2FJ7C

Crystal structure of nucleosome core particle containing a poly (da.dt) sequence element
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
107
structure length
107
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nucleosome Core Particles Containing a Poly(dA.dT) Sequence Element Exhibit a Locally Distorted DNA Structure.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords 147 bp DNA containing 16 bp poly dA element
total genus 23
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2005-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2fj7C00
3WKJB 4M6BA 3WKJC 4WZSB 5F99B 1P3KC 2NZDC 1P3PB 5B33B 3B6FA 4EO5B 4HGAC 4H9OA 3LJAB 1EQZC 3KUYD 1P3LA 3AZHC 3A6ND 5B0ZD 5AV5D 3B0DC 5AVCA 3UTBD 2CV5B 3X1SB 1U35B 3KWQD 3MGRD 3REIC 2HUEB 5B32A 3AZKA 1H3OA 3LZ1D 3W96D 4H9PB 5FUGA 3C1CB 5JRGB 5CHLB 1P3LB 4XUJD 4X23B 4JJNB 1AOID 5AV8B 1M18A 2CWEA 5AVBB 4H9RB 3AV1B 5KDMA 5GT0B 5E5AA 1TZYD 3X1UA 3AZIB 1S32B 2HIOC 4X23D 3KUYA 5B2JA 1AOIB 4AWLC 2HIOD 3W99C 3O62C 3UT9A 4G92B 3AN2A 5BT1D 1BH9B 4ZUXC 5AVBD 5AVCC 4J8VD 2F8ND 1U35C 3B0CW 3MGQD 3MGRA 1P34D 5B31A 4XUJB 5B40A 4JJND 2BYMA 1U35D 1F66D 4H9NB 4H9OB 3LJAA 4LD9D 2FJ7B 3AV2D 3C1CC 4XUJA 5B31B 5B40B 2BYKA 1KX4C 3AV1D 5B0YB 3W97D 3B6FB 5B33A 4J8XD 3WTPB 3WTPC 1N1JB 5GT3A 3X1SD 1R4VA 3LELC 3AZKB 5AV9C 3AZND 5B0YC 5GSUB 4J8WA 5C3IC 1KX5C 5B2IB 4H9SC 5E5AD 1KX5D 3W96B 1KX5B 1EQZB 2LY8A 4Z5TC 4J8XC 3AZEB 5B31G 1P3MA 3O62B 3AN2D 4G91C 3AFAB 3W99B 4H9RA 4QLCD 5AVBA 3LZ0C 3AZKD 3X1TC 4NE3A 3MGQA 5CPJD 4QLCC 5AV8A 5B40D 5B1MD 3AV2A 5GXQA 5B1MC 3REKD 4J8VC 4UUZA 4ZUXA 5AY8A 1B67A 3AYWA 3AZLB 5G49A 1P3OC 3X1UB 3AZIA 3TU4B 4WNNB 1P3KA 4XZQA 2YFWA 3NQUB 5B2JC 3B6FD 1M1AB 1P3OA 3UT9B 4CAYB 5GSUC 4E44A 3KXBD 3LJAC 5B2JD 1ZLAD 5CP6A 3LELB 3MGSA 4J8UD 4KGCA 1S32D 1M1AC 1P3BA 4NE6A 1P3GA 3X1SC 2BYMB 4Z2MG 2NQBC 3REIB 4QLCA 3B6GC 3RELD 5B24B 1A7WA 5B31D 5B24C 4JJNA 1KX4D 4KHAA 3X1TA 3AZNC 3KUYC 1P3GB 2RVQD 5CPKC 4LD9A 5AV8D 3AZMB 4Z66B 1F66B 3C1CA 3AZJA 3W98D 1BH8B 3X1SA 5B31C 5B24D 3KXBB 1KX4B 3AZGC 1P3IC 5DNNB 4XZQD 3UTBB 1TZYA 3X1UD 1P3MB 3KXBA 3AZEA 5B2IC 1P3PC 2HIOA 3UT9D 3W96C 1P3GD 3REKC 1Q9CA 5B32G 4R8PB 3AZFC 3TU4A 1M19B 3VH6T 1ID3C 3MGPA 5BO0A 3C1BA 2FJ7C 4KUDD 2HUEC 3B6FC 1P34C 4R8PA 3A6NB 5GXQD 4Z66C 4H9QB 5AVBC 4ZUXD 3REHC 5AY8D 3REHB 3AV1A 5CPKB 5F99D 1P3KD 5B24A 4JJNC 3WKJD 4J8WD 5DNMB 3KWQC 1ZLAA 5CP6D 3MGSD 1EQZD 3AZJC 5BNVB 5B0YD 4G92C 3AFAC 4G91B 3W97B 5B0ZC 2NZDD 5CPIC 5GT0C 4AWLB 3AZJB 3LZ0D 1P3MD 4LD9B 3UTAA 4XUJC 3LZ1C 3R45B 5B1LA 1KX4A 4Z66A 5GT3B 3WAAB 4YM6A 3MGQB 3C1BC 4ZUXB 3MGPC 3MVDD 3C1BD 1P3ID 4KUDA 1HTAA 5BS7C 2YFVB 1WWIA 1P3LC 4WU8D 5KDMB 4YS3D 3O62A 3UT9C 5CPJC 3W99A 4WU9B 2F8NB 1TAFA 5B1LC 3WKJA 4WNNA 5BT1C 4YM6B 1P3OD 1TZYC 3X1VB 1JFIB 3WA9C 1HQ3A 5AV6B 3A6NA 2NQBB 5AV5A 4EO5C 1S32A 4KUDC 1P3BD 2NQBD 1P3AA 5AVCD 4H9SA 1JFIA 3AZMA 1S32C 1M1AD 3RELA 1F1EA 2AROC 3LZ1A 1P3FB 5DNMA 3MGRB 1M19C 3REHA 3AZLD 4WU8B 3KSYA 2AROA 2PYOA 5B32C 3AZLC 4KGCB 5AV5B 5B1MB 5F99A 3VH5A 1ID3A 1P3OB 5AV5C 5CPJB 3X1VC 5CP6C 3MGSC 1N1JA 1KU5A 1EQZA 3V9RA 5GSUA 5JA4A 4J8WB 4WU9C 2NZDA 4XZQC 1M18B 5B2JB 2YFVA 3UTAC 4R8PC 3AZEC 3AZIC 3B0DB 5CPKD 1P3AD 3MVDB 3UTAD 3X1TB 5B1LD 2F8NA 5B0ZA 4KUDB 1WWSA 3MVDA 3WAAC 5AY8B 4R8PD 3REHD 3AZLA 2PYOD 3MNNC 3KXBC 3MNNB 3AV2B 4YS3A 2FJ7D 3NQJB 5B33D 5E5AB 3X1VA 1ID3D 5G49B 4J8VB 1HQ3D 5C3IB 5AV9A 2PYOB 3AZHB 3WA9B 1P3BB 3B0BA 5CPKA 4LD9C 5B2IA 5GT0D 3RELC 5CPJA 4YM6D 3WAAA 2RVQC 1P3FD 1F66C 1BH8A 3AZFB 3B6GD 4H9PA 5FUGB 2JSSA 1U35A 3REKA 1F66A 5B32B 4ZBJB 3AYWD 3AN2C 1P34B 3AZID 1TZYB 4CSRB 5AV6A 1P3IB 3LELD 5DNND 4WU9A 1KX3A 2HIOB 3KWQB 5DNNC 5DNMC 5E5AC 4J8XA 5CPIB 3AFAA 4KGCD 3AZGA 1AOIC 2NQBA 1ULYA 1ZLAC 3REKB 5JRGD 3NQJA 3VH5W 3AZMD 1KX5A 3MGQC 3C1BB 2PYOC 1P3PD 2CV5C 1TAFB 5DNMD 1M19A 4YS3B 1KX3C 3MNNA 4Z5TA 1ID3B 4UUZB 3VH6W 5AVCB 2CV5A 2AROD 3C1CD 3B6GA 3REIA 2FJ7A 5AY8C 3AZJD 3WA9D 3X1VD 5GXQC 4CAYA 4J8WC 3TU4C 5CP6B 3LELA 1HQ3C 3MGSB 5DNNA 4WU9D 5AV8C 3AV1C 4YM6C 3AZED 5AV9D 3R45A 5B1LB 3WTPD 3UTAB 5AV6C 2NZDB 3MVDC 3REJA 5BNXA 5GT0A 5B2ID 4J8UA 2L5AA 3AZFA 3WAAD 2AROB 3MGPD 3KWQA 4J8XB 4QLCB 1B6WA 3MNND 3LZ0B 3X1TD 5GT3C 3X1UC 1BFMA 4DRBA 5BNXB 5CPIA 5BO0B 1H3OB 3W99D 3AZKC 4X23C 1KX3D 5JRGC 3W98A 2YFWB 3NQUA 5F99C 4XZQB 1P3KB 1M18C 5B40C 1P3AB 1P3BC 5B0YA 4DRAA 3WTPA 3W98B 3WTPE 4NE5A 2F8NG 3REJD 1P3PA 4Z66D 1ZLAB 1M19D 3VH6A 3B6GB 4KHAB 3LZ1B 1P3FA 4J8VA 2IO5B 5BS7A 3TU4D 4CSRA 1P3IA 3AV2C 3MGRC 3A6NC 5B32D 3REID 4H9NA 1P3FC 3WA9A 1BH9A 2IO5C 3REJB 3REJC 3W96A 5JA4B 3V9RB 4J8UB 5AV6D 5CPID 3AZHD 3W97A 3AYWC 1P3MC 5GT3D 3AZNA 3UTBC 4HGAB 3AFAD 3AYWB 3AZGD 2BYKB 5B0ZB 5BNVA 1P3LD 1P3AC 5JRGA 3W98C 1M1AA 4X23A 4NFTA 3VH5T 3AZFD 4E45A 4Z2MH 3UTBA 3LZ0A 3RELB 4WV4B 4YS3C 1KX3B 2F8NH 4Z5TD 3MGPB 3AZNB 2CV5D 4Z5TB 1P34A 4ZBJC 3AN2B 3B0CT 3AZMC 4H9QA 4WU8C 3KUYB 5B1MA 1P3GC 3LJAD 5GXQB 1AOIA 4KGCC 4J8UC 1HQ3B 1M18D 3AZHA 4WU8A 5AV9B 2F8NK 5B33C 3AZGB 5GSUD 3O62D 3W97C
chains in the Genus database with same CATH superfamily
2DF4C 4M6BA 3WKJB 3WKJC 4WZSB 5F99B 1P3KC 2NZDC 1P3PB 5B33B 3B6FA 4EO5B 4HGAC 4H9OA 3LJAB 1EQZC 3KUYD 1P3LA 3AZHC 3A6ND 5B0ZD 5AV5D 3H0RC 3B0DC 5AVCA 3UTBD 2CV5B 3X1SB 1U35B 3KWQD 3MGRD 3REIC 2HUEB 2JE5A 5B32A 3AZKA 1H3OA 3LZ1D 3W96D 4H9PB 5FUGA 3C1CB 5JRGB 5CHLB 1P3LB 4XUJD 4X23B 4JJNB 1AOID 5AV8B 1M18A 2CWEA 3H0LC 5AVBB 4H9RB 3AV1B 2G5IC 5KDMA 5GT0B 1PZRA 5E5AA 1TZYD 3X1UA 3AZIB 1S32B 2HIOC 4X23D 3KUYA 5B2JA 1AOIB 4AWLC 2HIOD 3W99C 3O62C 3UT9A 4G92B 3AN2A 5BT1D 1BH9B 4ZUXC 5AVBD 5AVCC 4J8VD 2F8ND 1U35C 3B0CW 3MGQD 3MGRA 1P34D 5B31A 4XUJB 5B40A 4JJND 2BYMA 1U35D 1F66D 4H9NB 4H9OB 3LJAA 4LD9D 2FJ7B 3AV2D 3C1CC 3EPHA 4XUJA 5B31B 5B40B 2BYKA 1KX4C 2ZY2A 3AV1D 5B0YB 3W97D 3B6FB 2BG1A 5B33A 4J8XD 3WTPB 1N1JB 5GT3A 3X1SD 3WTPC 1R4VA 3LELC 3AZKB 5AV9C 3AZND 5B0YC 5GSUB 4J8WA 5C3IC 1KX5C 5B2IB 4H9SC 5E5AD 1KX5D 3W96B 1KX5B 1EQZB 2LY8A 4Z5TC 4J8XC 3AZEB 5B31G 1P3MA 3O62B 3AN2D 4G91C 3AFAB 3W99B 4H9RA 4QLCD 5AVBA 3LZ0C 3AZKD 3X1TC 4NE3A 3MGQA 2Y2JA 5CPJD 4QLCC 5AV8A 5B40D 5B1MD 2J8PA 3AV2A 5GXQA 5B1MC 3REKD 4J8VC 4UUZA 4ZUXA 5AY8A 1B67A 3AYWA 3AZLB 5G49A 1P3OC 3X1UB 3AZIA 3TU4B 4WNNB 1P3KA 4XZQA 2YFWA 3NQUB 5B2JC 3B6FD 1M1AB 1P3OA 3UT9B 4CAYB 5GSUC 4E44A 3KXBD 3LJAC 2XD5A 5B2JD 1ZLAD 5CP6A 3LELB 3MGSA 3KFUG 4J8UD 4KGCA 3EPJA 1S32D 1M1AC 1P3BA 4NE6A 1P3GA 3X1SC 2BYMB 4Z2MG 2NQBC 3REIB 4QLCA 3B6GC 3RELD 5B24B 1A7WA 5B31D 5B24C 4JJNA 1KX4D 4KHAA 3X1TA 3AZNC 3KUYC 1P3GB 2RVQD 4UPKA 5CPKC 4LD9A 5AV8D 3AZMB 3P5JB 4Z66B 1F66B 3C1CA 3AZJA 3W98D 1BH8B 3X1SA 5B31C 5B24D 3KXBB 1KX4B 3AZGC 3EG5B 1P3IC 5DNNB 4XZQD 3UTBB 1TZYA 3X1UD 1P3MB 3KXBA 3AZEA 2ZM5A 5B2IC 1P3PC 2HIOA 3UT9D 3W96C 1P3GD 3REKC 1Q9CA 5B32G 4R8PB 3AZFC 3TU4A 1M19B 3VH6T 1ID3C 3MGPA 5BO0A 2Y2NA 2Y2QA 3C1BA 2G5HC 2FJ7C 4KUDD 2HUEC 3B6FC 2Y2MA 4R8PA 1P34C 3A6NB 5GXQD 4Z66C 4H9QB 3FDDA 5AVBC 4ZUXD 3REHC 5AY8D 3REHB 3AV1A 5CPKB 5F99D 1P3KD 5B24A 4JJNC 3WKJD 4J8WD 5DNMB 3KWQC 1ZLAA 5CP6D 3MGSD 1EQZD 3AZJC 5BNVB 2Y2PA 5B0YD 4G92C 4G91B 3AFAC 3W97B 5B0ZC 2NZDD 5CPIC 5GT0C 4AWLB 3AZJB 3LZ0D 1P3MD 4LD9B 3UTAA 4XUJC 3LZ1C 3R45B 5B1LA 1KX4A 4Z66A 5GT3B 3WAAB 4YM6A 3MGQB 3C1BC 3O62D 4ZUXB 3MGPC 3MVDD 3C1BD 1P3ID 4KUDA 2Y2OA 1HTAA 5BS7C 2YFVB 1WWIA 1P3LC 4WU8D 5KDMB 4YS3D 3O62A 3UT9C 5CPJC 3W99A 4WU9B 2DQNC 2F8NB 3A1KA 1TAFA 5B1LC 3WKJA 4WNNA 5BT1C 4YM6B 1P3OD 1TZYC 3X1VB 1JFIB 3WA9C 1HQ3A 5AV6B 3A6NA 2NQBB 5AV5A 4EO5C 1S32A 4KUDC 1P3BD 2NQBD 1P3AA 5AVCD 4H9SA 5GSUD 1JFIA 3IP4C 3AZMA 1S32C 1M1AD 3RELA 1F1EA 2AROC 3LZ1A 1P3FB 5DNMA 3MGRB 1M19C 3REHA 3AZLD 4WU8B 3KSYA 2AROA 2PYOA 5B32C 3AZLC 2Y2KA 4KGCB 5AV5B 5B1MB 5F99A 3VH5A 1ID3A 1P3OB 5AV5C 5CPJB 3X1VC 5CP6C 3MGSC 1N1JA 2XD1A 1KU5A 1EQZA 3V9RA 5GSUA 5JA4A 4J8WB 2UWXA 4WU9C 2NZDA 4WJ3C 4XZQC 1M18B 5B2JB 2YFVA 3UTAC 4R8PC 3AZEC 3AZIC 3B0DB 5CPKD 1P3AD 3MVDB 3UTAD 3X1TB 5B1LD 2F8NA 5B0ZA 4KUDB 1WWSA 3AL0C 3MVDA 3WAAC 5AY8B 4R8PD 3REHD 3AZLA 2PYOD 3MNNC 3KXBC 3MNNB 3AV2B 4YS3A 2FJ7D 3NQJB 5B33D 5E5AB 3X1VA 1ID3D 5G49B 3A1IA 4J8VB 1HQ3D 5C3IB 5AV9A 2PYOB 3AZHB 3WA9B 1P3BB 3B0BA 5CPKA 4LD9C 3EPLA 5B2IA 5GT0D 3RELC 5CPJA 4YM6D 3WAAA 2RVQC 1P3FD 1F66C 1BH8A 4DQYB 3AZFB 3B6GD 4H9PA 5FUGB 2JSSA 1U35A 3REKA 1F66A 5B32B 4ZBJB 3AYWD 3AN2C 1P34B 3AZID 1TZYB 4CSRB 5AV6A 1P3IB 3LELD 5DNND 4WU9A 1KX3A 2HIOB 3KWQB 5DNNC 5DNMC 5E5AC 4J8XA 5CPIB 3AFAA 4KGCD 3AZGA 1AOIC 2NQBA 1ULYA 1ZLAC 3REKB 5JRGD 3NQJA 3VH5W 3AZMD 1KX5A 3MGQC 2Y2GA 3C1BB 2ZY5A 1P3PD 2PYOC 2CV5C 1TAFB 5DNMD 1M19A 2Y2LA 4YS3B 2Y2HA 1KX3C 3MNNA 4Z5TA 1ID3B 4UUZB 3VH6W 5AVCB 2CV5A 2AROD 2ZY3A 3C1CD 3B6GA 3REIA 2FJ7A 1W2EA 2Y2IA 2JCHA 5AY8C 3AZJD 3WA9D 3X1VD 5GXQC 4CAYA 4J8WC 3TU4C 3F6TA 5CP6B 3LELA 1HQ3C 3MGSB 5DNNA 4WU9D 5AV8C 3AV1C 4YM6C 3AZED 5AV9D 3R45A 5B1LB 3WTPD 3UTAB 5AV6C 2NZDB 3MVDC 3REJA 5BNXA 5GT0A 5B2ID 4J8UA 2L5AA 3AZFA 3WAAD 2AROB 3MGPD 3KWQA 4J8XB 4QLCB 1B6WA 3MNND 3LZ0B 3X1TD 5GT3C 3X1UC 1BFMA 4DRBA 5BNXB 5CPIA 5BO0B 1H3OB 3AZKC 4X23C 1KX3D 5JRGC 3W98A 2YFWB 3NQUA 5F99C 4XZQB 1P3KB 1M18C 5B40C 1P3AB 2RIQA 1P3BC 3H0MC 5B0YA 4DRAA 3EPKA 3WTPA 3W98B 3WTPE 4NE5A 2F8NG 3REJD 1P3PA 2VQRA 4Z66D 1ZLAB 1M19D 3VH6A 3B6GB 4KHAB 3LZ1B 1P3FA 4J8VA 2IO5B 5BS7A 3TU4D 4CSRA 1P3IA 3AV2C 3MGRC 3A6NC 5B32D 3REID 1T3UA 4H9NA 1P3FC 3WA9A 1BH9A 2IO5C 3REJB 3REJC 3W96A 5JA4B 2W8SA 3V9RB 4J8UB 5AV6D 5CPID 2ZY4A 3AZHD 3W97A 3AYWC 1P3MC 5GT3D 3AZNA 3UTBC 4HGAB 3AFAD 3AYWB 3AZGD 2BYKB 5B0ZB 5BNVA 1P3LD 1P3AC 5JRGA 3W98C 1M1AA 4X23A 4NFTA 3VH5T 3AZFD 4E45A 4Z2MH 3UTBA 3LZ0A 3RELB 4WV4B 4YS3C 1KX3B 2F8NH 4Z5TD 3MGPB 3AZNB 2CV5D 4Z5TB 1P34A 4ZBJC 3AN2B 3B0CT 3AZMC 4H9QA 4WU8C 3KUYB 5B1MA 1P3GC 3LJAD 5GXQB 1AOIA 1Z2CB 4KGCC 4J8UC 1HQ3B 1M18D 3AZHA 4WU8A 5AV9B 2F8NK 5B33C 3AZGB 2FFFB 3W99D 3W97C 2F2AC
chains in the Genus database with same CATH topology
2DF4C 4M6BA 3WKJB 3WKJC 4WZSB 5F99B 1P3KC 2NZDC 1P3PB 5B33B 3B6FA 4EO5B 4HGAC 4H9OA 3LJAB 1EQZC 3KUYD 1P3LA 3AZHC 3A6ND 5B0ZD 5AV5D 3H0RC 3B0DC 5AVCA 3UTBD 2CV5B 3X1SB 1U35B 3KWQD 3MGRD 3REIC 2HUEB 2JE5A 5B32A 3AZKA 1H3OA 3LZ1D 3W96D 4H9PB 5FUGA 3C1CB 5JRGB 5CHLB 1P3LB 4XUJD 4X23B 4JJNB 1AOID 5AV8B 1M18A 2CWEA 3H0LC 5AVBB 4H9RB 3AV1B 2G5IC 5KDMA 5GT0B 1PZRA 5E5AA 1TZYD 3X1UA 3AZIB 1S32B 2HIOC 4X23D 3KUYA 5B2JA 1AOIB 4AWLC 2HIOD 3W99C 3O62C 3UT9A 4G92B 3AN2A 5BT1D 1BH9B 4ZUXC 5AVBD 5AVCC 4J8VD 2F8ND 1U35C 3B0CW 3MGQD 3MGRA 1P34D 5B31A 4XUJB 5B40A 4JJND 2BYMA 1U35D 1F66D 4H9NB 4H9OB 3LJAA 4LD9D 2FJ7B 3AV2D 3C1CC 3EPHA 4XUJA 5B31B 5B40B 2BYKA 1KX4C 2ZY2A 3AV1D 5B0YB 3W97D 3B6FB 2BG1A 5B33A 4J8XD 3WTPB 1N1JB 5GT3A 3X1SD 3WTPC 1R4VA 3LELC 3AZKB 5AV9C 3AZND 5B0YC 5GSUB 4J8WA 5C3IC 1KX5C 5B2IB 4H9SC 5E5AD 1KX5D 3W96B 1KX5B 1EQZB 2LY8A 4Z5TC 4J8XC 3AZEB 5B31G 1P3MA 3O62B 3AN2D 4G91C 3AFAB 3W99B 4H9RA 4QLCD 5AVBA 3LZ0C 3AZKD 3X1TC 4NE3A 3MGQA 2Y2JA 5CPJD 4QLCC 5AV8A 5B40D 5B1MD 2J8PA 3AV2A 5GXQA 5B1MC 3REKD 4J8VC 4UUZA 4ZUXA 5AY8A 1B67A 3AYWA 3AZLB 5G49A 1P3OC 3X1UB 3AZIA 3TU4B 4WNNB 1P3KA 4XZQA 2YFWA 3NQUB 5B2JC 3B6FD 1M1AB 1P3OA 3UT9B 4CAYB 5GSUC 4E44A 3KXBD 3LJAC 2XD5A 5B2JD 1ZLAD 5CP6A 3LELB 3MGSA 3KFUG 4J8UD 4KGCA 3EPJA 1S32D 1M1AC 1P3BA 4NE6A 1P3GA 3X1SC 2BYMB 4Z2MG 2NQBC 3REIB 4QLCA 3B6GC 3RELD 5B24B 1A7WA 5B31D 5B24C 4JJNA 1KX4D 4KHAA 3X1TA 3AZNC 3KUYC 1P3GB 2RVQD 4UPKA 5CPKC 4LD9A 5AV8D 3AZMB 3P5JB 4Z66B 1F66B 3C1CA 3AZJA 3W98D 1BH8B 3X1SA 5B31C 5B24D 3KXBB 1KX4B 3AZGC 3EG5B 1P3IC 5DNNB 4XZQD 3UTBB 1TZYA 3X1UD 1P3MB 3KXBA 3AZEA 2ZM5A 5B2IC 1P3PC 2HIOA 3UT9D 3W96C 1P3GD 3REKC 1Q9CA 5B32G 4R8PB 3AZFC 3TU4A 1M19B 3VH6T 1ID3C 3MGPA 5BO0A 2Y2NA 2Y2QA 3C1BA 2G5HC 2FJ7C 4KUDD 2HUEC 3B6FC 2Y2MA 4R8PA 1P34C 3A6NB 5GXQD 4Z66C 4H9QB 3FDDA 5AVBC 4ZUXD 3REHC 5AY8D 3REHB 3AV1A 5CPKB 5F99D 1P3KD 5B24A 4JJNC 3WKJD 4J8WD 5DNMB 3KWQC 1ZLAA 5CP6D 3MGSD 1EQZD 3AZJC 5BNVB 2Y2PA 5B0YD 4G92C 4G91B 3AFAC 3W97B 5B0ZC 2NZDD 5CPIC 5GT0C 4AWLB 3AZJB 3LZ0D 1P3MD 4LD9B 3UTAA 4XUJC 3LZ1C 3R45B 5B1LA 1KX4A 4Z66A 5GT3B 3WAAB 4YM6A 3MGQB 3C1BC 3O62D 4ZUXB 3MGPC 3MVDD 3C1BD 1P3ID 4KUDA 2Y2OA 1HTAA 5BS7C 2YFVB 1WWIA 1P3LC 4WU8D 5KDMB 4YS3D 3O62A 3UT9C 5CPJC 3W99A 4WU9B 2DQNC 2F8NB 3A1KA 1TAFA 5B1LC 3WKJA 4WNNA 5BT1C 4YM6B 1P3OD 1TZYC 3X1VB 1JFIB 3WA9C 1HQ3A 5AV6B 3A6NA 2NQBB 5AV5A 4EO5C 1S32A 4KUDC 1P3BD 2NQBD 1P3AA 5AVCD 4H9SA 5GSUD 1JFIA 3IP4C 3AZMA 1S32C 1M1AD 3RELA 1F1EA 2AROC 3LZ1A 1P3FB 5DNMA 3MGRB 1M19C 3REHA 3AZLD 4WU8B 3KSYA 2AROA 2PYOA 5B32C 3AZLC 2Y2KA 4KGCB 5AV5B 5B1MB 5F99A 3VH5A 1ID3A 1P3OB 5AV5C 5CPJB 3X1VC 5CP6C 3MGSC 1N1JA 2XD1A 1KU5A 1EQZA 3V9RA 5GSUA 5JA4A 4J8WB 2UWXA 4WU9C 2NZDA 4WJ3C 4XZQC 1M18B 5B2JB 2YFVA 3UTAC 4R8PC 3AZEC 3AZIC 3B0DB 5CPKD 1P3AD 3MVDB 3UTAD 3X1TB 5B1LD 2F8NA 5B0ZA 4KUDB 1WWSA 3AL0C 3MVDA 3WAAC 5AY8B 4R8PD 3REHD 3AZLA 2PYOD 3MNNC 3KXBC 3MNNB 3AV2B 4YS3A 2FJ7D 3NQJB 5B33D 5E5AB 3X1VA 1ID3D 5G49B 3A1IA 4J8VB 1HQ3D 5C3IB 5AV9A 2PYOB 3AZHB 3WA9B 1P3BB 3B0BA 5CPKA 4LD9C 3EPLA 5B2IA 5GT0D 3RELC 5CPJA 4YM6D 3WAAA 2RVQC 1P3FD 1F66C 1BH8A 4DQYB 3AZFB 3B6GD 4H9PA 5FUGB 2JSSA 1U35A 3REKA 1F66A 5B32B 4ZBJB 3AYWD 3AN2C 1P34B 3AZID 1TZYB 4CSRB 5AV6A 1P3IB 3LELD 5DNND 4WU9A 1KX3A 2HIOB 3KWQB 5DNNC 5DNMC 5E5AC 4J8XA 5CPIB 3AFAA 4KGCD 3AZGA 1AOIC 2NQBA 1ULYA 1ZLAC 3REKB 5JRGD 3NQJA 3VH5W 3AZMD 1KX5A 3MGQC 2Y2GA 3C1BB 2ZY5A 1P3PD 2PYOC 2CV5C 1TAFB 5DNMD 1M19A 2Y2LA 4YS3B 2Y2HA 1KX3C 3MNNA 4Z5TA 1ID3B 4UUZB 3VH6W 5AVCB 2CV5A 2AROD 2ZY3A 3C1CD 3B6GA 3REIA 2FJ7A 1W2EA 2Y2IA 2JCHA 5AY8C 3AZJD 3WA9D 3X1VD 5GXQC 4CAYA 4J8WC 3TU4C 3F6TA 5CP6B 3LELA 1HQ3C 3MGSB 5DNNA 4WU9D 5AV8C 3AV1C 4YM6C 3AZED 5AV9D 3R45A 5B1LB 3WTPD 3UTAB 5AV6C 2NZDB 3MVDC 3REJA 5BNXA 5GT0A 5B2ID 4J8UA 2L5AA 3AZFA 3WAAD 2AROB 3MGPD 3KWQA 4J8XB 4QLCB 1B6WA 3MNND 3LZ0B 3X1TD 5GT3C 3X1UC 1BFMA 4DRBA 5BNXB 5CPIA 5BO0B 1H3OB 3AZKC 4X23C 1KX3D 5JRGC 3W98A 2YFWB 3NQUA 5F99C 4XZQB 1P3KB 1M18C 5B40C 1P3AB 2RIQA 1P3BC 3H0MC 5B0YA 4DRAA 3EPKA 3WTPA 3W98B 3WTPE 4NE5A 2F8NG 3REJD 1P3PA 2VQRA 4Z66D 1ZLAB 1M19D 3VH6A 3B6GB 4KHAB 3LZ1B 1P3FA 4J8VA 2IO5B 5BS7A 3TU4D 4CSRA 1P3IA 3AV2C 3MGRC 3A6NC 5B32D 3REID 1T3UA 4H9NA 1P3FC 3WA9A 1BH9A 2IO5C 3REJB 3REJC 3W96A 5JA4B 2W8SA 3V9RB 4J8UB 5AV6D 5CPID 2ZY4A 3AZHD 3W97A 3AYWC 1P3MC 5GT3D 3AZNA 3UTBC 4HGAB 3AFAD 3AYWB 3AZGD 2BYKB 5B0ZB 5BNVA 1P3LD 1P3AC 5JRGA 3W98C 1M1AA 4X23A 4NFTA 3VH5T 3AZFD 4E45A 4Z2MH 3UTBA 3LZ0A 3RELB 4WV4B 4YS3C 1KX3B 2F8NH 4Z5TD 3MGPB 3AZNB 2CV5D 4Z5TB 1P34A 4ZBJC 3AN2B 3B0CT 3AZMC 4H9QA 4WU8C 3KUYB 5B1MA 1P3GC 3LJAD 5GXQB 1AOIA 1Z2CB 4KGCC 4J8UC 1HQ3B 1M18D 3AZHA 4WU8A 5AV9B 2F8NK 5B33C 3AZGB 2FFFB 3W99D 3W97C 2F2AC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WKJ B;  4M6B A;  3WKJ C;  4WZS B;  5F99 B;  1P3K C;  2NZD C;  1P3P B;  5B33 B;  3B6F A;  4EO5 B;  4HGA C;  4H9O A;  3LJA B;  1EQZ C;  3KUY D;  1P3L A;  3AZH C;  3A6N D;  5B0Z D;  5AV5 D;  3B0D C;  5AVC A;  3UTB D;  2CV5 B;  3X1S B;  1U35 B;  3KWQ D;  3MGR D;  3REI C;  2HUE B;  5B32 A;  3AZK A;  1H3O A;  3LZ1 D;  3W96 D;  4H9P B;  5FUG A;  3C1C B;  5JRG B;  5CHL B;  1P3L B;  4XUJ D;  4X23 B;  4JJN B;  1AOI D;  5AV8 B;  1M18 A;  2CWE A;  5AVB B;  4H9R B;  3AV1 B;  5KDM A;  5GT0 B;  5E5A A;  1TZY D;  3X1U A;  3AZI B;  1S32 B;  2HIO C;  4X23 D;  3KUY A;  5B2J A;  1AOI B;  4AWL C;  2HIO D;  3W99 C;  3O62 C;  3UT9 A;  4G92 B;  3AN2 A;  5BT1 D;  1BH9 B;  4ZUX C;  5AVB D;  5AVC C;  4J8V D;  2F8N D;  1U35 C;  3B0C W;  3MGQ D;  3MGR A;  1P34 D;  5B31 A;  4XUJ B;  5B40 A;  4JJN D;  2BYM A;  1U35 D;  1F66 D;  4H9N B;  4H9O B;  3LJA A;  4LD9 D;  2FJ7 B;  3AV2 D;  3C1C C;  4XUJ A;  5B31 B;  5B40 B;  2BYK A;  1KX4 C;  3AV1 D;  5B0Y B;  3W97 D;  3B6F B;  5B33 A;  4J8X D;  3WTP B;  3WTP C;  1N1J B;  5GT3 A;  3X1S D;  1R4V A;  3LEL C;  3AZK B;  5AV9 C;  3AZN D;  5B0Y C;  5GSU B;  4J8W A;  5C3I C;  1KX5 C;  5B2I B;  4H9S C;  5E5A D;  1KX5 D;  3W96 B;  1KX5 B;  1EQZ B;  2LY8 A;  4Z5T C;  4J8X C;  3AZE B;  5B31 G;  1P3M A;  3O62 B;  3AN2 D;  4G91 C;  3AFA B;  3W99 B;  4H9R A;  4QLC D;  5AVB A;  3LZ0 C;  3AZK D;  3X1T C;  4NE3 A;  3MGQ A;  5CPJ D;  4QLC C;  5AV8 A;  5B40 D;  5B1M D;  3AV2 A;  5GXQ A;  5B1M C;  3REK D;  4J8V C;  4UUZ A;  4ZUX A;  5AY8 A;  1B67 A;  3AYW A;  3AZL B;  5G49 A;  1P3O C;  3X1U B;  3AZI A;  3TU4 B;  4WNN B;  1P3K A;  4XZQ A;  2YFW A;  3NQU B;  5B2J C;  3B6F D;  1M1A B;  1P3O A;  3UT9 B;  4CAY B;  5GSU C;  4E44 A;  3KXB D;  3LJA C;  5B2J D;  1ZLA D;  5CP6 A;  3LEL B;  3MGS A;  4J8U D;  4KGC A;  1S32 D;  1M1A C;  1P3B A;  4NE6 A;  1P3G A;  3X1S C;  2BYM B;  4Z2M G;  2NQB C;  3REI B;  4QLC A;  3B6G C;  3REL D;  5B24 B;  1A7W A;  5B31 D;  5B24 C;  4JJN A;  1KX4 D;  4KHA A;  3X1T A;  3AZN C;  3KUY C;  1P3G B;  2RVQ D;  5CPK C;  4LD9 A;  5AV8 D;  3AZM B;  4Z66 B;  1F66 B;  3C1C A;  3AZJ A;  3W98 D;  1BH8 B;  3X1S A;  5B31 C;  5B24 D;  3KXB B;  1KX4 B;  3AZG C;  1P3I C;  5DNN B;  4XZQ D;  3UTB B;  1TZY A;  3X1U D;  1P3M B;  3KXB A;  3AZE A;  5B2I C;  1P3P C;  2HIO A;  3UT9 D;  3W96 C;  1P3G D;  3REK C;  1Q9C A;  5B32 G;  4R8P B;  3AZF C;  3TU4 A;  1M19 B;  3VH6 T;  1ID3 C;  3MGP A;  5BO0 A;  3C1B A;  2FJ7 C;  4KUD D;  2HUE C;  3B6F C;  1P34 C;  4R8P A;  3A6N B;  5GXQ D;  4Z66 C;  4H9Q B;  5AVB C;  4ZUX D;  3REH C;  5AY8 D;  3REH B;  3AV1 A;  5CPK B;  5F99 D;  1P3K D;  5B24 A;  4JJN C;  3WKJ D;  4J8W D;  5DNM B;  3KWQ C;  1ZLA A;  5CP6 D;  3MGS D;  1EQZ D;  3AZJ C;  5BNV B;  5B0Y D;  4G92 C;  3AFA C;  4G91 B;  3W97 B;  5B0Z C;  2NZD D;  5CPI C;  5GT0 C;  4AWL B;  3AZJ B;  3LZ0 D;  1P3M D;  4LD9 B;  3UTA A;  4XUJ C;  3LZ1 C;  3R45 B;  5B1L A;  1KX4 A;  4Z66 A;  5GT3 B;  3WAA B;  4YM6 A;  3MGQ B;  3C1B C;  4ZUX B;  3MGP C;  3MVD D;  3C1B D;  1P3I D;  4KUD A;  1HTA A;  5BS7 C;  2YFV B;  1WWI A;  1P3L C;  4WU8 D;  5KDM B;  4YS3 D;  3O62 A;  3UT9 C;  5CPJ C;  3W99 A;  4WU9 B;  2F8N B;  1TAF A;  5B1L C;  3WKJ A;  4WNN A;  5BT1 C;  4YM6 B;  1P3O D;  1TZY C;  3X1V B;  1JFI B;  3WA9 C;  1HQ3 A;  5AV6 B;  3A6N A;  2NQB B;  5AV5 A;  4EO5 C;  1S32 A;  4KUD C;  1P3B D;  2NQB D;  1P3A A;  5AVC D;  4H9S A;  1JFI A;  3AZM A;  1S32 C;  1M1A D;  3REL A;  1F1E A;  2ARO C;  3LZ1 A;  1P3F B;  5DNM A;  3MGR B;  1M19 C;  3REH A;  3AZL D;  4WU8 B;  3KSY A;  2ARO A;  2PYO A;  5B32 C;  3AZL C;  4KGC B;  5AV5 B;  5B1M B;  5F99 A;  3VH5 A;  1ID3 A;  1P3O B;  5AV5 C;  5CPJ B;  3X1V C;  5CP6 C;  3MGS C;  1N1J A;  1KU5 A;  1EQZ A;  3V9R A;  5GSU A;  5JA4 A;  4J8W B;  4WU9 C;  2NZD A;  4XZQ C;  1M18 B;  5B2J B;  2YFV A;  3UTA C;  4R8P C;  3AZE C;  3AZI C;  3B0D B;  5CPK D;  1P3A D;  3MVD B;  3UTA D;  3X1T B;  5B1L D;  2F8N A;  5B0Z A;  4KUD B;  1WWS A;  3MVD A;  3WAA C;  5AY8 B;  4R8P D;  3REH D;  3AZL A;  2PYO D;  3MNN C;  3KXB C;  3MNN B;  3AV2 B;  4YS3 A;  2FJ7 D;  3NQJ B;  5B33 D;  5E5A B;  3X1V A;  1ID3 D;  5G49 B;  4J8V B;  1HQ3 D;  5C3I B;  5AV9 A;  2PYO B;  3AZH B;  3WA9 B;  1P3B B;  3B0B A;  5CPK A;  4LD9 C;  5B2I A;  5GT0 D;  3REL C;  5CPJ A;  4YM6 D;  3WAA A;  2RVQ C;  1P3F D;  1F66 C;  1BH8 A;  3AZF B;  3B6G D;  4H9P A;  5FUG B;  2JSS A;  1U35 A;  3REK A;  1F66 A;  5B32 B;  4ZBJ B;  3AYW D;  3AN2 C;  1P34 B;  3AZI D;  1TZY B;  4CSR B;  5AV6 A;  1P3I B;  3LEL D;  5DNN D;  4WU9 A;  1KX3 A;  2HIO B;  3KWQ B;  5DNN C;  5DNM C;  5E5A C;  4J8X A;  5CPI B;  3AFA A;  4KGC D;  3AZG A;  1AOI C;  2NQB A;  1ULY A;  1ZLA C;  3REK B;  5JRG D;  3NQJ A;  3VH5 W;  3AZM D;  1KX5 A;  3MGQ C;  3C1B B;  2PYO C;  1P3P D;  2CV5 C;  1TAF B;  5DNM D;  1M19 A;  4YS3 B;  1KX3 C;  3MNN A;  4Z5T A;  1ID3 B;  4UUZ B;  3VH6 W;  5AVC B;  2CV5 A;  2ARO D;  3C1C D;  3B6G A;  3REI A;  2FJ7 A;  5AY8 C;  3AZJ D;  3WA9 D;  3X1V D;  5GXQ C;  4CAY A;  4J8W C;  3TU4 C;  5CP6 B;  3LEL A;  1HQ3 C;  3MGS B;  5DNN A;  4WU9 D;  5AV8 C;  3AV1 C;  4YM6 C;  3AZE D;  5AV9 D;  3R45 A;  5B1L B;  3WTP D;  3UTA B;  5AV6 C;  2NZD B;  3MVD C;  3REJ A;  5BNX A;  5GT0 A;  5B2I D;  4J8U A;  2L5A A;  3AZF A;  3WAA D;  2ARO B;  3MGP D;  3KWQ A;  4J8X B;  4QLC B;  1B6W A;  3MNN D;  3LZ0 B;  3X1T D;  5GT3 C;  3X1U C;  1BFM A;  4DRB A;  5BNX B;  5CPI A;  5BO0 B;  1H3O B;  3W99 D;  3AZK C;  4X23 C;  1KX3 D;  5JRG C;  3W98 A;  2YFW B;  3NQU A;  5F99 C;  4XZQ B;  1P3K B;  1M18 C;  5B40 C;  1P3A B;  1P3B C;  5B0Y A;  4DRA A;  3WTP A;  3W98 B;  3WTP E;  4NE5 A;  2F8N G;  3REJ D;  1P3P A;  4Z66 D;  1ZLA B;  1M19 D;  3VH6 A;  3B6G B;  4KHA B;  3LZ1 B;  1P3F A;  4J8V A;  2IO5 B;  5BS7 A;  3TU4 D;  4CSR A;  1P3I A;  3AV2 C;  3MGR C;  3A6N C;  5B32 D;  3REI D;  4H9N A;  1P3F C;  3WA9 A;  1BH9 A;  2IO5 C;  3REJ B;  3REJ C;  3W96 A;  5JA4 B;  3V9R B;  4J8U B;  5AV6 D;  5CPI D;  3AZH D;  3W97 A;  3AYW C;  1P3M C;  5GT3 D;  3AZN A;  3UTB C;  4HGA B;  3AFA D;  3AYW B;  3AZG D;  2BYK B;  5B0Z B;  5BNV A;  1P3L D;  1P3A C;  5JRG A;  3W98 C;  1M1A A;  4X23 A;  4NFT A;  3VH5 T;  3AZF D;  4E45 A;  4Z2M H;  3UTB A;  3LZ0 A;  3REL B;  4WV4 B;  4YS3 C;  1KX3 B;  2F8N H;  4Z5T D;  3MGP B;  3AZN B;  2CV5 D;  4Z5T B;  1P34 A;  4ZBJ C;  3AN2 B;  3B0C T;  3AZM C;  4H9Q A;  4WU8 C;  3KUY B;  5B1M A;  1P3G C;  3LJA D;  5GXQ B;  1AOI A;  4KGC C;  4J8U C;  1HQ3 B;  1M18 D;  3AZH A;  4WU8 A;  5AV9 B;  2F8N K;  5B33 C;  3AZG B;  5GSU D;  3O62 D;  3W97 C; 
#chains in the Genus database with same CATH topology
 2DF4 C;  4M6B A;  3WKJ B;  3WKJ C;  4WZS B;  5F99 B;  1P3K C;  2NZD C;  1P3P B;  5B33 B;  3B6F A;  4EO5 B;  4HGA C;  4H9O A;  3LJA B;  1EQZ C;  3KUY D;  1P3L A;  3AZH C;  3A6N D;  5B0Z D;  5AV5 D;  3H0R C;  3B0D C;  5AVC A;  3UTB D;  2CV5 B;  3X1S B;  1U35 B;  3KWQ D;  3MGR D;  3REI C;  2HUE B;  2JE5 A;  5B32 A;  3AZK A;  1H3O A;  3LZ1 D;  3W96 D;  4H9P B;  5FUG A;  3C1C B;  5JRG B;  5CHL B;  1P3L B;  4XUJ D;  4X23 B;  4JJN B;  1AOI D;  5AV8 B;  1M18 A;  2CWE A;  3H0L C;  5AVB B;  4H9R B;  3AV1 B;  2G5I C;  5KDM A;  5GT0 B;  1PZR A;  5E5A A;  1TZY D;  3X1U A;  3AZI B;  1S32 B;  2HIO C;  4X23 D;  3KUY A;  5B2J A;  1AOI B;  4AWL C;  2HIO D;  3W99 C;  3O62 C;  3UT9 A;  4G92 B;  3AN2 A;  5BT1 D;  1BH9 B;  4ZUX C;  5AVB D;  5AVC C;  4J8V D;  2F8N D;  1U35 C;  3B0C W;  3MGQ D;  3MGR A;  1P34 D;  5B31 A;  4XUJ B;  5B40 A;  4JJN D;  2BYM A;  1U35 D;  1F66 D;  4H9N B;  4H9O B;  3LJA A;  4LD9 D;  2FJ7 B;  3AV2 D;  3C1C C;  3EPH A;  4XUJ A;  5B31 B;  5B40 B;  2BYK A;  1KX4 C;  2ZY2 A;  3AV1 D;  5B0Y B;  3W97 D;  3B6F B;  2BG1 A;  5B33 A;  4J8X D;  3WTP B;  1N1J B;  5GT3 A;  3X1S D;  3WTP C;  1R4V A;  3LEL C;  3AZK B;  5AV9 C;  3AZN D;  5B0Y C;  5GSU B;  4J8W A;  5C3I C;  1KX5 C;  5B2I B;  4H9S C;  5E5A D;  1KX5 D;  3W96 B;  1KX5 B;  1EQZ B;  2LY8 A;  4Z5T C;  4J8X C;  3AZE B;  5B31 G;  1P3M A;  3O62 B;  3AN2 D;  4G91 C;  3AFA B;  3W99 B;  4H9R A;  4QLC D;  5AVB A;  3LZ0 C;  3AZK D;  3X1T C;  4NE3 A;  3MGQ A;  2Y2J A;  5CPJ D;  4QLC C;  5AV8 A;  5B40 D;  5B1M D;  2J8P A;  3AV2 A;  5GXQ A;  5B1M C;  3REK D;  4J8V C;  4UUZ A;  4ZUX A;  5AY8 A;  1B67 A;  3AYW A;  3AZL B;  5G49 A;  1P3O C;  3X1U B;  3AZI A;  3TU4 B;  4WNN B;  1P3K A;  4XZQ A;  2YFW A;  3NQU B;  5B2J C;  3B6F D;  1M1A B;  1P3O A;  3UT9 B;  4CAY B;  5GSU C;  4E44 A;  3KXB D;  3LJA C;  2XD5 A;  5B2J D;  1ZLA D;  5CP6 A;  3LEL B;  3MGS A;  3KFU G;  4J8U D;  4KGC A;  3EPJ A;  1S32 D;  1M1A C;  1P3B A;  4NE6 A;  1P3G A;  3X1S C;  2BYM B;  4Z2M G;  2NQB C;  3REI B;  4QLC A;  3B6G C;  3REL D;  5B24 B;  1A7W A;  5B31 D;  5B24 C;  4JJN A;  1KX4 D;  4KHA A;  3X1T A;  3AZN C;  3KUY C;  1P3G B;  2RVQ D;  4UPK A;  5CPK C;  4LD9 A;  5AV8 D;  3AZM B;  3P5J B;  4Z66 B;  1F66 B;  3C1C A;  3AZJ A;  3W98 D;  1BH8 B;  3X1S A;  5B31 C;  5B24 D;  3KXB B;  1KX4 B;  3AZG C;  3EG5 B;  1P3I C;  5DNN B;  4XZQ D;  3UTB B;  1TZY A;  3X1U D;  1P3M B;  3KXB A;  3AZE A;  2ZM5 A;  5B2I C;  1P3P C;  2HIO A;  3UT9 D;  3W96 C;  1P3G D;  3REK C;  1Q9C A;  5B32 G;  4R8P B;  3AZF C;  3TU4 A;  1M19 B;  3VH6 T;  1ID3 C;  3MGP A;  5BO0 A;  2Y2N A;  2Y2Q A;  3C1B A;  2G5H C;  2FJ7 C;  4KUD D;  2HUE C;  3B6F C;  2Y2M A;  4R8P A;  1P34 C;  3A6N B;  5GXQ D;  4Z66 C;  4H9Q B;  3FDD A;  5AVB C;  4ZUX D;  3REH C;  5AY8 D;  3REH B;  3AV1 A;  5CPK B;  5F99 D;  1P3K D;  5B24 A;  4JJN C;  3WKJ D;  4J8W D;  5DNM B;  3KWQ C;  1ZLA A;  5CP6 D;  3MGS D;  1EQZ D;  3AZJ C;  5BNV B;  2Y2P A;  5B0Y D;  4G92 C;  4G91 B;  3AFA C;  3W97 B;  5B0Z C;  2NZD D;  5CPI C;  5GT0 C;  4AWL B;  3AZJ B;  3LZ0 D;  1P3M D;  4LD9 B;  3UTA A;  4XUJ C;  3LZ1 C;  3R45 B;  5B1L A;  1KX4 A;  4Z66 A;  5GT3 B;  3WAA B;  4YM6 A;  3MGQ B;  3C1B C;  3O62 D;  4ZUX B;  3MGP C;  3MVD D;  3C1B D;  1P3I D;  4KUD A;  2Y2O A;  1HTA A;  5BS7 C;  2YFV B;  1WWI A;  1P3L C;  4WU8 D;  5KDM B;  4YS3 D;  3O62 A;  3UT9 C;  5CPJ C;  3W99 A;  4WU9 B;  2DQN C;  2F8N B;  3A1K A;  1TAF A;  5B1L C;  3WKJ A;  4WNN A;  5BT1 C;  4YM6 B;  1P3O D;  1TZY C;  3X1V B;  1JFI B;  3WA9 C;  1HQ3 A;  5AV6 B;  3A6N A;  2NQB B;  5AV5 A;  4EO5 C;  1S32 A;  4KUD C;  1P3B D;  2NQB D;  1P3A A;  5AVC D;  4H9S A;  5GSU D;  1JFI A;  3IP4 C;  3AZM A;  1S32 C;  1M1A D;  3REL A;  1F1E A;  2ARO C;  3LZ1 A;  1P3F B;  5DNM A;  3MGR B;  1M19 C;  3REH A;  3AZL D;  4WU8 B;  3KSY A;  2ARO A;  2PYO A;  5B32 C;  3AZL C;  2Y2K A;  4KGC B;  5AV5 B;  5B1M B;  5F99 A;  3VH5 A;  1ID3 A;  1P3O B;  5AV5 C;  5CPJ B;  3X1V C;  5CP6 C;  3MGS C;  1N1J A;  2XD1 A;  1KU5 A;  1EQZ A;  3V9R A;  5GSU A;  5JA4 A;  4J8W B;  2UWX A;  4WU9 C;  2NZD A;  4WJ3 C;  4XZQ C;  1M18 B;  5B2J B;  2YFV A;  3UTA C;  4R8P C;  3AZE C;  3AZI C;  3B0D B;  5CPK D;  1P3A D;  3MVD B;  3UTA D;  3X1T B;  5B1L D;  2F8N A;  5B0Z A;  4KUD B;  1WWS A;  3AL0 C;  3MVD A;  3WAA C;  5AY8 B;  4R8P D;  3REH D;  3AZL A;  2PYO D;  3MNN C;  3KXB C;  3MNN B;  3AV2 B;  4YS3 A;  2FJ7 D;  3NQJ B;  5B33 D;  5E5A B;  3X1V A;  1ID3 D;  5G49 B;  3A1I A;  4J8V B;  1HQ3 D;  5C3I B;  5AV9 A;  2PYO B;  3AZH B;  3WA9 B;  1P3B B;  3B0B A;  5CPK A;  4LD9 C;  3EPL A;  5B2I A;  5GT0 D;  3REL C;  5CPJ A;  4YM6 D;  3WAA A;  2RVQ C;  1P3F D;  1F66 C;  1BH8 A;  4DQY B;  3AZF B;  3B6G D;  4H9P A;  5FUG B;  2JSS A;  1U35 A;  3REK A;  1F66 A;  5B32 B;  4ZBJ B;  3AYW D;  3AN2 C;  1P34 B;  3AZI D;  1TZY B;  4CSR B;  5AV6 A;  1P3I B;  3LEL D;  5DNN D;  4WU9 A;  1KX3 A;  2HIO B;  3KWQ B;  5DNN C;  5DNM C;  5E5A C;  4J8X A;  5CPI B;  3AFA A;  4KGC D;  3AZG A;  1AOI C;  2NQB A;  1ULY A;  1ZLA C;  3REK B;  5JRG D;  3NQJ A;  3VH5 W;  3AZM D;  1KX5 A;  3MGQ C;  2Y2G A;  3C1B B;  2ZY5 A;  1P3P D;  2PYO C;  2CV5 C;  1TAF B;  5DNM D;  1M19 A;  2Y2L A;  4YS3 B;  2Y2H A;  1KX3 C;  3MNN A;  4Z5T A;  1ID3 B;  4UUZ B;  3VH6 W;  5AVC B;  2CV5 A;  2ARO D;  2ZY3 A;  3C1C D;  3B6G A;  3REI A;  2FJ7 A;  1W2E A;  2Y2I A;  2JCH A;  5AY8 C;  3AZJ D;  3WA9 D;  3X1V D;  5GXQ C;  4CAY A;  4J8W C;  3TU4 C;  3F6T A;  5CP6 B;  3LEL A;  1HQ3 C;  3MGS B;  5DNN A;  4WU9 D;  5AV8 C;  3AV1 C;  4YM6 C;  3AZE D;  5AV9 D;  3R45 A;  5B1L B;  3WTP D;  3UTA B;  5AV6 C;  2NZD B;  3MVD C;  3REJ A;  5BNX A;  5GT0 A;  5B2I D;  4J8U A;  2L5A A;  3AZF A;  3WAA D;  2ARO B;  3MGP D;  3KWQ A;  4J8X B;  4QLC B;  1B6W A;  3MNN D;  3LZ0 B;  3X1T D;  5GT3 C;  3X1U C;  1BFM A;  4DRB A;  5BNX B;  5CPI A;  5BO0 B;  1H3O B;  3AZK C;  4X23 C;  1KX3 D;  5JRG C;  3W98 A;  2YFW B;  3NQU A;  5F99 C;  4XZQ B;  1P3K B;  1M18 C;  5B40 C;  1P3A B;  2RIQ A;  1P3B C;  3H0M C;  5B0Y A;  4DRA A;  3EPK A;  3WTP A;  3W98 B;  3WTP E;  4NE5 A;  2F8N G;  3REJ D;  1P3P A;  2VQR A;  4Z66 D;  1ZLA B;  1M19 D;  3VH6 A;  3B6G B;  4KHA B;  3LZ1 B;  1P3F A;  4J8V A;  2IO5 B;  5BS7 A;  3TU4 D;  4CSR A;  1P3I A;  3AV2 C;  3MGR C;  3A6N C;  5B32 D;  3REI D;  1T3U A;  4H9N A;  1P3F C;  3WA9 A;  1BH9 A;  2IO5 C;  3REJ B;  3REJ C;  3W96 A;  5JA4 B;  2W8S A;  3V9R B;  4J8U B;  5AV6 D;  5CPI D;  2ZY4 A;  3AZH D;  3W97 A;  3AYW C;  1P3M C;  5GT3 D;  3AZN A;  3UTB C;  4HGA B;  3AFA D;  3AYW B;  3AZG D;  2BYK B;  5B0Z B;  5BNV A;  1P3L D;  1P3A C;  5JRG A;  3W98 C;  1M1A A;  4X23 A;  4NFT A;  3VH5 T;  3AZF D;  4E45 A;  4Z2M H;  3UTB A;  3LZ0 A;  3REL B;  4WV4 B;  4YS3 C;  1KX3 B;  2F8N H;  4Z5T D;  3MGP B;  3AZN B;  2CV5 D;  4Z5T B;  1P34 A;  4ZBJ C;  3AN2 B;  3B0C T;  3AZM C;  4H9Q A;  4WU8 C;  3KUY B;  5B1M A;  1P3G C;  3LJA D;  5GXQ B;  1AOI A;  1Z2C B;  4KGC C;  4J8U C;  1HQ3 B;  1M18 D;  3AZH A;  4WU8 A;  5AV9 B;  2F8N K;  5B33 C;  3AZG B;  2FFF B;  3W99 D;  3W97 C;  2F2A C; 
#chains in the Genus database with same CATH homology
 2DF4 C;  4M6B A;  3WKJ B;  3WKJ C;  4WZS B;  5F99 B;  1P3K C;  2NZD C;  1P3P B;  5B33 B;  3B6F A;  4EO5 B;  4HGA C;  4H9O A;  3LJA B;  1EQZ C;  3KUY D;  1P3L A;  3AZH C;  3A6N D;  5B0Z D;  5AV5 D;  3H0R C;  3B0D C;  5AVC A;  3UTB D;  2CV5 B;  3X1S B;  1U35 B;  3KWQ D;  3MGR D;  3REI C;  2HUE B;  2JE5 A;  5B32 A;  3AZK A;  1H3O A;  3LZ1 D;  3W96 D;  4H9P B;  5FUG A;  3C1C B;  5JRG B;  5CHL B;  1P3L B;  4XUJ D;  4X23 B;  4JJN B;  1AOI D;  5AV8 B;  1M18 A;  2CWE A;  3H0L C;  5AVB B;  4H9R B;  3AV1 B;  2G5I C;  5KDM A;  5GT0 B;  1PZR A;  5E5A A;  1TZY D;  3X1U A;  3AZI B;  1S32 B;  2HIO C;  4X23 D;  3KUY A;  5B2J A;  1AOI B;  4AWL C;  2HIO D;  3W99 C;  3O62 C;  3UT9 A;  4G92 B;  3AN2 A;  5BT1 D;  1BH9 B;  4ZUX C;  5AVB D;  5AVC C;  4J8V D;  2F8N D;  1U35 C;  3B0C W;  3MGQ D;  3MGR A;  1P34 D;  5B31 A;  4XUJ B;  5B40 A;  4JJN D;  2BYM A;  1U35 D;  1F66 D;  4H9N B;  4H9O B;  3LJA A;  4LD9 D;  2FJ7 B;  3AV2 D;  3C1C C;  3EPH A;  4XUJ A;  5B31 B;  5B40 B;  2BYK A;  1KX4 C;  2ZY2 A;  3AV1 D;  5B0Y B;  3W97 D;  3B6F B;  2BG1 A;  5B33 A;  4J8X D;  3WTP B;  1N1J B;  5GT3 A;  3X1S D;  3WTP C;  1R4V A;  3LEL C;  3AZK B;  5AV9 C;  3AZN D;  5B0Y C;  5GSU B;  4J8W A;  5C3I C;  1KX5 C;  5B2I B;  4H9S C;  5E5A D;  1KX5 D;  3W96 B;  1KX5 B;  1EQZ B;  2LY8 A;  4Z5T C;  4J8X C;  3AZE B;  5B31 G;  1P3M A;  3O62 B;  3AN2 D;  4G91 C;  3AFA B;  3W99 B;  4H9R A;  4QLC D;  5AVB A;  3LZ0 C;  3AZK D;  3X1T C;  4NE3 A;  3MGQ A;  2Y2J A;  5CPJ D;  4QLC C;  5AV8 A;  5B40 D;  5B1M D;  2J8P A;  3AV2 A;  5GXQ A;  5B1M C;  3REK D;  4J8V C;  4UUZ A;  4ZUX A;  5AY8 A;  1B67 A;  3AYW A;  3AZL B;  5G49 A;  1P3O C;  3X1U B;  3AZI A;  3TU4 B;  4WNN B;  1P3K A;  4XZQ A;  2YFW A;  3NQU B;  5B2J C;  3B6F D;  1M1A B;  1P3O A;  3UT9 B;  4CAY B;  5GSU C;  4E44 A;  3KXB D;  3LJA C;  2XD5 A;  5B2J D;  1ZLA D;  5CP6 A;  3LEL B;  3MGS A;  3KFU G;  4J8U D;  4KGC A;  3EPJ A;  1S32 D;  1M1A C;  1P3B A;  4NE6 A;  1P3G A;  3X1S C;  2BYM B;  4Z2M G;  2NQB C;  3REI B;  4QLC A;  3B6G C;  3REL D;  5B24 B;  1A7W A;  5B31 D;  5B24 C;  4JJN A;  1KX4 D;  4KHA A;  3X1T A;  3AZN C;  3KUY C;  1P3G B;  2RVQ D;  4UPK A;  5CPK C;  4LD9 A;  5AV8 D;  3AZM B;  3P5J B;  4Z66 B;  1F66 B;  3C1C A;  3AZJ A;  3W98 D;  1BH8 B;  3X1S A;  5B31 C;  5B24 D;  3KXB B;  1KX4 B;  3AZG C;  3EG5 B;  1P3I C;  5DNN B;  4XZQ D;  3UTB B;  1TZY A;  3X1U D;  1P3M B;  3KXB A;  3AZE A;  2ZM5 A;  5B2I C;  1P3P C;  2HIO A;  3UT9 D;  3W96 C;  1P3G D;  3REK C;  1Q9C A;  5B32 G;  4R8P B;  3AZF C;  3TU4 A;  1M19 B;  3VH6 T;  1ID3 C;  3MGP A;  5BO0 A;  2Y2N A;  2Y2Q A;  3C1B A;  2G5H C;  2FJ7 C;  4KUD D;  2HUE C;  3B6F C;  2Y2M A;  4R8P A;  1P34 C;  3A6N B;  5GXQ D;  4Z66 C;  4H9Q B;  3FDD A;  5AVB C;  4ZUX D;  3REH C;  5AY8 D;  3REH B;  3AV1 A;  5CPK B;  5F99 D;  1P3K D;  5B24 A;  4JJN C;  3WKJ D;  4J8W D;  5DNM B;  3KWQ C;  1ZLA A;  5CP6 D;  3MGS D;  1EQZ D;  3AZJ C;  5BNV B;  2Y2P A;  5B0Y D;  4G92 C;  4G91 B;  3AFA C;  3W97 B;  5B0Z C;  2NZD D;  5CPI C;  5GT0 C;  4AWL B;  3AZJ B;  3LZ0 D;  1P3M D;  4LD9 B;  3UTA A;  4XUJ C;  3LZ1 C;  3R45 B;  5B1L A;  1KX4 A;  4Z66 A;  5GT3 B;  3WAA B;  4YM6 A;  3MGQ B;  3C1B C;  3O62 D;  4ZUX B;  3MGP C;  3MVD D;  3C1B D;  1P3I D;  4KUD A;  2Y2O A;  1HTA A;  5BS7 C;  2YFV B;  1WWI A;  1P3L C;  4WU8 D;  5KDM B;  4YS3 D;  3O62 A;  3UT9 C;  5CPJ C;  3W99 A;  4WU9 B;  2DQN C;  2F8N B;  3A1K A;  1TAF A;  5B1L C;  3WKJ A;  4WNN A;  5BT1 C;  4YM6 B;  1P3O D;  1TZY C;  3X1V B;  1JFI B;  3WA9 C;  1HQ3 A;  5AV6 B;  3A6N A;  2NQB B;  5AV5 A;  4EO5 C;  1S32 A;  4KUD C;  1P3B D;  2NQB D;  1P3A A;  5AVC D;  4H9S A;  5GSU D;  1JFI A;  3IP4 C;  3AZM A;  1S32 C;  1M1A D;  3REL A;  1F1E A;  2ARO C;  3LZ1 A;  1P3F B;  5DNM A;  3MGR B;  1M19 C;  3REH A;  3AZL D;  4WU8 B;  3KSY A;  2ARO A;  2PYO A;  5B32 C;  3AZL C;  2Y2K A;  4KGC B;  5AV5 B;  5B1M B;  5F99 A;  3VH5 A;  1ID3 A;  1P3O B;  5AV5 C;  5CPJ B;  3X1V C;  5CP6 C;  3MGS C;  1N1J A;  2XD1 A;  1KU5 A;  1EQZ A;  3V9R A;  5GSU A;  5JA4 A;  4J8W B;  2UWX A;  4WU9 C;  2NZD A;  4WJ3 C;  4XZQ C;  1M18 B;  5B2J B;  2YFV A;  3UTA C;  4R8P C;  3AZE C;  3AZI C;  3B0D B;  5CPK D;  1P3A D;  3MVD B;  3UTA D;  3X1T B;  5B1L D;  2F8N A;  5B0Z A;  4KUD B;  1WWS A;  3AL0 C;  3MVD A;  3WAA C;  5AY8 B;  4R8P D;  3REH D;  3AZL A;  2PYO D;  3MNN C;  3KXB C;  3MNN B;  3AV2 B;  4YS3 A;  2FJ7 D;  3NQJ B;  5B33 D;  5E5A B;  3X1V A;  1ID3 D;  5G49 B;  3A1I A;  4J8V B;  1HQ3 D;  5C3I B;  5AV9 A;  2PYO B;  3AZH B;  3WA9 B;  1P3B B;  3B0B A;  5CPK A;  4LD9 C;  3EPL A;  5B2I A;  5GT0 D;  3REL C;  5CPJ A;  4YM6 D;  3WAA A;  2RVQ C;  1P3F D;  1F66 C;  1BH8 A;  4DQY B;  3AZF B;  3B6G D;  4H9P A;  5FUG B;  2JSS A;  1U35 A;  3REK A;  1F66 A;  5B32 B;  4ZBJ B;  3AYW D;  3AN2 C;  1P34 B;  3AZI D;  1TZY B;  4CSR B;  5AV6 A;  1P3I B;  3LEL D;  5DNN D;  4WU9 A;  1KX3 A;  2HIO B;  3KWQ B;  5DNN C;  5DNM C;  5E5A C;  4J8X A;  5CPI B;  3AFA A;  4KGC D;  3AZG A;  1AOI C;  2NQB A;  1ULY A;  1ZLA C;  3REK B;  5JRG D;  3NQJ A;  3VH5 W;  3AZM D;  1KX5 A;  3MGQ C;  2Y2G A;  3C1B B;  2ZY5 A;  1P3P D;  2PYO C;  2CV5 C;  1TAF B;  5DNM D;  1M19 A;  2Y2L A;  4YS3 B;  2Y2H A;  1KX3 C;  3MNN A;  4Z5T A;  1ID3 B;  4UUZ B;  3VH6 W;  5AVC B;  2CV5 A;  2ARO D;  2ZY3 A;  3C1C D;  3B6G A;  3REI A;  2FJ7 A;  1W2E A;  2Y2I A;  2JCH A;  5AY8 C;  3AZJ D;  3WA9 D;  3X1V D;  5GXQ C;  4CAY A;  4J8W C;  3TU4 C;  3F6T A;  5CP6 B;  3LEL A;  1HQ3 C;  3MGS B;  5DNN A;  4WU9 D;  5AV8 C;  3AV1 C;  4YM6 C;  3AZE D;  5AV9 D;  3R45 A;  5B1L B;  3WTP D;  3UTA B;  5AV6 C;  2NZD B;  3MVD C;  3REJ A;  5BNX A;  5GT0 A;  5B2I D;  4J8U A;  2L5A A;  3AZF A;  3WAA D;  2ARO B;  3MGP D;  3KWQ A;  4J8X B;  4QLC B;  1B6W A;  3MNN D;  3LZ0 B;  3X1T D;  5GT3 C;  3X1U C;  1BFM A;  4DRB A;  5BNX B;  5CPI A;  5BO0 B;  1H3O B;  3AZK C;  4X23 C;  1KX3 D;  5JRG C;  3W98 A;  2YFW B;  3NQU A;  5F99 C;  4XZQ B;  1P3K B;  1M18 C;  5B40 C;  1P3A B;  2RIQ A;  1P3B C;  3H0M C;  5B0Y A;  4DRA A;  3EPK A;  3WTP A;  3W98 B;  3WTP E;  4NE5 A;  2F8N G;  3REJ D;  1P3P A;  2VQR A;  4Z66 D;  1ZLA B;  1M19 D;  3VH6 A;  3B6G B;  4KHA B;  3LZ1 B;  1P3F A;  4J8V A;  2IO5 B;  5BS7 A;  3TU4 D;  4CSR A;  1P3I A;  3AV2 C;  3MGR C;  3A6N C;  5B32 D;  3REI D;  1T3U A;  4H9N A;  1P3F C;  3WA9 A;  1BH9 A;  2IO5 C;  3REJ B;  3REJ C;  3W96 A;  5JA4 B;  2W8S A;  3V9R B;  4J8U B;  5AV6 D;  5CPI D;  2ZY4 A;  3AZH D;  3W97 A;  3AYW C;  1P3M C;  5GT3 D;  3AZN A;  3UTB C;  4HGA B;  3AFA D;  3AYW B;  3AZG D;  2BYK B;  5B0Z B;  5BNV A;  1P3L D;  1P3A C;  5JRG A;  3W98 C;  1M1A A;  4X23 A;  4NFT A;  3VH5 T;  3AZF D;  4E45 A;  4Z2M H;  3UTB A;  3LZ0 A;  3REL B;  4WV4 B;  4YS3 C;  1KX3 B;  2F8N H;  4Z5T D;  3MGP B;  3AZN B;  2CV5 D;  4Z5T B;  1P34 A;  4ZBJ C;  3AN2 B;  3B0C T;  3AZM C;  4H9Q A;  4WU8 C;  3KUY B;  5B1M A;  1P3G C;  3LJA D;  5GXQ B;  1AOI A;  1Z2C B;  4KGC C;  4J8U C;  1HQ3 B;  1M18 D;  3AZH A;  4WU8 A;  5AV9 B;  2F8N K;  5B33 C;  3AZG B;  2FFF B;  3W99 D;  3W97 C;  2F2A C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...