2FJ7C

Crystal structure of nucleosome core particle containing a poly (da.dt) sequence element
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
107
structure length
107
Chain Sequence
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords 147 bp DNA containing 16 bp poly dA element
publication title Nucleosome Core Particles Containing a Poly(dA.dT) Sequence Element Exhibit a Locally Distorted DNA Structure.
pubmed doi rcsb
source organism Xenopus laevis
total genus 23
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2005-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2fj7C00
3AN2B 3AZJB 4LD9B 4QLCB 4KUDA 3UT9B 4YM6A 5CPKB 1HQ3D 3AV2A 2CV5D 2HUEC 4ZBJB 5AVCD 4JJNC 3REKB 3KSYA 4X23D 2AROB 3AZGA 5B0ZC 5CHLB 1H3OA 5AV6D 5B33C 2FJ7A 3MVDB 1TZYD 1P3FB 2PYOC 3AFAA 4J8UC 3WA9C 1P3MD 3MGQD 3LJAC 4KGCC 3X1UD 3REHA 3LZ0A 1F66C 2HUEB 1Q9CA 4JJNB 3RELC 5CPIC 5GT3A 3AZLC 4WNNA 5B0ZB 3AYWD 4Z5TC 5B33B 1P3PA 5B24A 3AZEA 1P3GD 2PYOB 4J8UB 3B6FC 3WA9B 1U35D 3A6ND 3MGSA 3LJAB 4KGCB 3MGPA 3X1SC 5AV8C 1F66B 3RELB 3B0DC 5CP6C 5CPIB 3W98A 4Z66D 3AZLB 5DNMD 1M1AD 3C1CD 4Z5TB 4J8WD 5B1MA 5AVBA 3AN2D 3AZJD 3B6FB 4QLCD 4LD9D 3B6GC 5B2JC 5CPKD 4H9RA 3MGRC 2JSSA 4KHAB 3AZFA 3REKD 5E5AC 4UUZB 3X1SB 3TU4C 1S32A 5AV8B 2AROD 4DRAA 3B0DB 4R8PC 5B2IC 5CP6B 4ZUXC 4J8VC 3R45A 4XUJA 3MNNC 3MVDD 3AZNC 2HIOA 4WU9A 5CPJC 1P3FD 3KXBA 3C1BC 5GT0C 5AV9C 3B0BA 5B32G 2F8NH 3W97A 3B6GB 5B2JB 2NZDC 3MGRB 5JRGC 5FUGA 5B31C 4JJND 4CSRA 5E5AB 5BS7A 3KWQC 3W96A 3TU4B 3REJA 3LELC 5B2IB 5B0ZD 4R8PB 5GXQA 1KX4C 5B33D 4ZUXB 4J8VB 3AZNB 3MNNB 4Z2MH 5CPJB 3WKJC 5AV5C 4E45A 2PYOD 4J8UD 1KX3A 3WA9D 3C1BB 3AZHA 5GT0B 3VH6A 5AV9B 3LJAD 4H9NB 2NZDB 2CV5A 5JRGB 5AVCA 3WTPA 5B31B 1F66D 5BO0B 3RELD 5CPID 5G49A 3KWQB 1KX5A 5B1LA 3AZLD 3LELB 5BNXA 1KX4B 4Z5TD 3O62A 1BH8B 1TZYA 1P3IC 1ZLAC 3WKJB 3UTAA 5AV5B 1M18C 3B6FD 1P3LA 4E44A 3WAAA 4H9QB 2NQBC 5GSUC 3X1SD 5AV8D 3NQUB 5CP6D 5C3IC 4YM6C 1B6WA 4J8XC 3X1VA 2LY8A 1P3IB 1P3BA 1ZLAB 1P3AC 3W99C 4G92B 1M18B 1U35A 5B32A 1P3KA 3B6GD 2FJ7C 5B2JD 1WWIA 3MGRD 3B0CW 3AFAC 2L5AA 5E5AD 4M6BA 5GSUB 3AZMA 3TU4D 5B2ID 4R8PD 5C3IB 4YM6B 1P3OA 3REHC 1ID3A 4ZUXD 5AY8C 4J8VD 3MNND 3LZ0C 3AZND 4J8XB 4J8WA 5CPJD 3AZKA 3C1BD 5GT3C 3AN2A 4NFTA 5GT0D 1P3AB 3W99B 5BT1C 2F8NK 3AV1C 2FJ7B 1P3PC 5B24C 5JRGD 4AWLC 5B31D 3AFAB 2F8NB 5B40C 3MGSC 3KWQD 3LELD 1KX4D 3REHB 3UTBC 3VH5W 5AY8B 3LZ0B 3WKJD 5AV5D 3W98C 5GT3B 4WNNB 3AV1B 1P3PB 5B1MC 4H9PA 5B24B 5AVBC 4CAYA 3LZ1A 4JJNA 4AWLB 5B40B 3MGSB 5B0ZA 1P34A 3WTPE 3UTBB 3B0CT 1P3ID 5F99A 1ZLAD 2BYMB 2PYOA 2RVQC 5DNNA 5B0YA 3WA9A 1M18D 1EQZA 3W98B 2CWEA 3NQJA 4WU9C 3LJAA 2HIOC 3UT9D 4XZQA 3KXBC 3AZIA 5B1MB 5AVBB 5GSUD 4WV4B 3RELA 5CPIA 5JA4B 1AOIC 3W97C 4YM6D 3KUYA 4H9RB 3AZLA 4J8XD 5BS7C 3W96C 1P3AD 3B6FA 3W99D 5GXQC 2BYKA 2FJ7D 5KDMA 3R45B 4WU9B 2HIOB 4WU8A 3VH5T 3KXBB 4UUZA 3AFAD 2F8ND 3X1SA 3AZHC 5BNVA 1AOIB 3W97B 3REHD 4H9OA 5AY8D 1M19A 3LZ0D 5AVCC 5FUGB 3WTPC 3X1TC 4CSRB 1TAFA 5GT3D 3W96B 1KX5C 5B1LC 4YS3C 5BT1D 3AV1D 5GXQB 3O62C 1TZYC 3MGRA 5B24D 1N1JB 4KGCD 1HQ3A 3UTAC 2YFVA 3AZHB 1P3LC 5B40D 3MGSD 3WAAC 4X23A 4J8VA 3UTBD 4H9SA 5AV6A 3WTPB 3X1TB 3W98D 1KX5B 5B1LB 1P3MA 4YS3B 3MGQA 3X1VC 4H9NA 3REIC 3O62B 1TZYB 1B67A 3X1UA 5JRGA 5B1MD 1P3BC 3VH6W 5AVBD 2F8NG 3UTAB 5B32C 1P3KC 1P3LB 4NE3A 4KUDC 3WAAB 1KX4A 3AYWA 3AV2C 3AZMC 5AV5A 4G91C 2RVQD 1ID3C 1P3OC 1P3GA 4Z2MG 3AZGC 4WU9D 3A6NA 2HIOD 3X1VB 3REIB 1BH9A 3KXBD 3AZKC 1P3BB 2NQBB 5B32B 1P3KB 1AOID 2YFWA 3W97D 1JFIA 4KUDB 4Z66A 5DNMA 1M1AA 3AV2B 3V9RA 3C1CA 3AZMB 1M18A 3W96D 4G91B 1ID3B 5GXQD 5AV9D 4QLCA 3AZJA 1P3OB 4LD9A 3UT9A 3AZGB 1BFMA 5CPKA 1H3OB 4NE6A 3AZKB 2NZDD 3AZEC 1KU5A 3REKA 3AZHD 2AROA 4J8XA 3LZ1C 3VH5A 3WTPD 3MVDA 3MGPC 3X1TD 3VH6T 1P3AA 1P3FA 3W99A 1WWSA 1KX5D 5B1LD 1P34C 4YS3D 3O62D 5F99C 2F8NA 5DNNC 5B0YC 3UTAD 1EQZC 3AZEB 1P3LD 3WAAD 4XZQC 5AY8A 3AZIC 4H9PB 5B33A 4CAYB 3LZ1B 3AZFC 3MGPB 1S32C 3KUYC 4J8UA 3AV1A 1P34B 3X1VD 3REID 4XUJC 4KGCA 4DRBA 1P3BD 5F99B 5DNNB 5B0YB 2NQBD 5B32D 5B40A 5B31G 1P3KD 1EQZB 1F66A 3NQJB 4EO5C 4KUDD 4NE5A 4XZQB 4WU8C 3UTBA 3AZIB 3AV2D 2BYMA 4Z5TA 3AZMD 3AZFB 1ID3D 1S32B 1P3OD 3KUYB 3REJC 3AZGD 1M19C 3AZKD 4XUJB 4KHAA 5JA4A 1KX3C 1A7WA 5AV8A 2BYKB 4EO5B 5KDMB 5CP6A 4WU8B 1HQ3C 2CV5C 5BNVB 4X23C 3REJB 3B6GA 4H9SC 4H9OB 1M19B 5AV6C 5B2JA 1P3PD 1TAFB 3AZED 5E5AA 1AOIA 1P3MC 1KX3B 3MGQC 2IO5C 3TU4A 4WZSB 5B2IA 4R8PA 1HTAA 3X1UC 4ZUXA 3LZ1D 1HQ3B 4HGAC 3MNNA 3AZNA 2YFVB 2CV5B 3MGPD 5CPJA 1ULYA 5AVCB 3C1BA 1P34D 1R4VA 5G49B 5GT0A 5AV9A 4X23B 3AYWC 1N1JA 5AV6B 5F99D 5BNXB 2NZDA 1F1EA 5DNND 5B0YD 1EQZD 1P3GC 5B31A 5BO0A 1U35C 1P3MB 3A6NC 3MGQB 3KWQA 4XZQD 2IO5B 3LELA 3AZID 3X1UB 1BH8A 3X1TA 4HGAB 3AZFD 3WKJA 1S32D 3KUYD 4YS3A 4Z66C 5DNMC 1M1AC 3AYWB 4XUJD 3C1CC 4H9QA 4J8WC 4G92C 3AN2C 3AZJC 1P3GB 4QLCC 4LD9C 3NQUA 3UT9C 1U35B 3A6NB 5CPKC 4WU8D 1BH9B 4ZBJC 3REKC 1P3IA 1ZLAA 2YFWB 1JFIB 2AROC 3REJD 1M19D 4Z66B 3REIA 3MVDC 5DNMB 1M1AB 3V9RB 1P3FC 3C1CB 4J8WB 2NQBA 1KX3D 5GSUA
chains in the Genus database with same CATH superfamily
3AN2B 3AZJB 4LD9B 4QLCB 4KUDA 3UT9B 4YM6A 5CPKB 1HQ3D 3AV2A 2CV5D 2RIQA 2HUEC 4ZBJB 5AVCD 1PZRA 4JJNC 3KSYA 3REKB 4X23D 2AROB 3AZGA 5B0ZC 5CHLB 1H3OA 5AV6D 5B33C 2FJ7A 4DQYB 3MVDB 1TZYD 1P3FB 2PYOC 3AFAA 2W8SA 4J8UC 3WA9C 1P3MD 3MGQD 3EPLA 3LJAC 4KGCC 3X1UD 3REHA 3LZ0A 1F66C 2HUEB 1Q9CA 4JJNB 3RELC 5CPIC 5GT3A 3AZLC 4WNNA 2UWXA 5B0ZB 3AYWD 4Z5TC 5B33B 1P3PA 5B24A 3AZEA 1P3GD 2PYOB 4J8UB 3B6FC 3WA9B 1U35D 3A6ND 3MGSA 3H0MC 3LJAB 4KGCB 3MGPA 2Y2PA 3X1SC 5AV8C 1F66B 3RELB 3B0DC 5CP6C 2Y2QA 5CPIB 3W98A 4Z66D 3AZLB 5DNMD 1M1AD 2BG1A 3C1CD 4Z5TB 4J8WD 5B1MA 5AVBA 3AN2D 3AZJD 3B6FB 4QLCD 4LD9D 3B6GC 5B2JC 5CPKD 4H9RA 3MGRC 2JSSA 4KHAB 3AZFA 3REKD 5E5AC 4UUZB 3X1SB 3TU4C 1S32A 5AV8B 2AROD 4DRAA 3B0DB 4R8PC 5B2IC 5CP6B 4ZUXC 4J8VC 3R45A 4XUJA 3MNNC 3MVDD 3AZNC 2HIOA 4WU9A 5CPJC 1P3FD 3KXBA 3C1BC 5GT0C 5AV9C 3B0BA 5B32G 2F8NH 3W97A 3B6GB 5B2JB 2NZDC 3MGRB 5JRGC 5FUGA 5B31C 4JJND 4CSRA 5E5AB 5BS7A 4WJ3C 3KWQC 3W96A 3TU4B 3REJA 2DQNC 3LELC 5B2IB 5B0ZD 4R8PB 5GXQA 1KX4C 5B33D 4ZUXB 4J8VB 3AZNB 3MNNB 4Z2MH 5CPJB 3WKJC 5AV5C 4E45A 2PYOD 4J8UD 1KX3A 3WA9D 2Y2IA 3C1BB 3AZHA 5GT0B 3VH6A 5AV9B 3LJAD 4H9NB 2NZDB 2CV5A 2JCHA 5JRGB 5AVCA 2DF4C 3WTPA 5B31B 1F66D 5BO0B 3RELD 5CPID 5G49A 3KWQB 1KX5A 5B1LA 3AZLD 3LELB 5BNXA 1KX4B 4Z5TD 3O62A 1BH8B 1TZYA 1P3IC 3H0RC 1ZLAC 3F6TA 3WKJB 3UTAA 5AV5B 1M18C 3B6FD 1P3LA 4E44A 3WAAA 4H9QB 2NQBC 5GSUC 3X1SD 5AV8D 3P5JB 3NQUB 5CP6D 5C3IC 4YM6C 1B6WA 2ZY4A 4J8XC 3X1VA 2LY8A 1P3IB 1P3BA 1ZLAB 1P3AC 3W99C 4G92B 1M18B 1U35A 5B32A 1P3KA 3B6GD 2FJ7C 5B2JD 1WWIA 3MGRD 3B0CW 3AFAC 2L5AA 5E5AD 4M6BA 5GSUB 3AZMA 3TU4D 5B2ID 4R8PD 5C3IB 4YM6B 1P3OA 3REHC 1ID3A 4ZUXD 5AY8C 4J8VD 3MNND 3LZ0C 3AZND 4J8XB 4J8WA 5CPJD 3AZKA 3C1BD 5GT3C 3AN2A 4NFTA 5GT0D 1P3AB 3W99B 5BT1C 2F8NK 3AV1C 2FJ7B 1P3PC 5B24C 5JRGD 4AWLC 5B31D 3AFAB 2F8NB 3A1KA 5B40C 3MGSC 3KWQD 3LELD 1KX4D 3REHB 3UTBC 3VH5W 2XD5A 5AY8B 3LZ0B 3WKJD 5AV5D 3W98C 1W2EA 5GT3B 4WNNB 3AV1B 1P3PB 5B1MC 4H9PA 5B24B 5AVBC 4CAYA 3LZ1A 4JJNA 4AWLB 5B40B 3MGSB 5B0ZA 1P34A 3WTPE 3UTBB 3B0CT 1P3ID 5F99A 1ZLAD 2BYMB 2PYOA 2RVQC 5DNNA 5B0YA 2ZM5A 1M18D 3WA9A 1EQZA 3W98B 2CWEA 3NQJA 4WU9C 3LJAA 2HIOC 3UT9D 4XZQA 3KXBC 3AZIA 5B1MB 5AVBB 5GSUD 4WV4B 3RELA 5CPIA 5JA4B 1AOIC 3W97C 4YM6D 3KUYA 4H9RB 3AZLA 4J8XD 5BS7C 2Y2NA 3W96C 1P3AD 3B6FA 3W99D 5GXQC 2BYKA 2FJ7D 5KDMA 3R45B 2Y2HA 4WU9B 2HIOB 3EPJA 4WU8A 3VH5T 3KXBB 4UUZA 3AFAD 2F8ND 3X1SA 3AZHC 5BNVA 1AOIB 3W97B 3REHD 4H9OA 5AY8D 1M19A 3LZ0D 5AVCC 5FUGB 3WTPC 3X1TC 4CSRB 1TAFA 5GT3D 3W96B 1KX5C 5B1LC 4YS3C 5BT1D 3AV1D 5GXQB 3O62C 1TZYC 3MGRA 5B24D 1N1JB 4KGCD 1HQ3A 3UTAC 2YFVA 3AZHB 1P3LC 5B40D 3MGSD 3WAAC 4X23A 4J8VA 3UTBD 4H9SA 5AV6A 3WTPB 3X1TB 3W98D 1KX5B 5B1LB 1P3MA 4YS3B 3MGQA 3X1VC 3A1IA 4H9NA 3REIC 3O62B 3KFUG 1TZYB 2Y2JA 1B67A 3X1UA 2ZY3A 5B1MD 5JRGA 1P3BC 3VH6W 5AVBD 2F8NG 3UTAB 5B32C 1P3KC 1P3LB 4NE3A 4KUDC 3WAAB 1KX4A 3AYWA 3AV2C 3AZMC 5AV5A 2G5IC 2ZY2A 4G91C 2RVQD 1ID3C 1P3OC 1P3GA 4Z2MG 3AZGC 4WU9D 3A6NA 2HIOD 3X1VB 3REIB 1BH9A 3KXBD 3AZKC 1P3BB 2NQBB 5B32B 1P3KB 1AOID 2YFWA 3W97D 1JFIA 4KUDB 4Z66A 5DNMA 1M1AA 3AV2B 3V9RA 3C1CA 3AZMB 1M18A 3W96D 4G91B 2J8PA 1ID3B 5GXQD 5AV9D 4QLCA 3AZJA 1P3OB 4LD9A 3UT9A 3AZGB 1BFMA 5CPKA 1H3OB 2F2AC 4NE6A 3AZKB 2NZDD 3AZEC 2Y2GA 1KU5A 3REKA 3AZHD 2AROA 4J8XA 3LZ1C 2Y2LA 3VH5A 3WTPD 3MVDA 3MGPC 3X1TD 3VH6T 1P3AA 1P3FA 3W99A 1WWSA 1KX5D 5B1LD 1P34C 4YS3D 3O62D 5F99C 2F8NA 5DNNC 5B0YC 3UTAD 1EQZC 3AZEB 1P3LD 2Y2OA 3WAAD 4XZQC 5AY8A 3AZIC 4H9PB 5B33A 4CAYB 3LZ1B 3AZFC 3MGPB 1S32C 3KUYC 4J8UA 3AV1A 1P34B 3X1VD 3REID 4XUJC 1Z2CB 4DRBA 4KGCA 1P3BD 2XD1A 3IP4C 5F99B 5DNNB 5B0YB 2NQBD 2Y2KA 5B32D 5B40A 5B31G 1P3KD 1EQZB 1F66A 3NQJB 4EO5C 4KUDD 2FFFB 4NE5A 4XZQB 4WU8C 3UTBA 3EG5B 3AL0C 3AZIB 3AV2D 2BYMA 4Z5TA 3AZMD 3AZFB 1ID3D 1S32B 1P3OD 3KUYB 3REJC 3AZGD 1M19C 2G5HC 3AZKD 4XUJB 4KHAA 5JA4A 1KX3C 1A7WA 5AV8A 2BYKB 2Y2MA 4EO5B 5KDMB 5CP6A 4WU8B 1HQ3C 2VQRA 2CV5C 3H0LC 5BNVB 4X23C 3REJB 3B6GA 4H9SC 4H9OB 1M19B 5AV6C 5B2JA 1P3PD 2ZY5A 1TAFB 3AZED 5E5AA 1AOIA 1P3MC 1KX3B 3MGQC 2IO5C 3TU4A 4WZSB 5B2IA 4R8PA 1T3UA 1HTAA 3X1UC 4ZUXA 3LZ1D 1HQ3B 4HGAC 3MNNA 3AZNA 2YFVB 2CV5B 3MGPD 3EPHA 5CPJA 1ULYA 5AVCB 3C1BA 1P34D 1R4VA 5G49B 5GT0A 5AV9A 4X23B 3AYWC 1N1JA 5AV6B 5F99D 5BNXB 2NZDA 1F1EA 5DNND 5B0YD 1EQZD 1P3GC 5B31A 5BO0A 1U35C 1P3MB 3A6NC 3MGQB 3KWQA 4XZQD 2IO5B 3LELA 3AZID 3X1UB 1BH8A 3X1TA 4HGAB 3AZFD 3FDDA 3WKJA 1S32D 3KUYD 4YS3A 4Z66C 5DNMC 1M1AC 3AYWB 4XUJD 3C1CC 4H9QA 4J8WC 4G92C 3AN2C 3AZJC 1P3GB 4QLCC 4LD9C 3NQUA 3UT9C 2JE5A 1U35B 3A6NB 4UPKA 5CPKC 4WU8D 1BH9B 3EPKA 4ZBJC 3REKC 1P3IA 1ZLAA 2YFWB 1JFIB 2AROC 3REJD 1M19D 4Z66B 3REIA 3MVDC 5DNMB 1M1AB 3V9RB 1P3FC 3C1CB 4J8WB 2NQBA 1KX3D 5GSUA
chains in the Genus database with same CATH topology
3AN2B 3AZJB 4LD9B 4QLCB 4KUDA 3UT9B 4YM6A 5CPKB 1HQ3D 3AV2A 2CV5D 2RIQA 2HUEC 4ZBJB 5AVCD 1PZRA 4JJNC 3KSYA 3REKB 4X23D 2AROB 3AZGA 5B0ZC 5CHLB 1H3OA 5AV6D 5B33C 2FJ7A 4DQYB 3MVDB 1TZYD 1P3FB 2PYOC 3AFAA 2W8SA 4J8UC 3WA9C 1P3MD 3MGQD 3EPLA 3LJAC 4KGCC 3X1UD 3REHA 3LZ0A 1F66C 2HUEB 1Q9CA 4JJNB 3RELC 5CPIC 5GT3A 3AZLC 4WNNA 2UWXA 5B0ZB 3AYWD 4Z5TC 5B33B 1P3PA 5B24A 3AZEA 1P3GD 2PYOB 4J8UB 3B6FC 3WA9B 1U35D 3A6ND 3MGSA 3H0MC 3LJAB 4KGCB 3MGPA 2Y2PA 3X1SC 5AV8C 1F66B 3RELB 3B0DC 5CP6C 2Y2QA 5CPIB 3W98A 4Z66D 3AZLB 5DNMD 1M1AD 2BG1A 3C1CD 4Z5TB 4J8WD 5B1MA 5AVBA 3AN2D 3AZJD 3B6FB 4QLCD 4LD9D 3B6GC 5B2JC 5CPKD 4H9RA 3MGRC 2JSSA 4KHAB 3AZFA 3REKD 5E5AC 4UUZB 3X1SB 3TU4C 1S32A 5AV8B 2AROD 4DRAA 3B0DB 4R8PC 5B2IC 5CP6B 4ZUXC 4J8VC 3R45A 4XUJA 3MNNC 3MVDD 3AZNC 2HIOA 4WU9A 5CPJC 1P3FD 3KXBA 3C1BC 5GT0C 5AV9C 3B0BA 5B32G 2F8NH 3W97A 3B6GB 5B2JB 2NZDC 3MGRB 5JRGC 5FUGA 5B31C 4JJND 4CSRA 5E5AB 5BS7A 4WJ3C 3KWQC 3W96A 3TU4B 3REJA 2DQNC 3LELC 5B2IB 5B0ZD 4R8PB 5GXQA 1KX4C 5B33D 4ZUXB 4J8VB 3AZNB 3MNNB 4Z2MH 5CPJB 3WKJC 5AV5C 4E45A 2PYOD 4J8UD 1KX3A 3WA9D 2Y2IA 3C1BB 3AZHA 5GT0B 3VH6A 5AV9B 3LJAD 4H9NB 2NZDB 2CV5A 2JCHA 5JRGB 5AVCA 2DF4C 3WTPA 5B31B 1F66D 5BO0B 3RELD 5CPID 5G49A 3KWQB 1KX5A 5B1LA 3AZLD 3LELB 5BNXA 1KX4B 4Z5TD 3O62A 1BH8B 1TZYA 1P3IC 3H0RC 1ZLAC 3F6TA 3WKJB 3UTAA 5AV5B 1M18C 3B6FD 1P3LA 4E44A 3WAAA 4H9QB 2NQBC 5GSUC 3X1SD 5AV8D 3P5JB 3NQUB 5CP6D 5C3IC 4YM6C 1B6WA 2ZY4A 4J8XC 3X1VA 2LY8A 1P3IB 1P3BA 1ZLAB 1P3AC 3W99C 4G92B 1M18B 1U35A 5B32A 1P3KA 3B6GD 2FJ7C 5B2JD 1WWIA 3MGRD 3B0CW 3AFAC 2L5AA 5E5AD 4M6BA 5GSUB 3AZMA 3TU4D 5B2ID 4R8PD 5C3IB 4YM6B 1P3OA 3REHC 1ID3A 4ZUXD 5AY8C 4J8VD 3MNND 3LZ0C 3AZND 4J8XB 4J8WA 5CPJD 3AZKA 3C1BD 5GT3C 3AN2A 4NFTA 5GT0D 1P3AB 3W99B 5BT1C 2F8NK 3AV1C 2FJ7B 1P3PC 5B24C 5JRGD 4AWLC 5B31D 3AFAB 2F8NB 3A1KA 5B40C 3MGSC 3KWQD 3LELD 1KX4D 3REHB 3UTBC 3VH5W 2XD5A 5AY8B 3LZ0B 3WKJD 5AV5D 3W98C 1W2EA 5GT3B 4WNNB 3AV1B 1P3PB 5B1MC 4H9PA 5B24B 5AVBC 4CAYA 3LZ1A 4JJNA 4AWLB 5B40B 3MGSB 5B0ZA 1P34A 3WTPE 3UTBB 3B0CT 1P3ID 5F99A 1ZLAD 2BYMB 2PYOA 2RVQC 5DNNA 5B0YA 2ZM5A 1M18D 3WA9A 1EQZA 3W98B 2CWEA 3NQJA 4WU9C 3LJAA 2HIOC 3UT9D 4XZQA 3KXBC 3AZIA 5B1MB 5AVBB 5GSUD 4WV4B 3RELA 5CPIA 5JA4B 1AOIC 3W97C 4YM6D 3KUYA 4H9RB 3AZLA 4J8XD 5BS7C 2Y2NA 3W96C 1P3AD 3B6FA 3W99D 5GXQC 2BYKA 2FJ7D 5KDMA 3R45B 2Y2HA 4WU9B 2HIOB 3EPJA 4WU8A 3VH5T 3KXBB 4UUZA 3AFAD 2F8ND 3X1SA 3AZHC 5BNVA 1AOIB 3W97B 3REHD 4H9OA 5AY8D 1M19A 3LZ0D 5AVCC 5FUGB 3WTPC 3X1TC 4CSRB 1TAFA 5GT3D 3W96B 1KX5C 5B1LC 4YS3C 5BT1D 3AV1D 5GXQB 3O62C 1TZYC 3MGRA 5B24D 1N1JB 4KGCD 1HQ3A 3UTAC 2YFVA 3AZHB 1P3LC 5B40D 3MGSD 3WAAC 4X23A 4J8VA 3UTBD 4H9SA 5AV6A 3WTPB 3X1TB 3W98D 1KX5B 5B1LB 1P3MA 4YS3B 3MGQA 3X1VC 3A1IA 4H9NA 3REIC 3O62B 3KFUG 1TZYB 2Y2JA 1B67A 3X1UA 2ZY3A 5B1MD 5JRGA 1P3BC 3VH6W 5AVBD 2F8NG 3UTAB 5B32C 1P3KC 1P3LB 4NE3A 4KUDC 3WAAB 1KX4A 3AYWA 3AV2C 3AZMC 5AV5A 2G5IC 2ZY2A 4G91C 2RVQD 1ID3C 1P3OC 1P3GA 4Z2MG 3AZGC 4WU9D 3A6NA 2HIOD 3X1VB 3REIB 1BH9A 3KXBD 3AZKC 1P3BB 2NQBB 5B32B 1P3KB 1AOID 2YFWA 3W97D 1JFIA 4KUDB 4Z66A 5DNMA 1M1AA 3AV2B 3V9RA 3C1CA 3AZMB 1M18A 3W96D 4G91B 2J8PA 1ID3B 5GXQD 5AV9D 4QLCA 3AZJA 1P3OB 4LD9A 3UT9A 3AZGB 1BFMA 5CPKA 1H3OB 2F2AC 4NE6A 3AZKB 2NZDD 3AZEC 2Y2GA 1KU5A 3REKA 3AZHD 2AROA 4J8XA 3LZ1C 2Y2LA 3VH5A 3WTPD 3MVDA 3MGPC 3X1TD 3VH6T 1P3AA 1P3FA 3W99A 1WWSA 1KX5D 5B1LD 1P34C 4YS3D 3O62D 5F99C 2F8NA 5DNNC 5B0YC 3UTAD 1EQZC 3AZEB 1P3LD 2Y2OA 3WAAD 4XZQC 5AY8A 3AZIC 4H9PB 5B33A 4CAYB 3LZ1B 3AZFC 3MGPB 1S32C 3KUYC 4J8UA 3AV1A 1P34B 3X1VD 3REID 4XUJC 1Z2CB 4DRBA 4KGCA 1P3BD 2XD1A 3IP4C 5F99B 5DNNB 5B0YB 2NQBD 2Y2KA 5B32D 5B40A 5B31G 1P3KD 1EQZB 1F66A 3NQJB 4EO5C 4KUDD 2FFFB 4NE5A 4XZQB 4WU8C 3UTBA 3EG5B 3AL0C 3AZIB 3AV2D 2BYMA 4Z5TA 3AZMD 3AZFB 1ID3D 1S32B 1P3OD 3KUYB 3REJC 3AZGD 1M19C 2G5HC 3AZKD 4XUJB 4KHAA 5JA4A 1KX3C 1A7WA 5AV8A 2BYKB 2Y2MA 4EO5B 5KDMB 5CP6A 4WU8B 1HQ3C 2VQRA 2CV5C 3H0LC 5BNVB 4X23C 3REJB 3B6GA 4H9SC 4H9OB 1M19B 5AV6C 5B2JA 1P3PD 2ZY5A 1TAFB 3AZED 5E5AA 1AOIA 1P3MC 1KX3B 3MGQC 2IO5C 3TU4A 4WZSB 5B2IA 4R8PA 1T3UA 1HTAA 3X1UC 4ZUXA 3LZ1D 1HQ3B 4HGAC 3MNNA 3AZNA 2YFVB 2CV5B 3MGPD 3EPHA 5CPJA 1ULYA 5AVCB 3C1BA 1P34D 1R4VA 5G49B 5GT0A 5AV9A 4X23B 3AYWC 1N1JA 5AV6B 5F99D 5BNXB 2NZDA 1F1EA 5DNND 5B0YD 1EQZD 1P3GC 5B31A 5BO0A 1U35C 1P3MB 3A6NC 3MGQB 3KWQA 4XZQD 2IO5B 3LELA 3AZID 3X1UB 1BH8A 3X1TA 4HGAB 3AZFD 3FDDA 3WKJA 1S32D 3KUYD 4YS3A 4Z66C 5DNMC 1M1AC 3AYWB 4XUJD 3C1CC 4H9QA 4J8WC 4G92C 3AN2C 3AZJC 1P3GB 4QLCC 4LD9C 3NQUA 3UT9C 2JE5A 1U35B 3A6NB 4UPKA 5CPKC 4WU8D 1BH9B 3EPKA 4ZBJC 3REKC 1P3IA 1ZLAA 2YFWB 1JFIB 2AROC 3REJD 1M19D 4Z66B 3REIA 3MVDC 5DNMB 1M1AB 3V9RB 1P3FC 3C1CB 4J8WB 2NQBA 1KX3D 5GSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AN2 B;  3AZJ B;  4LD9 B;  4QLC B;  4KUD A;  3UT9 B;  4YM6 A;  5CPK B;  1HQ3 D;  3AV2 A;  2CV5 D;  2HUE C;  4ZBJ B;  5AVC D;  4JJN C;  3REK B;  3KSY A;  4X23 D;  2ARO B;  3AZG A;  5B0Z C;  5CHL B;  1H3O A;  5AV6 D;  5B33 C;  2FJ7 A;  3MVD B;  1TZY D;  1P3F B;  2PYO C;  3AFA A;  4J8U C;  3WA9 C;  1P3M D;  3MGQ D;  3LJA C;  4KGC C;  3X1U D;  3REH A;  3LZ0 A;  1F66 C;  2HUE B;  1Q9C A;  4JJN B;  3REL C;  5CPI C;  5GT3 A;  3AZL C;  4WNN A;  5B0Z B;  3AYW D;  4Z5T C;  5B33 B;  1P3P A;  5B24 A;  3AZE A;  1P3G D;  2PYO B;  4J8U B;  3B6F C;  3WA9 B;  1U35 D;  3A6N D;  3MGS A;  3LJA B;  4KGC B;  3MGP A;  3X1S C;  5AV8 C;  1F66 B;  3REL B;  3B0D C;  5CP6 C;  5CPI B;  3W98 A;  4Z66 D;  3AZL B;  5DNM D;  1M1A D;  3C1C D;  4Z5T B;  4J8W D;  5B1M A;  5AVB A;  3AN2 D;  3AZJ D;  3B6F B;  4QLC D;  4LD9 D;  3B6G C;  5B2J C;  5CPK D;  4H9R A;  3MGR C;  2JSS A;  4KHA B;  3AZF A;  3REK D;  5E5A C;  4UUZ B;  3X1S B;  3TU4 C;  1S32 A;  5AV8 B;  2ARO D;  4DRA A;  3B0D B;  4R8P C;  5B2I C;  5CP6 B;  4ZUX C;  4J8V C;  3R45 A;  4XUJ A;  3MNN C;  3MVD D;  3AZN C;  2HIO A;  4WU9 A;  5CPJ C;  1P3F D;  3KXB A;  3C1B C;  5GT0 C;  5AV9 C;  3B0B A;  5B32 G;  2F8N H;  3W97 A;  3B6G B;  5B2J B;  2NZD C;  3MGR B;  5JRG C;  5FUG A;  5B31 C;  4JJN D;  4CSR A;  5E5A B;  5BS7 A;  3KWQ C;  3W96 A;  3TU4 B;  3REJ A;  3LEL C;  5B2I B;  5B0Z D;  4R8P B;  5GXQ A;  1KX4 C;  5B33 D;  4ZUX B;  4J8V B;  3AZN B;  3MNN B;  4Z2M H;  5CPJ B;  3WKJ C;  5AV5 C;  4E45 A;  2PYO D;  4J8U D;  1KX3 A;  3WA9 D;  3C1B B;  3AZH A;  5GT0 B;  3VH6 A;  5AV9 B;  3LJA D;  4H9N B;  2NZD B;  2CV5 A;  5JRG B;  5AVC A;  3WTP A;  5B31 B;  1F66 D;  5BO0 B;  3REL D;  5CPI D;  5G49 A;  3KWQ B;  1KX5 A;  5B1L A;  3AZL D;  3LEL B;  5BNX A;  1KX4 B;  4Z5T D;  3O62 A;  1BH8 B;  1TZY A;  1P3I C;  1ZLA C;  3WKJ B;  3UTA A;  5AV5 B;  1M18 C;  3B6F D;  1P3L A;  4E44 A;  3WAA A;  4H9Q B;  2NQB C;  5GSU C;  3X1S D;  5AV8 D;  3NQU B;  5CP6 D;  5C3I C;  4YM6 C;  1B6W A;  4J8X C;  3X1V A;  2LY8 A;  1P3I B;  1P3B A;  1ZLA B;  1P3A C;  3W99 C;  4G92 B;  1M18 B;  1U35 A;  5B32 A;  1P3K A;  3B6G D;  2FJ7 C;  5B2J D;  1WWI A;  3MGR D;  3B0C W;  3AFA C;  2L5A A;  5E5A D;  4M6B A;  5GSU B;  3AZM A;  3TU4 D;  5B2I D;  4R8P D;  5C3I B;  4YM6 B;  1P3O A;  3REH C;  1ID3 A;  4ZUX D;  5AY8 C;  4J8V D;  3MNN D;  3LZ0 C;  3AZN D;  4J8X B;  4J8W A;  5CPJ D;  3AZK A;  3C1B D;  5GT3 C;  3AN2 A;  4NFT A;  5GT0 D;  1P3A B;  3W99 B;  5BT1 C;  2F8N K;  3AV1 C;  2FJ7 B;  1P3P C;  5B24 C;  5JRG D;  4AWL C;  5B31 D;  3AFA B;  2F8N B;  5B40 C;  3MGS C;  3KWQ D;  3LEL D;  1KX4 D;  3REH B;  3UTB C;  3VH5 W;  5AY8 B;  3LZ0 B;  3WKJ D;  5AV5 D;  3W98 C;  5GT3 B;  4WNN B;  3AV1 B;  1P3P B;  5B1M C;  4H9P A;  5B24 B;  5AVB C;  4CAY A;  3LZ1 A;  4JJN A;  4AWL B;  5B40 B;  3MGS B;  5B0Z A;  1P34 A;  3WTP E;  3UTB B;  3B0C T;  1P3I D;  5F99 A;  1ZLA D;  2BYM B;  2PYO A;  2RVQ C;  5DNN A;  5B0Y A;  3WA9 A;  1M18 D;  1EQZ A;  3W98 B;  2CWE A;  3NQJ A;  4WU9 C;  3LJA A;  2HIO C;  3UT9 D;  4XZQ A;  3KXB C;  3AZI A;  5B1M B;  5AVB B;  5GSU D;  4WV4 B;  3REL A;  5CPI A;  5JA4 B;  1AOI C;  3W97 C;  4YM6 D;  3KUY A;  4H9R B;  3AZL A;  4J8X D;  5BS7 C;  3W96 C;  1P3A D;  3B6F A;  3W99 D;  5GXQ C;  2BYK A;  2FJ7 D;  5KDM A;  3R45 B;  4WU9 B;  2HIO B;  4WU8 A;  3VH5 T;  3KXB B;  4UUZ A;  3AFA D;  2F8N D;  3X1S A;  3AZH C;  5BNV A;  1AOI B;  3W97 B;  3REH D;  4H9O A;  5AY8 D;  1M19 A;  3LZ0 D;  5AVC C;  5FUG B;  3WTP C;  3X1T C;  4CSR B;  1TAF A;  5GT3 D;  3W96 B;  1KX5 C;  5B1L C;  4YS3 C;  5BT1 D;  3AV1 D;  5GXQ B;  3O62 C;  1TZY C;  3MGR A;  5B24 D;  1N1J B;  4KGC D;  1HQ3 A;  3UTA C;  2YFV A;  3AZH B;  1P3L C;  5B40 D;  3MGS D;  3WAA C;  4X23 A;  4J8V A;  3UTB D;  4H9S A;  5AV6 A;  3WTP B;  3X1T B;  3W98 D;  1KX5 B;  5B1L B;  1P3M A;  4YS3 B;  3MGQ A;  3X1V C;  4H9N A;  3REI C;  3O62 B;  1TZY B;  1B67 A;  3X1U A;  5JRG A;  5B1M D;  1P3B C;  3VH6 W;  5AVB D;  2F8N G;  3UTA B;  5B32 C;  1P3K C;  1P3L B;  4NE3 A;  4KUD C;  3WAA B;  1KX4 A;  3AYW A;  3AV2 C;  3AZM C;  5AV5 A;  4G91 C;  2RVQ D;  1ID3 C;  1P3O C;  1P3G A;  4Z2M G;  3AZG C;  4WU9 D;  3A6N A;  2HIO D;  3X1V B;  3REI B;  1BH9 A;  3KXB D;  3AZK C;  1P3B B;  2NQB B;  5B32 B;  1P3K B;  1AOI D;  2YFW A;  3W97 D;  1JFI A;  4KUD B;  4Z66 A;  5DNM A;  1M1A A;  3AV2 B;  3V9R A;  3C1C A;  3AZM B;  1M18 A;  3W96 D;  4G91 B;  1ID3 B;  5GXQ D;  5AV9 D;  4QLC A;  3AZJ A;  1P3O B;  4LD9 A;  3UT9 A;  3AZG B;  1BFM A;  5CPK A;  1H3O B;  4NE6 A;  3AZK B;  2NZD D;  3AZE C;  1KU5 A;  3REK A;  3AZH D;  2ARO A;  4J8X A;  3LZ1 C;  3VH5 A;  3WTP D;  3MVD A;  3MGP C;  3X1T D;  3VH6 T;  1P3A A;  1P3F A;  3W99 A;  1WWS A;  1KX5 D;  5B1L D;  1P34 C;  4YS3 D;  3O62 D;  5F99 C;  2F8N A;  5DNN C;  5B0Y C;  3UTA D;  1EQZ C;  3AZE B;  1P3L D;  3WAA D;  4XZQ C;  5AY8 A;  3AZI C;  4H9P B;  5B33 A;  4CAY B;  3LZ1 B;  3AZF C;  3MGP B;  1S32 C;  3KUY C;  4J8U A;  3AV1 A;  1P34 B;  3X1V D;  3REI D;  4XUJ C;  4KGC A;  4DRB A;  1P3B D;  5F99 B;  5DNN B;  5B0Y B;  2NQB D;  5B32 D;  5B40 A;  5B31 G;  1P3K D;  1EQZ B;  1F66 A;  3NQJ B;  4EO5 C;  4KUD D;  4NE5 A;  4XZQ B;  4WU8 C;  3UTB A;  3AZI B;  3AV2 D;  2BYM A;  4Z5T A;  3AZM D;  3AZF B;  1ID3 D;  1S32 B;  1P3O D;  3KUY B;  3REJ C;  3AZG D;  1M19 C;  3AZK D;  4XUJ B;  4KHA A;  5JA4 A;  1KX3 C;  1A7W A;  5AV8 A;  2BYK B;  4EO5 B;  5KDM B;  5CP6 A;  4WU8 B;  1HQ3 C;  2CV5 C;  5BNV B;  4X23 C;  3REJ B;  3B6G A;  4H9S C;  4H9O B;  1M19 B;  5AV6 C;  5B2J A;  1P3P D;  1TAF B;  3AZE D;  5E5A A;  1AOI A;  1P3M C;  1KX3 B;  3MGQ C;  2IO5 C;  3TU4 A;  4WZS B;  5B2I A;  4R8P A;  1HTA A;  3X1U C;  4ZUX A;  3LZ1 D;  1HQ3 B;  4HGA C;  3MNN A;  3AZN A;  2YFV B;  2CV5 B;  3MGP D;  5CPJ A;  1ULY A;  5AVC B;  3C1B A;  1P34 D;  1R4V A;  5G49 B;  5GT0 A;  5AV9 A;  4X23 B;  3AYW C;  1N1J A;  5AV6 B;  5F99 D;  5BNX B;  2NZD A;  1F1E A;  5DNN D;  5B0Y D;  1EQZ D;  1P3G C;  5B31 A;  5BO0 A;  1U35 C;  1P3M B;  3A6N C;  3MGQ B;  3KWQ A;  4XZQ D;  2IO5 B;  3LEL A;  3AZI D;  3X1U B;  1BH8 A;  3X1T A;  4HGA B;  3AZF D;  3WKJ A;  1S32 D;  3KUY D;  4YS3 A;  4Z66 C;  5DNM C;  1M1A C;  3AYW B;  4XUJ D;  3C1C C;  4H9Q A;  4J8W C;  4G92 C;  3AN2 C;  3AZJ C;  1P3G B;  4QLC C;  4LD9 C;  3NQU A;  3UT9 C;  1U35 B;  3A6N B;  5CPK C;  4WU8 D;  1BH9 B;  4ZBJ C;  3REK C;  1P3I A;  1ZLA A;  2YFW B;  1JFI B;  2ARO C;  3REJ D;  1M19 D;  4Z66 B;  3REI A;  3MVD C;  5DNM B;  1M1A B;  3V9R B;  1P3F C;  3C1C B;  4J8W B;  2NQB A;  1KX3 D;  5GSU A; 
#chains in the Genus database with same CATH topology
 3AN2 B;  3AZJ B;  4LD9 B;  4QLC B;  4KUD A;  3UT9 B;  4YM6 A;  5CPK B;  1HQ3 D;  3AV2 A;  2CV5 D;  2RIQ A;  2HUE C;  4ZBJ B;  5AVC D;  1PZR A;  4JJN C;  3KSY A;  3REK B;  4X23 D;  2ARO B;  3AZG A;  5B0Z C;  5CHL B;  1H3O A;  5AV6 D;  5B33 C;  2FJ7 A;  4DQY B;  3MVD B;  1TZY D;  1P3F B;  2PYO C;  3AFA A;  2W8S A;  4J8U C;  3WA9 C;  1P3M D;  3MGQ D;  3EPL A;  3LJA C;  4KGC C;  3X1U D;  3REH A;  3LZ0 A;  1F66 C;  2HUE B;  1Q9C A;  4JJN B;  3REL C;  5CPI C;  5GT3 A;  3AZL C;  4WNN A;  2UWX A;  5B0Z B;  3AYW D;  4Z5T C;  5B33 B;  1P3P A;  5B24 A;  3AZE A;  1P3G D;  2PYO B;  4J8U B;  3B6F C;  3WA9 B;  1U35 D;  3A6N D;  3MGS A;  3H0M C;  3LJA B;  4KGC B;  3MGP A;  2Y2P A;  3X1S C;  5AV8 C;  1F66 B;  3REL B;  3B0D C;  5CP6 C;  2Y2Q A;  5CPI B;  3W98 A;  4Z66 D;  3AZL B;  5DNM D;  1M1A D;  2BG1 A;  3C1C D;  4Z5T B;  4J8W D;  5B1M A;  5AVB A;  3AN2 D;  3AZJ D;  3B6F B;  4QLC D;  4LD9 D;  3B6G C;  5B2J C;  5CPK D;  4H9R A;  3MGR C;  2JSS A;  4KHA B;  3AZF A;  3REK D;  5E5A C;  4UUZ B;  3X1S B;  3TU4 C;  1S32 A;  5AV8 B;  2ARO D;  4DRA A;  3B0D B;  4R8P C;  5B2I C;  5CP6 B;  4ZUX C;  4J8V C;  3R45 A;  4XUJ A;  3MNN C;  3MVD D;  3AZN C;  2HIO A;  4WU9 A;  5CPJ C;  1P3F D;  3KXB A;  3C1B C;  5GT0 C;  5AV9 C;  3B0B A;  5B32 G;  2F8N H;  3W97 A;  3B6G B;  5B2J B;  2NZD C;  3MGR B;  5JRG C;  5FUG A;  5B31 C;  4JJN D;  4CSR A;  5E5A B;  5BS7 A;  4WJ3 C;  3KWQ C;  3W96 A;  3TU4 B;  3REJ A;  2DQN C;  3LEL C;  5B2I B;  5B0Z D;  4R8P B;  5GXQ A;  1KX4 C;  5B33 D;  4ZUX B;  4J8V B;  3AZN B;  3MNN B;  4Z2M H;  5CPJ B;  3WKJ C;  5AV5 C;  4E45 A;  2PYO D;  4J8U D;  1KX3 A;  3WA9 D;  2Y2I A;  3C1B B;  3AZH A;  5GT0 B;  3VH6 A;  5AV9 B;  3LJA D;  4H9N B;  2NZD B;  2CV5 A;  2JCH A;  5JRG B;  5AVC A;  2DF4 C;  3WTP A;  5B31 B;  1F66 D;  5BO0 B;  3REL D;  5CPI D;  5G49 A;  3KWQ B;  1KX5 A;  5B1L A;  3AZL D;  3LEL B;  5BNX A;  1KX4 B;  4Z5T D;  3O62 A;  1BH8 B;  1TZY A;  1P3I C;  3H0R C;  1ZLA C;  3F6T A;  3WKJ B;  3UTA A;  5AV5 B;  1M18 C;  3B6F D;  1P3L A;  4E44 A;  3WAA A;  4H9Q B;  2NQB C;  5GSU C;  3X1S D;  5AV8 D;  3P5J B;  3NQU B;  5CP6 D;  5C3I C;  4YM6 C;  1B6W A;  2ZY4 A;  4J8X C;  3X1V A;  2LY8 A;  1P3I B;  1P3B A;  1ZLA B;  1P3A C;  3W99 C;  4G92 B;  1M18 B;  1U35 A;  5B32 A;  1P3K A;  3B6G D;  2FJ7 C;  5B2J D;  1WWI A;  3MGR D;  3B0C W;  3AFA C;  2L5A A;  5E5A D;  4M6B A;  5GSU B;  3AZM A;  3TU4 D;  5B2I D;  4R8P D;  5C3I B;  4YM6 B;  1P3O A;  3REH C;  1ID3 A;  4ZUX D;  5AY8 C;  4J8V D;  3MNN D;  3LZ0 C;  3AZN D;  4J8X B;  4J8W A;  5CPJ D;  3AZK A;  3C1B D;  5GT3 C;  3AN2 A;  4NFT A;  5GT0 D;  1P3A B;  3W99 B;  5BT1 C;  2F8N K;  3AV1 C;  2FJ7 B;  1P3P C;  5B24 C;  5JRG D;  4AWL C;  5B31 D;  3AFA B;  2F8N B;  3A1K A;  5B40 C;  3MGS C;  3KWQ D;  3LEL D;  1KX4 D;  3REH B;  3UTB C;  3VH5 W;  2XD5 A;  5AY8 B;  3LZ0 B;  3WKJ D;  5AV5 D;  3W98 C;  1W2E A;  5GT3 B;  4WNN B;  3AV1 B;  1P3P B;  5B1M C;  4H9P A;  5B24 B;  5AVB C;  4CAY A;  3LZ1 A;  4JJN A;  4AWL B;  5B40 B;  3MGS B;  5B0Z A;  1P34 A;  3WTP E;  3UTB B;  3B0C T;  1P3I D;  5F99 A;  1ZLA D;  2BYM B;  2PYO A;  2RVQ C;  5DNN A;  5B0Y A;  2ZM5 A;  1M18 D;  3WA9 A;  1EQZ A;  3W98 B;  2CWE A;  3NQJ A;  4WU9 C;  3LJA A;  2HIO C;  3UT9 D;  4XZQ A;  3KXB C;  3AZI A;  5B1M B;  5AVB B;  5GSU D;  4WV4 B;  3REL A;  5CPI A;  5JA4 B;  1AOI C;  3W97 C;  4YM6 D;  3KUY A;  4H9R B;  3AZL A;  4J8X D;  5BS7 C;  2Y2N A;  3W96 C;  1P3A D;  3B6F A;  3W99 D;  5GXQ C;  2BYK A;  2FJ7 D;  5KDM A;  3R45 B;  2Y2H A;  4WU9 B;  2HIO B;  3EPJ A;  4WU8 A;  3VH5 T;  3KXB B;  4UUZ A;  3AFA D;  2F8N D;  3X1S A;  3AZH C;  5BNV A;  1AOI B;  3W97 B;  3REH D;  4H9O A;  5AY8 D;  1M19 A;  3LZ0 D;  5AVC C;  5FUG B;  3WTP C;  3X1T C;  4CSR B;  1TAF A;  5GT3 D;  3W96 B;  1KX5 C;  5B1L C;  4YS3 C;  5BT1 D;  3AV1 D;  5GXQ B;  3O62 C;  1TZY C;  3MGR A;  5B24 D;  1N1J B;  4KGC D;  1HQ3 A;  3UTA C;  2YFV A;  3AZH B;  1P3L C;  5B40 D;  3MGS D;  3WAA C;  4X23 A;  4J8V A;  3UTB D;  4H9S A;  5AV6 A;  3WTP B;  3X1T B;  3W98 D;  1KX5 B;  5B1L B;  1P3M A;  4YS3 B;  3MGQ A;  3X1V C;  3A1I A;  4H9N A;  3REI C;  3O62 B;  3KFU G;  1TZY B;  2Y2J A;  1B67 A;  3X1U A;  2ZY3 A;  5B1M D;  5JRG A;  1P3B C;  3VH6 W;  5AVB D;  2F8N G;  3UTA B;  5B32 C;  1P3K C;  1P3L B;  4NE3 A;  4KUD C;  3WAA B;  1KX4 A;  3AYW A;  3AV2 C;  3AZM C;  5AV5 A;  2G5I C;  2ZY2 A;  4G91 C;  2RVQ D;  1ID3 C;  1P3O C;  1P3G A;  4Z2M G;  3AZG C;  4WU9 D;  3A6N A;  2HIO D;  3X1V B;  3REI B;  1BH9 A;  3KXB D;  3AZK C;  1P3B B;  2NQB B;  5B32 B;  1P3K B;  1AOI D;  2YFW A;  3W97 D;  1JFI A;  4KUD B;  4Z66 A;  5DNM A;  1M1A A;  3AV2 B;  3V9R A;  3C1C A;  3AZM B;  1M18 A;  3W96 D;  4G91 B;  2J8P A;  1ID3 B;  5GXQ D;  5AV9 D;  4QLC A;  3AZJ A;  1P3O B;  4LD9 A;  3UT9 A;  3AZG B;  1BFM A;  5CPK A;  1H3O B;  2F2A C;  4NE6 A;  3AZK B;  2NZD D;  3AZE C;  2Y2G A;  1KU5 A;  3REK A;  3AZH D;  2ARO A;  4J8X A;  3LZ1 C;  2Y2L A;  3VH5 A;  3WTP D;  3MVD A;  3MGP C;  3X1T D;  3VH6 T;  1P3A A;  1P3F A;  3W99 A;  1WWS A;  1KX5 D;  5B1L D;  1P34 C;  4YS3 D;  3O62 D;  5F99 C;  2F8N A;  5DNN C;  5B0Y C;  3UTA D;  1EQZ C;  3AZE B;  1P3L D;  2Y2O A;  3WAA D;  4XZQ C;  5AY8 A;  3AZI C;  4H9P B;  5B33 A;  4CAY B;  3LZ1 B;  3AZF C;  3MGP B;  1S32 C;  3KUY C;  4J8U A;  3AV1 A;  1P34 B;  3X1V D;  3REI D;  4XUJ C;  1Z2C B;  4DRB A;  4KGC A;  1P3B D;  2XD1 A;  3IP4 C;  5F99 B;  5DNN B;  5B0Y B;  2NQB D;  2Y2K A;  5B32 D;  5B40 A;  5B31 G;  1P3K D;  1EQZ B;  1F66 A;  3NQJ B;  4EO5 C;  4KUD D;  2FFF B;  4NE5 A;  4XZQ B;  4WU8 C;  3UTB A;  3EG5 B;  3AL0 C;  3AZI B;  3AV2 D;  2BYM A;  4Z5T A;  3AZM D;  3AZF B;  1ID3 D;  1S32 B;  1P3O D;  3KUY B;  3REJ C;  3AZG D;  1M19 C;  2G5H C;  3AZK D;  4XUJ B;  4KHA A;  5JA4 A;  1KX3 C;  1A7W A;  5AV8 A;  2BYK B;  2Y2M A;  4EO5 B;  5KDM B;  5CP6 A;  4WU8 B;  1HQ3 C;  2VQR A;  2CV5 C;  3H0L C;  5BNV B;  4X23 C;  3REJ B;  3B6G A;  4H9S C;  4H9O B;  1M19 B;  5AV6 C;  5B2J A;  1P3P D;  2ZY5 A;  1TAF B;  3AZE D;  5E5A A;  1AOI A;  1P3M C;  1KX3 B;  3MGQ C;  2IO5 C;  3TU4 A;  4WZS B;  5B2I A;  4R8P A;  1T3U A;  1HTA A;  3X1U C;  4ZUX A;  3LZ1 D;  1HQ3 B;  4HGA C;  3MNN A;  3AZN A;  2YFV B;  2CV5 B;  3MGP D;  3EPH A;  5CPJ A;  1ULY A;  5AVC B;  3C1B A;  1P34 D;  1R4V A;  5G49 B;  5GT0 A;  5AV9 A;  4X23 B;  3AYW C;  1N1J A;  5AV6 B;  5F99 D;  5BNX B;  2NZD A;  1F1E A;  5DNN D;  5B0Y D;  1EQZ D;  1P3G C;  5B31 A;  5BO0 A;  1U35 C;  1P3M B;  3A6N C;  3MGQ B;  3KWQ A;  4XZQ D;  2IO5 B;  3LEL A;  3AZI D;  3X1U B;  1BH8 A;  3X1T A;  4HGA B;  3AZF D;  3FDD A;  3WKJ A;  1S32 D;  3KUY D;  4YS3 A;  4Z66 C;  5DNM C;  1M1A C;  3AYW B;  4XUJ D;  3C1C C;  4H9Q A;  4J8W C;  4G92 C;  3AN2 C;  3AZJ C;  1P3G B;  4QLC C;  4LD9 C;  3NQU A;  3UT9 C;  2JE5 A;  1U35 B;  3A6N B;  4UPK A;  5CPK C;  4WU8 D;  1BH9 B;  3EPK A;  4ZBJ C;  3REK C;  1P3I A;  1ZLA A;  2YFW B;  1JFI B;  2ARO C;  3REJ D;  1M19 D;  4Z66 B;  3REI A;  3MVD C;  5DNM B;  1M1A B;  3V9R B;  1P3F C;  3C1C B;  4J8W B;  2NQB A;  1KX3 D;  5GSU A; 
#chains in the Genus database with same CATH homology
 3AN2 B;  3AZJ B;  4LD9 B;  4QLC B;  4KUD A;  3UT9 B;  4YM6 A;  5CPK B;  1HQ3 D;  3AV2 A;  2CV5 D;  2RIQ A;  2HUE C;  4ZBJ B;  5AVC D;  1PZR A;  4JJN C;  3KSY A;  3REK B;  4X23 D;  2ARO B;  3AZG A;  5B0Z C;  5CHL B;  1H3O A;  5AV6 D;  5B33 C;  2FJ7 A;  4DQY B;  3MVD B;  1TZY D;  1P3F B;  2PYO C;  3AFA A;  2W8S A;  4J8U C;  3WA9 C;  1P3M D;  3MGQ D;  3EPL A;  3LJA C;  4KGC C;  3X1U D;  3REH A;  3LZ0 A;  1F66 C;  2HUE B;  1Q9C A;  4JJN B;  3REL C;  5CPI C;  5GT3 A;  3AZL C;  4WNN A;  2UWX A;  5B0Z B;  3AYW D;  4Z5T C;  5B33 B;  1P3P A;  5B24 A;  3AZE A;  1P3G D;  2PYO B;  4J8U B;  3B6F C;  3WA9 B;  1U35 D;  3A6N D;  3MGS A;  3H0M C;  3LJA B;  4KGC B;  3MGP A;  2Y2P A;  3X1S C;  5AV8 C;  1F66 B;  3REL B;  3B0D C;  5CP6 C;  2Y2Q A;  5CPI B;  3W98 A;  4Z66 D;  3AZL B;  5DNM D;  1M1A D;  2BG1 A;  3C1C D;  4Z5T B;  4J8W D;  5B1M A;  5AVB A;  3AN2 D;  3AZJ D;  3B6F B;  4QLC D;  4LD9 D;  3B6G C;  5B2J C;  5CPK D;  4H9R A;  3MGR C;  2JSS A;  4KHA B;  3AZF A;  3REK D;  5E5A C;  4UUZ B;  3X1S B;  3TU4 C;  1S32 A;  5AV8 B;  2ARO D;  4DRA A;  3B0D B;  4R8P C;  5B2I C;  5CP6 B;  4ZUX C;  4J8V C;  3R45 A;  4XUJ A;  3MNN C;  3MVD D;  3AZN C;  2HIO A;  4WU9 A;  5CPJ C;  1P3F D;  3KXB A;  3C1B C;  5GT0 C;  5AV9 C;  3B0B A;  5B32 G;  2F8N H;  3W97 A;  3B6G B;  5B2J B;  2NZD C;  3MGR B;  5JRG C;  5FUG A;  5B31 C;  4JJN D;  4CSR A;  5E5A B;  5BS7 A;  4WJ3 C;  3KWQ C;  3W96 A;  3TU4 B;  3REJ A;  2DQN C;  3LEL C;  5B2I B;  5B0Z D;  4R8P B;  5GXQ A;  1KX4 C;  5B33 D;  4ZUX B;  4J8V B;  3AZN B;  3MNN B;  4Z2M H;  5CPJ B;  3WKJ C;  5AV5 C;  4E45 A;  2PYO D;  4J8U D;  1KX3 A;  3WA9 D;  2Y2I A;  3C1B B;  3AZH A;  5GT0 B;  3VH6 A;  5AV9 B;  3LJA D;  4H9N B;  2NZD B;  2CV5 A;  2JCH A;  5JRG B;  5AVC A;  2DF4 C;  3WTP A;  5B31 B;  1F66 D;  5BO0 B;  3REL D;  5CPI D;  5G49 A;  3KWQ B;  1KX5 A;  5B1L A;  3AZL D;  3LEL B;  5BNX A;  1KX4 B;  4Z5T D;  3O62 A;  1BH8 B;  1TZY A;  1P3I C;  3H0R C;  1ZLA C;  3F6T A;  3WKJ B;  3UTA A;  5AV5 B;  1M18 C;  3B6F D;  1P3L A;  4E44 A;  3WAA A;  4H9Q B;  2NQB C;  5GSU C;  3X1S D;  5AV8 D;  3P5J B;  3NQU B;  5CP6 D;  5C3I C;  4YM6 C;  1B6W A;  2ZY4 A;  4J8X C;  3X1V A;  2LY8 A;  1P3I B;  1P3B A;  1ZLA B;  1P3A C;  3W99 C;  4G92 B;  1M18 B;  1U35 A;  5B32 A;  1P3K A;  3B6G D;  2FJ7 C;  5B2J D;  1WWI A;  3MGR D;  3B0C W;  3AFA C;  2L5A A;  5E5A D;  4M6B A;  5GSU B;  3AZM A;  3TU4 D;  5B2I D;  4R8P D;  5C3I B;  4YM6 B;  1P3O A;  3REH C;  1ID3 A;  4ZUX D;  5AY8 C;  4J8V D;  3MNN D;  3LZ0 C;  3AZN D;  4J8X B;  4J8W A;  5CPJ D;  3AZK A;  3C1B D;  5GT3 C;  3AN2 A;  4NFT A;  5GT0 D;  1P3A B;  3W99 B;  5BT1 C;  2F8N K;  3AV1 C;  2FJ7 B;  1P3P C;  5B24 C;  5JRG D;  4AWL C;  5B31 D;  3AFA B;  2F8N B;  3A1K A;  5B40 C;  3MGS C;  3KWQ D;  3LEL D;  1KX4 D;  3REH B;  3UTB C;  3VH5 W;  2XD5 A;  5AY8 B;  3LZ0 B;  3WKJ D;  5AV5 D;  3W98 C;  1W2E A;  5GT3 B;  4WNN B;  3AV1 B;  1P3P B;  5B1M C;  4H9P A;  5B24 B;  5AVB C;  4CAY A;  3LZ1 A;  4JJN A;  4AWL B;  5B40 B;  3MGS B;  5B0Z A;  1P34 A;  3WTP E;  3UTB B;  3B0C T;  1P3I D;  5F99 A;  1ZLA D;  2BYM B;  2PYO A;  2RVQ C;  5DNN A;  5B0Y A;  2ZM5 A;  1M18 D;  3WA9 A;  1EQZ A;  3W98 B;  2CWE A;  3NQJ A;  4WU9 C;  3LJA A;  2HIO C;  3UT9 D;  4XZQ A;  3KXB C;  3AZI A;  5B1M B;  5AVB B;  5GSU D;  4WV4 B;  3REL A;  5CPI A;  5JA4 B;  1AOI C;  3W97 C;  4YM6 D;  3KUY A;  4H9R B;  3AZL A;  4J8X D;  5BS7 C;  2Y2N A;  3W96 C;  1P3A D;  3B6F A;  3W99 D;  5GXQ C;  2BYK A;  2FJ7 D;  5KDM A;  3R45 B;  2Y2H A;  4WU9 B;  2HIO B;  3EPJ A;  4WU8 A;  3VH5 T;  3KXB B;  4UUZ A;  3AFA D;  2F8N D;  3X1S A;  3AZH C;  5BNV A;  1AOI B;  3W97 B;  3REH D;  4H9O A;  5AY8 D;  1M19 A;  3LZ0 D;  5AVC C;  5FUG B;  3WTP C;  3X1T C;  4CSR B;  1TAF A;  5GT3 D;  3W96 B;  1KX5 C;  5B1L C;  4YS3 C;  5BT1 D;  3AV1 D;  5GXQ B;  3O62 C;  1TZY C;  3MGR A;  5B24 D;  1N1J B;  4KGC D;  1HQ3 A;  3UTA C;  2YFV A;  3AZH B;  1P3L C;  5B40 D;  3MGS D;  3WAA C;  4X23 A;  4J8V A;  3UTB D;  4H9S A;  5AV6 A;  3WTP B;  3X1T B;  3W98 D;  1KX5 B;  5B1L B;  1P3M A;  4YS3 B;  3MGQ A;  3X1V C;  3A1I A;  4H9N A;  3REI C;  3O62 B;  3KFU G;  1TZY B;  2Y2J A;  1B67 A;  3X1U A;  2ZY3 A;  5B1M D;  5JRG A;  1P3B C;  3VH6 W;  5AVB D;  2F8N G;  3UTA B;  5B32 C;  1P3K C;  1P3L B;  4NE3 A;  4KUD C;  3WAA B;  1KX4 A;  3AYW A;  3AV2 C;  3AZM C;  5AV5 A;  2G5I C;  2ZY2 A;  4G91 C;  2RVQ D;  1ID3 C;  1P3O C;  1P3G A;  4Z2M G;  3AZG C;  4WU9 D;  3A6N A;  2HIO D;  3X1V B;  3REI B;  1BH9 A;  3KXB D;  3AZK C;  1P3B B;  2NQB B;  5B32 B;  1P3K B;  1AOI D;  2YFW A;  3W97 D;  1JFI A;  4KUD B;  4Z66 A;  5DNM A;  1M1A A;  3AV2 B;  3V9R A;  3C1C A;  3AZM B;  1M18 A;  3W96 D;  4G91 B;  2J8P A;  1ID3 B;  5GXQ D;  5AV9 D;  4QLC A;  3AZJ A;  1P3O B;  4LD9 A;  3UT9 A;  3AZG B;  1BFM A;  5CPK A;  1H3O B;  2F2A C;  4NE6 A;  3AZK B;  2NZD D;  3AZE C;  2Y2G A;  1KU5 A;  3REK A;  3AZH D;  2ARO A;  4J8X A;  3LZ1 C;  2Y2L A;  3VH5 A;  3WTP D;  3MVD A;  3MGP C;  3X1T D;  3VH6 T;  1P3A A;  1P3F A;  3W99 A;  1WWS A;  1KX5 D;  5B1L D;  1P34 C;  4YS3 D;  3O62 D;  5F99 C;  2F8N A;  5DNN C;  5B0Y C;  3UTA D;  1EQZ C;  3AZE B;  1P3L D;  2Y2O A;  3WAA D;  4XZQ C;  5AY8 A;  3AZI C;  4H9P B;  5B33 A;  4CAY B;  3LZ1 B;  3AZF C;  3MGP B;  1S32 C;  3KUY C;  4J8U A;  3AV1 A;  1P34 B;  3X1V D;  3REI D;  4XUJ C;  1Z2C B;  4DRB A;  4KGC A;  1P3B D;  2XD1 A;  3IP4 C;  5F99 B;  5DNN B;  5B0Y B;  2NQB D;  2Y2K A;  5B32 D;  5B40 A;  5B31 G;  1P3K D;  1EQZ B;  1F66 A;  3NQJ B;  4EO5 C;  4KUD D;  2FFF B;  4NE5 A;  4XZQ B;  4WU8 C;  3UTB A;  3EG5 B;  3AL0 C;  3AZI B;  3AV2 D;  2BYM A;  4Z5T A;  3AZM D;  3AZF B;  1ID3 D;  1S32 B;  1P3O D;  3KUY B;  3REJ C;  3AZG D;  1M19 C;  2G5H C;  3AZK D;  4XUJ B;  4KHA A;  5JA4 A;  1KX3 C;  1A7W A;  5AV8 A;  2BYK B;  2Y2M A;  4EO5 B;  5KDM B;  5CP6 A;  4WU8 B;  1HQ3 C;  2VQR A;  2CV5 C;  3H0L C;  5BNV B;  4X23 C;  3REJ B;  3B6G A;  4H9S C;  4H9O B;  1M19 B;  5AV6 C;  5B2J A;  1P3P D;  2ZY5 A;  1TAF B;  3AZE D;  5E5A A;  1AOI A;  1P3M C;  1KX3 B;  3MGQ C;  2IO5 C;  3TU4 A;  4WZS B;  5B2I A;  4R8P A;  1T3U A;  1HTA A;  3X1U C;  4ZUX A;  3LZ1 D;  1HQ3 B;  4HGA C;  3MNN A;  3AZN A;  2YFV B;  2CV5 B;  3MGP D;  3EPH A;  5CPJ A;  1ULY A;  5AVC B;  3C1B A;  1P34 D;  1R4V A;  5G49 B;  5GT0 A;  5AV9 A;  4X23 B;  3AYW C;  1N1J A;  5AV6 B;  5F99 D;  5BNX B;  2NZD A;  1F1E A;  5DNN D;  5B0Y D;  1EQZ D;  1P3G C;  5B31 A;  5BO0 A;  1U35 C;  1P3M B;  3A6N C;  3MGQ B;  3KWQ A;  4XZQ D;  2IO5 B;  3LEL A;  3AZI D;  3X1U B;  1BH8 A;  3X1T A;  4HGA B;  3AZF D;  3FDD A;  3WKJ A;  1S32 D;  3KUY D;  4YS3 A;  4Z66 C;  5DNM C;  1M1A C;  3AYW B;  4XUJ D;  3C1C C;  4H9Q A;  4J8W C;  4G92 C;  3AN2 C;  3AZJ C;  1P3G B;  4QLC C;  4LD9 C;  3NQU A;  3UT9 C;  2JE5 A;  1U35 B;  3A6N B;  4UPK A;  5CPK C;  4WU8 D;  1BH9 B;  3EPK A;  4ZBJ C;  3REK C;  1P3I A;  1ZLA A;  2YFW B;  1JFI B;  2ARO C;  3REJ D;  1M19 D;  4Z66 B;  3REI A;  3MVD C;  5DNM B;  1M1A B;  3V9R B;  1P3F C;  3C1C B;  4J8W B;  2NQB A;  1KX3 D;  5GSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...