3R45A

Structure of a cenp-a-histone h4 heterodimer in complex with chaperone hjurp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
82
structure length
82
Chain Sequence
HLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords Histone H3-like centromeric protein A
publication title Structure of a CENP-A-histone H4 heterodimer in complex with chaperone HJURP
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2011-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3r45A00
1P3PB 4EO5B 4J8UA 5AVBA 4WU9B 3LZ0C 1M19C 3AZHA 3TU4C 1ZLAB 4J8UD 5AVBD 3REHA 3MNNB 5B1LB 4Z2MH 4Z5TB 5GT3C 1P3GA 4KUDC 5AV9C 3X1VA 3REHD 5G49A 2CV5C 1P3BC 3MGPB 3B6FB 1BH9B 3UTBC 3AZKD 5GSUC 1P3IA 1P3GD 5B2JC 4X23A 3X1VD 5B40B 1B67A 3X1UA 1U35A 4H9QA 3AZFB 1P3ID 3AN2C 4X23D 1P3LA 4WU8B 3X1UD 2BYMB 5AV5A 3REKC 3AZMB 4J8WA 4AWLB 3REJA 1P3LD 4G92C 3AZEB 5AV5D 4J8VB 1M1AB 4R8PB 4J8WD 3AYWB 3REJD 3WTPA 4XZQC 4ZBJB 2F8NK 2NZDB 4QLCB 4WNNA 3C1BB 3AV2A 4H9OB 3WTPD 3W97C 3NQJA 3AV2D 5CPJB 2HIOD 1P3MC 5CP6B 3MNNA 3REIC 5B1LA 3AFAB 3B6GA 5DNNB 1KX5B 5B32G 3LJAC 5B31G 3MGPA 3W96C 3RELD 3B6GD 4KGCC 5F99B 3MGPD 5B24C 5AV6C 3AZFA 2AROB 5GT3A 3AZLC 4KUDA 2FJ7B 5AV9A 2CV5A 1P3BA 1P3AC 3AZFD 1P34C 5GSUA 4H9NB 5GT3D 3AZGB 3LZ1A 4KUDD 4H9PB 5AV9D 2CV5D 1P3BD 3AZEA 1BH8B 1M1AA 1KX3B 5GSUD 3X1TB 5AV8C 4R8PA 3LZ1D 3LELC 2IO5B 3KXBC 2NZDA 1M1AD 3REKA 4R8PD 1P3OB 2NZDD 2HUEB 5GXQC 3WAAC 5B33A 3REKD 1H3OB 5AVBB 2RVQC 5BS7A 5B33D 4LD9C 5KDMA 3B0DC 1KX5A 3MGQC 3REHB 4E45A 3WKJC 3AZKB 1AOIC 1P3GB 3AZJA 3A6NC 3X1VB 5G49B 3REIA 3C1CC 3LJAA 3AZJD 4X23B 3W96A 3REID 3X1UB 4H9QB 2BYKA 2PYOC 5CHLB 3LJAD 2F8NG 5AV6A 1P3LB 4M6BA 3W96D 3X1TA 1ID3C 3NQUB 5AV5B 4J8WB 4WZSB 5AV6D 1P34A 1A7WA 5B1MC 4Z66C 5B2IA 3WA9B 3WTPB 1P34D 5B2ID 5AV8A 4WNNB 1H3OA 2HIOB 1P3KC 3NQJB 4G91C 5AV8D 5GT0C 4HGAB 4XUJC 3WAAA 3AZKA 3RELB 3B6GB 5GXQD 4WU9C 3WAAD 1ZLAC 3LZ0B 2NQBC 5AY8C 1Q9CA 3AZIA 4LD9D 3WKJA 5B0ZC 2YFWB 5GT3B 4KUDB 3AZID 5AV9B 2CV5B 1P3BB 3NQUA 4KHAA 3WKJD 1HQ3C 5GSUB 3LZ1B 5JA4A 5AVCC 3WA9A 1P3FA 3AN2B 1ID3A 3WA9D 1WWSA 1P3FD 3O62C 3UTAC 3REKB 2HIOA 2LY8A 3VH5T 5B1MA 2JSSA 4J8VC 1S32C 5JRGA 4Z66A 4G92B 1ID3D 3MGSA 5B33B 3UT9C 4H9RA 5B1MD 4QLCC 5JRGD 4Z66D 5DNMC 3C1BC 3MGSD 3RELA 4H9SC 5KDMB 3AZNC 3W98C 3W97B 5CPKC 3LZ0A 3VH6T 5CP6C 1M19A 3TU4A 1P3MB 4NE3A 4JJNC 1BFMA 3AFAC 3AZJB 3LZ0D 3REIB 1M19D 2YFWA 3TU4D 1EQZC 3LJAB 3UTBA 4UUZA 3W96B 5F99C 3MVDC 5B2JA 2BYKB 4KGCB 1TAFB 5B24B 5AV6B 3UTBD 5B0ZA 2YFVA 5B32C 3V9RA 5B31C 3AN2A 4CAYA 5B2JD 4YM6C 5AY8D 2FJ7C 1M18C 4J8XC 1P34B 5BNXA 5BNVB 5B0ZD 4YS3C 1HQ3A 3AN2D 5B2IB 5B0YC 3B0CT 1KX4C 1HQ3D 5AV8B 1WWIA 3KXBB 4XZQA 4ZUXC 1P3OC 1HTAA 3O62A 3UTAA 5E5AC 1JFIB 1F66C 3W97A 4XZQD 1S32A 5GXQB 3O62D 3UTAD 3WAAB 3AV1C 3UT9A 1P3MA 4J8UC 3W97D 1S32D 3KUYC 3KSYA 4H9SA 3R45A 4LD9B 3AZHC 3B0DB 3UT9D 1P3MD 3W98A 4DRAA 1R4VA 5CPKA 3AZIB 3X1SC 4DRBA 3W99C 3WKJB 1TZYC 3AZND 1AOIB 3W98D 4KGCA 1TAFA 5C3IC 4JJNA 5B24A 5CPKD 3A6NB 5CPIC 1P3IC 4KHAB 3AZLA 1EQZA 4X23C 4KGCD 4JJND 3C1CB 5B24D 1U35C 1P3AA 5BNVA 5JA4B 3AZLD 1EQZD 1P3FB 2PYOB 1P3AD 5AV5C 1ID3B 5B32A 5B31A 3MVDD 3LELA 4J8WC 3KXBA 3REJC 1M18A 5BT1C 4J8XA 5B1MB 4YS3A 5JRGB 4Z66B 5B32D 5FUGB 5B31D 3LELD 3MGSB 5B0YA 1JFIA 3KXBD 3MGRC 1M18D 3KWQC 4J8XD 5GXQA 4H9RB 4NE6A 4YS3D 1KX4A 3AV2C 5B0YD 1P3PC 4EO5C 5BO0B 4ZUXA 4CSRA 1P3KB 1KX4D 4G91B 3VH5W 5E5AA 4LD9A 1F66A 2CWEA 1M19B 5GT0B 4ZUXD 3MGQA 3TU4B 2RVQD 3MNNC 5B1LC 4Z5TC 5E5AD 3AV1A 1F66D 1AOIA 3MGQD 3MGPC 3B0BA 3B6FC 3A6NA 3KUYA 3AV1D 3UTBB 1AOID 2F8NH 4UUZB 3C1CA 5B40C 5B2JB 2NQBB 5AY8B 3A6ND 3VH6W 3KUYD 3AZFC 3X1SA 3W99A 3AZHD 1TZYA 2YFVB 5B0ZB 3V9RB 2PYOA 3C1CD 4NFTA 4CAYB 4WU8C 3X1SD 1N1JA 5CPIA 3W99D 1TZYD 5BNXB 3LZ1C 4AWLC 1HQ3B 3AZMC 2PYOD 3AZEC 1M1AC 5CPID 5AVCB 5FUGA 4R8PC 3AYWC 3VH5A 4ZBJC 2NZDC 1B6WA 1U35D 4XZQB 3O62B 3UTAB 5BO0A 4WV4B 1P3KA 1S32B 2F8NA 5B33C 5CPJC 5GT0A 3B0CW 3MGRA 5BT1D 3UT9B 4XUJA 3KWQA 1P3KD 2F8ND 5BS7C 5DNNC 3VH6A 5DNMB 1KX5C 1P3PA 5GT0D 3R45B 3MGRD 4XUJD 3KWQD 3AZNB 3W98B 4WU9A 5CPKB 1ZLAA 1P3PD 2NQBA 5AY8A 3AZJC 4WU9D 4JJNB 2AROC 4Z5TA 1ZLAD 1F1EA 3AZLB 2NQBD 1EQZB 3B6FA 1BH9A 4E44A 3MNND 5B1LD 1P3AB 4Z5TD 3AZGC 3MVDB 5B40A 3B6FD 1KX3C 3X1TC 5AVCA 2IO5C 5B32B 5B31B 5B40D 4WU8A 4YM6B 3LELB 2BYMA 1M18B 5AVCD 5B2IC 4J8XB 3AZMA 4YS3B 4WU8D 2HUEC 5B0YB 4J8VA 3AZMD 1KU5A 3AYWA 1KX4B 3AZED 1ULYA 5AVBC 4J8VD 4ZUXB 4QLCA 3C1BA 5DNMA 4CSRB 4H9OA 3AYWD 5E5AB 1F66B 3AZNA 3MGQB 4QLCD 3REHC 3C1BD 5DNMD 5CPJA 3AZKC 5CP6A 3AV1B 1P3GC 4J8UB 3X1VC 3AFAA 5CPJD 4NE5A 5DNNA 3KUYB 2L5AA 5CP6D 3AZHB 4Z2MG 3AZIC 3AFAD 3X1UC 5DNND 3WTPE 1KX5D 3X1SB 3W99B 5F99A 3MVDA 1TZYB 1P3LC 5C3IB 2AROA 1N1JB 5CPIB 1P3IB 2FJ7A 5F99D 4YM6A 2AROD 4H9NA 1U35B 3WA9C 3AZGA 1P3FC 4H9PA 2FJ7D 4YM6D 1BH8A 3WTPC 1KX3A 3AZGD 2HIOC 3REJB 1KX3D 3X1TD 5JRGC 3MGSC 1P3OA 2F8NB 4HGAC 3MGRB 4XUJB 3KWQB 1P3OD 3RELC 3B6GC 3AV2B
chains in the Genus database with same CATH superfamily
1P3PB 4EO5B 4J8UA 5AVBA 4WU9B 3LZ0C 3AL0C 1M19C 3AZHA 3TU4C 1ZLAB 4J8UD 5AVBD 3REHA 3MNNB 5B1LB 4Z2MH 4Z5TB 5GT3C 1P3GA 4KUDC 2Y2OA 5AV9C 3X1VA 3REHD 5G49A 2CV5C 1P3BC 3MGPB 3B6FB 1BH9B 3UTBC 3AZKD 5GSUC 1P3IA 2Y2PA 1P3GD 3A1IA 5B2JC 4X23A 3X1VD 5B40B 1B67A 3X1UA 1U35A 4H9QA 3AZFB 1P3ID 2Y2LA 3AN2C 4X23D 1P3LA 4WU8B 3X1UD 2BYMB 5AV5A 3REKC 3AZMB 4J8WA 4AWLB 3REJA 1P3LD 2VQRA 4G92C 3AZEB 2Y2IA 5AV5D 4J8VB 1M1AB 4R8PB 4J8WD 3AYWB 3REJD 3WTPA 4XZQC 4ZBJB 2F8NK 2NZDB 4QLCB 3P5JB 4WNNA 3C1BB 3AV2A 4H9OB 2DQNC 3WTPD 3W97C 3NQJA 3AV2D 5CPJB 2HIOD 1P3MC 5CP6B 2UWXA 3MNNA 2ZY5A 3REIC 5B1LA 3AFAB 3B6GA 5DNNB 1KX5B 5B32G 3LJAC 5B31G 3MGPA 3W96C 3RELD 3B6GD 4KGCC 5F99B 3MGPD 5B24C 5AV6C 3AZFA 2AROB 5GT3A 3AZLC 4KUDA 2FJ7B 5AV9A 2CV5A 1P3BA 1P3AC 3AZFD 1P34C 2Y2MA 5GSUA 3EPJA 4H9NB 5GT3D 3AZGB 3LZ1A 4KUDD 4H9PB 5AV9D 2CV5D 1P3BD 3AZEA 1BH8B 1M1AA 1KX3B 5GSUD 3X1TB 5AV8C 4R8PA 3LZ1D 3LELC 2IO5B 3KXBC 2NZDA 1M1AD 2Y2HA 3REKA 4R8PD 1P3OB 2NZDD 2HUEB 5GXQC 3WAAC 5B33A 3REKD 1H3OB 5AVBB 2RVQC 5BS7A 5B33D 4LD9C 5KDMA 3B0DC 1KX5A 3MGQC 3REHB 4E45A 3WKJC 3AZKB 1AOIC 2ZM5A 1P3GB 3AZJA 3A6NC 3X1VB 5G49B 3REIA 4UPKA 2J8PA 3C1CC 3LJAA 3AZJD 4X23B 3W96A 3REID 3X1UB 4H9QB 2BYKA 2PYOC 5CHLB 3LJAD 2F8NG 5AV6A 1P3LB 2G5IC 4M6BA 3X1TA 1ID3C 3W96D 3NQUB 5AV5B 3H0MC 4J8WB 4WZSB 5AV6D 1P34A 1A7WA 5B1MC 3F6TA 4Z66C 5B2IA 3WA9B 2BG1A 3WTPB 1P34D 2Y2QA 5B2ID 5AV8A 4WNNB 1H3OA 2HIOB 1P3KC 3NQJB 4G91C 5AV8D 5GT0C 2F2AC 4HGAB 4XUJC 3KFUG 3WAAA 3AZKA 3RELB 3B6GB 5GXQD 4WU9C 3WAAD 3EPHA 1ZLAC 3LZ0B 2NQBC 5AY8C 1Q9CA 3AZIA 2W8SA 4LD9D 3WKJA 5B0ZC 2YFWB 5GT3B 4KUDB 3AZID 5AV9B 2CV5B 1P3BB 3NQUA 4KHAA 3WKJD 1HQ3C 5GSUB 3LZ1B 5JA4A 5AVCC 3WA9A 1P3FA 3AN2B 2ZY4A 1ID3A 3WA9D 1WWSA 1P3FD 3O62C 3UTAC 3REKB 2HIOA 2LY8A 3VH5T 5B1MA 2JSSA 4J8VC 1S32C 5JRGA 4Z66A 4G92B 1ID3D 3MGSA 5B33B 2Y2KA 3UT9C 4H9RA 5B1MD 4QLCC 5JRGD 4Z66D 5DNMC 3C1BC 3MGSD 3RELA 4H9SC 5KDMB 3AZNC 3W98C 3W97B 5CPKC 3LZ0A 3VH6T 5CP6C 1M19A 3TU4A 1P3MB 4NE3A 4JJNC 1BFMA 3AFAC 3AZJB 3LZ0D 3REIB 1M19D 2YFWA 3TU4D 1EQZC 3LJAB 3UTBA 4UUZA 3W96B 5F99C 3MVDC 5B2JA 2G5HC 2BYKB 4KGCB 2ZY3A 1TAFB 5B24B 5AV6B 3UTBD 5B0ZA 2YFVA 5B32C 3V9RA 5B31C 3AN2A 4CAYA 5B2JD 4YM6C 5AY8D 2FJ7C 1M18C 4J8XC 1P34B 5BNXA 5BNVB 5B0ZD 4YS3C 1HQ3A 3AN2D 5B2IB 5B0YC 3B0CT 1KX4C 1HQ3D 5AV8B 1WWIA 3KXBB 4XZQA 4ZUXC 1P3OC 1HTAA 3O62A 3UTAA 5E5AC 1JFIB 1F66C 2Y2JA 3W97A 4XZQD 1S32A 2RIQA 5GXQB 3O62D 3UTAD 4WJ3C 3WAAB 3AV1C 3UT9A 2XD5A 4J8UC 1P3MA 3W97D 1S32D 3KUYC 1PZRA 3KSYA 4H9SA 3R45A 4LD9B 3AZHC 3B0DB 3EPKA 3UT9D 1P3MD 3W98A 4DRAA 1R4VA 5CPKA 3AZIB 3X1SC 4DRBA 3W99C 3WKJB 1TZYC 3AZND 1AOIB 3W98D 4KGCA 1TAFA 5C3IC 4JJNA 5B24A 5CPKD 3A6NB 5CPIC 1P3IC 4KHAB 3AZLA 1EQZA 4X23C 4KGCD 4JJND 3C1CB 5B24D 1U35C 1P3AA 5BNVA 5JA4B 3AZLD 1EQZD 1P3FB 2PYOB 1P3AD 5AV5C 1ID3B 5B32A 5B31A 3MVDD 3LELA 4J8WC 3KXBA 3REJC 1M18A 5BT1C 4J8XA 5B1MB 4YS3A 5JRGB 4Z66B 5B32D 5FUGB 5B31D 3LELD 3MGSB 5B0YA 1JFIA 3KXBD 3MGRC 1M18D 2DF4C 3KWQC 4J8XD 5GXQA 4H9RB 4NE6A 4YS3D 1KX4A 3AV2C 5B0YD 1P3PC 4EO5C 5BO0B 4ZUXA 2JE5A 4CSRA 1P3KB 1KX4D 4G91B 3VH5W 5E5AA 4LD9A 1F66A 2CWEA 1M19B 5GT0B 4ZUXD 3MGQA 3TU4B 2RVQD 3MNNC 5B1LC 4Z5TC 5E5AD 3AV1A 1F66D 1AOIA 3MGQD 3MGPC 3B0BA 3B6FC 3A6NA 3KUYA 3AV1D 3UTBB 1AOID 2F8NH 4UUZB 3C1CA 5B40C 5B2JB 2NQBB 5AY8B 3A6ND 3VH6W 3KUYD 3AZFC 3X1SA 3W99A 3AZHD 1TZYA 2YFVB 5B0ZB 3V9RB 2PYOA 3C1CD 4NFTA 4CAYB 4WU8C 3X1SD 1N1JA 5CPIA 3W99D 1TZYD 5BNXB 3LZ1C 4AWLC 1HQ3B 3AZMC 2PYOD 3AZEC 1M1AC 5CPID 5AVCB 5FUGA 4R8PC 3AYWC 3VH5A 2Y2NA 4ZBJC 2NZDC 1B6WA 1U35D 4XZQB 3O62B 3UTAB 5BO0A 4WV4B 3EPLA 1P3KA 1S32B 2F8NA 5B33C 5CPJC 5GT0A 3B0CW 3MGRA 5BT1D 3UT9B 4XUJA 3KWQA 1P3KD 1W2EA 2F8ND 5BS7C 5DNNC 3VH6A 5DNMB 1KX5C 1P3PA 5GT0D 3R45B 3MGRD 4XUJD 3KWQD 3AZNB 3W98B 4WU9A 5CPKB 1ZLAA 1P3PD 2NQBA 5AY8A 3AZJC 2ZY2A 4WU9D 4JJNB 2AROC 4Z5TA 1ZLAD 1F1EA 3AZLB 2NQBD 1EQZB 1T3UA 3B6FA 1BH9A 4E44A 3MNND 5B1LD 1P3AB 4Z5TD 3AZGC 3MVDB 5B40A 3B6FD 3A1KA 1KX3C 3X1TC 5AVCA 4DQYB 2IO5C 5B32B 5B31B 5B40D 4WU8A 4YM6B 3LELB 2BYMA 1M18B 5AVCD 5B2IC 4J8XB 1Z2CB 3AZMA 4YS3B 4WU8D 2HUEC 5B0YB 2JCHA 4J8VA 3FDDA 3AZMD 1KU5A 3AYWA 1KX4B 3AZED 1ULYA 5AVBC 4J8VD 4ZUXB 4QLCA 3C1BA 5DNMA 4CSRB 4H9OA 3AYWD 3EG5B 5E5AB 1F66B 3AZNA 3MGQB 4QLCD 3REHC 3C1BD 5DNMD 5CPJA 3AZKC 5CP6A 3AV1B 1P3GC 4J8UB 3X1VC 3AFAA 5CPJD 4NE5A 5DNNA 3KUYB 2L5AA 5CP6D 3AZHB 4Z2MG 3AZIC 3AFAD 3X1UC 5DNND 3WTPE 1KX5D 3X1SB 3W99B 5F99A 3MVDA 1TZYB 1P3LC 5C3IB 2XD1A 2AROA 1N1JB 5CPIB 1P3IB 2FJ7A 5F99D 4YM6A 2Y2GA 3H0LC 2AROD 4H9NA 1U35B 3WA9C 3AZGA 1P3FC 4H9PA 2FJ7D 4YM6D 1BH8A 3WTPC 1KX3A 3AZGD 2HIOC 3REJB 1KX3D 3X1TD 5JRGC 3MGSC 1P3OA 2F8NB 4HGAC 3H0RC 3MGRB 2FFFB 4XUJB 3KWQB 3IP4C 1P3OD 3RELC 3B6GC 3AV2B
chains in the Genus database with same CATH topology
1P3PB 4EO5B 4J8UA 5AVBA 4WU9B 3LZ0C 3AL0C 1M19C 3AZHA 3TU4C 1ZLAB 4J8UD 5AVBD 3REHA 3MNNB 5B1LB 4Z2MH 4Z5TB 5GT3C 1P3GA 4KUDC 2Y2OA 5AV9C 3X1VA 3REHD 5G49A 2CV5C 1P3BC 3MGPB 3B6FB 1BH9B 3UTBC 3AZKD 5GSUC 1P3IA 2Y2PA 1P3GD 3A1IA 5B2JC 4X23A 3X1VD 5B40B 1B67A 3X1UA 1U35A 4H9QA 3AZFB 1P3ID 2Y2LA 3AN2C 4X23D 1P3LA 4WU8B 3X1UD 2BYMB 5AV5A 3REKC 3AZMB 4J8WA 4AWLB 3REJA 1P3LD 2VQRA 4G92C 3AZEB 2Y2IA 5AV5D 4J8VB 1M1AB 4R8PB 4J8WD 3AYWB 3REJD 3WTPA 4XZQC 4ZBJB 2F8NK 2NZDB 4QLCB 3P5JB 4WNNA 3C1BB 3AV2A 4H9OB 2DQNC 3WTPD 3W97C 3NQJA 3AV2D 5CPJB 2HIOD 1P3MC 5CP6B 2UWXA 3MNNA 2ZY5A 3REIC 5B1LA 3AFAB 3B6GA 5DNNB 1KX5B 5B32G 3LJAC 5B31G 3MGPA 3W96C 3RELD 3B6GD 4KGCC 5F99B 3MGPD 5B24C 5AV6C 3AZFA 2AROB 5GT3A 3AZLC 4KUDA 2FJ7B 5AV9A 2CV5A 1P3BA 1P3AC 3AZFD 1P34C 2Y2MA 5GSUA 3EPJA 4H9NB 5GT3D 3AZGB 3LZ1A 4KUDD 4H9PB 5AV9D 2CV5D 1P3BD 3AZEA 1BH8B 1M1AA 1KX3B 5GSUD 3X1TB 5AV8C 4R8PA 3LZ1D 3LELC 2IO5B 3KXBC 2NZDA 1M1AD 2Y2HA 3REKA 4R8PD 1P3OB 2NZDD 2HUEB 5GXQC 3WAAC 5B33A 3REKD 1H3OB 5AVBB 2RVQC 5BS7A 5B33D 4LD9C 5KDMA 3B0DC 1KX5A 3MGQC 3REHB 4E45A 3WKJC 3AZKB 1AOIC 2ZM5A 1P3GB 3AZJA 3A6NC 3X1VB 5G49B 3REIA 4UPKA 2J8PA 3C1CC 3LJAA 3AZJD 4X23B 3W96A 3REID 3X1UB 4H9QB 2BYKA 2PYOC 5CHLB 3LJAD 2F8NG 5AV6A 1P3LB 2G5IC 4M6BA 3X1TA 1ID3C 3W96D 3NQUB 5AV5B 3H0MC 4J8WB 4WZSB 5AV6D 1P34A 1A7WA 5B1MC 3F6TA 4Z66C 5B2IA 3WA9B 2BG1A 3WTPB 1P34D 2Y2QA 5B2ID 5AV8A 4WNNB 1H3OA 2HIOB 1P3KC 3NQJB 4G91C 5AV8D 5GT0C 2F2AC 4HGAB 4XUJC 3KFUG 3WAAA 3AZKA 3RELB 3B6GB 5GXQD 4WU9C 3WAAD 3EPHA 1ZLAC 3LZ0B 2NQBC 5AY8C 1Q9CA 3AZIA 2W8SA 4LD9D 3WKJA 5B0ZC 2YFWB 5GT3B 4KUDB 3AZID 5AV9B 2CV5B 1P3BB 3NQUA 4KHAA 3WKJD 1HQ3C 5GSUB 3LZ1B 5JA4A 5AVCC 3WA9A 1P3FA 3AN2B 2ZY4A 1ID3A 3WA9D 1WWSA 1P3FD 3O62C 3UTAC 3REKB 2HIOA 2LY8A 3VH5T 5B1MA 2JSSA 4J8VC 1S32C 5JRGA 4Z66A 4G92B 1ID3D 3MGSA 5B33B 2Y2KA 3UT9C 4H9RA 5B1MD 4QLCC 5JRGD 4Z66D 5DNMC 3C1BC 3MGSD 3RELA 4H9SC 5KDMB 3AZNC 3W98C 3W97B 5CPKC 3LZ0A 3VH6T 5CP6C 1M19A 3TU4A 1P3MB 4NE3A 4JJNC 1BFMA 3AFAC 3AZJB 3LZ0D 3REIB 1M19D 2YFWA 3TU4D 1EQZC 3LJAB 3UTBA 4UUZA 3W96B 5F99C 3MVDC 5B2JA 2G5HC 2BYKB 4KGCB 2ZY3A 1TAFB 5B24B 5AV6B 3UTBD 5B0ZA 2YFVA 5B32C 3V9RA 5B31C 3AN2A 4CAYA 5B2JD 4YM6C 5AY8D 2FJ7C 1M18C 4J8XC 1P34B 5BNXA 5BNVB 5B0ZD 4YS3C 1HQ3A 3AN2D 5B2IB 5B0YC 3B0CT 1KX4C 1HQ3D 5AV8B 1WWIA 3KXBB 4XZQA 4ZUXC 1P3OC 1HTAA 3O62A 3UTAA 5E5AC 1JFIB 1F66C 2Y2JA 3W97A 4XZQD 1S32A 2RIQA 5GXQB 3O62D 3UTAD 4WJ3C 3WAAB 3AV1C 3UT9A 2XD5A 4J8UC 1P3MA 3W97D 1S32D 3KUYC 1PZRA 3KSYA 4H9SA 3R45A 4LD9B 3AZHC 3B0DB 3EPKA 3UT9D 1P3MD 3W98A 4DRAA 1R4VA 5CPKA 3AZIB 3X1SC 4DRBA 3W99C 3WKJB 1TZYC 3AZND 1AOIB 3W98D 4KGCA 1TAFA 5C3IC 4JJNA 5B24A 5CPKD 3A6NB 5CPIC 1P3IC 4KHAB 3AZLA 1EQZA 4X23C 4KGCD 4JJND 3C1CB 5B24D 1U35C 1P3AA 5BNVA 5JA4B 3AZLD 1EQZD 1P3FB 2PYOB 1P3AD 5AV5C 1ID3B 5B32A 5B31A 3MVDD 3LELA 4J8WC 3KXBA 3REJC 1M18A 5BT1C 4J8XA 5B1MB 4YS3A 5JRGB 4Z66B 5B32D 5FUGB 5B31D 3LELD 3MGSB 5B0YA 1JFIA 3KXBD 3MGRC 1M18D 2DF4C 3KWQC 4J8XD 5GXQA 4H9RB 4NE6A 4YS3D 1KX4A 3AV2C 5B0YD 1P3PC 4EO5C 5BO0B 4ZUXA 2JE5A 4CSRA 1P3KB 1KX4D 4G91B 3VH5W 5E5AA 4LD9A 1F66A 2CWEA 1M19B 5GT0B 4ZUXD 3MGQA 3TU4B 2RVQD 3MNNC 5B1LC 4Z5TC 5E5AD 3AV1A 1F66D 1AOIA 3MGQD 3MGPC 3B0BA 3B6FC 3A6NA 3KUYA 3AV1D 3UTBB 1AOID 2F8NH 4UUZB 3C1CA 5B40C 5B2JB 2NQBB 5AY8B 3A6ND 3VH6W 3KUYD 3AZFC 3X1SA 3W99A 3AZHD 1TZYA 2YFVB 5B0ZB 3V9RB 2PYOA 3C1CD 4NFTA 4CAYB 4WU8C 3X1SD 1N1JA 5CPIA 3W99D 1TZYD 5BNXB 3LZ1C 4AWLC 1HQ3B 3AZMC 2PYOD 3AZEC 1M1AC 5CPID 5AVCB 5FUGA 4R8PC 3AYWC 3VH5A 2Y2NA 4ZBJC 2NZDC 1B6WA 1U35D 4XZQB 3O62B 3UTAB 5BO0A 4WV4B 3EPLA 1P3KA 1S32B 2F8NA 5B33C 5CPJC 5GT0A 3B0CW 3MGRA 5BT1D 3UT9B 4XUJA 3KWQA 1P3KD 1W2EA 2F8ND 5BS7C 5DNNC 3VH6A 5DNMB 1KX5C 1P3PA 5GT0D 3R45B 3MGRD 4XUJD 3KWQD 3AZNB 3W98B 4WU9A 5CPKB 1ZLAA 1P3PD 2NQBA 5AY8A 3AZJC 2ZY2A 4WU9D 4JJNB 2AROC 4Z5TA 1ZLAD 1F1EA 3AZLB 2NQBD 1EQZB 1T3UA 3B6FA 1BH9A 4E44A 3MNND 5B1LD 1P3AB 4Z5TD 3AZGC 3MVDB 5B40A 3B6FD 3A1KA 1KX3C 3X1TC 5AVCA 4DQYB 2IO5C 5B32B 5B31B 5B40D 4WU8A 4YM6B 3LELB 2BYMA 1M18B 5AVCD 5B2IC 4J8XB 1Z2CB 3AZMA 4YS3B 4WU8D 2HUEC 5B0YB 2JCHA 4J8VA 3FDDA 3AZMD 1KU5A 3AYWA 1KX4B 3AZED 1ULYA 5AVBC 4J8VD 4ZUXB 4QLCA 3C1BA 5DNMA 4CSRB 4H9OA 3AYWD 3EG5B 5E5AB 1F66B 3AZNA 3MGQB 4QLCD 3REHC 3C1BD 5DNMD 5CPJA 3AZKC 5CP6A 3AV1B 1P3GC 4J8UB 3X1VC 3AFAA 5CPJD 4NE5A 5DNNA 3KUYB 2L5AA 5CP6D 3AZHB 4Z2MG 3AZIC 3AFAD 3X1UC 5DNND 3WTPE 1KX5D 3X1SB 3W99B 5F99A 3MVDA 1TZYB 1P3LC 5C3IB 2XD1A 2AROA 1N1JB 5CPIB 1P3IB 2FJ7A 5F99D 4YM6A 2Y2GA 3H0LC 2AROD 4H9NA 1U35B 3WA9C 3AZGA 1P3FC 4H9PA 2FJ7D 4YM6D 1BH8A 3WTPC 1KX3A 3AZGD 2HIOC 3REJB 1KX3D 3X1TD 5JRGC 3MGSC 1P3OA 2F8NB 4HGAC 3H0RC 3MGRB 2FFFB 4XUJB 3KWQB 3IP4C 1P3OD 3RELC 3B6GC 3AV2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3P B;  4EO5 B;  4J8U A;  5AVB A;  4WU9 B;  3LZ0 C;  1M19 C;  3AZH A;  3TU4 C;  1ZLA B;  4J8U D;  5AVB D;  3REH A;  3MNN B;  5B1L B;  4Z2M H;  4Z5T B;  5GT3 C;  1P3G A;  4KUD C;  5AV9 C;  3X1V A;  3REH D;  5G49 A;  2CV5 C;  1P3B C;  3MGP B;  3B6F B;  1BH9 B;  3UTB C;  3AZK D;  5GSU C;  1P3I A;  1P3G D;  5B2J C;  4X23 A;  3X1V D;  5B40 B;  1B67 A;  3X1U A;  1U35 A;  4H9Q A;  3AZF B;  1P3I D;  3AN2 C;  4X23 D;  1P3L A;  4WU8 B;  3X1U D;  2BYM B;  5AV5 A;  3REK C;  3AZM B;  4J8W A;  4AWL B;  3REJ A;  1P3L D;  4G92 C;  3AZE B;  5AV5 D;  4J8V B;  1M1A B;  4R8P B;  4J8W D;  3AYW B;  3REJ D;  3WTP A;  4XZQ C;  4ZBJ B;  2F8N K;  2NZD B;  4QLC B;  4WNN A;  3C1B B;  3AV2 A;  4H9O B;  3WTP D;  3W97 C;  3NQJ A;  3AV2 D;  5CPJ B;  2HIO D;  1P3M C;  5CP6 B;  3MNN A;  3REI C;  5B1L A;  3AFA B;  3B6G A;  5DNN B;  1KX5 B;  5B32 G;  3LJA C;  5B31 G;  3MGP A;  3W96 C;  3REL D;  3B6G D;  4KGC C;  5F99 B;  3MGP D;  5B24 C;  5AV6 C;  3AZF A;  2ARO B;  5GT3 A;  3AZL C;  4KUD A;  2FJ7 B;  5AV9 A;  2CV5 A;  1P3B A;  1P3A C;  3AZF D;  1P34 C;  5GSU A;  4H9N B;  5GT3 D;  3AZG B;  3LZ1 A;  4KUD D;  4H9P B;  5AV9 D;  2CV5 D;  1P3B D;  3AZE A;  1BH8 B;  1M1A A;  1KX3 B;  5GSU D;  3X1T B;  5AV8 C;  4R8P A;  3LZ1 D;  3LEL C;  2IO5 B;  3KXB C;  2NZD A;  1M1A D;  3REK A;  4R8P D;  1P3O B;  2NZD D;  2HUE B;  5GXQ C;  3WAA C;  5B33 A;  3REK D;  1H3O B;  5AVB B;  2RVQ C;  5BS7 A;  5B33 D;  4LD9 C;  5KDM A;  3B0D C;  1KX5 A;  3MGQ C;  3REH B;  4E45 A;  3WKJ C;  3AZK B;  1AOI C;  1P3G B;  3AZJ A;  3A6N C;  3X1V B;  5G49 B;  3REI A;  3C1C C;  3LJA A;  3AZJ D;  4X23 B;  3W96 A;  3REI D;  3X1U B;  4H9Q B;  2BYK A;  2PYO C;  5CHL B;  3LJA D;  2F8N G;  5AV6 A;  1P3L B;  4M6B A;  3W96 D;  3X1T A;  1ID3 C;  3NQU B;  5AV5 B;  4J8W B;  4WZS B;  5AV6 D;  1P34 A;  1A7W A;  5B1M C;  4Z66 C;  5B2I A;  3WA9 B;  3WTP B;  1P34 D;  5B2I D;  5AV8 A;  4WNN B;  1H3O A;  2HIO B;  1P3K C;  3NQJ B;  4G91 C;  5AV8 D;  5GT0 C;  4HGA B;  4XUJ C;  3WAA A;  3AZK A;  3REL B;  3B6G B;  5GXQ D;  4WU9 C;  3WAA D;  1ZLA C;  3LZ0 B;  2NQB C;  5AY8 C;  1Q9C A;  3AZI A;  4LD9 D;  3WKJ A;  5B0Z C;  2YFW B;  5GT3 B;  4KUD B;  3AZI D;  5AV9 B;  2CV5 B;  1P3B B;  3NQU A;  4KHA A;  3WKJ D;  1HQ3 C;  5GSU B;  3LZ1 B;  5JA4 A;  5AVC C;  3WA9 A;  1P3F A;  3AN2 B;  1ID3 A;  3WA9 D;  1WWS A;  1P3F D;  3O62 C;  3UTA C;  3REK B;  2HIO A;  2LY8 A;  3VH5 T;  5B1M A;  2JSS A;  4J8V C;  1S32 C;  5JRG A;  4Z66 A;  4G92 B;  1ID3 D;  3MGS A;  5B33 B;  3UT9 C;  4H9R A;  5B1M D;  4QLC C;  5JRG D;  4Z66 D;  5DNM C;  3C1B C;  3MGS D;  3REL A;  4H9S C;  5KDM B;  3AZN C;  3W98 C;  3W97 B;  5CPK C;  3LZ0 A;  3VH6 T;  5CP6 C;  1M19 A;  3TU4 A;  1P3M B;  4NE3 A;  4JJN C;  1BFM A;  3AFA C;  3AZJ B;  3LZ0 D;  3REI B;  1M19 D;  2YFW A;  3TU4 D;  1EQZ C;  3LJA B;  3UTB A;  4UUZ A;  3W96 B;  5F99 C;  3MVD C;  5B2J A;  2BYK B;  4KGC B;  1TAF B;  5B24 B;  5AV6 B;  3UTB D;  5B0Z A;  2YFV A;  5B32 C;  3V9R A;  5B31 C;  3AN2 A;  4CAY A;  5B2J D;  4YM6 C;  5AY8 D;  2FJ7 C;  1M18 C;  4J8X C;  1P34 B;  5BNX A;  5BNV B;  5B0Z D;  4YS3 C;  1HQ3 A;  3AN2 D;  5B2I B;  5B0Y C;  3B0C T;  1KX4 C;  1HQ3 D;  5AV8 B;  1WWI A;  3KXB B;  4XZQ A;  4ZUX C;  1P3O C;  1HTA A;  3O62 A;  3UTA A;  5E5A C;  1JFI B;  1F66 C;  3W97 A;  4XZQ D;  1S32 A;  5GXQ B;  3O62 D;  3UTA D;  3WAA B;  3AV1 C;  3UT9 A;  1P3M A;  4J8U C;  3W97 D;  1S32 D;  3KUY C;  3KSY A;  4H9S A;  3R45 A;  4LD9 B;  3AZH C;  3B0D B;  3UT9 D;  1P3M D;  3W98 A;  4DRA A;  1R4V A;  5CPK A;  3AZI B;  3X1S C;  4DRB A;  3W99 C;  3WKJ B;  1TZY C;  3AZN D;  1AOI B;  3W98 D;  4KGC A;  1TAF A;  5C3I C;  4JJN A;  5B24 A;  5CPK D;  3A6N B;  5CPI C;  1P3I C;  4KHA B;  3AZL A;  1EQZ A;  4X23 C;  4KGC D;  4JJN D;  3C1C B;  5B24 D;  1U35 C;  1P3A A;  5BNV A;  5JA4 B;  3AZL D;  1EQZ D;  1P3F B;  2PYO B;  1P3A D;  5AV5 C;  1ID3 B;  5B32 A;  5B31 A;  3MVD D;  3LEL A;  4J8W C;  3KXB A;  3REJ C;  1M18 A;  5BT1 C;  4J8X A;  5B1M B;  4YS3 A;  5JRG B;  4Z66 B;  5B32 D;  5FUG B;  5B31 D;  3LEL D;  3MGS B;  5B0Y A;  1JFI A;  3KXB D;  3MGR C;  1M18 D;  3KWQ C;  4J8X D;  5GXQ A;  4H9R B;  4NE6 A;  4YS3 D;  1KX4 A;  3AV2 C;  5B0Y D;  1P3P C;  4EO5 C;  5BO0 B;  4ZUX A;  4CSR A;  1P3K B;  1KX4 D;  4G91 B;  3VH5 W;  5E5A A;  4LD9 A;  1F66 A;  2CWE A;  1M19 B;  5GT0 B;  4ZUX D;  3MGQ A;  3TU4 B;  2RVQ D;  3MNN C;  5B1L C;  4Z5T C;  5E5A D;  3AV1 A;  1F66 D;  1AOI A;  3MGQ D;  3MGP C;  3B0B A;  3B6F C;  3A6N A;  3KUY A;  3AV1 D;  3UTB B;  1AOI D;  2F8N H;  4UUZ B;  3C1C A;  5B40 C;  5B2J B;  2NQB B;  5AY8 B;  3A6N D;  3VH6 W;  3KUY D;  3AZF C;  3X1S A;  3W99 A;  3AZH D;  1TZY A;  2YFV B;  5B0Z B;  3V9R B;  2PYO A;  3C1C D;  4NFT A;  4CAY B;  4WU8 C;  3X1S D;  1N1J A;  5CPI A;  3W99 D;  1TZY D;  5BNX B;  3LZ1 C;  4AWL C;  1HQ3 B;  3AZM C;  2PYO D;  3AZE C;  1M1A C;  5CPI D;  5AVC B;  5FUG A;  4R8P C;  3AYW C;  3VH5 A;  4ZBJ C;  2NZD C;  1B6W A;  1U35 D;  4XZQ B;  3O62 B;  3UTA B;  5BO0 A;  4WV4 B;  1P3K A;  1S32 B;  2F8N A;  5B33 C;  5CPJ C;  5GT0 A;  3B0C W;  3MGR A;  5BT1 D;  3UT9 B;  4XUJ A;  3KWQ A;  1P3K D;  2F8N D;  5BS7 C;  5DNN C;  3VH6 A;  5DNM B;  1KX5 C;  1P3P A;  5GT0 D;  3R45 B;  3MGR D;  4XUJ D;  3KWQ D;  3AZN B;  3W98 B;  4WU9 A;  5CPK B;  1ZLA A;  1P3P D;  2NQB A;  5AY8 A;  3AZJ C;  4WU9 D;  4JJN B;  2ARO C;  4Z5T A;  1ZLA D;  1F1E A;  3AZL B;  2NQB D;  1EQZ B;  3B6F A;  1BH9 A;  4E44 A;  3MNN D;  5B1L D;  1P3A B;  4Z5T D;  3AZG C;  3MVD B;  5B40 A;  3B6F D;  1KX3 C;  3X1T C;  5AVC A;  2IO5 C;  5B32 B;  5B31 B;  5B40 D;  4WU8 A;  4YM6 B;  3LEL B;  2BYM A;  1M18 B;  5AVC D;  5B2I C;  4J8X B;  3AZM A;  4YS3 B;  4WU8 D;  2HUE C;  5B0Y B;  4J8V A;  3AZM D;  1KU5 A;  3AYW A;  1KX4 B;  3AZE D;  1ULY A;  5AVB C;  4J8V D;  4ZUX B;  4QLC A;  3C1B A;  5DNM A;  4CSR B;  4H9O A;  3AYW D;  5E5A B;  1F66 B;  3AZN A;  3MGQ B;  4QLC D;  3REH C;  3C1B D;  5DNM D;  5CPJ A;  3AZK C;  5CP6 A;  3AV1 B;  1P3G C;  4J8U B;  3X1V C;  3AFA A;  5CPJ D;  4NE5 A;  5DNN A;  3KUY B;  2L5A A;  5CP6 D;  3AZH B;  4Z2M G;  3AZI C;  3AFA D;  3X1U C;  5DNN D;  3WTP E;  1KX5 D;  3X1S B;  3W99 B;  5F99 A;  3MVD A;  1TZY B;  1P3L C;  5C3I B;  2ARO A;  1N1J B;  5CPI B;  1P3I B;  2FJ7 A;  5F99 D;  4YM6 A;  2ARO D;  4H9N A;  1U35 B;  3WA9 C;  3AZG A;  1P3F C;  4H9P A;  2FJ7 D;  4YM6 D;  1BH8 A;  3WTP C;  1KX3 A;  3AZG D;  2HIO C;  3REJ B;  1KX3 D;  3X1T D;  5JRG C;  3MGS C;  1P3O A;  2F8N B;  4HGA C;  3MGR B;  4XUJ B;  3KWQ B;  1P3O D;  3REL C;  3B6G C;  3AV2 B; 
#chains in the Genus database with same CATH topology
 1P3P B;  4EO5 B;  4J8U A;  5AVB A;  4WU9 B;  3LZ0 C;  3AL0 C;  1M19 C;  3AZH A;  3TU4 C;  1ZLA B;  4J8U D;  5AVB D;  3REH A;  3MNN B;  5B1L B;  4Z2M H;  4Z5T B;  5GT3 C;  1P3G A;  4KUD C;  2Y2O A;  5AV9 C;  3X1V A;  3REH D;  5G49 A;  2CV5 C;  1P3B C;  3MGP B;  3B6F B;  1BH9 B;  3UTB C;  3AZK D;  5GSU C;  1P3I A;  2Y2P A;  1P3G D;  3A1I A;  5B2J C;  4X23 A;  3X1V D;  5B40 B;  1B67 A;  3X1U A;  1U35 A;  4H9Q A;  3AZF B;  1P3I D;  2Y2L A;  3AN2 C;  4X23 D;  1P3L A;  4WU8 B;  3X1U D;  2BYM B;  5AV5 A;  3REK C;  3AZM B;  4J8W A;  4AWL B;  3REJ A;  1P3L D;  2VQR A;  4G92 C;  3AZE B;  2Y2I A;  5AV5 D;  4J8V B;  1M1A B;  4R8P B;  4J8W D;  3AYW B;  3REJ D;  3WTP A;  4XZQ C;  4ZBJ B;  2F8N K;  2NZD B;  4QLC B;  3P5J B;  4WNN A;  3C1B B;  3AV2 A;  4H9O B;  2DQN C;  3WTP D;  3W97 C;  3NQJ A;  3AV2 D;  5CPJ B;  2HIO D;  1P3M C;  5CP6 B;  2UWX A;  3MNN A;  2ZY5 A;  3REI C;  5B1L A;  3AFA B;  3B6G A;  5DNN B;  1KX5 B;  5B32 G;  3LJA C;  5B31 G;  3MGP A;  3W96 C;  3REL D;  3B6G D;  4KGC C;  5F99 B;  3MGP D;  5B24 C;  5AV6 C;  3AZF A;  2ARO B;  5GT3 A;  3AZL C;  4KUD A;  2FJ7 B;  5AV9 A;  2CV5 A;  1P3B A;  1P3A C;  3AZF D;  1P34 C;  2Y2M A;  5GSU A;  3EPJ A;  4H9N B;  5GT3 D;  3AZG B;  3LZ1 A;  4KUD D;  4H9P B;  5AV9 D;  2CV5 D;  1P3B D;  3AZE A;  1BH8 B;  1M1A A;  1KX3 B;  5GSU D;  3X1T B;  5AV8 C;  4R8P A;  3LZ1 D;  3LEL C;  2IO5 B;  3KXB C;  2NZD A;  1M1A D;  2Y2H A;  3REK A;  4R8P D;  1P3O B;  2NZD D;  2HUE B;  5GXQ C;  3WAA C;  5B33 A;  3REK D;  1H3O B;  5AVB B;  2RVQ C;  5BS7 A;  5B33 D;  4LD9 C;  5KDM A;  3B0D C;  1KX5 A;  3MGQ C;  3REH B;  4E45 A;  3WKJ C;  3AZK B;  1AOI C;  2ZM5 A;  1P3G B;  3AZJ A;  3A6N C;  3X1V B;  5G49 B;  3REI A;  4UPK A;  2J8P A;  3C1C C;  3LJA A;  3AZJ D;  4X23 B;  3W96 A;  3REI D;  3X1U B;  4H9Q B;  2BYK A;  2PYO C;  5CHL B;  3LJA D;  2F8N G;  5AV6 A;  1P3L B;  2G5I C;  4M6B A;  3X1T A;  1ID3 C;  3W96 D;  3NQU B;  5AV5 B;  3H0M C;  4J8W B;  4WZS B;  5AV6 D;  1P34 A;  1A7W A;  5B1M C;  3F6T A;  4Z66 C;  5B2I A;  3WA9 B;  2BG1 A;  3WTP B;  1P34 D;  2Y2Q A;  5B2I D;  5AV8 A;  4WNN B;  1H3O A;  2HIO B;  1P3K C;  3NQJ B;  4G91 C;  5AV8 D;  5GT0 C;  2F2A C;  4HGA B;  4XUJ C;  3KFU G;  3WAA A;  3AZK A;  3REL B;  3B6G B;  5GXQ D;  4WU9 C;  3WAA D;  3EPH A;  1ZLA C;  3LZ0 B;  2NQB C;  5AY8 C;  1Q9C A;  3AZI A;  2W8S A;  4LD9 D;  3WKJ A;  5B0Z C;  2YFW B;  5GT3 B;  4KUD B;  3AZI D;  5AV9 B;  2CV5 B;  1P3B B;  3NQU A;  4KHA A;  3WKJ D;  1HQ3 C;  5GSU B;  3LZ1 B;  5JA4 A;  5AVC C;  3WA9 A;  1P3F A;  3AN2 B;  2ZY4 A;  1ID3 A;  3WA9 D;  1WWS A;  1P3F D;  3O62 C;  3UTA C;  3REK B;  2HIO A;  2LY8 A;  3VH5 T;  5B1M A;  2JSS A;  4J8V C;  1S32 C;  5JRG A;  4Z66 A;  4G92 B;  1ID3 D;  3MGS A;  5B33 B;  2Y2K A;  3UT9 C;  4H9R A;  5B1M D;  4QLC C;  5JRG D;  4Z66 D;  5DNM C;  3C1B C;  3MGS D;  3REL A;  4H9S C;  5KDM B;  3AZN C;  3W98 C;  3W97 B;  5CPK C;  3LZ0 A;  3VH6 T;  5CP6 C;  1M19 A;  3TU4 A;  1P3M B;  4NE3 A;  4JJN C;  1BFM A;  3AFA C;  3AZJ B;  3LZ0 D;  3REI B;  1M19 D;  2YFW A;  3TU4 D;  1EQZ C;  3LJA B;  3UTB A;  4UUZ A;  3W96 B;  5F99 C;  3MVD C;  5B2J A;  2G5H C;  2BYK B;  4KGC B;  2ZY3 A;  1TAF B;  5B24 B;  5AV6 B;  3UTB D;  5B0Z A;  2YFV A;  5B32 C;  3V9R A;  5B31 C;  3AN2 A;  4CAY A;  5B2J D;  4YM6 C;  5AY8 D;  2FJ7 C;  1M18 C;  4J8X C;  1P34 B;  5BNX A;  5BNV B;  5B0Z D;  4YS3 C;  1HQ3 A;  3AN2 D;  5B2I B;  5B0Y C;  3B0C T;  1KX4 C;  1HQ3 D;  5AV8 B;  1WWI A;  3KXB B;  4XZQ A;  4ZUX C;  1P3O C;  1HTA A;  3O62 A;  3UTA A;  5E5A C;  1JFI B;  1F66 C;  2Y2J A;  3W97 A;  4XZQ D;  1S32 A;  2RIQ A;  5GXQ B;  3O62 D;  3UTA D;  4WJ3 C;  3WAA B;  3AV1 C;  3UT9 A;  2XD5 A;  4J8U C;  1P3M A;  3W97 D;  1S32 D;  3KUY C;  1PZR A;  3KSY A;  4H9S A;  3R45 A;  4LD9 B;  3AZH C;  3B0D B;  3EPK A;  3UT9 D;  1P3M D;  3W98 A;  4DRA A;  1R4V A;  5CPK A;  3AZI B;  3X1S C;  4DRB A;  3W99 C;  3WKJ B;  1TZY C;  3AZN D;  1AOI B;  3W98 D;  4KGC A;  1TAF A;  5C3I C;  4JJN A;  5B24 A;  5CPK D;  3A6N B;  5CPI C;  1P3I C;  4KHA B;  3AZL A;  1EQZ A;  4X23 C;  4KGC D;  4JJN D;  3C1C B;  5B24 D;  1U35 C;  1P3A A;  5BNV A;  5JA4 B;  3AZL D;  1EQZ D;  1P3F B;  2PYO B;  1P3A D;  5AV5 C;  1ID3 B;  5B32 A;  5B31 A;  3MVD D;  3LEL A;  4J8W C;  3KXB A;  3REJ C;  1M18 A;  5BT1 C;  4J8X A;  5B1M B;  4YS3 A;  5JRG B;  4Z66 B;  5B32 D;  5FUG B;  5B31 D;  3LEL D;  3MGS B;  5B0Y A;  1JFI A;  3KXB D;  3MGR C;  1M18 D;  2DF4 C;  3KWQ C;  4J8X D;  5GXQ A;  4H9R B;  4NE6 A;  4YS3 D;  1KX4 A;  3AV2 C;  5B0Y D;  1P3P C;  4EO5 C;  5BO0 B;  4ZUX A;  2JE5 A;  4CSR A;  1P3K B;  1KX4 D;  4G91 B;  3VH5 W;  5E5A A;  4LD9 A;  1F66 A;  2CWE A;  1M19 B;  5GT0 B;  4ZUX D;  3MGQ A;  3TU4 B;  2RVQ D;  3MNN C;  5B1L C;  4Z5T C;  5E5A D;  3AV1 A;  1F66 D;  1AOI A;  3MGQ D;  3MGP C;  3B0B A;  3B6F C;  3A6N A;  3KUY A;  3AV1 D;  3UTB B;  1AOI D;  2F8N H;  4UUZ B;  3C1C A;  5B40 C;  5B2J B;  2NQB B;  5AY8 B;  3A6N D;  3VH6 W;  3KUY D;  3AZF C;  3X1S A;  3W99 A;  3AZH D;  1TZY A;  2YFV B;  5B0Z B;  3V9R B;  2PYO A;  3C1C D;  4NFT A;  4CAY B;  4WU8 C;  3X1S D;  1N1J A;  5CPI A;  3W99 D;  1TZY D;  5BNX B;  3LZ1 C;  4AWL C;  1HQ3 B;  3AZM C;  2PYO D;  3AZE C;  1M1A C;  5CPI D;  5AVC B;  5FUG A;  4R8P C;  3AYW C;  3VH5 A;  2Y2N A;  4ZBJ C;  2NZD C;  1B6W A;  1U35 D;  4XZQ B;  3O62 B;  3UTA B;  5BO0 A;  4WV4 B;  3EPL A;  1P3K A;  1S32 B;  2F8N A;  5B33 C;  5CPJ C;  5GT0 A;  3B0C W;  3MGR A;  5BT1 D;  3UT9 B;  4XUJ A;  3KWQ A;  1P3K D;  1W2E A;  2F8N D;  5BS7 C;  5DNN C;  3VH6 A;  5DNM B;  1KX5 C;  1P3P A;  5GT0 D;  3R45 B;  3MGR D;  4XUJ D;  3KWQ D;  3AZN B;  3W98 B;  4WU9 A;  5CPK B;  1ZLA A;  1P3P D;  2NQB A;  5AY8 A;  3AZJ C;  2ZY2 A;  4WU9 D;  4JJN B;  2ARO C;  4Z5T A;  1ZLA D;  1F1E A;  3AZL B;  2NQB D;  1EQZ B;  1T3U A;  3B6F A;  1BH9 A;  4E44 A;  3MNN D;  5B1L D;  1P3A B;  4Z5T D;  3AZG C;  3MVD B;  5B40 A;  3B6F D;  3A1K A;  1KX3 C;  3X1T C;  5AVC A;  4DQY B;  2IO5 C;  5B32 B;  5B31 B;  5B40 D;  4WU8 A;  4YM6 B;  3LEL B;  2BYM A;  1M18 B;  5AVC D;  5B2I C;  4J8X B;  1Z2C B;  3AZM A;  4YS3 B;  4WU8 D;  2HUE C;  5B0Y B;  2JCH A;  4J8V A;  3FDD A;  3AZM D;  1KU5 A;  3AYW A;  1KX4 B;  3AZE D;  1ULY A;  5AVB C;  4J8V D;  4ZUX B;  4QLC A;  3C1B A;  5DNM A;  4CSR B;  4H9O A;  3AYW D;  3EG5 B;  5E5A B;  1F66 B;  3AZN A;  3MGQ B;  4QLC D;  3REH C;  3C1B D;  5DNM D;  5CPJ A;  3AZK C;  5CP6 A;  3AV1 B;  1P3G C;  4J8U B;  3X1V C;  3AFA A;  5CPJ D;  4NE5 A;  5DNN A;  3KUY B;  2L5A A;  5CP6 D;  3AZH B;  4Z2M G;  3AZI C;  3AFA D;  3X1U C;  5DNN D;  3WTP E;  1KX5 D;  3X1S B;  3W99 B;  5F99 A;  3MVD A;  1TZY B;  1P3L C;  5C3I B;  2XD1 A;  2ARO A;  1N1J B;  5CPI B;  1P3I B;  2FJ7 A;  5F99 D;  4YM6 A;  2Y2G A;  3H0L C;  2ARO D;  4H9N A;  1U35 B;  3WA9 C;  3AZG A;  1P3F C;  4H9P A;  2FJ7 D;  4YM6 D;  1BH8 A;  3WTP C;  1KX3 A;  3AZG D;  2HIO C;  3REJ B;  1KX3 D;  3X1T D;  5JRG C;  3MGS C;  1P3O A;  2F8N B;  4HGA C;  3H0R C;  3MGR B;  2FFF B;  4XUJ B;  3KWQ B;  3IP4 C;  1P3O D;  3REL C;  3B6G C;  3AV2 B; 
#chains in the Genus database with same CATH homology
 1P3P B;  4EO5 B;  4J8U A;  5AVB A;  4WU9 B;  3LZ0 C;  3AL0 C;  1M19 C;  3AZH A;  3TU4 C;  1ZLA B;  4J8U D;  5AVB D;  3REH A;  3MNN B;  5B1L B;  4Z2M H;  4Z5T B;  5GT3 C;  1P3G A;  4KUD C;  2Y2O A;  5AV9 C;  3X1V A;  3REH D;  5G49 A;  2CV5 C;  1P3B C;  3MGP B;  3B6F B;  1BH9 B;  3UTB C;  3AZK D;  5GSU C;  1P3I A;  2Y2P A;  1P3G D;  3A1I A;  5B2J C;  4X23 A;  3X1V D;  5B40 B;  1B67 A;  3X1U A;  1U35 A;  4H9Q A;  3AZF B;  1P3I D;  2Y2L A;  3AN2 C;  4X23 D;  1P3L A;  4WU8 B;  3X1U D;  2BYM B;  5AV5 A;  3REK C;  3AZM B;  4J8W A;  4AWL B;  3REJ A;  1P3L D;  2VQR A;  4G92 C;  3AZE B;  2Y2I A;  5AV5 D;  4J8V B;  1M1A B;  4R8P B;  4J8W D;  3AYW B;  3REJ D;  3WTP A;  4XZQ C;  4ZBJ B;  2F8N K;  2NZD B;  4QLC B;  3P5J B;  4WNN A;  3C1B B;  3AV2 A;  4H9O B;  2DQN C;  3WTP D;  3W97 C;  3NQJ A;  3AV2 D;  5CPJ B;  2HIO D;  1P3M C;  5CP6 B;  2UWX A;  3MNN A;  2ZY5 A;  3REI C;  5B1L A;  3AFA B;  3B6G A;  5DNN B;  1KX5 B;  5B32 G;  3LJA C;  5B31 G;  3MGP A;  3W96 C;  3REL D;  3B6G D;  4KGC C;  5F99 B;  3MGP D;  5B24 C;  5AV6 C;  3AZF A;  2ARO B;  5GT3 A;  3AZL C;  4KUD A;  2FJ7 B;  5AV9 A;  2CV5 A;  1P3B A;  1P3A C;  3AZF D;  1P34 C;  2Y2M A;  5GSU A;  3EPJ A;  4H9N B;  5GT3 D;  3AZG B;  3LZ1 A;  4KUD D;  4H9P B;  5AV9 D;  2CV5 D;  1P3B D;  3AZE A;  1BH8 B;  1M1A A;  1KX3 B;  5GSU D;  3X1T B;  5AV8 C;  4R8P A;  3LZ1 D;  3LEL C;  2IO5 B;  3KXB C;  2NZD A;  1M1A D;  2Y2H A;  3REK A;  4R8P D;  1P3O B;  2NZD D;  2HUE B;  5GXQ C;  3WAA C;  5B33 A;  3REK D;  1H3O B;  5AVB B;  2RVQ C;  5BS7 A;  5B33 D;  4LD9 C;  5KDM A;  3B0D C;  1KX5 A;  3MGQ C;  3REH B;  4E45 A;  3WKJ C;  3AZK B;  1AOI C;  2ZM5 A;  1P3G B;  3AZJ A;  3A6N C;  3X1V B;  5G49 B;  3REI A;  4UPK A;  2J8P A;  3C1C C;  3LJA A;  3AZJ D;  4X23 B;  3W96 A;  3REI D;  3X1U B;  4H9Q B;  2BYK A;  2PYO C;  5CHL B;  3LJA D;  2F8N G;  5AV6 A;  1P3L B;  2G5I C;  4M6B A;  3X1T A;  1ID3 C;  3W96 D;  3NQU B;  5AV5 B;  3H0M C;  4J8W B;  4WZS B;  5AV6 D;  1P34 A;  1A7W A;  5B1M C;  3F6T A;  4Z66 C;  5B2I A;  3WA9 B;  2BG1 A;  3WTP B;  1P34 D;  2Y2Q A;  5B2I D;  5AV8 A;  4WNN B;  1H3O A;  2HIO B;  1P3K C;  3NQJ B;  4G91 C;  5AV8 D;  5GT0 C;  2F2A C;  4HGA B;  4XUJ C;  3KFU G;  3WAA A;  3AZK A;  3REL B;  3B6G B;  5GXQ D;  4WU9 C;  3WAA D;  3EPH A;  1ZLA C;  3LZ0 B;  2NQB C;  5AY8 C;  1Q9C A;  3AZI A;  2W8S A;  4LD9 D;  3WKJ A;  5B0Z C;  2YFW B;  5GT3 B;  4KUD B;  3AZI D;  5AV9 B;  2CV5 B;  1P3B B;  3NQU A;  4KHA A;  3WKJ D;  1HQ3 C;  5GSU B;  3LZ1 B;  5JA4 A;  5AVC C;  3WA9 A;  1P3F A;  3AN2 B;  2ZY4 A;  1ID3 A;  3WA9 D;  1WWS A;  1P3F D;  3O62 C;  3UTA C;  3REK B;  2HIO A;  2LY8 A;  3VH5 T;  5B1M A;  2JSS A;  4J8V C;  1S32 C;  5JRG A;  4Z66 A;  4G92 B;  1ID3 D;  3MGS A;  5B33 B;  2Y2K A;  3UT9 C;  4H9R A;  5B1M D;  4QLC C;  5JRG D;  4Z66 D;  5DNM C;  3C1B C;  3MGS D;  3REL A;  4H9S C;  5KDM B;  3AZN C;  3W98 C;  3W97 B;  5CPK C;  3LZ0 A;  3VH6 T;  5CP6 C;  1M19 A;  3TU4 A;  1P3M B;  4NE3 A;  4JJN C;  1BFM A;  3AFA C;  3AZJ B;  3LZ0 D;  3REI B;  1M19 D;  2YFW A;  3TU4 D;  1EQZ C;  3LJA B;  3UTB A;  4UUZ A;  3W96 B;  5F99 C;  3MVD C;  5B2J A;  2G5H C;  2BYK B;  4KGC B;  2ZY3 A;  1TAF B;  5B24 B;  5AV6 B;  3UTB D;  5B0Z A;  2YFV A;  5B32 C;  3V9R A;  5B31 C;  3AN2 A;  4CAY A;  5B2J D;  4YM6 C;  5AY8 D;  2FJ7 C;  1M18 C;  4J8X C;  1P34 B;  5BNX A;  5BNV B;  5B0Z D;  4YS3 C;  1HQ3 A;  3AN2 D;  5B2I B;  5B0Y C;  3B0C T;  1KX4 C;  1HQ3 D;  5AV8 B;  1WWI A;  3KXB B;  4XZQ A;  4ZUX C;  1P3O C;  1HTA A;  3O62 A;  3UTA A;  5E5A C;  1JFI B;  1F66 C;  2Y2J A;  3W97 A;  4XZQ D;  1S32 A;  2RIQ A;  5GXQ B;  3O62 D;  3UTA D;  4WJ3 C;  3WAA B;  3AV1 C;  3UT9 A;  2XD5 A;  4J8U C;  1P3M A;  3W97 D;  1S32 D;  3KUY C;  1PZR A;  3KSY A;  4H9S A;  3R45 A;  4LD9 B;  3AZH C;  3B0D B;  3EPK A;  3UT9 D;  1P3M D;  3W98 A;  4DRA A;  1R4V A;  5CPK A;  3AZI B;  3X1S C;  4DRB A;  3W99 C;  3WKJ B;  1TZY C;  3AZN D;  1AOI B;  3W98 D;  4KGC A;  1TAF A;  5C3I C;  4JJN A;  5B24 A;  5CPK D;  3A6N B;  5CPI C;  1P3I C;  4KHA B;  3AZL A;  1EQZ A;  4X23 C;  4KGC D;  4JJN D;  3C1C B;  5B24 D;  1U35 C;  1P3A A;  5BNV A;  5JA4 B;  3AZL D;  1EQZ D;  1P3F B;  2PYO B;  1P3A D;  5AV5 C;  1ID3 B;  5B32 A;  5B31 A;  3MVD D;  3LEL A;  4J8W C;  3KXB A;  3REJ C;  1M18 A;  5BT1 C;  4J8X A;  5B1M B;  4YS3 A;  5JRG B;  4Z66 B;  5B32 D;  5FUG B;  5B31 D;  3LEL D;  3MGS B;  5B0Y A;  1JFI A;  3KXB D;  3MGR C;  1M18 D;  2DF4 C;  3KWQ C;  4J8X D;  5GXQ A;  4H9R B;  4NE6 A;  4YS3 D;  1KX4 A;  3AV2 C;  5B0Y D;  1P3P C;  4EO5 C;  5BO0 B;  4ZUX A;  2JE5 A;  4CSR A;  1P3K B;  1KX4 D;  4G91 B;  3VH5 W;  5E5A A;  4LD9 A;  1F66 A;  2CWE A;  1M19 B;  5GT0 B;  4ZUX D;  3MGQ A;  3TU4 B;  2RVQ D;  3MNN C;  5B1L C;  4Z5T C;  5E5A D;  3AV1 A;  1F66 D;  1AOI A;  3MGQ D;  3MGP C;  3B0B A;  3B6F C;  3A6N A;  3KUY A;  3AV1 D;  3UTB B;  1AOI D;  2F8N H;  4UUZ B;  3C1C A;  5B40 C;  5B2J B;  2NQB B;  5AY8 B;  3A6N D;  3VH6 W;  3KUY D;  3AZF C;  3X1S A;  3W99 A;  3AZH D;  1TZY A;  2YFV B;  5B0Z B;  3V9R B;  2PYO A;  3C1C D;  4NFT A;  4CAY B;  4WU8 C;  3X1S D;  1N1J A;  5CPI A;  3W99 D;  1TZY D;  5BNX B;  3LZ1 C;  4AWL C;  1HQ3 B;  3AZM C;  2PYO D;  3AZE C;  1M1A C;  5CPI D;  5AVC B;  5FUG A;  4R8P C;  3AYW C;  3VH5 A;  2Y2N A;  4ZBJ C;  2NZD C;  1B6W A;  1U35 D;  4XZQ B;  3O62 B;  3UTA B;  5BO0 A;  4WV4 B;  3EPL A;  1P3K A;  1S32 B;  2F8N A;  5B33 C;  5CPJ C;  5GT0 A;  3B0C W;  3MGR A;  5BT1 D;  3UT9 B;  4XUJ A;  3KWQ A;  1P3K D;  1W2E A;  2F8N D;  5BS7 C;  5DNN C;  3VH6 A;  5DNM B;  1KX5 C;  1P3P A;  5GT0 D;  3R45 B;  3MGR D;  4XUJ D;  3KWQ D;  3AZN B;  3W98 B;  4WU9 A;  5CPK B;  1ZLA A;  1P3P D;  2NQB A;  5AY8 A;  3AZJ C;  2ZY2 A;  4WU9 D;  4JJN B;  2ARO C;  4Z5T A;  1ZLA D;  1F1E A;  3AZL B;  2NQB D;  1EQZ B;  1T3U A;  3B6F A;  1BH9 A;  4E44 A;  3MNN D;  5B1L D;  1P3A B;  4Z5T D;  3AZG C;  3MVD B;  5B40 A;  3B6F D;  3A1K A;  1KX3 C;  3X1T C;  5AVC A;  4DQY B;  2IO5 C;  5B32 B;  5B31 B;  5B40 D;  4WU8 A;  4YM6 B;  3LEL B;  2BYM A;  1M18 B;  5AVC D;  5B2I C;  4J8X B;  1Z2C B;  3AZM A;  4YS3 B;  4WU8 D;  2HUE C;  5B0Y B;  2JCH A;  4J8V A;  3FDD A;  3AZM D;  1KU5 A;  3AYW A;  1KX4 B;  3AZE D;  1ULY A;  5AVB C;  4J8V D;  4ZUX B;  4QLC A;  3C1B A;  5DNM A;  4CSR B;  4H9O A;  3AYW D;  3EG5 B;  5E5A B;  1F66 B;  3AZN A;  3MGQ B;  4QLC D;  3REH C;  3C1B D;  5DNM D;  5CPJ A;  3AZK C;  5CP6 A;  3AV1 B;  1P3G C;  4J8U B;  3X1V C;  3AFA A;  5CPJ D;  4NE5 A;  5DNN A;  3KUY B;  2L5A A;  5CP6 D;  3AZH B;  4Z2M G;  3AZI C;  3AFA D;  3X1U C;  5DNN D;  3WTP E;  1KX5 D;  3X1S B;  3W99 B;  5F99 A;  3MVD A;  1TZY B;  1P3L C;  5C3I B;  2XD1 A;  2ARO A;  1N1J B;  5CPI B;  1P3I B;  2FJ7 A;  5F99 D;  4YM6 A;  2Y2G A;  3H0L C;  2ARO D;  4H9N A;  1U35 B;  3WA9 C;  3AZG A;  1P3F C;  4H9P A;  2FJ7 D;  4YM6 D;  1BH8 A;  3WTP C;  1KX3 A;  3AZG D;  2HIO C;  3REJ B;  1KX3 D;  3X1T D;  5JRG C;  3MGS C;  1P3O A;  2F8N B;  4HGA C;  3H0R C;  3MGR B;  2FFF B;  4XUJ B;  3KWQ B;  3IP4 C;  1P3O D;  3REL C;  3B6G C;  3AV2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...