4J8U C;  5DNN A;  5B24 A;  3AZN C;  1M18 D;  5BNV B;  3NQU A;  3AZJ C;  4X23 C;  4H9N B;  5BO0 A;  3REI D;  5B33 C;  1F1E A;  3REJ C;  1A7W A;  3LJA B;  5B0Z B;  3AZH C;  4JJN B;  2F8N G;  3V9R B;  5B2J A;  2XD5 A;  3WA9 D;  5GT0 A;  1WWS A;  2FJ7 C;  5C3I B;  4DRA A;  4LD9 C;  3AZE A;  1PZR A;  1ZLA A;  1AOI A;  3WTP E;  4J8X D;  3LZ1 B;  3REK B;  4DRB A;  3AZI C;  4WU8 C;  4HGA B;  5AV9 D;  5BS7 C;  5CP6 A;  5KDM A;  3MVD C;  5CPI A;  2ARO B;  3AZG D;  1TZY C;  2BYM B;  2Y2I A;  4G92 C;  1P3I D;  5B40 C;  4NFT A;  3AZM A;  3X1V B;  3KUY C;  3REL D;  3AV1 A;  4Z2M G;  3FDD A;  5AVB C;  3IP4 C;  1P3B B;  4CAY B;  4KGC D;  5B0Y B;  2Y2J A;  2NZD D;  2Y2P A;  1BH8 A;  1F66 C;  3B6G A;  5DNN D;  5B24 D;  2ZY2 A;  4UUZ A;  4J8V B;  5BNX B;  1ID3 C;  2IO5 B;  5B32 B;  5DNM C;  3WKJ C;  3KXB A;  3UTA C;  4YM6 C;  5E5A B;  4XUJ C;  5CPK C;  3VH6 W;  5GT0 D;  4R8P A;  3AL0 C;  1S32 A;  3O62 A;  3WAA C;  1W2E A;  2L5A A;  1KX5 B;  5GT3 B;  3MGP B;  2JSS A;  1P34 C;  2YFW A;  1AOI D;  1P3G C;  2DF4 C;  1P3O B;  1M1A A;  1H3O A;  5CP6 D;  3WTP A;  5CPJ C;  5CPI D;  3H0M C;  4ZUX C;  3REH C;  3LJA C;  3AZK A;  4Z5T B;  3KSY A;  4XZQ B;  1JFI B;  3AZF B;  5B31 D;  3X1U B;  4J8U B;  5AY8 B;  1R4V A;  4NE3 A;  3AZN B;  1HQ3 A;  3AZJ B;  4X23 B;  5B33 B;  1KX4 A;  3MGR D;  3MGS C;  3REJ B;  2NQB C;  5JA4 B;  4CSR B;  3AZH B;  5G49 B;  3AV2 A;  1EQZ C;  2FJ7 B;  2UWX A;  3B6F B;  2BYK B;  3MGQ A;  3AYW B;  4LD9 B;  3MNN C;  4WJ3 C;  3KWQ A;  4WU8 B;  4R8P D;  1S32 D;  3O62 D;  3MVD B;  1P3M C;  1M19 C;  3WA9 C;  3UTB D;  3A1I A;  3KFU G;  1TZY B;  1P3K C;  4G92 B;  5B40 B;  1KX3 D;  4AWL C;  4G91 C;  5B32 G;  3TU4 A;  3X1T C;  1M1A D;  2F2A C;  3R45 B;  4J8X C;  5B1M A;  5AVB B;  3WTP D;  4DQY B;  3NQJ A;  3X1S A;  3W98 A;  3AZK D;  4QLC B;  4YS3 B;  4Z66 A;  4J8W A;  1F66 B;  3AZG C;  1P3I C;  2F8N H;  5AV9 A;  1HQ3 D;  1ID3 B;  1KX4 D;  1P3F D;  5B2I A;  5GXQ B;  4KGC C;  3UTA B;  3W99 B;  4YM6 B;  5GSU B;  5BT1 D;  4XUJ B;  4WU9 A;  2CV5 A;  4H9P A;  1P3P A;  3AV2 D;  1Q9C A;  5DNN C;  3WAA B;  3C1B A;  3MGQ D;  4XZQ C;  3KWQ D;  1P3G B;  5AY8 C;  3W96 B;  4Z2M H;  3AZN D;  3EPK A;  3VH6 T;  5CPJ B;  5B0Z D;  5B2J C;  5GT0 C;  5AVC A;  4ZUX B;  3REH B;  3LZ0 A;  5F99 A;  3TU4 D;  3AZE C;  1ZLA C;  4E44 A;  2HIO A;  2DQN C;  1AOI C;  4WV4 B;  2Y2Q A;  5B1M D;  5AV5 A;  3X1S D;  3B6F C;  5CP6 C;  3MGS B;  3AYW C;  3W98 D;  3REK D;  5CPI C;  2NQB B;  4Z66 D;  4J8W D;  4KHA A;  5AV8 B;  1EQZ B;  3AZM C;  5FUG A;  3UT9 A;  3AV1 C;  1Z2C B;  1M18 B;  1N1J A;  3X1V D;  5B2I D;  3VH5 T;  3REI B;  3MNN B;  5B31 A;  1P3A A;  2CV5 D;  4WU9 D;  1P3B D;  4H9R B;  1P3P D;  3B6G C;  5B0Y D;  3AN2 A;  5B1L A;  1P3M B;  1M19 B;  4NE5 A;  3MGR A;  3WA9 B;  3C1B D;  4QLC C;  4YS3 C;  4E45 A;  1P3K B;  2YFV B;  4AWL B;  4G91 B;  3X1T B;  5AV6 A;  1P3L A;  3KXB C;  4H9O B;  4WNN B;  4J8X B;  5B32 D;  2F8N A;  5AVC D;  3C1C A;  1S32 C;  5GXQ C;  2LY8 A;  3O62 C;  3LZ0 D;  3W99 C;  3AZI A;  5GSU C;  5F99 D;  1TAF B;  3AZG B;  1BH9 B;  1P3I B;  2HIO D;  1KX5 D;  2FFF B;  5AV5 D;  3REL B;  1M1A C;  3AFA A;  2ZM5 A;  3UTB A;  1P3O D;  3WTP C;  3KUY A;  4KGC B;  1KX3 A;  3W97 A;  2RVQ D;  3W96 C;  2NZD B;  3AZL A;  3UT9 D;  5DNN B;  3LEL A;  2JCH A;  5B24 B;  3NQU B;  1HQ3 C;  4J8U D;  3B0D C;  5BO0 B;  1KX4 C;  1U35 A;  1P3A D;  4X23 D;  1ULY A;  4H9Q A;  5BT1 C;  3AN2 D;  5B1L D;  2PYO C;  2J8P A;  5DNM A;  3VH5 W;  3AV2 C;  5B2J B;  3WKJ A;  5GT0 B;  1P3F A;  2HUE C;  3A6N A;  5CPK A;  3MGQ C;  1P3L D;  5AV8 C;  3AZE B;  5AV6 D;  5JRG A;  1ZLA B;  1AOI B;  3KWQ C;  4KUD A;  1P34 A;  2F8N D;  1M18 C;  5CP6 B;  3C1C D;  5KDM B;  3REI C;  5CPI B;  3AZI D;  5BNV A;  4H9N A;  3MVD D;  3AZM B;  3TU4 C;  2JE5 A;  3LJA A;  5B0Z A;  3AV1 B;  3AFA D;  5B40 D;  5B1M C;  4JJN A;  3KUY D;  3X1S C;  3V9R A;  3W98 C;  3W97 D;  4Z66 C;  4J8W C;  3AZL D;  1BH8 B;  3B6G B;  3LEL D;  4M6B A;  5AV9 C;  4UUZ B;  3LZ1 A;  3REK A;  4EO5 C;  2CWE A;  1U35 D;  3B0B A;  2ARO A;  3H0R C;  3KXB B;  3H0L C;  2ZY5 A;  3REL C;  4WU9 C;  2BYM A;  1P3P C;  5DNM D;  3WKJ D;  4R8P B;  3X1V A;  1S32 B;  2ZY4 A;  3O62 B;  3A6N D;  5CPK D;  2Y2L A;  3C1B C;  2NZD C;  1P3B A;  2YFW B;  5JRG D;  4CAY A;  5B0Y A;  4KUD D;  5B24 C;  1M1A B;  1P34 D;  1H3O B;  2W8S A;  3WTP B;  2BG1 A;  5AVC C;  3AZK B;  3LZ0 C;  3EPL A;  5BNX A;  4J8V A;  5F99 C;  2Y2N A;  4ZUX D;  5B32 A;  3LJA D;  2HIO C;  4H9S A;  5E5A A;  5AV5 C;  1HQ3 B;  4JJN D;  3B0D B;  4ZBJ B;  1KX4 B;  2RIQ A;  1KX5 A;  5GT3 A;  3MGP A;  2RVQ C;  2ZY3 A;  2PYO B;  3AV2 B;  1P3O A;  3UT9 C;  3LZ1 D;  2HUE B;  3MGQ B;  2ARO D;  5B31 C;  3KWQ B;  1B67 A;  1P3A C;  4UPK A;  4Z5T A;  4XZQ A;  1JFI A;  3VH6 A;  3MNN D;  3AZF A;  4WZS B;  3X1U A;  2G5I C;  4J8U A;  5B1L C;  3AN2 C;  5AY8 A;  3MGR C;  3AZN A;  3AZJ A;  4X23 A;  1P3M D;  1M19 D;  5B33 A;  2F8N K;  1P3L C;  3TU4 B;  5AV6 C;  3REJ A;  5JA4 A;  4CSR A;  1P3K D;  1WWI A;  3AZH A;  5B1M B;  5G49 A;  3X1T D;  3NQJ B;  3X1S B;  3C1C C;  3W98 B;  2Y2M A;  2Y2G A;  4J8V D;  2Y2H A;  2FJ7 A;  4Z66 B;  4J8W B;  3B6F A;  2BYK A;  3EPH A;  3AYW A;  4LD9 A;  5AV9 B;  4R8P C;  5E5A D;  3AFA C;  4EO5 B;  4WU8 A;  3UTB C;  3VH5 A;  5BS7 A;  3A1K A;  3MVD A;  5B2I B;  1KX3 C;  5GT3 D;  3MGP D;  3W97 C;  2CV5 B;  4WU9 B;  1TZY A;  4H9P B;  1P3P B;  5B40 A;  3AZL C;  3LEL C;  3R45 A;  3AZK C;  3P5J B;  3C1B B;  5AVB A;  1U35 C;  4Z5T D;  4QLC A;  4XZQ D;  4YS3 A;  3AZF D;  1F66 A;  3X1U D;  4ZBJ C;  5AY8 D;  3B0C T;  5AVC B;  1P3F C;  3LZ0 B; 
#chains in the Genus database with same CATH homology
 3AZJ D;  3A6N C;  5B33 D;  1ID3 A;  5B2J D;  3EG5 B;  5F99 B;  3REJ D;  5JRG C;  5GXQ A;  2HIO B;  3EPJ A;  3UTA A;  3AZH D;  3W99 A;  4YM6 A;  4XUJ A;  5GSU A;  4KUD C;  5AV5 B;  3AZE D;  1KU5 A;  1ZLA D;  1T3U A;  2FJ7 D;  3WAA A;  3B6F D;  3AYW D;  4LD9 D;  4KHA B;  3F6T A;  1P3G A;  5FUG B;  3UT9 B;  5B0Z C;  4NE6 A;  3W96 A;  4WU8 D;  3AZM D;  1N1J B;  4JJN C;  5CPJ A;  3AV1 D;  5B31 B;  1P3A B;  4ZUX A;  3REH A;  1TZY D;  5C3I C;  2Y2O A;  3AN2 B;  2VQR A;  5B1L B;  3MGR B;  3B6G D;  3LZ1 C;  5AVB D;  3REK C;  4HGA C;  2PYO A;  3MGS A;  1P3L B;  5AV6 B;  4QLC D;  4YS3 D;  2ARO C;  1HTA A;  2NQB A;  2G5H C;  1F66 D;  5AV8 A;  2F8N B;  1EQZ A;  3KXB D;  3X1V C;  3C1C B;  5B2I C;  1ID3 D;  5CHL B;  3AZI B;  1M18 A;  2CV5 C;  1P3B C;  5GXQ D;  3REI A;  3MNN A;  5B0Y C;  3UTA D;  3W99 D;  3B0C W;  4YM6 D;  4XUJ D;  5GSU D;  3AFA B;  1B6W A;  4H9R A;  3UTB B;  1P3M A;  1M19 A;  3KUY B;  3WAA D;  1KX3 B;  3WA9 A;  3W97 B;  4J8V C;  1P3K A;  2IO5 C;  3AZL B;  2YFV A;  1P3G D;  3X1T A;  5B32 C;  1BFM A;  4H9S C;  3LEL B;  3W96 D;  4H9O A;  2XD1 A;  4WNN A;  5E5A C;  4J8X A;  5CPJ D;  1U35 B;  3REH D;  1KX5 C;  5GT3 C;  3MGP C;  4H9Q B;  1TAF A;  3AZG A;  1BH9 A;  1P3I A;  5DNM B;  3WKJ B;  1P3O C;  1P3F B;  3REL A;  2PYO D;  3A6N B;  5CPK B;  2Y2K A;  3MGS D;  5JRG B;  4KGC A;  2NQB D;  5B31 G;  4Z5T C;  4KUD B;  2NZD A;  5AV8 D;  1P34 B;  3AZF C;  1EQZ D;  3X1U C;  4J8U C;  5DNN A;  5B24 A;  3AZN C;  1M18 D;  5BNV B;  3NQU A;  3AZJ C;  4X23 C;  4H9N B;  5BO0 A;  3REI D;  5B33 C;  1F1E A;  3REJ C;  1A7W A;  3LJA B;  5B0Z B;  3AZH C;  4JJN B;  2F8N G;  3V9R B;  5B2J A;  2XD5 A;  3WA9 D;  5GT0 A;  1WWS A;  2FJ7 C;  5C3I B;  4DRA A;  4LD9 C;  3AZE A;  1PZR A;  1ZLA A;  1AOI A;  3WTP E;  4J8X D;  3LZ1 B;  3REK B;  4DRB A;  3AZI C;  4WU8 C;  4HGA B;  5AV9 D;  5BS7 C;  5CP6 A;  5KDM A;  3MVD C;  5CPI A;  2ARO B;  3AZG D;  1TZY C;  2BYM B;  2Y2I A;  4G92 C;  1P3I D;  5B40 C;  4NFT A;  3AZM A;  3X1V B;  3KUY C;  3REL D;  3AV1 A;  4Z2M G;  3FDD A;  5AVB C;  3IP4 C;  1P3B B;  4CAY B;  4KGC D;  5B0Y B;  2Y2J A;  2NZD D;  2Y2P A;  1BH8 A;  1F66 C;  3B6G A;  5DNN D;  5B24 D;  2ZY2 A;  4UUZ A;  4J8V B;  5BNX B;  1ID3 C;  2IO5 B;  5B32 B;  5DNM C;  3WKJ C;  3KXB A;  3UTA C;  4YM6 C;  5E5A B;  4XUJ C;  5CPK C;  3VH6 W;  5GT0 D;  4R8P A;  3AL0 C;  1S32 A;  3O62 A;  3WAA C;  1W2E A;  2L5A A;  1KX5 B;  5GT3 B;  3MGP B;  2JSS A;  1P34 C;  2YFW A;  1AOI D;  1P3G C;  2DF4 C;  1P3O B;  1M1A A;  1H3O A;  5CP6 D;  3WTP A;  5CPJ C;  5CPI D;  3H0M C;  4ZUX C;  3REH C;  3LJA C;  3AZK A;  4Z5T B;  3KSY A;  4XZQ B;  1JFI B;  3AZF B;  5B31 D;  3X1U B;  4J8U B;  5AY8 B;  1R4V A;  4NE3 A;  3AZN B;  1HQ3 A;  3AZJ B;  4X23 B;  5B33 B;  1KX4 A;  3MGR D;  3MGS C;  3REJ B;  2NQB C;  5JA4 B;  4CSR B;  3AZH B;  5G49 B;  3AV2 A;  1EQZ C;  2FJ7 B;  2UWX A;  3B6F B;  2BYK B;  3MGQ A;  3AYW B;  4LD9 B;  3MNN C;  4WJ3 C;  3KWQ A;  4WU8 B;  4R8P D;  1S32 D;  3O62 D;  3MVD B;  1P3M C;  1M19 C;  3WA9 C;  3UTB D;  3A1I A;  3KFU G;  1TZY B;  1P3K C;  4G92 B;  5B40 B;  1KX3 D;  4AWL C;  4G91 C;  5B32 G;  3TU4 A;  3X1T C;  1M1A D;  2F2A C;  3R45 B;  4J8X C;  5B1M A;  5AVB B;  3WTP D;  4DQY B;  3NQJ A;  3X1S A;  3W98 A;  3AZK D;  4QLC B;  4YS3 B;  4Z66 A;  4J8W A;  1F66 B;  3AZG C;  1P3I C;  2F8N H;  5AV9 A;  1HQ3 D;  1ID3 B;  1KX4 D;  1P3F D;  5B2I A;  5GXQ B;  4KGC C;  3UTA B;  3W99 B;  4YM6 B;  5GSU B;  5BT1 D;  4XUJ B;  4WU9 A;  2CV5 A;  4H9P A;  1P3P A;  3AV2 D;  1Q9C A;  5DNN C;  3WAA B;  3C1B A;  3MGQ D;  4XZQ C;  3KWQ D;  1P3G B;  5AY8 C;  3W96 B;  4Z2M H;  3AZN D;  3EPK A;  3VH6 T;  5CPJ B;  5B0Z D;  5B2J C;  5GT0 C;  5AVC A;  4ZUX B;  3REH B;  3LZ0 A;  5F99 A;  3TU4 D;  3AZE C;  1ZLA C;  4E44 A;  2HIO A;  2DQN C;  1AOI C;  4WV4 B;  2Y2Q A;  5B1M D;  5AV5 A;  3X1S D;  3B6F C;  5CP6 C;  3MGS B;  3AYW C;  3W98 D;  3REK D;  5CPI C;  2NQB B;  4Z66 D;  4J8W D;  4KHA A;  5AV8 B;  1EQZ B;  3AZM C;  5FUG A;  3UT9 A;  3AV1 C;  1Z2C B;  1M18 B;  1N1J A;  3X1V D;  5B2I D;  3VH5 T;  3REI B;  3MNN B;  5B31 A;  1P3A A;  2CV5 D;  4WU9 D;  1P3B D;  4H9R B;  1P3P D;  3B6G C;  5B0Y D;  3AN2 A;  5B1L A;  1P3M B;  1M19 B;  4NE5 A;  3MGR A;  3WA9 B;  3C1B D;  4QLC C;  4YS3 C;  4E45 A;  1P3K B;  2YFV B;  4AWL B;  4G91 B;  3X1T B;  5AV6 A;  1P3L A;  3KXB C;  4H9O B;  4WNN B;  4J8X B;  5B32 D;  2F8N A;  5AVC D;  3C1C A;  1S32 C;  5GXQ C;  2LY8 A;  3O62 C;  3LZ0 D;  3W99 C;  3AZI A;  5GSU C;  5F99 D;  1TAF B;  3AZG B;  1BH9 B;  1P3I B;  2HIO D;  1KX5 D;  2FFF B;  5AV5 D;  3REL B;  1M1A C;  3AFA A;  2ZM5 A;  3UTB A;  1P3O D;  3WTP C;  3KUY A;  4KGC B;  1KX3 A;  3W97 A;  2RVQ D;  3W96 C;  2NZD B;  3AZL A;  3UT9 D;  5DNN B;  3LEL A;  2JCH A;  5B24 B;  3NQU B;  1HQ3 C;  4J8U D;  3B0D C;  5BO0 B;  1KX4 C;  1U35 A;  1P3A D;  4X23 D;  1ULY A;  4H9Q A;  5BT1 C;  3AN2 D;  5B1L D;  2PYO C;  2J8P A;  5DNM A;  3VH5 W;  3AV2 C;  5B2J B;  3WKJ A;  5GT0 B;  1P3F A;  2HUE C;  3A6N A;  5CPK A;  3MGQ C;  1P3L D;  5AV8 C;  3AZE B;  5AV6 D;  5JRG A;  1ZLA B;  1AOI B;  3KWQ C;  4KUD A;  1P34 A;  2F8N D;  1M18 C;  5CP6 B;  3C1C D;  5KDM B;  3REI C;  5CPI B;  3AZI D;  5BNV A;  4H9N A;  3MVD D;  3AZM B;  3TU4 C;  2JE5 A;  3LJA A;  5B0Z A;  3AV1 B;  3AFA D;  5B40 D;  5B1M C;  4JJN A;  3KUY D;  3X1S C;  3V9R A;  3W98 C;  3W97 D;  4Z66 C;  4J8W C;  3AZL D;  1BH8 B;  3B6G B;  3LEL D;  4M6B A;  5AV9 C;  4UUZ B;  3LZ1 A;  3REK A;  4EO5 C;  2CWE A;  1U35 D;  3B0B A;  2ARO A;  3H0R C;  3KXB B;  3H0L C;  2ZY5 A;  3REL C;  4WU9 C;  2BYM A;  1P3P C;  5DNM D;  3WKJ D;  4R8P B;  3X1V A;  1S32 B;  2ZY4 A;  3O62 B;  3A6N D;  5CPK D;  2Y2L A;  3C1B C;  2NZD C;  1P3B A;  2YFW B;  5JRG D;  4CAY A;  5B0Y A;  4KUD D;  5B24 C;  1M1A B;  1P34 D;  1H3O B;  2W8S A;  3WTP B;  2BG1 A;  5AVC C;  3AZK B;  3LZ0 C;  3EPL A;  5BNX A;  4J8V A;  5F99 C;  2Y2N A;  4ZUX D;  5B32 A;  3LJA D;  2HIO C;  4H9S A;  5E5A A;  5AV5 C;  1HQ3 B;  4JJN D;  3B0D B;  4ZBJ B;  1KX4 B;  2RIQ A;  1KX5 A;  5GT3 A;  3MGP A;  2RVQ C;  2ZY3 A;  2PYO B;  3AV2 B;  1P3O A;  3UT9 C;  3LZ1 D;  2HUE B;  3MGQ B;  2ARO D;  5B31 C;  3KWQ B;  1B67 A;  1P3A C;  4UPK A;  4Z5T A;  4XZQ A;  1JFI A;  3VH6 A;  3MNN D;  3AZF A;  4WZS B;  3X1U A;  2G5I C;  4J8U A;  5B1L C;  3AN2 C;  5AY8 A;  3MGR C;  3AZN A;  3AZJ A;  4X23 A;  1P3M D;  1M19 D;  5B33 A;  2F8N K;  1P3L C;  3TU4 B;  5AV6 C;  3REJ A;  5JA4 A;  4CSR A;  1P3K D;  1WWI A;  3AZH A;  5B1M B;  5G49 A;  3X1T D;  3NQJ B;  3X1S B;  3C1C C;  3W98 B;  2Y2M A;  2Y2G A;  4J8V D;  2Y2H A;  2FJ7 A;  4Z66 B;  4J8W B;  3B6F A;  2BYK A;  3EPH A;  3AYW A;  4LD9 A;  5AV9 B;  4R8P C;  5E5A D;  3AFA C;  4EO5 B;  4WU8 A;  3UTB C;  3VH5 A;  5BS7 A;  3A1K A;  3MVD A;  5B2I B;  1KX3 C;  5GT3 D;  3MGP D;  3W97 C;  2CV5 B;  4WU9 B;  1TZY A;  4H9P B;  1P3P B;  5B40 A;  3AZL C;  3LEL C;  3R45 A;  3AZK C;  3P5J B;  3C1B B;  5AVB A;  1U35 C;  4Z5T D;  4QLC A;  4XZQ D;  4YS3 A;  3AZF D;  1F66 A;  3X1U D;  4ZBJ C;  5AY8 D;  3B0C T;  5AVC B;  1P3F C;  3LZ0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...