2FJ7C

Crystal structure of nucleosome core particle containing a poly (da.dt) sequence element
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
107
structure length
107
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 147 bp DNA containing 16 bp poly dA element
publication title Nucleosome Core Particles Containing a Poly(dA.dT) Sequence Element Exhibit a Locally Distorted DNA Structure.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 23
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2005-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2fj7C00
5B33C 3WKJB 4ZUXA 1Q9CA 1U35D 3AZHB 3O62C 3MGRB 3W97C 3NQUA 3WA9C 3AZEB 3WAAB 1KX3A 4WNNA 4LD9B 5AV6A 1P3KC 3LJAC 3WAAA 5JA4A 3WTPE 3C1CC 3MGSA 2NZDA 1M1AB 3W98B 3WAAD 4X23A 3MGSD 4YS3A 3VH6T 4LD9D 2NZDD 2FJ7A 3AZIB 3REKB 4X23D 4J8UA 1TAFA 5G49B 3LZ1B 1M1AD 3C1BB 3W98D 3X1VA 4J8UD 2CV5C 1B6WA 4YM6C 3AZNB 1P3MA 4JJNC 4XUJC 3X1VD 2YFWB 4KHAB 3REKD 5B32C 4G92C 3LZ1D 3AN2C 3AYWB 1ZLAC 2RVQD 3AZND 5GSUB 1P3PB 1AOIC 3WTPC 5B1LA 3TU4C 1F66C 5FUGB 4WZSB 5CPIC 4UUZB 4WU8C 3MNNA 1P3FA 5GXQB 2JSSA 5GT3B 1HTAA 3UTAB 3MNND 3WKJC 2NQBA 3AZKC 1HQ3A 5GSUD 5BS7A 3A6NC 1P3FD 3AZHC 3X1SB 1TZYC 1HQ3D 3MGRC 3AZLC 1S32A 3MGPB 3AZEC 3KWQA 3W99B 5JRGB 5GT3D 4QLCA 3X1SA 1S32D 3KWQD 4XZQB 1H3OA 3X1SD 1P3LA 3W96C 3LZ0A 5AVBC 4M6BA 2CWEA 3MGPD 3W98C 3W99D 1P3LD 5BT1D 3LZ0D 4J8XC 1N1JB 4KGCB 2AROA 3REIA 3AZIC 1P3OC 3B0DC 1EQZC 2AROD 1R4VA 3C1BC 4Z66B 1P3AA 5B24B 4KGCD 3KXBA 3AZGB 3B6GB 3X1TA 4KUDB 3VH6W 3KXBD 1M19A 2HIOA 3X1TD 4EO5B 4J8WA 3AV1A 3UT9A 3AYWC 5BNXA 5GT0C 2HIOD 4J8WD 1P3PC 5B40A 3AV1D 3MGQB 3AV2B 3UT9D 3B6FC 4ZBJB 5B31G 5B40D 5KDMB 3AZFA 5B0YB 1P34C 3REHA 2IO5B 4HGAB 5GXQC 5F99C 5B33A 4E45A 3UTAC 1BH8B 5BO0B 3AZFD 5CP6C 3MGQD 3AV2D 3REJC 5AV5B 3WA9A 4CSRA 5B0YD 5JRGC 5B32G 5CPKB 1P3GC 3UTBA 2BYKB 4XZQC 3UTBD 3C1CA 1ULYA 3V9RA 3AZJC 5AV5D 4Z5TA 3KSYA 4ZUXB 5B31A 4Z5TD 5B2IA 4J8VC 3KUYA 2F8NK 5DNMA 3NQUB 1P3BB 5B31D 5B2ID 3KUYD 1KX3B 4WNNB 5AV6B 4Z66C 3B0CT 4ZUXD 1P3BA 5B24C 4JJNA 4XUJA 5JA4B 4H9RA 4G91B 3AZGC 3B6GC 3MGSB 2NZDB 5B32A 1P3BD 2BYMA 3MVDC 4KUDC 1KX3D 4X23B 4E44A 3AN2A 4YS3B 5AV6D 2FJ7B 4J8UB 1TAFB 1F66A 5AV8A 4ZBJC 5AV9A 3X1VB 1M18A 1P3MB 4YS3D 5AV8D 1ID3A 2IO5C 2FJ7D 5AV9D 3AZKA 4R8PC 1F1EA 4H9QA 5AVCC 3A6NA 3AFAA 1ID3D 1P3IC 3X1UA 1TZYA 3AZLA 2F8NG 3LELA 3AFAD 3NQJA 1KX4A 3X1UD 1P3MD 5CPKC 3VH5A 3LELD 5B1LB 3VH5T 1KX4D 2HUEB 5E5AA 3MNNB 3W96A 1P3FB 1U35C 5E5AD 5C3IB 4NFTA 2NQBB 1HQ3B 4J8XA 5B1LD 3R45A 1P3OA 5B0ZA 5DNNA 1S32B 1EQZA 3KWQB 1JFIA 5B2JA 4QLCB 5B0ZD 4AWLB 4H9SA 5DNND 2NQBD 4H9OA 2F8NA 5B2JD 1KX5A 3WAAC 1H3OB 1P3LB 4G91C 3LZ0B 3MGSC 4LD9C 2NZDC 2F8ND 1KX5D 4X23C 4QLCD 2AROB 1KU5A 3REIB 4H9NA 5GT0A 5CPJA 1M1AC 4J8UC 3B0CW 3B6FA 5CPJD 3X1VC 3REKC 1P3AB 1P34A 5F99A 3KXBB 3REID 5B1MB 3AZMA 3LZ1C 3X1TB 5CP6A 2RVQC 1M19B 3AZNC 3AZMD 2HIOB 4J8WB 4WU9A 3AV1B 5B1MA 1BFMA 3UT9B 5BNXB 1P3AD 1P3GA 4WU9D 5B40B 5B1MD 2HUEC 3MNNC 1M19D 3AZFB 5GSUC 3AZJA 1WWSA 3REHB 1P3FC 5B33B 2PYOA 5C3IC 3RELA 1HQ3C 4CAYA 4J8VA 5AY8A 2PYOD 5GT3C 3RELD 3WA9B 4CSRB 1S32C 5AY8D 3KWQC 3VH5W 3REHD 3UTBB 5B33D 3O62A 3X1SC 3W97A 1BH9A 3LJAB 3MGPC 3W99C 3C1CB 3O62D 1P3LC 3V9RB 5BT1C 3LZ0C 4Z5TB 3W97D 3WA9D 1P3KA 3MVDA 3LJAA 5B31B 5B2IB 5BNVA 3KUYB 2AROC 3B0BA 1P3KD 5DNMB 3LJAD 3C1CD 4H9PA 1WWIA 4KGCC 4JJNB 4XUJB 4H9RB 3KXBC 5DNMD 4R8PA 5B32B 5AVCA 3X1TC 2BYMB 2CV5A 1P3IA 4YM6A 3AN2B 2HIOC 4J8WC 3AV1C 1A7WA 2CV5D 3UT9C 4YM6D 4JJND 4XUJD 5B40C 1F66B 5AV8B 5B32D 4EO5C 1ZLAA 5AV9B 1M18B 3AZFC 4Z2MG 3WTPA 3AN2D 1U35A 1ID3B 2YFVA 1AOIA 3TU4A 3MGQC 3AV2C 1ZLAD 5CPIA 3AZKB 4WU8A 4H9QB 3AFAB 3A6NB 1AOID 3WTPD 4NE5A 3TU4D 1F66D 3X1UB 1TZYB 5B0YC 5CPID 4WU8D 4HGAC 3AZLB 3LELB 3WKJA 3NQJB 1M18D 2F8NH 1KX4B 3AZHA 3UTBC 3WKJD 3AZKD 3MGRA 5AV5C 3A6ND 5E5AB 3AZEA 3AZHD 3W96B 1TZYD 5AVBB 3AZLD 3MGRD 4LD9A 4Z5TC 3AZED 3VH6A 4J8XB 5B31C 5B2IC 3KUYC 5AVBA 3R45B 5DNMC 1M1AA 1P3OB 5B0ZB 3B0DB 3W98A 5DNNB 1EQZB 4ZUXC 1JFIB 3W96D 5B2JB 5AVBD 3AZIA 3REKA 4H9OB 4J8XD 1P3BC 2F8NB 1KX5B 4DRAA 5G49A 4DRBA 1KX3C 3LZ1A 3AZID 4WV4B 1P3OD 5AV6C 3C1BA 1EQZD 2LY8A 3AZNA 3C1BD 2YFWA 4KHAA 4H9NB 5GT0B 5CPJB 3B6FB 4YS3C 5AV8C 3AYWA 2FJ7C 5AV9C 1M18C 5GSUA 1P34B 1P3PA 1ID3C 5F99B 3AYWD 5FUGA 3AZMB 5GT0D 4UUZA 3AFAC 1P3PD 5CP6B 3REJB 3B6FD 3X1UC 5GT3A 5GXQA 4WU9B 1P3MC 3UTAA 4NE6A 3LELC 1KX4C 1P34D 5GXQD 5F99D 1P3GB 3REJA 3UTAD 5E5AC 5CP6D 3MGPA 3REJD 3W99A 5JRGA 3AZJB 5B1LC 2PYOB 3RELB 5JRGD 1P3GD 4XZQA 4CAYB 4J8VB 5AY8B 5B0ZC 4XZQD 5DNNC 2NQBC 5BS7C 3AZJD 1N1JA 5B2JC 4KGCA 3O62B 4H9SC 3W97B 1BH9B 4J8VD 1KX5C 1B67A 4QLCC 4AWLC 4Z66A 1P3KB 3MVDB 5B24A 3AZGA 5BNVB 3B6GA 4NE3A 4Z66D 5B24D 5CPJC 4KUDA 3AZGD 3B6GD 4H9PB 3REIC 3MVDD 4KUDD 3MGQA 3AV2A 4R8PB 3AZMC 5AVCB 1P3IB 2CV5B 5KDMA 4YM6B 1P3AC 5B0YA 4WU9C 5B1MC 1BH8A 4G92B 5BO0A 1M19C 4R8PD 5AV5A 5CHLB 5AVCD 1ZLAB 1P3ID 5CPKA 1U35B 3WTPB 1AOIB 2YFVB 4Z2MH 3TU4B 5CPIB 2PYOC 4WU8B 3RELC 5CPKD 2BYKA 2L5AA 5AY8C 3REHC
chains in the Genus database with same CATH superfamily
5B33C 3WKJB 4ZUXA 1Q9CA 1U35D 3AZHB 3FDDA 3O62C 3MGRB 3W97C 3NQUA 3WA9C 3AZEB 2VQRA 3WAAB 1KX3A 4WNNA 4LD9B 5AV6A 1P3KC 3LJAC 3WAAA 5JA4A 3WTPE 3C1CC 3MGSA 2NZDA 1M1AB 3W98B 3WAAD 3KFUG 4X23A 3MGSD 4YS3A 3VH6T 4LD9D 2NZDD 2FJ7A 3AZIB 3REKB 4X23D 4J8UA 1TAFA 5G49B 3LZ1B 1M1AD 3C1BB 3W98D 3X1VA 4J8UD 2CV5C 1B6WA 4YM6C 3AZNB 1P3MA 4JJNC 1T3UA 4XUJC 1Z2CB 3X1VD 2YFWB 4KHAB 3REKD 5B32C 4G92C 3LZ1D 3AN2C 3AYWB 1ZLAC 2RVQD 3AZND 5GSUB 1P3PB 1AOIC 3WTPC 5B1LA 3TU4C 1F66C 5FUGB 4WZSB 5CPIC 4UUZB 3H0MC 3MNNA 4WU8C 1P3FA 5GXQB 2JSSA 5GT3B 1HTAA 3UTAB 3MNND 3WKJC 2NQBA 3AZKC 1HQ3A 5GSUD 5BS7A 3A6NC 1P3FD 3AZHC 3X1SB 1TZYC 1HQ3D 3MGRC 3AZLC 1S32A 3MGPB 3AZEC 3KWQA 3W99B 5JRGB 5GT3D 4QLCA 3X1SA 1S32D 3KWQD 4XZQB 1H3OA 3X1SD 1P3LA 3W96C 3LZ0A 5AVBC 4M6BA 2CWEA 3MGPD 3W98C 3W99D 2Y2JA 1P3LD 5BT1D 3LZ0D 4J8XC 1N1JB 4KGCB 2AROA 3REIA 3AZIC 1P3OC 3B0DC 1EQZC 2AROD 1R4VA 3C1BC 4Z66B 1P3AA 5B24B 4KGCD 3KXBA 3AZGB 3B6GB 3X1TA 4KUDB 3VH6W 3P5JB 3KXBD 1M19A 2HIOA 3A1IA 4EO5B 3X1TD 4J8WA 3AV1A 3UT9A 3AYWC 5BNXA 5GT0C 2HIOD 4J8WD 1P3PC 5B40A 3AV1D 3MGQB 3AV2B 3UT9D 3B6FC 4ZBJB 5B31G 5B40D 5KDMB 3AZFA 5B0YB 1P34C 4UPKA 3REHA 2IO5B 4HGAB 5GXQC 5F99C 5B33A 4E45A 3UTAC 1BH8B 5BO0B 3AZFD 5CP6C 3MGQD 3AV2D 3REJC 5AV5B 3WA9A 4CSRA 3EPLA 5B0YD 5JRGC 5B32G 5CPKB 1P3GC 3UTBA 2BYKB 4XZQC 3UTBD 3C1CA 1ULYA 3V9RA 3AZJC 5AV5D 4Z5TA 3KSYA 4ZUXB 5B31A 2Y2LA 4Z5TD 5B2IA 4J8VC 3KUYA 2F8NK 5DNMA 3NQUB 1P3BB 5B31D 5B2ID 3KUYD 1KX3B 4WNNB 5AV6B 4Z66C 3B0CT 4ZUXD 1P3BA 5B24C 4JJNA 4XUJA 5JA4B 4H9RA 4G91B 3AZGC 3B6GC 3MGSB 2NZDB 5B32A 1P3BD 2BYMA 3MVDC 4KUDC 1KX3D 4X23B 4E44A 3AN2A 4YS3B 2Y2QA 5AV6D 2FJ7B 4J8UB 1TAFB 1F66A 5AV8A 4ZBJC 5AV9A 3X1VB 1M18A 2Y2OA 4YS3D 5AV8D 1P3MB 1ID3A 2IO5C 2FJ7D 5AV9D 3AZKA 4R8PC 1F1EA 4H9QA 5AVCC 3A6NA 3AFAA 1ID3D 1P3IC 3X1UA 4WJ3C 1TZYA 3AZLA 2F8NG 3LELA 3AFAD 3NQJA 1KX4A 3X1UD 1P3MD 5CPKC 3VH5A 3LELD 5B1LB 3VH5T 1KX4D 2HUEB 5E5AA 3MNNB 2Y2PA 3W96A 1P3FB 2W8SA 1U35C 2Y2GA 5E5AD 5C3IB 4NFTA 2NQBB 1HQ3B 4J8XA 5B1LD 3R45A 1P3OA 5B0ZA 5DNNA 1S32B 1EQZA 3KWQB 1JFIA 5B2JA 4QLCB 5B0ZD 4AWLB 4H9SA 5DNND 2NQBD 4H9OA 2F8NA 5B2JD 1KX5A 3WAAC 1H3OB 1P3LB 4G91C 3LZ0B 3MGSC 4LD9C 2NZDC 2F8ND 1KX5D 4X23C 4QLCD 2AROB 1KU5A 2Y2HA 3REIB 4H9NA 2Y2NA 5GT0A 5CPJA 1M1AC 4J8UC 3B0CW 3B6FA 5CPJD 3X1VC 1W2EA 3REKC 1P3AB 1P34A 2Y2KA 5F99A 3KXBB 3REID 5B1MB 3AZMA 3LZ1C 3X1TB 5CP6A 2RVQC 1M19B 3AZNC 3AZMD 2HIOB 4J8WB 4WU9A 3AV1B 5B1MA 1BFMA 3EG5B 3UT9B 5BNXB 1P3AD 1P3GA 4WU9D 5B40B 5B1MD 2Y2IA 2J8PA 2BG1A 2HUEC 3MNNC 1M19D 3AZFB 2DQNC 5GSUC 3AZJA 1WWSA 3H0RC 3REHB 1P3FC 5B33B 2PYOA 5C3IC 3RELA 1HQ3C 3AL0C 2F2AC 4CAYA 4J8VA 5AY8A 2ZY4A 2PYOD 5GT3C 3RELD 3WA9B 4CSRB 1S32C 5AY8D 3KWQC 3VH5W 3REHD 3UTBB 5B33D 3O62A 3X1SC 3W97A 1BH9A 3LJAB 3MGPC 3W99C 3C1CB 3O62D 1P3LC 3V9RB 5BT1C 3LZ0C 4Z5TB 3W97D 3F6TA 3WA9D 1P3KA 3MVDA 3LJAA 5B31B 3A1KA 5B2IB 5BNVA 3KUYB 2AROC 3B0BA 1P3KD 5DNMB 3LJAD 3C1CD 4H9PA 1WWIA 4KGCC 3EPJA 4JJNB 4XUJB 4H9RB 3KXBC 2XD5A 5DNMD 4R8PA 5B32B 5AVCA 3H0LC 3X1TC 2BYMB 2CV5A 1P3IA 2UWXA 4YM6A 3IP4C 3AN2B 2HIOC 4J8WC 3AV1C 1A7WA 2CV5D 3UT9C 4YM6D 4JJND 4XUJD 5B40C 1F66B 2RIQA 5AV8B 5B32D 4EO5C 1ZLAA 5AV9B 1M18B 3AZFC 4Z2MG 3WTPA 3AN2D 1U35A 1ID3B 2YFVA 1AOIA 3TU4A 3MGQC 2ZY5A 3AV2C 1ZLAD 5CPIA 3AZKB 4WU8A 4H9QB 3AFAB 3A6NB 1AOID 3WTPD 4NE5A 3TU4D 1F66D 3X1UB 1TZYB 5B0YC 5CPID 4WU8D 4HGAC 3AZLB 3LELB 3WKJA 3NQJB 1M18D 2F8NH 1KX4B 3AZHA 3UTBC 2JE5A 3WKJD 3AZKD 3MGRA 5AV5C 3A6ND 5E5AB 3AZEA 3AZHD 3W96B 1TZYD 2Y2MA 5AVBB 3MGRD 3AZLD 4LD9A 4Z5TC 3AZED 2FFFB 3VH6A 4J8XB 5B31C 5B2IC 3KUYC 5AVBA 3R45B 2ZM5A 5DNMC 1M1AA 1P3OB 5B0ZB 3B0DB 3W98A 5DNNB 1EQZB 4ZUXC 1JFIB 3W96D 5B2JB 5AVBD 3AZIA 3REKA 4H9OB 4J8XD 1P3BC 2F8NB 2JCHA 4DRAA 1KX5B 5G49A 4DRBA 1KX3C 3LZ1A 3AZID 4WV4B 1P3OD 5AV6C 3C1BA 1EQZD 2LY8A 3AZNA 3C1BD 2YFWA 4KHAA 4H9NB 5GT0B 5CPJB 3B6FB 4YS3C 5AV8C 3AYWA 2FJ7C 5AV9C 1M18C 5GSUA 1P34B 1P3PA 2DF4C 1ID3C 5F99B 3AYWD 5FUGA 3AZMB 5GT0D 4UUZA 3AFAC 1P3PD 5CP6B 3REJB 3B6FD 3X1UC 5GT3A 5GXQA 4WU9B 1P3MC 3UTAA 4NE6A 3LELC 1KX4C 1P34D 5GXQD 5F99D 1P3GB 3REJA 3UTAD 5E5AC 5CP6D 3MGPA 3REJD 3W99A 5JRGA 3AZJB 5B1LC 2PYOB 3RELB 5JRGD 1PZRA 2G5IC 1P3GD 4XZQA 4CAYB 4J8VB 5AY8B 3EPHA 2ZY3A 5B0ZC 4XZQD 5DNNC 2NQBC 5BS7C 3AZJD 1N1JA 5B2JC 4KGCA 2G5HC 3O62B 4H9SC 3W97B 1BH9B 2XD1A 4J8VD 1KX5C 1B67A 4QLCC 4AWLC 4Z66A 1P3KB 3MVDB 5B24A 3AZGA 5BNVB 3B6GA 4NE3A 4Z66D 5B24D 5CPJC 4KUDA 3AZGD 2ZY2A 3B6GD 4H9PB 3REIC 4DQYB 3MVDD 4KUDD 3MGQA 3AV2A 4R8PB 3AZMC 5AVCB 1P3IB 2CV5B 5KDMA 4YM6B 3EPKA 1P3AC 5B0YA 4WU9C 5B1MC 1BH8A 4G92B 5BO0A 1M19C 4R8PD 5AV5A 5CHLB 5AVCD 1ZLAB 1P3ID 5CPKA 1U35B 3WTPB 1AOIB 2YFVB 4Z2MH 3TU4B 5CPIB 2PYOC 4WU8B 3RELC 5CPKD 2BYKA 2L5AA 5AY8C 3REHC
chains in the Genus database with same CATH topology
5B33C 3WKJB 4ZUXA 1Q9CA 1U35D 3AZHB 3FDDA 3O62C 3MGRB 3W97C 3NQUA 3WA9C 3AZEB 2VQRA 3WAAB 1KX3A 4WNNA 4LD9B 5AV6A 1P3KC 3LJAC 3WAAA 5JA4A 3WTPE 3C1CC 3MGSA 2NZDA 1M1AB 3W98B 3WAAD 3KFUG 4X23A 3MGSD 4YS3A 3VH6T 4LD9D 2NZDD 2FJ7A 3AZIB 3REKB 4X23D 4J8UA 1TAFA 5G49B 3LZ1B 1M1AD 3C1BB 3W98D 3X1VA 4J8UD 2CV5C 1B6WA 4YM6C 3AZNB 1P3MA 4JJNC 1T3UA 4XUJC 1Z2CB 3X1VD 2YFWB 4KHAB 3REKD 5B32C 4G92C 3LZ1D 3AN2C 3AYWB 1ZLAC 2RVQD 3AZND 5GSUB 1P3PB 1AOIC 3WTPC 5B1LA 3TU4C 1F66C 5FUGB 4WZSB 5CPIC 4UUZB 3H0MC 3MNNA 4WU8C 1P3FA 5GXQB 2JSSA 5GT3B 1HTAA 3UTAB 3MNND 3WKJC 2NQBA 3AZKC 1HQ3A 5GSUD 5BS7A 3A6NC 1P3FD 3AZHC 3X1SB 1TZYC 1HQ3D 3MGRC 3AZLC 1S32A 3MGPB 3AZEC 3KWQA 3W99B 5JRGB 5GT3D 4QLCA 3X1SA 1S32D 3KWQD 4XZQB 1H3OA 3X1SD 1P3LA 3W96C 3LZ0A 5AVBC 4M6BA 2CWEA 3MGPD 3W98C 3W99D 2Y2JA 1P3LD 5BT1D 3LZ0D 4J8XC 1N1JB 4KGCB 2AROA 3REIA 3AZIC 1P3OC 3B0DC 1EQZC 2AROD 1R4VA 3C1BC 4Z66B 1P3AA 5B24B 4KGCD 3KXBA 3AZGB 3B6GB 3X1TA 4KUDB 3VH6W 3P5JB 3KXBD 1M19A 2HIOA 3A1IA 4EO5B 3X1TD 4J8WA 3AV1A 3UT9A 3AYWC 5BNXA 5GT0C 2HIOD 4J8WD 1P3PC 5B40A 3AV1D 3MGQB 3AV2B 3UT9D 3B6FC 4ZBJB 5B31G 5B40D 5KDMB 3AZFA 5B0YB 1P34C 4UPKA 3REHA 2IO5B 4HGAB 5GXQC 5F99C 5B33A 4E45A 3UTAC 1BH8B 5BO0B 3AZFD 5CP6C 3MGQD 3AV2D 3REJC 5AV5B 3WA9A 4CSRA 3EPLA 5B0YD 5JRGC 5B32G 5CPKB 1P3GC 3UTBA 2BYKB 4XZQC 3UTBD 3C1CA 1ULYA 3V9RA 3AZJC 5AV5D 4Z5TA 3KSYA 4ZUXB 5B31A 2Y2LA 4Z5TD 5B2IA 4J8VC 3KUYA 2F8NK 5DNMA 3NQUB 1P3BB 5B31D 5B2ID 3KUYD 1KX3B 4WNNB 5AV6B 4Z66C 3B0CT 4ZUXD 1P3BA 5B24C 4JJNA 4XUJA 5JA4B 4H9RA 4G91B 3AZGC 3B6GC 3MGSB 2NZDB 5B32A 1P3BD 2BYMA 3MVDC 4KUDC 1KX3D 4X23B 4E44A 3AN2A 4YS3B 2Y2QA 5AV6D 2FJ7B 4J8UB 1TAFB 1F66A 5AV8A 4ZBJC 5AV9A 3X1VB 1M18A 2Y2OA 4YS3D 5AV8D 1P3MB 1ID3A 2IO5C 2FJ7D 5AV9D 3AZKA 4R8PC 1F1EA 4H9QA 5AVCC 3A6NA 3AFAA 1ID3D 1P3IC 3X1UA 4WJ3C 1TZYA 3AZLA 2F8NG 3LELA 3AFAD 3NQJA 1KX4A 3X1UD 1P3MD 5CPKC 3VH5A 3LELD 5B1LB 3VH5T 1KX4D 2HUEB 5E5AA 3MNNB 2Y2PA 3W96A 1P3FB 2W8SA 1U35C 2Y2GA 5E5AD 5C3IB 4NFTA 2NQBB 1HQ3B 4J8XA 5B1LD 3R45A 1P3OA 5B0ZA 5DNNA 1S32B 1EQZA 3KWQB 1JFIA 5B2JA 4QLCB 5B0ZD 4AWLB 4H9SA 5DNND 2NQBD 4H9OA 2F8NA 5B2JD 1KX5A 3WAAC 1H3OB 1P3LB 4G91C 3LZ0B 3MGSC 4LD9C 2NZDC 2F8ND 1KX5D 4X23C 4QLCD 2AROB 1KU5A 2Y2HA 3REIB 4H9NA 2Y2NA 5GT0A 5CPJA 1M1AC 4J8UC 3B0CW 3B6FA 5CPJD 3X1VC 1W2EA 3REKC 1P3AB 1P34A 2Y2KA 5F99A 3KXBB 3REID 5B1MB 3AZMA 3LZ1C 3X1TB 5CP6A 2RVQC 1M19B 3AZNC 3AZMD 2HIOB 4J8WB 4WU9A 3AV1B 5B1MA 1BFMA 3EG5B 3UT9B 5BNXB 1P3AD 1P3GA 4WU9D 5B40B 5B1MD 2Y2IA 2J8PA 2BG1A 2HUEC 3MNNC 1M19D 3AZFB 2DQNC 5GSUC 3AZJA 1WWSA 3H0RC 3REHB 1P3FC 5B33B 2PYOA 5C3IC 3RELA 1HQ3C 3AL0C 2F2AC 4CAYA 4J8VA 5AY8A 2ZY4A 2PYOD 5GT3C 3RELD 3WA9B 4CSRB 1S32C 5AY8D 3KWQC 3VH5W 3REHD 3UTBB 5B33D 3O62A 3X1SC 3W97A 1BH9A 3LJAB 3MGPC 3W99C 3C1CB 3O62D 1P3LC 3V9RB 5BT1C 3LZ0C 4Z5TB 3W97D 3F6TA 3WA9D 1P3KA 3MVDA 3LJAA 5B31B 3A1KA 5B2IB 5BNVA 3KUYB 2AROC 3B0BA 1P3KD 5DNMB 3LJAD 3C1CD 4H9PA 1WWIA 4KGCC 3EPJA 4JJNB 4XUJB 4H9RB 3KXBC 2XD5A 5DNMD 4R8PA 5B32B 5AVCA 3H0LC 3X1TC 2BYMB 2CV5A 1P3IA 2UWXA 4YM6A 3IP4C 3AN2B 2HIOC 4J8WC 3AV1C 1A7WA 2CV5D 3UT9C 4YM6D 4JJND 4XUJD 5B40C 1F66B 2RIQA 5AV8B 5B32D 4EO5C 1ZLAA 5AV9B 1M18B 3AZFC 4Z2MG 3WTPA 3AN2D 1U35A 1ID3B 2YFVA 1AOIA 3TU4A 3MGQC 2ZY5A 3AV2C 1ZLAD 5CPIA 3AZKB 4WU8A 4H9QB 3AFAB 3A6NB 1AOID 3WTPD 4NE5A 3TU4D 1F66D 3X1UB 1TZYB 5B0YC 5CPID 4WU8D 4HGAC 3AZLB 3LELB 3WKJA 3NQJB 1M18D 2F8NH 1KX4B 3AZHA 3UTBC 2JE5A 3WKJD 3AZKD 3MGRA 5AV5C 3A6ND 5E5AB 3AZEA 3AZHD 3W96B 1TZYD 2Y2MA 5AVBB 3MGRD 3AZLD 4LD9A 4Z5TC 3AZED 2FFFB 3VH6A 4J8XB 5B31C 5B2IC 3KUYC 5AVBA 3R45B 2ZM5A 5DNMC 1M1AA 1P3OB 5B0ZB 3B0DB 3W98A 5DNNB 1EQZB 4ZUXC 1JFIB 3W96D 5B2JB 5AVBD 3AZIA 3REKA 4H9OB 4J8XD 1P3BC 2F8NB 2JCHA 4DRAA 1KX5B 5G49A 4DRBA 1KX3C 3LZ1A 3AZID 4WV4B 1P3OD 5AV6C 3C1BA 1EQZD 2LY8A 3AZNA 3C1BD 2YFWA 4KHAA 4H9NB 5GT0B 5CPJB 3B6FB 4YS3C 5AV8C 3AYWA 2FJ7C 5AV9C 1M18C 5GSUA 1P34B 1P3PA 2DF4C 1ID3C 5F99B 3AYWD 5FUGA 3AZMB 5GT0D 4UUZA 3AFAC 1P3PD 5CP6B 3REJB 3B6FD 3X1UC 5GT3A 5GXQA 4WU9B 1P3MC 3UTAA 4NE6A 3LELC 1KX4C 1P34D 5GXQD 5F99D 1P3GB 3REJA 3UTAD 5E5AC 5CP6D 3MGPA 3REJD 3W99A 5JRGA 3AZJB 5B1LC 2PYOB 3RELB 5JRGD 1PZRA 2G5IC 1P3GD 4XZQA 4CAYB 4J8VB 5AY8B 3EPHA 2ZY3A 5B0ZC 4XZQD 5DNNC 2NQBC 5BS7C 3AZJD 1N1JA 5B2JC 4KGCA 2G5HC 3O62B 4H9SC 3W97B 1BH9B 2XD1A 4J8VD 1KX5C 1B67A 4QLCC 4AWLC 4Z66A 1P3KB 3MVDB 5B24A 3AZGA 5BNVB 3B6GA 4NE3A 4Z66D 5B24D 5CPJC 4KUDA 3AZGD 2ZY2A 3B6GD 4H9PB 3REIC 4DQYB 3MVDD 4KUDD 3MGQA 3AV2A 4R8PB 3AZMC 5AVCB 1P3IB 2CV5B 5KDMA 4YM6B 3EPKA 1P3AC 5B0YA 4WU9C 5B1MC 1BH8A 4G92B 5BO0A 1M19C 4R8PD 5AV5A 5CHLB 5AVCD 1ZLAB 1P3ID 5CPKA 1U35B 3WTPB 1AOIB 2YFVB 4Z2MH 3TU4B 5CPIB 2PYOC 4WU8B 3RELC 5CPKD 2BYKA 2L5AA 5AY8C 3REHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B33 C;  3WKJ B;  4ZUX A;  1Q9C A;  1U35 D;  3AZH B;  3O62 C;  3MGR B;  3W97 C;  3NQU A;  3WA9 C;  3AZE B;  3WAA B;  1KX3 A;  4WNN A;  4LD9 B;  5AV6 A;  1P3K C;  3LJA C;  3WAA A;  5JA4 A;  3WTP E;  3C1C C;  3MGS A;  2NZD A;  1M1A B;  3W98 B;  3WAA D;  4X23 A;  3MGS D;  4YS3 A;  3VH6 T;  4LD9 D;  2NZD D;  2FJ7 A;  3AZI B;  3REK B;  4X23 D;  4J8U A;  1TAF A;  5G49 B;  3LZ1 B;  1M1A D;  3C1B B;  3W98 D;  3X1V A;  4J8U D;  2CV5 C;  1B6W A;  4YM6 C;  3AZN B;  1P3M A;  4JJN C;  4XUJ C;  3X1V D;  2YFW B;  4KHA B;  3REK D;  5B32 C;  4G92 C;  3LZ1 D;  3AN2 C;  3AYW B;  1ZLA C;  2RVQ D;  3AZN D;  5GSU B;  1P3P B;  1AOI C;  3WTP C;  5B1L A;  3TU4 C;  1F66 C;  5FUG B;  4WZS B;  5CPI C;  4UUZ B;  4WU8 C;  3MNN A;  1P3F A;  5GXQ B;  2JSS A;  5GT3 B;  1HTA A;  3UTA B;  3MNN D;  3WKJ C;  2NQB A;  3AZK C;  1HQ3 A;  5GSU D;  5BS7 A;  3A6N C;  1P3F D;  3AZH C;  3X1S B;  1TZY C;  1HQ3 D;  3MGR C;  3AZL C;  1S32 A;  3MGP B;  3AZE C;  3KWQ A;  3W99 B;  5JRG B;  5GT3 D;  4QLC A;  3X1S A;  1S32 D;  3KWQ D;  4XZQ B;  1H3O A;  3X1S D;  1P3L A;  3W96 C;  3LZ0 A;  5AVB C;  4M6B A;  2CWE A;  3MGP D;  3W98 C;  3W99 D;  1P3L D;  5BT1 D;  3LZ0 D;  4J8X C;  1N1J B;  4KGC B;  2ARO A;  3REI A;  3AZI C;  1P3O C;  3B0D C;  1EQZ C;  2ARO D;  1R4V A;  3C1B C;  4Z66 B;  1P3A A;  5B24 B;  4KGC D;  3KXB A;  3AZG B;  3B6G B;  3X1T A;  4KUD B;  3VH6 W;  3KXB D;  1M19 A;  2HIO A;  3X1T D;  4EO5 B;  4J8W A;  3AV1 A;  3UT9 A;  3AYW C;  5BNX A;  5GT0 C;  2HIO D;  4J8W D;  1P3P C;  5B40 A;  3AV1 D;  3MGQ B;  3AV2 B;  3UT9 D;  3B6F C;  4ZBJ B;  5B31 G;  5B40 D;  5KDM B;  3AZF A;  5B0Y B;  1P34 C;  3REH A;  2IO5 B;  4HGA B;  5GXQ C;  5F99 C;  5B33 A;  4E45 A;  3UTA C;  1BH8 B;  5BO0 B;  3AZF D;  5CP6 C;  3MGQ D;  3AV2 D;  3REJ C;  5AV5 B;  3WA9 A;  4CSR A;  5B0Y D;  5JRG C;  5B32 G;  5CPK B;  1P3G C;  3UTB A;  2BYK B;  4XZQ C;  3UTB D;  3C1C A;  1ULY A;  3V9R A;  3AZJ C;  5AV5 D;  4Z5T A;  3KSY A;  4ZUX B;  5B31 A;  4Z5T D;  5B2I A;  4J8V C;  3KUY A;  2F8N K;  5DNM A;  3NQU B;  1P3B B;  5B31 D;  5B2I D;  3KUY D;  1KX3 B;  4WNN B;  5AV6 B;  4Z66 C;  3B0C T;  4ZUX D;  1P3B A;  5B24 C;  4JJN A;  4XUJ A;  5JA4 B;  4H9R A;  4G91 B;  3AZG C;  3B6G C;  3MGS B;  2NZD B;  5B32 A;  1P3B D;  2BYM A;  3MVD C;  4KUD C;  1KX3 D;  4X23 B;  4E44 A;  3AN2 A;  4YS3 B;  5AV6 D;  2FJ7 B;  4J8U B;  1TAF B;  1F66 A;  5AV8 A;  4ZBJ C;  5AV9 A;  3X1V B;  1M18 A;  1P3M B;  4YS3 D;  5AV8 D;  1ID3 A;  2IO5 C;  2FJ7 D;  5AV9 D;  3AZK A;  4R8P C;  1F1E A;  4H9Q A;  5AVC C;  3A6N A;  3AFA A;  1ID3 D;  1P3I C;  3X1U A;  1TZY A;  3AZL A;  2F8N G;  3LEL A;  3AFA D;  3NQJ A;  1KX4 A;  3X1U D;  1P3M D;  5CPK C;  3VH5 A;  3LEL D;  5B1L B;  3VH5 T;  1KX4 D;  2HUE B;  5E5A A;  3MNN B;  3W96 A;  1P3F B;  1U35 C;  5E5A D;  5C3I B;  4NFT A;  2NQB B;  1HQ3 B;  4J8X A;  5B1L D;  3R45 A;  1P3O A;  5B0Z A;  5DNN A;  1S32 B;  1EQZ A;  3KWQ B;  1JFI A;  5B2J A;  4QLC B;  5B0Z D;  4AWL B;  4H9S A;  5DNN D;  2NQB D;  4H9O A;  2F8N A;  5B2J D;  1KX5 A;  3WAA C;  1H3O B;  1P3L B;  4G91 C;  3LZ0 B;  3MGS C;  4LD9 C;  2NZD C;  2F8N D;  1KX5 D;  4X23 C;  4QLC D;  2ARO B;  1KU5 A;  3REI B;  4H9N A;  5GT0 A;  5CPJ A;  1M1A C;  4J8U C;  3B0C W;  3B6F A;  5CPJ D;  3X1V C;  3REK C;  1P3A B;  1P34 A;  5F99 A;  3KXB B;  3REI D;  5B1M B;  3AZM A;  3LZ1 C;  3X1T B;  5CP6 A;  2RVQ C;  1M19 B;  3AZN C;  3AZM D;  2HIO B;  4J8W B;  4WU9 A;  3AV1 B;  5B1M A;  1BFM A;  3UT9 B;  5BNX B;  1P3A D;  1P3G A;  4WU9 D;  5B40 B;  5B1M D;  2HUE C;  3MNN C;  1M19 D;  3AZF B;  5GSU C;  3AZJ A;  1WWS A;  3REH B;  1P3F C;  5B33 B;  2PYO A;  5C3I C;  3REL A;  1HQ3 C;  4CAY A;  4J8V A;  5AY8 A;  2PYO D;  5GT3 C;  3REL D;  3WA9 B;  4CSR B;  1S32 C;  5AY8 D;  3KWQ C;  3VH5 W;  3REH D;  3UTB B;  5B33 D;  3O62 A;  3X1S C;  3W97 A;  1BH9 A;  3LJA B;  3MGP C;  3W99 C;  3C1C B;  3O62 D;  1P3L C;  3V9R B;  5BT1 C;  3LZ0 C;  4Z5T B;  3W97 D;  3WA9 D;  1P3K A;  3MVD A;  3LJA A;  5B31 B;  5B2I B;  5BNV A;  3KUY B;  2ARO C;  3B0B A;  1P3K D;  5DNM B;  3LJA D;  3C1C D;  4H9P A;  1WWI A;  4KGC C;  4JJN B;  4XUJ B;  4H9R B;  3KXB C;  5DNM D;  4R8P A;  5B32 B;  5AVC A;  3X1T C;  2BYM B;  2CV5 A;  1P3I A;  4YM6 A;  3AN2 B;  2HIO C;  4J8W C;  3AV1 C;  1A7W A;  2CV5 D;  3UT9 C;  4YM6 D;  4JJN D;  4XUJ D;  5B40 C;  1F66 B;  5AV8 B;  5B32 D;  4EO5 C;  1ZLA A;  5AV9 B;  1M18 B;  3AZF C;  4Z2M G;  3WTP A;  3AN2 D;  1U35 A;  1ID3 B;  2YFV A;  1AOI A;  3TU4 A;  3MGQ C;  3AV2 C;  1ZLA D;  5CPI A;  3AZK B;  4WU8 A;  4H9Q B;  3AFA B;  3A6N B;  1AOI D;  3WTP D;  4NE5 A;  3TU4 D;  1F66 D;  3X1U B;  1TZY B;  5B0Y C;  5CPI D;  4WU8 D;  4HGA C;  3AZL B;  3LEL B;  3WKJ A;  3NQJ B;  1M18 D;  2F8N H;  1KX4 B;  3AZH A;  3UTB C;  3WKJ D;  3AZK D;  3MGR A;  5AV5 C;  3A6N D;  5E5A B;  3AZE A;  3AZH D;  3W96 B;  1TZY D;  5AVB B;  3AZL D;  3MGR D;  4LD9 A;  4Z5T C;  3AZE D;  3VH6 A;  4J8X B;  5B31 C;  5B2I C;  3KUY C;  5AVB A;  3R45 B;  5DNM C;  1M1A A;  1P3O B;  5B0Z B;  3B0D B;  3W98 A;  5DNN B;  1EQZ B;  4ZUX C;  1JFI B;  3W96 D;  5B2J B;  5AVB D;  3AZI A;  3REK A;  4H9O B;  4J8X D;  1P3B C;  2F8N B;  1KX5 B;  4DRA A;  5G49 A;  4DRB A;  1KX3 C;  3LZ1 A;  3AZI D;  4WV4 B;  1P3O D;  5AV6 C;  3C1B A;  1EQZ D;  2LY8 A;  3AZN A;  3C1B D;  2YFW A;  4KHA A;  4H9N B;  5GT0 B;  5CPJ B;  3B6F B;  4YS3 C;  5AV8 C;  3AYW A;  2FJ7 C;  5AV9 C;  1M18 C;  5GSU A;  1P34 B;  1P3P A;  1ID3 C;  5F99 B;  3AYW D;  5FUG A;  3AZM B;  5GT0 D;  4UUZ A;  3AFA C;  1P3P D;  5CP6 B;  3REJ B;  3B6F D;  3X1U C;  5GT3 A;  5GXQ A;  4WU9 B;  1P3M C;  3UTA A;  4NE6 A;  3LEL C;  1KX4 C;  1P34 D;  5GXQ D;  5F99 D;  1P3G B;  3REJ A;  3UTA D;  5E5A C;  5CP6 D;  3MGP A;  3REJ D;  3W99 A;  5JRG A;  3AZJ B;  5B1L C;  2PYO B;  3REL B;  5JRG D;  1P3G D;  4XZQ A;  4CAY B;  4J8V B;  5AY8 B;  5B0Z C;  4XZQ D;  5DNN C;  2NQB C;  5BS7 C;  3AZJ D;  1N1J A;  5B2J C;  4KGC A;  3O62 B;  4H9S C;  3W97 B;  1BH9 B;  4J8V D;  1KX5 C;  1B67 A;  4QLC C;  4AWL C;  4Z66 A;  1P3K B;  3MVD B;  5B24 A;  3AZG A;  5BNV B;  3B6G A;  4NE3 A;  4Z66 D;  5B24 D;  5CPJ C;  4KUD A;  3AZG D;  3B6G D;  4H9P B;  3REI C;  3MVD D;  4KUD D;  3MGQ A;  3AV2 A;  4R8P B;  3AZM C;  5AVC B;  1P3I B;  2CV5 B;  5KDM A;  4YM6 B;  1P3A C;  5B0Y A;  4WU9 C;  5B1M C;  1BH8 A;  4G92 B;  5BO0 A;  1M19 C;  4R8P D;  5AV5 A;  5CHL B;  5AVC D;  1ZLA B;  1P3I D;  5CPK A;  1U35 B;  3WTP B;  1AOI B;  2YFV B;  4Z2M H;  3TU4 B;  5CPI B;  2PYO C;  4WU8 B;  3REL C;  5CPK D;  2BYK A;  2L5A A;  5AY8 C;  3REH C; 
#chains in the Genus database with same CATH topology
 5B33 C;  3WKJ B;  4ZUX A;  1Q9C A;  1U35 D;  3AZH B;  3FDD A;  3O62 C;  3MGR B;  3W97 C;  3NQU A;  3WA9 C;  3AZE B;  2VQR A;  3WAA B;  1KX3 A;  4WNN A;  4LD9 B;  5AV6 A;  1P3K C;  3LJA C;  3WAA A;  5JA4 A;  3WTP E;  3C1C C;  3MGS A;  2NZD A;  1M1A B;  3W98 B;  3WAA D;  3KFU G;  4X23 A;  3MGS D;  4YS3 A;  3VH6 T;  4LD9 D;  2NZD D;  2FJ7 A;  3AZI B;  3REK B;  4X23 D;  4J8U A;  1TAF A;  5G49 B;  3LZ1 B;  1M1A D;  3C1B B;  3W98 D;  3X1V A;  4J8U D;  2CV5 C;  1B6W A;  4YM6 C;  3AZN B;  1P3M A;  4JJN C;  1T3U A;  4XUJ C;  1Z2C B;  3X1V D;  2YFW B;  4KHA B;  3REK D;  5B32 C;  4G92 C;  3LZ1 D;  3AN2 C;  3AYW B;  1ZLA C;  2RVQ D;  3AZN D;  5GSU B;  1P3P B;  1AOI C;  3WTP C;  5B1L A;  3TU4 C;  1F66 C;  5FUG B;  4WZS B;  5CPI C;  4UUZ B;  3H0M C;  3MNN A;  4WU8 C;  1P3F A;  5GXQ B;  2JSS A;  5GT3 B;  1HTA A;  3UTA B;  3MNN D;  3WKJ C;  2NQB A;  3AZK C;  1HQ3 A;  5GSU D;  5BS7 A;  3A6N C;  1P3F D;  3AZH C;  3X1S B;  1TZY C;  1HQ3 D;  3MGR C;  3AZL C;  1S32 A;  3MGP B;  3AZE C;  3KWQ A;  3W99 B;  5JRG B;  5GT3 D;  4QLC A;  3X1S A;  1S32 D;  3KWQ D;  4XZQ B;  1H3O A;  3X1S D;  1P3L A;  3W96 C;  3LZ0 A;  5AVB C;  4M6B A;  2CWE A;  3MGP D;  3W98 C;  3W99 D;  2Y2J A;  1P3L D;  5BT1 D;  3LZ0 D;  4J8X C;  1N1J B;  4KGC B;  2ARO A;  3REI A;  3AZI C;  1P3O C;  3B0D C;  1EQZ C;  2ARO D;  1R4V A;  3C1B C;  4Z66 B;  1P3A A;  5B24 B;  4KGC D;  3KXB A;  3AZG B;  3B6G B;  3X1T A;  4KUD B;  3VH6 W;  3P5J B;  3KXB D;  1M19 A;  2HIO A;  3A1I A;  4EO5 B;  3X1T D;  4J8W A;  3AV1 A;  3UT9 A;  3AYW C;  5BNX A;  5GT0 C;  2HIO D;  4J8W D;  1P3P C;  5B40 A;  3AV1 D;  3MGQ B;  3AV2 B;  3UT9 D;  3B6F C;  4ZBJ B;  5B31 G;  5B40 D;  5KDM B;  3AZF A;  5B0Y B;  1P34 C;  4UPK A;  3REH A;  2IO5 B;  4HGA B;  5GXQ C;  5F99 C;  5B33 A;  4E45 A;  3UTA C;  1BH8 B;  5BO0 B;  3AZF D;  5CP6 C;  3MGQ D;  3AV2 D;  3REJ C;  5AV5 B;  3WA9 A;  4CSR A;  3EPL A;  5B0Y D;  5JRG C;  5B32 G;  5CPK B;  1P3G C;  3UTB A;  2BYK B;  4XZQ C;  3UTB D;  3C1C A;  1ULY A;  3V9R A;  3AZJ C;  5AV5 D;  4Z5T A;  3KSY A;  4ZUX B;  5B31 A;  2Y2L A;  4Z5T D;  5B2I A;  4J8V C;  3KUY A;  2F8N K;  5DNM A;  3NQU B;  1P3B B;  5B31 D;  5B2I D;  3KUY D;  1KX3 B;  4WNN B;  5AV6 B;  4Z66 C;  3B0C T;  4ZUX D;  1P3B A;  5B24 C;  4JJN A;  4XUJ A;  5JA4 B;  4H9R A;  4G91 B;  3AZG C;  3B6G C;  3MGS B;  2NZD B;  5B32 A;  1P3B D;  2BYM A;  3MVD C;  4KUD C;  1KX3 D;  4X23 B;  4E44 A;  3AN2 A;  4YS3 B;  2Y2Q A;  5AV6 D;  2FJ7 B;  4J8U B;  1TAF B;  1F66 A;  5AV8 A;  4ZBJ C;  5AV9 A;  3X1V B;  1M18 A;  2Y2O A;  4YS3 D;  5AV8 D;  1P3M B;  1ID3 A;  2IO5 C;  2FJ7 D;  5AV9 D;  3AZK A;  4R8P C;  1F1E A;  4H9Q A;  5AVC C;  3A6N A;  3AFA A;  1ID3 D;  1P3I C;  3X1U A;  4WJ3 C;  1TZY A;  3AZL A;  2F8N G;  3LEL A;  3AFA D;  3NQJ A;  1KX4 A;  3X1U D;  1P3M D;  5CPK C;  3VH5 A;  3LEL D;  5B1L B;  3VH5 T;  1KX4 D;  2HUE B;  5E5A A;  3MNN B;  2Y2P A;  3W96 A;  1P3F B;  2W8S A;  1U35 C;  2Y2G A;  5E5A D;  5C3I B;  4NFT A;  2NQB B;  1HQ3 B;  4J8X A;  5B1L D;  3R45 A;  1P3O A;  5B0Z A;  5DNN A;  1S32 B;  1EQZ A;  3KWQ B;  1JFI A;  5B2J A;  4QLC B;  5B0Z D;  4AWL B;  4H9S A;  5DNN D;  2NQB D;  4H9O A;  2F8N A;  5B2J D;  1KX5 A;  3WAA C;  1H3O B;  1P3L B;  4G91 C;  3LZ0 B;  3MGS C;  4LD9 C;  2NZD C;  2F8N D;  1KX5 D;  4X23 C;  4QLC D;  2ARO B;  1KU5 A;  2Y2H A;  3REI B;  4H9N A;  2Y2N A;  5GT0 A;  5CPJ A;  1M1A C;  4J8U C;  3B0C W;  3B6F A;  5CPJ D;  3X1V C;  1W2E A;  3REK C;  1P3A B;  1P34 A;  2Y2K A;  5F99 A;  3KXB B;  3REI D;  5B1M B;  3AZM A;  3LZ1 C;  3X1T B;  5CP6 A;  2RVQ C;  1M19 B;  3AZN C;  3AZM D;  2HIO B;  4J8W B;  4WU9 A;  3AV1 B;  5B1M A;  1BFM A;  3EG5 B;  3UT9 B;  5BNX B;  1P3A D;  1P3G A;  4WU9 D;  5B40 B;  5B1M D;  2Y2I A;  2J8P A;  2BG1 A;  2HUE C;  3MNN C;  1M19 D;  3AZF B;  2DQN C;  5GSU C;  3AZJ A;  1WWS A;  3H0R C;  3REH B;  1P3F C;  5B33 B;  2PYO A;  5C3I C;  3REL A;  1HQ3 C;  3AL0 C;  2F2A C;  4CAY A;  4J8V A;  5AY8 A;  2ZY4 A;  2PYO D;  5GT3 C;  3REL D;  3WA9 B;  4CSR B;  1S32 C;  5AY8 D;  3KWQ C;  3VH5 W;  3REH D;  3UTB B;  5B33 D;  3O62 A;  3X1S C;  3W97 A;  1BH9 A;  3LJA B;  3MGP C;  3W99 C;  3C1C B;  3O62 D;  1P3L C;  3V9R B;  5BT1 C;  3LZ0 C;  4Z5T B;  3W97 D;  3F6T A;  3WA9 D;  1P3K A;  3MVD A;  3LJA A;  5B31 B;  3A1K A;  5B2I B;  5BNV A;  3KUY B;  2ARO C;  3B0B A;  1P3K D;  5DNM B;  3LJA D;  3C1C D;  4H9P A;  1WWI A;  4KGC C;  3EPJ A;  4JJN B;  4XUJ B;  4H9R B;  3KXB C;  2XD5 A;  5DNM D;  4R8P A;  5B32 B;  5AVC A;  3H0L C;  3X1T C;  2BYM B;  2CV5 A;  1P3I A;  2UWX A;  4YM6 A;  3IP4 C;  3AN2 B;  2HIO C;  4J8W C;  3AV1 C;  1A7W A;  2CV5 D;  3UT9 C;  4YM6 D;  4JJN D;  4XUJ D;  5B40 C;  1F66 B;  2RIQ A;  5AV8 B;  5B32 D;  4EO5 C;  1ZLA A;  5AV9 B;  1M18 B;  3AZF C;  4Z2M G;  3WTP A;  3AN2 D;  1U35 A;  1ID3 B;  2YFV A;  1AOI A;  3TU4 A;  3MGQ C;  2ZY5 A;  3AV2 C;  1ZLA D;  5CPI A;  3AZK B;  4WU8 A;  4H9Q B;  3AFA B;  3A6N B;  1AOI D;  3WTP D;  4NE5 A;  3TU4 D;  1F66 D;  3X1U B;  1TZY B;  5B0Y C;  5CPI D;  4WU8 D;  4HGA C;  3AZL B;  3LEL B;  3WKJ A;  3NQJ B;  1M18 D;  2F8N H;  1KX4 B;  3AZH A;  3UTB C;  2JE5 A;  3WKJ D;  3AZK D;  3MGR A;  5AV5 C;  3A6N D;  5E5A B;  3AZE A;  3AZH D;  3W96 B;  1TZY D;  2Y2M A;  5AVB B;  3MGR D;  3AZL D;  4LD9 A;  4Z5T C;  3AZE D;  2FFF B;  3VH6 A;  4J8X B;  5B31 C;  5B2I C;  3KUY C;  5AVB A;  3R45 B;  2ZM5 A;  5DNM C;  1M1A A;  1P3O B;  5B0Z B;  3B0D B;  3W98 A;  5DNN B;  1EQZ B;  4ZUX C;  1JFI B;  3W96 D;  5B2J B;  5AVB D;  3AZI A;  3REK A;  4H9O B;  4J8X D;  1P3B C;  2F8N B;  2JCH A;  4DRA A;  1KX5 B;  5G49 A;  4DRB A;  1KX3 C;  3LZ1 A;  3AZI D;  4WV4 B;  1P3O D;  5AV6 C;  3C1B A;  1EQZ D;  2LY8 A;  3AZN A;  3C1B D;  2YFW A;  4KHA A;  4H9N B;  5GT0 B;  5CPJ B;  3B6F B;  4YS3 C;  5AV8 C;  3AYW A;  2FJ7 C;  5AV9 C;  1M18 C;  5GSU A;  1P34 B;  1P3P A;  2DF4 C;  1ID3 C;  5F99 B;  3AYW D;  5FUG A;  3AZM B;  5GT0 D;  4UUZ A;  3AFA C;  1P3P D;  5CP6 B;  3REJ B;  3B6F D;  3X1U C;  5GT3 A;  5GXQ A;  4WU9 B;  1P3M C;  3UTA A;  4NE6 A;  3LEL C;  1KX4 C;  1P34 D;  5GXQ D;  5F99 D;  1P3G B;  3REJ A;  3UTA D;  5E5A C;  5CP6 D;  3MGP A;  3REJ D;  3W99 A;  5JRG A;  3AZJ B;  5B1L C;  2PYO B;  3REL B;  5JRG D;  1PZR A;  2G5I C;  1P3G D;  4XZQ A;  4CAY B;  4J8V B;  5AY8 B;  3EPH A;  2ZY3 A;  5B0Z C;  4XZQ D;  5DNN C;  2NQB C;  5BS7 C;  3AZJ D;  1N1J A;  5B2J C;  4KGC A;  2G5H C;  3O62 B;  4H9S C;  3W97 B;  1BH9 B;  2XD1 A;  4J8V D;  1KX5 C;  1B67 A;  4QLC C;  4AWL C;  4Z66 A;  1P3K B;  3MVD B;  5B24 A;  3AZG A;  5BNV B;  3B6G A;  4NE3 A;  4Z66 D;  5B24 D;  5CPJ C;  4KUD A;  3AZG D;  2ZY2 A;  3B6G D;  4H9P B;  3REI C;  4DQY B;  3MVD D;  4KUD D;  3MGQ A;  3AV2 A;  4R8P B;  3AZM C;  5AVC B;  1P3I B;  2CV5 B;  5KDM A;  4YM6 B;  3EPK A;  1P3A C;  5B0Y A;  4WU9 C;  5B1M C;  1BH8 A;  4G92 B;  5BO0 A;  1M19 C;  4R8P D;  5AV5 A;  5CHL B;  5AVC D;  1ZLA B;  1P3I D;  5CPK A;  1U35 B;  3WTP B;  1AOI B;  2YFV B;  4Z2M H;  3TU4 B;  5CPI B;  2PYO C;  4WU8 B;  3REL C;  5CPK D;  2BYK A;  2L5A A;  5AY8 C;  3REH C; 
#chains in the Genus database with same CATH homology
 5B33 C;  3WKJ B;  4ZUX A;  1Q9C A;  1U35 D;  3AZH B;  3FDD A;  3O62 C;  3MGR B;  3W97 C;  3NQU A;  3WA9 C;  3AZE B;  2VQR A;  3WAA B;  1KX3 A;  4WNN A;  4LD9 B;  5AV6 A;  1P3K C;  3LJA C;  3WAA A;  5JA4 A;  3WTP E;  3C1C C;  3MGS A;  2NZD A;  1M1A B;  3W98 B;  3WAA D;  3KFU G;  4X23 A;  3MGS D;  4YS3 A;  3VH6 T;  4LD9 D;  2NZD D;  2FJ7 A;  3AZI B;  3REK B;  4X23 D;  4J8U A;  1TAF A;  5G49 B;  3LZ1 B;  1M1A D;  3C1B B;  3W98 D;  3X1V A;  4J8U D;  2CV5 C;  1B6W A;  4YM6 C;  3AZN B;  1P3M A;  4JJN C;  1T3U A;  4XUJ C;  1Z2C B;  3X1V D;  2YFW B;  4KHA B;  3REK D;  5B32 C;  4G92 C;  3LZ1 D;  3AN2 C;  3AYW B;  1ZLA C;  2RVQ D;  3AZN D;  5GSU B;  1P3P B;  1AOI C;  3WTP C;  5B1L A;  3TU4 C;  1F66 C;  5FUG B;  4WZS B;  5CPI C;  4UUZ B;  3H0M C;  3MNN A;  4WU8 C;  1P3F A;  5GXQ B;  2JSS A;  5GT3 B;  1HTA A;  3UTA B;  3MNN D;  3WKJ C;  2NQB A;  3AZK C;  1HQ3 A;  5GSU D;  5BS7 A;  3A6N C;  1P3F D;  3AZH C;  3X1S B;  1TZY C;  1HQ3 D;  3MGR C;  3AZL C;  1S32 A;  3MGP B;  3AZE C;  3KWQ A;  3W99 B;  5JRG B;  5GT3 D;  4QLC A;  3X1S A;  1S32 D;  3KWQ D;  4XZQ B;  1H3O A;  3X1S D;  1P3L A;  3W96 C;  3LZ0 A;  5AVB C;  4M6B A;  2CWE A;  3MGP D;  3W98 C;  3W99 D;  2Y2J A;  1P3L D;  5BT1 D;  3LZ0 D;  4J8X C;  1N1J B;  4KGC B;  2ARO A;  3REI A;  3AZI C;  1P3O C;  3B0D C;  1EQZ C;  2ARO D;  1R4V A;  3C1B C;  4Z66 B;  1P3A A;  5B24 B;  4KGC D;  3KXB A;  3AZG B;  3B6G B;  3X1T A;  4KUD B;  3VH6 W;  3P5J B;  3KXB D;  1M19 A;  2HIO A;  3A1I A;  4EO5 B;  3X1T D;  4J8W A;  3AV1 A;  3UT9 A;  3AYW C;  5BNX A;  5GT0 C;  2HIO D;  4J8W D;  1P3P C;  5B40 A;  3AV1 D;  3MGQ B;  3AV2 B;  3UT9 D;  3B6F C;  4ZBJ B;  5B31 G;  5B40 D;  5KDM B;  3AZF A;  5B0Y B;  1P34 C;  4UPK A;  3REH A;  2IO5 B;  4HGA B;  5GXQ C;  5F99 C;  5B33 A;  4E45 A;  3UTA C;  1BH8 B;  5BO0 B;  3AZF D;  5CP6 C;  3MGQ D;  3AV2 D;  3REJ C;  5AV5 B;  3WA9 A;  4CSR A;  3EPL A;  5B0Y D;  5JRG C;  5B32 G;  5CPK B;  1P3G C;  3UTB A;  2BYK B;  4XZQ C;  3UTB D;  3C1C A;  1ULY A;  3V9R A;  3AZJ C;  5AV5 D;  4Z5T A;  3KSY A;  4ZUX B;  5B31 A;  2Y2L A;  4Z5T D;  5B2I A;  4J8V C;  3KUY A;  2F8N K;  5DNM A;  3NQU B;  1P3B B;  5B31 D;  5B2I D;  3KUY D;  1KX3 B;  4WNN B;  5AV6 B;  4Z66 C;  3B0C T;  4ZUX D;  1P3B A;  5B24 C;  4JJN A;  4XUJ A;  5JA4 B;  4H9R A;  4G91 B;  3AZG C;  3B6G C;  3MGS B;  2NZD B;  5B32 A;  1P3B D;  2BYM A;  3MVD C;  4KUD C;  1KX3 D;  4X23 B;  4E44 A;  3AN2 A;  4YS3 B;  2Y2Q A;  5AV6 D;  2FJ7 B;  4J8U B;  1TAF B;  1F66 A;  5AV8 A;  4ZBJ C;  5AV9 A;  3X1V B;  1M18 A;  2Y2O A;  4YS3 D;  5AV8 D;  1P3M B;  1ID3 A;  2IO5 C;  2FJ7 D;  5AV9 D;  3AZK A;  4R8P C;  1F1E A;  4H9Q A;  5AVC C;  3A6N A;  3AFA A;  1ID3 D;  1P3I C;  3X1U A;  4WJ3 C;  1TZY A;  3AZL A;  2F8N G;  3LEL A;  3AFA D;  3NQJ A;  1KX4 A;  3X1U D;  1P3M D;  5CPK C;  3VH5 A;  3LEL D;  5B1L B;  3VH5 T;  1KX4 D;  2HUE B;  5E5A A;  3MNN B;  2Y2P A;  3W96 A;  1P3F B;  2W8S A;  1U35 C;  2Y2G A;  5E5A D;  5C3I B;  4NFT A;  2NQB B;  1HQ3 B;  4J8X A;  5B1L D;  3R45 A;  1P3O A;  5B0Z A;  5DNN A;  1S32 B;  1EQZ A;  3KWQ B;  1JFI A;  5B2J A;  4QLC B;  5B0Z D;  4AWL B;  4H9S A;  5DNN D;  2NQB D;  4H9O A;  2F8N A;  5B2J D;  1KX5 A;  3WAA C;  1H3O B;  1P3L B;  4G91 C;  3LZ0 B;  3MGS C;  4LD9 C;  2NZD C;  2F8N D;  1KX5 D;  4X23 C;  4QLC D;  2ARO B;  1KU5 A;  2Y2H A;  3REI B;  4H9N A;  2Y2N A;  5GT0 A;  5CPJ A;  1M1A C;  4J8U C;  3B0C W;  3B6F A;  5CPJ D;  3X1V C;  1W2E A;  3REK C;  1P3A B;  1P34 A;  2Y2K A;  5F99 A;  3KXB B;  3REI D;  5B1M B;  3AZM A;  3LZ1 C;  3X1T B;  5CP6 A;  2RVQ C;  1M19 B;  3AZN C;  3AZM D;  2HIO B;  4J8W B;  4WU9 A;  3AV1 B;  5B1M A;  1BFM A;  3EG5 B;  3UT9 B;  5BNX B;  1P3A D;  1P3G A;  4WU9 D;  5B40 B;  5B1M D;  2Y2I A;  2J8P A;  2BG1 A;  2HUE C;  3MNN C;  1M19 D;  3AZF B;  2DQN C;  5GSU C;  3AZJ A;  1WWS A;  3H0R C;  3REH B;  1P3F C;  5B33 B;  2PYO A;  5C3I C;  3REL A;  1HQ3 C;  3AL0 C;  2F2A C;  4CAY A;  4J8V A;  5AY8 A;  2ZY4 A;  2PYO D;  5GT3 C;  3REL D;  3WA9 B;  4CSR B;  1S32 C;  5AY8 D;  3KWQ C;  3VH5 W;  3REH D;  3UTB B;  5B33 D;  3O62 A;  3X1S C;  3W97 A;  1BH9 A;  3LJA B;  3MGP C;  3W99 C;  3C1C B;  3O62 D;  1P3L C;  3V9R B;  5BT1 C;  3LZ0 C;  4Z5T B;  3W97 D;  3F6T A;  3WA9 D;  1P3K A;  3MVD A;  3LJA A;  5B31 B;  3A1K A;  5B2I B;  5BNV A;  3KUY B;  2ARO C;  3B0B A;  1P3K D;  5DNM B;  3LJA D;  3C1C D;  4H9P A;  1WWI A;  4KGC C;  3EPJ A;  4JJN B;  4XUJ B;  4H9R B;  3KXB C;  2XD5 A;  5DNM D;  4R8P A;  5B32 B;  5AVC A;  3H0L C;  3X1T C;  2BYM B;  2CV5 A;  1P3I A;  2UWX A;  4YM6 A;  3IP4 C;  3AN2 B;  2HIO C;  4J8W C;  3AV1 C;  1A7W A;  2CV5 D;  3UT9 C;  4YM6 D;  4JJN D;  4XUJ D;  5B40 C;  1F66 B;  2RIQ A;  5AV8 B;  5B32 D;  4EO5 C;  1ZLA A;  5AV9 B;  1M18 B;  3AZF C;  4Z2M G;  3WTP A;  3AN2 D;  1U35 A;  1ID3 B;  2YFV A;  1AOI A;  3TU4 A;  3MGQ C;  2ZY5 A;  3AV2 C;  1ZLA D;  5CPI A;  3AZK B;  4WU8 A;  4H9Q B;  3AFA B;  3A6N B;  1AOI D;  3WTP D;  4NE5 A;  3TU4 D;  1F66 D;  3X1U B;  1TZY B;  5B0Y C;  5CPI D;  4WU8 D;  4HGA C;  3AZL B;  3LEL B;  3WKJ A;  3NQJ B;  1M18 D;  2F8N H;  1KX4 B;  3AZH A;  3UTB C;  2JE5 A;  3WKJ D;  3AZK D;  3MGR A;  5AV5 C;  3A6N D;  5E5A B;  3AZE A;  3AZH D;  3W96 B;  1TZY D;  2Y2M A;  5AVB B;  3MGR D;  3AZL D;  4LD9 A;  4Z5T C;  3AZE D;  2FFF B;  3VH6 A;  4J8X B;  5B31 C;  5B2I C;  3KUY C;  5AVB A;  3R45 B;  2ZM5 A;  5DNM C;  1M1A A;  1P3O B;  5B0Z B;  3B0D B;  3W98 A;  5DNN B;  1EQZ B;  4ZUX C;  1JFI B;  3W96 D;  5B2J B;  5AVB D;  3AZI A;  3REK A;  4H9O B;  4J8X D;  1P3B C;  2F8N B;  2JCH A;  4DRA A;  1KX5 B;  5G49 A;  4DRB A;  1KX3 C;  3LZ1 A;  3AZI D;  4WV4 B;  1P3O D;  5AV6 C;  3C1B A;  1EQZ D;  2LY8 A;  3AZN A;  3C1B D;  2YFW A;  4KHA A;  4H9N B;  5GT0 B;  5CPJ B;  3B6F B;  4YS3 C;  5AV8 C;  3AYW A;  2FJ7 C;  5AV9 C;  1M18 C;  5GSU A;  1P34 B;  1P3P A;  2DF4 C;  1ID3 C;  5F99 B;  3AYW D;  5FUG A;  3AZM B;  5GT0 D;  4UUZ A;  3AFA C;  1P3P D;  5CP6 B;  3REJ B;  3B6F D;  3X1U C;  5GT3 A;  5GXQ A;  4WU9 B;  1P3M C;  3UTA A;  4NE6 A;  3LEL C;  1KX4 C;  1P34 D;  5GXQ D;  5F99 D;  1P3G B;  3REJ A;  3UTA D;  5E5A C;  5CP6 D;  3MGP A;  3REJ D;  3W99 A;  5JRG A;  3AZJ B;  5B1L C;  2PYO B;  3REL B;  5JRG D;  1PZR A;  2G5I C;  1P3G D;  4XZQ A;  4CAY B;  4J8V B;  5AY8 B;  3EPH A;  2ZY3 A;  5B0Z C;  4XZQ D;  5DNN C;  2NQB C;  5BS7 C;  3AZJ D;  1N1J A;  5B2J C;  4KGC A;  2G5H C;  3O62 B;  4H9S C;  3W97 B;  1BH9 B;  2XD1 A;  4J8V D;  1KX5 C;  1B67 A;  4QLC C;  4AWL C;  4Z66 A;  1P3K B;  3MVD B;  5B24 A;  3AZG A;  5BNV B;  3B6G A;  4NE3 A;  4Z66 D;  5B24 D;  5CPJ C;  4KUD A;  3AZG D;  2ZY2 A;  3B6G D;  4H9P B;  3REI C;  4DQY B;  3MVD D;  4KUD D;  3MGQ A;  3AV2 A;  4R8P B;  3AZM C;  5AVC B;  1P3I B;  2CV5 B;  5KDM A;  4YM6 B;  3EPK A;  1P3A C;  5B0Y A;  4WU9 C;  5B1M C;  1BH8 A;  4G92 B;  5BO0 A;  1M19 C;  4R8P D;  5AV5 A;  5CHL B;  5AVC D;  1ZLA B;  1P3I D;  5CPK A;  1U35 B;  3WTP B;  1AOI B;  2YFV B;  4Z2M H;  3TU4 B;  5CPI B;  2PYO C;  4WU8 B;  3REL C;  5CPK D;  2BYK A;  2L5A A;  5AY8 C;  3REH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...