5AV9D

Human nucleosome core particle
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
97
structure length
97
Chain Sequence
RKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Histone H3.1
publication title Intra- and inter-nucleosomal interactions of the histone H4 tail revealed with a human nucleosome core particle with genetically-incorporated H4 tetra-acetylation
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 97
sequence length 97
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5av9D00
1F66C 2FJ7B 3WAAA 3AZEB 4H9RB 3AZJB 3REKD 3AZGC 5GXQB 3WTPC 2YFWA 5AV8C 2IO5C 4J8XB 1F66D 3UTAC 3C1CA 5GT3D 3AYWB 1P3IA 3W99A 3X1SC 5AVBC 3MGPA 3AZGD 3WTPD 1HQ3B 1EQZA 4X23D 2YFVA 4WV4B 5CPID 3B6GA 3AZFD 1P3AD 3X1SD 5AVBD 1TAFB 5B0YA 4AWLC 5B32B 1BH8A 1B6WA 4WU8C 5G49A 3B6FB 1P3LD 5B24B 3R45B 3WAAB 3LJAC 1P3KD 1M19A 5GT3B 5F99A 3KXBA 3W96D 3B0BA 3O62C 4WU8D 1JFIA 2LY8A 5BO0B 5CPIB 2RVQD 5AV5D 3AZFB 2AROA 5CP6C 3LJAD 3AZLC 3AFAA 1P3IB 3W99B 3MGQA 1P3AB 4XZQC 5JA4B 3AZND 4YS3A 4Z5TC 3O62D 5BNVA 3NQJB 1U35C 2YFVB 3B6GB 1P3LB 2HUEB 5CP6D 3NQUA 3AZLD 4QLCA 2PYOA 1P3KB 5B0YB 4Z5TD 4XUJD 3W96B 5E5AA 5CPJA 5C3IB 1H3OA 2F8NA 3AN2D 1P3BD 5B1LA 4KGCA 1KU5A 5AV5B 5JRGC 3KXBB 3UTBA 3AZIA 3AZMC 3AZNB 4Z66D 2BYKA 5B2JD 3LZ0A 3MGRA 4H9SC 3AZHA 1P3PA 5DNNC 2NQBA 4G92C 5CPKC 3REJA 2AROB 4G91C 4EO5C 3AFAB 3MGQB 4WU9C 3AZKA 4XUJB 4JJND 1P3GD 5BNVB 3MGSD 5DNND 5B32G 3C1BD 1TZYA 5B33A 5B40C 3AN2B 3REIA 3TU4C 4J8UA 1P3BB 2PYOB 4UUZA 4NE5A 5GT0C 2NZDC 1P3OA 3W98D 1H3OB 3AV2C 3MVDA 4Z66B 5B2IA 5B2JB 2FJ7C 1AOIA 3WKJA 3X1UD 4ZBJB 1KX3D 5B1LB 5B40D 3AZEC 3AZJC 4KGCB 3VH5A 4YM6A 5GXQC 3UTBB 5KDMB 2BYKB 3LZ0B 3MGRB 4J8WA 4JJNB 4J8XC 3AV2D 3MGSB 3AZHB 5DNMA 2FJ7D 1P3PB 3AYWC 2NQBB 5B1MC 3UT9A 3C1BB 3REJB 3AZJD 1HQ3C 1S32A 4J8XD 3W98B 3B0DB 1KX4A 1P3FA 1KX3B 3REHD 5GSUA 5B32C 5AV9D 1P3OB 4R8PA 5B24C 3LELA 4KUDD 1AOIB 3WAAC 5GT3C 1F1EA 5B32D 4NE3A 1P34D 4KHAA 3X1VA 3X1TD 3B6FD 4X23C 5B24D 5CPIC 3WAAD 3AZFC 1P3IC 3WA9A 1P3AC 3KWQA 4CSRA 3REHB 5AV9B 1ID3A 4LD9A 3B6GC 4H9QA 5AV6A 1P3LC 3C1CD 2HUEC 1P3ID 4KUDB 1KX4B 3W99D 3LZ1A 1P3FB 3MGPD 1P3KC 5B0YC 3W97A 5GSUB 3W96C 1EQZD 1P34B 2F8NG 5C3IC 4ZUXA 5BT1D 3X1TB 3KUYA 3B6GD 5AV8A 5B31A 2RVQC 3UTAA 5AV5C 5B0YD 3KXBC 1A7WA 3AZNC 4NE6A 1M18A 2YFWB 4WNNA 2AROC 3V9RA 3C1CB 3AFAC 1M19D 2HIOA 5F99D 3WA9B 3MGQC 3KXBD 2F8NH 5BNXA 3MGPB 4CSRB 4XUJC 1ID3B 1EQZB 4LD9B 5AV6B 2AROD 4CAYA 3AN2C 3AFAD 1P3BC 3LZ1B 2BYMA 3MGQD 2PYOC 4YS3D 5AY8A 3W97B 5AVCA 1BH9A 1BH8B 4ZUXB 3O62A 4Z66C 5B2JC 5G49B 3KUYB 4M6BA 4ZBJC 5B31B 5B1LC 1WWIA 4KGCC 1WWSA 4QLCD 2PYOD 1B67A 1M19B 5F99B 3B0CT 3UTBC 4XZQA 5E5AD 5CPJD 3LZ0C 3MGRC 4JJNC 1P3GC 1JFIB 1M18B 4WNNB 3MGSC 3AZHC 1U35A 1P3PC 2F8ND 2NQBC 5B1LD 3C1BC 3REJC 4KGCD 4NFTA 1KX5A 2HIOB 3UTBD 3AZID 4H9PA 4E44A 4YS3B 3AV1A 3LZ0D 3MGRD 3W98C 3AZHD 1P3PD 2NQBD 3REJD 3X1UC 1KX3C 3VH6A 3NQUB 4QLCB 3AZKD 5AY8B 5AVCB 1P3OC 1P3MA 3MNNA 5JRGA 3AZMA 5E5AB 5CPJB 1AOIC 1TZYD 4H9SA 5B33D 2F8NB 3REID 4J8UD 5CPKA 1P3OD 4WU9A 3AZIB 1ZLAA 3MVDD 5B2ID 3WKJD 1AOID 4YM6D 1KX5B 3TU4A 3REHC 5AV9C 4H9PB 3AZKB 5GT0A 2NZDA 3AV1B 4J8WD 2CV5A 5DNMD 3A6NA 4KUDC 1KX4C 5B0ZA 3UT9D 1P3FC 1TZYB 5B33B 1M1AA 3AZEA 4H9RA 5GSUC 3REIB 4J8UB 4UUZB 5GXQA 5B31G 3MNNB 1S32D 1P34C 1P3MB 3X1TC 3B6FC 3MVDB 5B2IB 4J8VA 1KX4D 3WKJB 1P3FD 3AYWA 2CWEA 5B1MA 5GSUD 4YM6B 3RELA 1HQ3A 1ZLAB 4R8PD 3LELD 4J8WB 5DNMB 3C1CC 3WA9C 3W99C 3UT9B 3MGPC 3X1VD 1ID3C 3REKA 5BS7A 1EQZC 3WTPE 1S32B 4LD9C 5BT1C 2CV5B 5AV6C 3A6NB 4Z2MG 3R45A 5B0ZB 3LZ1C 4HGAB 3WA9D 1F66A 3KWQD 1M1AB 5GT3A 3W97C 1ID3D 3AZGA 4ZUXC 3WTPA 4LD9D 1ULYA 3KUYC 5BO0A 5AV6D 4X23A 4R8PB 5B31C 3LELB 4J8VB 3LZ1D 5CPIA 5B24A 3AZFA 1M19C 5B1MB 5F99C 3W97D 2F8NK 1P3AA 4DRAA 5JA4A 3X1SA 5AVBA 4KHAB 3RELB 3X1VB 4ZUXD 1M18C 3NQJA 4Z2MH 3KUYD 5AV8D 5B31D 3UTAD 1P3LA 2HIOC 2L5AA 3KWQB 1P3KA 4YS3C 1Q9CA 3W96A 3REKB 1M18D 4WU8A 4H9QB 2HIOD 1F66B 4QLCC 5AV5A 5AY8C 3LJAA 5AVCC 4H9OA 5E5AC 3AZNA 3AZGB 5CPJC 3WTPB 4X23B 1R4VA 5AV8B 2IO5B 3UTAB 5AY8D 5CP6A 5AVCD 1N1JA 4H9NA 3AZLA 3AZIC 3VH6T 3X1SB 5AVBB 4Z5TA 4XUJA 1BFMA 1KX5C 3V9RB 3AN2A 1P3BA 4XZQD 5BNXB 3AZKC 4AWLB 3AV1C 3VH5T 2JSSA 1U35D 3B0DC 4WU8B 4Z66A 5B2JA 1TZYC 5B33C 1KX5D 4CAYB 3REIC 4J8UC 2BYMB 3LJAB 1P3MC 3MNNC 1BH9B 3AV1D 4H9OB 5KDMA 3O62B 3MVDC 4JJNA 5B2IC 1P3GA 3WKJC 3MGSA 5DNNA 3C1BA 4YM6C 5CP6B 3AZLB 1N1JB 4H9NB 3MNND 1P3MD 5JRGD 4XZQB 3AZMD 1ZLAC 4Z5TB 4J8WC 1U35B 3W98A 5DNMC 4DRBA 5CPKD 3UT9C 1HTAA 3X1UA 1KX3A 5B40A 4WU9D 1ZLAD 1S32C 2CV5C 3A6NC 3AV2A 5FUGA 5B0ZC 4HGAC 2FJ7A 3B0CW 3VH6W 1M1AC 3TU4D 3AZJA 5GT0D 2NZDD 5JRGB 2CV5D 3AZMB 4E45A 4R8PC 3A6ND 3LELC 1P3GB 4J8VC 5B0ZD 4J8XA 1M1AD 3AZED 5DNNB 3VH5W 4G92B 5CPKB 4G91B 5GXQD 4EO5B 3X1VC 3REHA 3RELC 5AV9A 4WU9B 4J8VD 3KSYA 5CHLB 3AYWD 4KUDA 5B1MD 3X1UB 3KWQC 5B40B 1TAFA 3RELD 3TU4B 5B32A 3REKC 1HQ3D 5BS7C 1P34A 5GT0B 2NZDB 3X1TA 3B6FA 3AV2B 4WZSB 5FUGB
chains in the Genus database with same CATH superfamily
1F66C 3P5JB 2FJ7B 3WAAA 3AZEB 4H9RB 3AZJB 3REKD 3AZGC 5GXQB 3WTPC 2XD1A 2RIQA 2YFWA 2ZM5A 5AV8C 2IO5C 4J8XB 1F66D 3UTAC 3C1CA 5GT3D 3AYWB 1P3IA 3W99A 3X1SC 5AVBC 3MGPA 3AZGD 3WTPD 1HQ3B 1EQZA 2F2AC 3H0MC 4X23D 2YFVA 4WV4B 1Z2CB 5CPID 3B6GA 3AZFD 1P3AD 3X1SD 5AVBD 1TAFB 5B0YA 4AWLC 5B32B 1BH8A 1B6WA 4WU8C 5G49A 3B6FB 1P3LD 5B24B 3R45B 3WAAB 3LJAC 4DQYB 1P3KD 1M19A 5GT3B 5F99A 3KXBA 3W96D 3B0BA 3O62C 4WU8D 1JFIA 2LY8A 5BO0B 5CPIB 2RVQD 5AV5D 3AZFB 2AROA 5CP6C 3LJAD 3AZLC 3AFAA 1P3IB 3W99B 3MGQA 1P3AB 4XZQC 5JA4B 3AZND 4YS3A 4Z5TC 3O62D 5BNVA 3NQJB 1U35C 2YFVB 3EPHA 3B6GB 1P3LB 2HUEB 3H0LC 5CP6D 3NQUA 3AZLD 4QLCA 2PYOA 1P3KB 5B0YB 4Z5TD 4XUJD 3W96B 5E5AA 5CPJA 5C3IB 1H3OA 3EPLA 2F8NA 3AN2D 1P3BD 5B1LA 2ZY4A 4KGCA 1KU5A 5AV5B 5JRGC 3KXBB 3UTBA 3AZIA 3AZMC 3AZNB 4Z66D 2BYKA 5B2JD 3LZ0A 3MGRA 4H9SC 3AZHA 1P3PA 5DNNC 2NQBA 4G92C 5CPKC 3REJA 2AROB 4G91C 4EO5C 3AFAB 3MGQB 4WU9C 3AZKA 4XUJB 4JJND 1P3GD 5BNVB 3MGSD 5DNND 5B32G 3C1BD 1TZYA 5B33A 2G5IC 5B40C 3AN2B 3REIA 3TU4C 4J8UA 1P3BB 2PYOB 4UUZA 4NE5A 5GT0C 2NZDC 1P3OA 3H0RC 3W98D 1H3OB 3AV2C 3MVDA 4Z66B 2Y2KA 5B2JB 5B2IA 2FJ7C 1AOIA 3WKJA 3X1UD 4ZBJB 1KX3D 5B1LB 5B40D 3AZEC 3AZJC 4KGCB 3VH5A 4YM6A 5GXQC 3UTBB 1T3UA 5KDMB 2BYKB 3LZ0B 3MGRB 4J8WA 4JJNB 4J8XC 3AV2D 3MGSB 2Y2OA 5DNMA 3AZHB 2FJ7D 1P3PB 3AYWC 2NQBB 5B1MC 3UT9A 3C1BB 3REJB 3AZJD 1HQ3C 2BG1A 1S32A 4J8XD 3W98B 3B0DB 1KX4A 1P3FA 1KX3B 3REHD 5GSUA 5B32C 5AV9D 3KFUG 1P3OB 2Y2IA 4R8PA 5B24C 3LELA 4KUDD 1AOIB 3WAAC 2Y2MA 1F1EA 5GT3C 5B32D 2J8PA 4NE3A 1P34D 4KHAA 3X1VA 3X1TD 3A1KA 3B6FD 4X23C 5B24D 4WJ3C 5CPIC 3WAAD 3AZFC 1P3IC 3WA9A 3EPKA 1P3AC 3KWQA 4CSRA 3REHB 5AV9B 1ID3A 4LD9A 3B6GC 4H9QA 5AV6A 1P3LC 3C1CD 2HUEC 2JCHA 1P3ID 3FDDA 1KX4B 3W99D 3LZ1A 1P3FB 4KUDB 3MGPD 1P3KC 5B0YC 3W97A 5GSUB 3W96C 1EQZD 1P34B 2F8NG 5C3IC 4ZUXA 5BT1D 3X1TB 3KUYA 3B6GD 5AV8A 5B31A 2RVQC 3UTAA 5AV5C 2Y2NA 5B0YD 2Y2PA 3KXBC 1A7WA 3AZNC 2Y2QA 4NE6A 1M18A 2YFWB 4WNNA 2AROC 3V9RA 3C1CB 3AFAC 1M19D 2HIOA 5F99D 3WA9B 3MGQC 3KXBD 2F8NH 5BNXA 3MGPB 4CSRB 4XUJC 1ID3B 1EQZB 4LD9B 5AV6B 2AROD 4CAYA 3AN2C 3AFAD 1P3BC 3LZ1B 2BYMA 3MGQD 2PYOC 4YS3D 5AY8A 3W97B 5AVCA 1BH9A 1BH8B 4ZUXB 3O62A 4Z66C 5B2JC 5G49B 3KUYB 4M6BA 4ZBJC 5B31B 5B1LC 1WWIA 4KGCC 1WWSA 4QLCD 2PYOD 1B67A 1M19B 5F99B 3B0CT 3UTBC 4XZQA 5E5AD 5CPJD 2ZY3A 2ZY5A 3LZ0C 2JE5A 3MGRC 4JJNC 1P3GC 4WNNB 1M18B 3MGSC 3AZHC 1U35A 1JFIB 1P3PC 2F8ND 2NQBC 5B1LD 3C1BC 3REJC 4KGCD 4NFTA 1KX5A 2HIOB 3UTBD 3AZID 4H9PA 4E44A 4YS3B 3AV1A 3LZ0D 3MGRD 3W98C 3AZHD 1P3PD 2NQBD 3REJD 3X1UC 1KX3C 3VH6A 3NQUB 4QLCB 3AZKD 5AY8B 5AVCB 1P3OC 1P3MA 3MNNA 5JRGA 3AZMA 5E5AB 5CPJB 1AOIC 1TZYD 4H9SA 5B33D 2F8NB 3REID 4J8UD 5CPKA 1P3OD 4WU9A 3AZIB 1ZLAA 2DF4C 3MVDD 5B2ID 3WKJD 1AOID 4YM6D 1KX5B 3TU4A 3REHC 5AV9C 4H9PB 3AZKB 5GT0A 2NZDA 3AV1B 4J8WD 2G5HC 2CV5A 5DNMD 3A6NA 4KUDC 1KX4C 5B0ZA 3UT9D 1P3FC 1TZYB 5B33B 1M1AA 3AZEA 4H9RA 5GSUC 3REIB 4J8UB 4UUZB 5GXQA 5B31G 3MNNB 1S32D 1P34C 1P3MB 3X1TC 3A1IA 3B6FC 3MVDB 5B2IB 4J8VA 1KX4D 3WKJB 1P3FD 3AYWA 2CWEA 5B1MA 5GSUD 4YM6B 3RELA 1HQ3A 1ZLAB 4R8PD 3LELD 4J8WB 5DNMB 3C1CC 3WA9C 3W99C 3UT9B 3MGPC 3X1VD 1ID3C 3REKA 5BS7A 1EQZC 3WTPE 1S32B 4LD9C 5BT1C 2CV5B 5AV6C 3A6NB 4Z2MG 3R45A 5B0ZB 3LZ1C 4HGAB 3WA9D 1F66A 3KWQD 1M1AB 5GT3A 3W97C 1ID3D 3EPJA 2Y2GA 3AZGA 4ZUXC 2XD5A 3WTPA 3EG5B 1ULYA 4LD9D 3KUYC 5BO0A 2Y2JA 5AV6D 4X23A 4R8PB 5B31C 3LELB 4J8VB 1W2EA 3LZ1D 5CPIA 3AZFA 1M19C 5B1MB 5F99C 3W97D 2F8NK 1P3AA 4DRAA 5JA4A 3X1SA 5AVBA 4KHAB 3RELB 3X1VB 4ZUXD 1M18C 3NQJA 4Z2MH 3KUYD 5AV8D 5B31D 3UTAD 1P3LA 2HIOC 2L5AA 3KWQB 1P3KA 4YS3C 1Q9CA 3F6TA 3W96A 3REKB 1M18D 2W8SA 4WU8A 4H9QB 2HIOD 1F66B 4QLCC 5AV5A 5AY8C 3LJAA 5AVCC 4H9OA 5E5AC 3AZNA 2FFFB 3AZGB 5CPJC 3WTPB 4X23B 1R4VA 5AV8B 4UPKA 2IO5B 1PZRA 3UTAB 5AY8D 5CP6A 5AVCD 1N1JA 4H9NA 3AZLA 3AZIC 3VH6T 3X1SB 5AVBB 4Z5TA 4XUJA 1BFMA 2VQRA 1KX5C 3V9RB 3AN2A 1P3BA 4XZQD 2ZY2A 5BNXB 3AZKC 4AWLB 3AV1C 3VH5T 2JSSA 1U35D 3B0DC 4WU8B 4Z66A 5B2JA 1TZYC 5B33C 1KX5D 4CAYB 3REIC 4J8UC 2BYMB 3LJAB 1P3MC 2DQNC 3MNNC 1BH9B 3AV1D 4H9OB 5KDMA 3O62B 3MVDC 4JJNA 5B2IC 1P3GA 3WKJC 3MGSA 5DNNA 3C1BA 4YM6C 2Y2HA 5CP6B 3AZLB 1N1JB 4H9NB 3MNND 1P3MD 5JRGD 4XZQB 3AZMD 1ZLAC 4Z5TB 4J8WC 1U35B 3W98A 5DNMC 4DRBA 5CPKD 3UT9C 1HTAA 3X1UA 4WZSB 1KX3A 5B40A 4WU9D 1ZLAD 1S32C 2CV5C 3A6NC 3AV2A 5FUGA 5B0ZC 4HGAC 2FJ7A 3B0CW 3VH6W 1M1AC 3TU4D 3AZJA 5GT0D 2NZDD 3IP4C 5JRGB 3AL0C 2CV5D 3AZMB 4E45A 4R8PC 3A6ND 3LELC 1P3GB 4J8VC 5B0ZD 4J8XA 1M1AD 3AZED 5DNNB 3VH5W 4G92B 2Y2LA 5CPKB 4G91B 5GXQD 4EO5B 3X1VC 3REHA 3RELC 5AV9A 4WU9B 2UWXA 4J8VD 3KSYA 5CHLB 3AYWD 4KUDA 5B1MD 3X1UB 3KWQC 5B40B 1TAFA 3RELD 3TU4B 5B32A 3REKC 1HQ3D 5BS7C 1P34A 5GT0B 2NZDB 3X1TA 3B6FA 3AV2B 5B24A 5FUGB
chains in the Genus database with same CATH topology
1F66C 3P5JB 2FJ7B 3WAAA 3AZEB 4H9RB 3AZJB 3REKD 3AZGC 5GXQB 3WTPC 2XD1A 2RIQA 2YFWA 2ZM5A 5AV8C 2IO5C 4J8XB 1F66D 3UTAC 3C1CA 5GT3D 3AYWB 1P3IA 3W99A 3X1SC 5AVBC 3MGPA 3AZGD 3WTPD 1HQ3B 1EQZA 2F2AC 3H0MC 4X23D 2YFVA 4WV4B 1Z2CB 5CPID 3B6GA 3AZFD 1P3AD 3X1SD 5AVBD 1TAFB 5B0YA 4AWLC 5B32B 1BH8A 1B6WA 4WU8C 5G49A 3B6FB 1P3LD 5B24B 3R45B 3WAAB 3LJAC 4DQYB 1P3KD 1M19A 5GT3B 5F99A 3KXBA 3W96D 3B0BA 3O62C 4WU8D 1JFIA 2LY8A 5BO0B 5CPIB 2RVQD 5AV5D 3AZFB 2AROA 5CP6C 3LJAD 3AZLC 3AFAA 1P3IB 3W99B 3MGQA 1P3AB 4XZQC 5JA4B 3AZND 4YS3A 4Z5TC 3O62D 5BNVA 3NQJB 1U35C 2YFVB 3EPHA 3B6GB 1P3LB 2HUEB 3H0LC 5CP6D 3NQUA 3AZLD 4QLCA 2PYOA 1P3KB 5B0YB 4Z5TD 4XUJD 3W96B 5E5AA 5CPJA 5C3IB 1H3OA 3EPLA 2F8NA 3AN2D 1P3BD 5B1LA 2ZY4A 4KGCA 1KU5A 5AV5B 5JRGC 3KXBB 3UTBA 3AZIA 3AZMC 3AZNB 4Z66D 2BYKA 5B2JD 3LZ0A 3MGRA 4H9SC 3AZHA 1P3PA 5DNNC 2NQBA 4G92C 5CPKC 3REJA 2AROB 4G91C 4EO5C 3AFAB 3MGQB 4WU9C 3AZKA 4XUJB 4JJND 1P3GD 5BNVB 3MGSD 5DNND 5B32G 3C1BD 1TZYA 5B33A 2G5IC 5B40C 3AN2B 3REIA 3TU4C 4J8UA 1P3BB 2PYOB 4UUZA 4NE5A 5GT0C 2NZDC 1P3OA 3H0RC 3W98D 1H3OB 3AV2C 3MVDA 4Z66B 2Y2KA 5B2JB 5B2IA 2FJ7C 1AOIA 3WKJA 3X1UD 4ZBJB 1KX3D 5B1LB 5B40D 3AZEC 3AZJC 4KGCB 3VH5A 4YM6A 5GXQC 3UTBB 1T3UA 5KDMB 2BYKB 3LZ0B 3MGRB 4J8WA 4JJNB 4J8XC 3AV2D 3MGSB 2Y2OA 5DNMA 3AZHB 2FJ7D 1P3PB 3AYWC 2NQBB 5B1MC 3UT9A 3C1BB 3REJB 3AZJD 1HQ3C 2BG1A 1S32A 4J8XD 3W98B 3B0DB 1KX4A 1P3FA 1KX3B 3REHD 5GSUA 5B32C 5AV9D 3KFUG 1P3OB 2Y2IA 4R8PA 5B24C 3LELA 4KUDD 1AOIB 3WAAC 2Y2MA 1F1EA 5GT3C 5B32D 2J8PA 4NE3A 1P34D 4KHAA 3X1VA 3X1TD 3A1KA 3B6FD 4X23C 5B24D 4WJ3C 5CPIC 3WAAD 3AZFC 1P3IC 3WA9A 3EPKA 1P3AC 3KWQA 4CSRA 3REHB 5AV9B 1ID3A 4LD9A 3B6GC 4H9QA 5AV6A 1P3LC 3C1CD 2HUEC 2JCHA 1P3ID 3FDDA 1KX4B 3W99D 3LZ1A 1P3FB 4KUDB 3MGPD 1P3KC 5B0YC 3W97A 5GSUB 3W96C 1EQZD 1P34B 2F8NG 5C3IC 4ZUXA 5BT1D 3X1TB 3KUYA 3B6GD 5AV8A 5B31A 2RVQC 3UTAA 5AV5C 2Y2NA 5B0YD 2Y2PA 3KXBC 1A7WA 3AZNC 2Y2QA 4NE6A 1M18A 2YFWB 4WNNA 2AROC 3V9RA 3C1CB 3AFAC 1M19D 2HIOA 5F99D 3WA9B 3MGQC 3KXBD 2F8NH 5BNXA 3MGPB 4CSRB 4XUJC 1ID3B 1EQZB 4LD9B 5AV6B 2AROD 4CAYA 3AN2C 3AFAD 1P3BC 3LZ1B 2BYMA 3MGQD 2PYOC 4YS3D 5AY8A 3W97B 5AVCA 1BH9A 1BH8B 4ZUXB 3O62A 4Z66C 5B2JC 5G49B 3KUYB 4M6BA 4ZBJC 5B31B 5B1LC 1WWIA 4KGCC 1WWSA 4QLCD 2PYOD 1B67A 1M19B 5F99B 3B0CT 3UTBC 4XZQA 5E5AD 5CPJD 2ZY3A 2ZY5A 3LZ0C 2JE5A 3MGRC 4JJNC 1P3GC 4WNNB 1M18B 3MGSC 3AZHC 1U35A 1JFIB 1P3PC 2F8ND 2NQBC 5B1LD 3C1BC 3REJC 4KGCD 4NFTA 1KX5A 2HIOB 3UTBD 3AZID 4H9PA 4E44A 4YS3B 3AV1A 3LZ0D 3MGRD 3W98C 3AZHD 1P3PD 2NQBD 3REJD 3X1UC 1KX3C 3VH6A 3NQUB 4QLCB 3AZKD 5AY8B 5AVCB 1P3OC 1P3MA 3MNNA 5JRGA 3AZMA 5E5AB 5CPJB 1AOIC 1TZYD 4H9SA 5B33D 2F8NB 3REID 4J8UD 5CPKA 1P3OD 4WU9A 3AZIB 1ZLAA 2DF4C 3MVDD 5B2ID 3WKJD 1AOID 4YM6D 1KX5B 3TU4A 3REHC 5AV9C 4H9PB 3AZKB 5GT0A 2NZDA 3AV1B 4J8WD 2G5HC 2CV5A 5DNMD 3A6NA 4KUDC 1KX4C 5B0ZA 3UT9D 1P3FC 1TZYB 5B33B 1M1AA 3AZEA 4H9RA 5GSUC 3REIB 4J8UB 4UUZB 5GXQA 5B31G 3MNNB 1S32D 1P34C 1P3MB 3X1TC 3A1IA 3B6FC 3MVDB 5B2IB 4J8VA 1KX4D 3WKJB 1P3FD 3AYWA 2CWEA 5B1MA 5GSUD 4YM6B 3RELA 1HQ3A 1ZLAB 4R8PD 3LELD 4J8WB 5DNMB 3C1CC 3WA9C 3W99C 3UT9B 3MGPC 3X1VD 1ID3C 3REKA 5BS7A 1EQZC 3WTPE 1S32B 4LD9C 5BT1C 2CV5B 5AV6C 3A6NB 4Z2MG 3R45A 5B0ZB 3LZ1C 4HGAB 3WA9D 1F66A 3KWQD 1M1AB 5GT3A 3W97C 1ID3D 3EPJA 2Y2GA 3AZGA 4ZUXC 2XD5A 3WTPA 3EG5B 1ULYA 4LD9D 3KUYC 5BO0A 2Y2JA 5AV6D 4X23A 4R8PB 5B31C 3LELB 4J8VB 1W2EA 3LZ1D 5CPIA 3AZFA 1M19C 5B1MB 5F99C 3W97D 2F8NK 1P3AA 4DRAA 5JA4A 3X1SA 5AVBA 4KHAB 3RELB 3X1VB 4ZUXD 1M18C 3NQJA 4Z2MH 3KUYD 5AV8D 5B31D 3UTAD 1P3LA 2HIOC 2L5AA 3KWQB 1P3KA 4YS3C 1Q9CA 3F6TA 3W96A 3REKB 1M18D 2W8SA 4WU8A 4H9QB 2HIOD 1F66B 4QLCC 5AV5A 5AY8C 3LJAA 5AVCC 4H9OA 5E5AC 3AZNA 2FFFB 3AZGB 5CPJC 3WTPB 4X23B 1R4VA 5AV8B 4UPKA 2IO5B 1PZRA 3UTAB 5AY8D 5CP6A 5AVCD 1N1JA 4H9NA 3AZLA 3AZIC 3VH6T 3X1SB 5AVBB 4Z5TA 4XUJA 1BFMA 2VQRA 1KX5C 3V9RB 3AN2A 1P3BA 4XZQD 2ZY2A 5BNXB 3AZKC 4AWLB 3AV1C 3VH5T 2JSSA 1U35D 3B0DC 4WU8B 4Z66A 5B2JA 1TZYC 5B33C 1KX5D 4CAYB 3REIC 4J8UC 2BYMB 3LJAB 1P3MC 2DQNC 3MNNC 1BH9B 3AV1D 4H9OB 5KDMA 3O62B 3MVDC 4JJNA 5B2IC 1P3GA 3WKJC 3MGSA 5DNNA 3C1BA 4YM6C 2Y2HA 5CP6B 3AZLB 1N1JB 4H9NB 3MNND 1P3MD 5JRGD 4XZQB 3AZMD 1ZLAC 4Z5TB 4J8WC 1U35B 3W98A 5DNMC 4DRBA 5CPKD 3UT9C 1HTAA 3X1UA 4WZSB 1KX3A 5B40A 4WU9D 1ZLAD 1S32C 2CV5C 3A6NC 3AV2A 5FUGA 5B0ZC 4HGAC 2FJ7A 3B0CW 3VH6W 1M1AC 3TU4D 3AZJA 5GT0D 2NZDD 3IP4C 5JRGB 3AL0C 2CV5D 3AZMB 4E45A 4R8PC 3A6ND 3LELC 1P3GB 4J8VC 5B0ZD 4J8XA 1M1AD 3AZED 5DNNB 3VH5W 4G92B 2Y2LA 5CPKB 4G91B 5GXQD 4EO5B 3X1VC 3REHA 3RELC 5AV9A 4WU9B 2UWXA 4J8VD 3KSYA 5CHLB 3AYWD 4KUDA 5B1MD 3X1UB 3KWQC 5B40B 1TAFA 3RELD 3TU4B 5B32A 3REKC 1HQ3D 5BS7C 1P34A 5GT0B 2NZDB 3X1TA 3B6FA 3AV2B 5B24A 5FUGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F66 C;  2FJ7 B;  3WAA A;  3AZE B;  4H9R B;  3AZJ B;  3REK D;  3AZG C;  5GXQ B;  3WTP C;  2YFW A;  5AV8 C;  2IO5 C;  4J8X B;  1F66 D;  3UTA C;  3C1C A;  5GT3 D;  3AYW B;  1P3I A;  3W99 A;  3X1S C;  5AVB C;  3MGP A;  3AZG D;  3WTP D;  1HQ3 B;  1EQZ A;  4X23 D;  2YFV A;  4WV4 B;  5CPI D;  3B6G A;  3AZF D;  1P3A D;  3X1S D;  5AVB D;  1TAF B;  5B0Y A;  4AWL C;  5B32 B;  1BH8 A;  1B6W A;  4WU8 C;  5G49 A;  3B6F B;  1P3L D;  5B24 B;  3R45 B;  3WAA B;  3LJA C;  1P3K D;  1M19 A;  5GT3 B;  5F99 A;  3KXB A;  3W96 D;  3B0B A;  3O62 C;  4WU8 D;  1JFI A;  2LY8 A;  5BO0 B;  5CPI B;  2RVQ D;  5AV5 D;  3AZF B;  2ARO A;  5CP6 C;  3LJA D;  3AZL C;  3AFA A;  1P3I B;  3W99 B;  3MGQ A;  1P3A B;  4XZQ C;  5JA4 B;  3AZN D;  4YS3 A;  4Z5T C;  3O62 D;  5BNV A;  3NQJ B;  1U35 C;  2YFV B;  3B6G B;  1P3L B;  2HUE B;  5CP6 D;  3NQU A;  3AZL D;  4QLC A;  2PYO A;  1P3K B;  5B0Y B;  4Z5T D;  4XUJ D;  3W96 B;  5E5A A;  5CPJ A;  5C3I B;  1H3O A;  2F8N A;  3AN2 D;  1P3B D;  5B1L A;  4KGC A;  1KU5 A;  5AV5 B;  5JRG C;  3KXB B;  3UTB A;  3AZI A;  3AZM C;  3AZN B;  4Z66 D;  2BYK A;  5B2J D;  3LZ0 A;  3MGR A;  4H9S C;  3AZH A;  1P3P A;  5DNN C;  2NQB A;  4G92 C;  5CPK C;  3REJ A;  2ARO B;  4G91 C;  4EO5 C;  3AFA B;  3MGQ B;  4WU9 C;  3AZK A;  4XUJ B;  4JJN D;  1P3G D;  5BNV B;  3MGS D;  5DNN D;  5B32 G;  3C1B D;  1TZY A;  5B33 A;  5B40 C;  3AN2 B;  3REI A;  3TU4 C;  4J8U A;  1P3B B;  2PYO B;  4UUZ A;  4NE5 A;  5GT0 C;  2NZD C;  1P3O A;  3W98 D;  1H3O B;  3AV2 C;  3MVD A;  4Z66 B;  5B2I A;  5B2J B;  2FJ7 C;  1AOI A;  3WKJ A;  3X1U D;  4ZBJ B;  1KX3 D;  5B1L B;  5B40 D;  3AZE C;  3AZJ C;  4KGC B;  3VH5 A;  4YM6 A;  5GXQ C;  3UTB B;  5KDM B;  2BYK B;  3LZ0 B;  3MGR B;  4J8W A;  4JJN B;  4J8X C;  3AV2 D;  3MGS B;  3AZH B;  5DNM A;  2FJ7 D;  1P3P B;  3AYW C;  2NQB B;  5B1M C;  3UT9 A;  3C1B B;  3REJ B;  3AZJ D;  1HQ3 C;  1S32 A;  4J8X D;  3W98 B;  3B0D B;  1KX4 A;  1P3F A;  1KX3 B;  3REH D;  5GSU A;  5B32 C;  5AV9 D;  1P3O B;  4R8P A;  5B24 C;  3LEL A;  4KUD D;  1AOI B;  3WAA C;  5GT3 C;  1F1E A;  5B32 D;  4NE3 A;  1P34 D;  4KHA A;  3X1V A;  3X1T D;  3B6F D;  4X23 C;  5B24 D;  5CPI C;  3WAA D;  3AZF C;  1P3I C;  3WA9 A;  1P3A C;  3KWQ A;  4CSR A;  3REH B;  5AV9 B;  1ID3 A;  4LD9 A;  3B6G C;  4H9Q A;  5AV6 A;  1P3L C;  3C1C D;  2HUE C;  1P3I D;  4KUD B;  1KX4 B;  3W99 D;  3LZ1 A;  1P3F B;  3MGP D;  1P3K C;  5B0Y C;  3W97 A;  5GSU B;  3W96 C;  1EQZ D;  1P34 B;  2F8N G;  5C3I C;  4ZUX A;  5BT1 D;  3X1T B;  3KUY A;  3B6G D;  5AV8 A;  5B31 A;  2RVQ C;  3UTA A;  5AV5 C;  5B0Y D;  3KXB C;  1A7W A;  3AZN C;  4NE6 A;  1M18 A;  2YFW B;  4WNN A;  2ARO C;  3V9R A;  3C1C B;  3AFA C;  1M19 D;  2HIO A;  5F99 D;  3WA9 B;  3MGQ C;  3KXB D;  2F8N H;  5BNX A;  3MGP B;  4CSR B;  4XUJ C;  1ID3 B;  1EQZ B;  4LD9 B;  5AV6 B;  2ARO D;  4CAY A;  3AN2 C;  3AFA D;  1P3B C;  3LZ1 B;  2BYM A;  3MGQ D;  2PYO C;  4YS3 D;  5AY8 A;  3W97 B;  5AVC A;  1BH9 A;  1BH8 B;  4ZUX B;  3O62 A;  4Z66 C;  5B2J C;  5G49 B;  3KUY B;  4M6B A;  4ZBJ C;  5B31 B;  5B1L C;  1WWI A;  4KGC C;  1WWS A;  4QLC D;  2PYO D;  1B67 A;  1M19 B;  5F99 B;  3B0C T;  3UTB C;  4XZQ A;  5E5A D;  5CPJ D;  3LZ0 C;  3MGR C;  4JJN C;  1P3G C;  1JFI B;  1M18 B;  4WNN B;  3MGS C;  3AZH C;  1U35 A;  1P3P C;  2F8N D;  2NQB C;  5B1L D;  3C1B C;  3REJ C;  4KGC D;  4NFT A;  1KX5 A;  2HIO B;  3UTB D;  3AZI D;  4H9P A;  4E44 A;  4YS3 B;  3AV1 A;  3LZ0 D;  3MGR D;  3W98 C;  3AZH D;  1P3P D;  2NQB D;  3REJ D;  3X1U C;  1KX3 C;  3VH6 A;  3NQU B;  4QLC B;  3AZK D;  5AY8 B;  5AVC B;  1P3O C;  1P3M A;  3MNN A;  5JRG A;  3AZM A;  5E5A B;  5CPJ B;  1AOI C;  1TZY D;  4H9S A;  5B33 D;  2F8N B;  3REI D;  4J8U D;  5CPK A;  1P3O D;  4WU9 A;  3AZI B;  1ZLA A;  3MVD D;  5B2I D;  3WKJ D;  1AOI D;  4YM6 D;  1KX5 B;  3TU4 A;  3REH C;  5AV9 C;  4H9P B;  3AZK B;  5GT0 A;  2NZD A;  3AV1 B;  4J8W D;  2CV5 A;  5DNM D;  3A6N A;  4KUD C;  1KX4 C;  5B0Z A;  3UT9 D;  1P3F C;  1TZY B;  5B33 B;  1M1A A;  3AZE A;  4H9R A;  5GSU C;  3REI B;  4J8U B;  4UUZ B;  5GXQ A;  5B31 G;  3MNN B;  1S32 D;  1P34 C;  1P3M B;  3X1T C;  3B6F C;  3MVD B;  5B2I B;  4J8V A;  1KX4 D;  3WKJ B;  1P3F D;  3AYW A;  2CWE A;  5B1M A;  5GSU D;  4YM6 B;  3REL A;  1HQ3 A;  1ZLA B;  4R8P D;  3LEL D;  4J8W B;  5DNM B;  3C1C C;  3WA9 C;  3W99 C;  3UT9 B;  3MGP C;  3X1V D;  1ID3 C;  3REK A;  5BS7 A;  1EQZ C;  3WTP E;  1S32 B;  4LD9 C;  5BT1 C;  2CV5 B;  5AV6 C;  3A6N B;  4Z2M G;  3R45 A;  5B0Z B;  3LZ1 C;  4HGA B;  3WA9 D;  1F66 A;  3KWQ D;  1M1A B;  5GT3 A;  3W97 C;  1ID3 D;  3AZG A;  4ZUX C;  3WTP A;  4LD9 D;  1ULY A;  3KUY C;  5BO0 A;  5AV6 D;  4X23 A;  4R8P B;  5B31 C;  3LEL B;  4J8V B;  3LZ1 D;  5CPI A;  5B24 A;  3AZF A;  1M19 C;  5B1M B;  5F99 C;  3W97 D;  2F8N K;  1P3A A;  4DRA A;  5JA4 A;  3X1S A;  5AVB A;  4KHA B;  3REL B;  3X1V B;  4ZUX D;  1M18 C;  3NQJ A;  4Z2M H;  3KUY D;  5AV8 D;  5B31 D;  3UTA D;  1P3L A;  2HIO C;  2L5A A;  3KWQ B;  1P3K A;  4YS3 C;  1Q9C A;  3W96 A;  3REK B;  1M18 D;  4WU8 A;  4H9Q B;  2HIO D;  1F66 B;  4QLC C;  5AV5 A;  5AY8 C;  3LJA A;  5AVC C;  4H9O A;  5E5A C;  3AZN A;  3AZG B;  5CPJ C;  3WTP B;  4X23 B;  1R4V A;  5AV8 B;  2IO5 B;  3UTA B;  5AY8 D;  5CP6 A;  5AVC D;  1N1J A;  4H9N A;  3AZL A;  3AZI C;  3VH6 T;  3X1S B;  5AVB B;  4Z5T A;  4XUJ A;  1BFM A;  1KX5 C;  3V9R B;  3AN2 A;  1P3B A;  4XZQ D;  5BNX B;  3AZK C;  4AWL B;  3AV1 C;  3VH5 T;  2JSS A;  1U35 D;  3B0D C;  4WU8 B;  4Z66 A;  5B2J A;  1TZY C;  5B33 C;  1KX5 D;  4CAY B;  3REI C;  4J8U C;  2BYM B;  3LJA B;  1P3M C;  3MNN C;  1BH9 B;  3AV1 D;  4H9O B;  5KDM A;  3O62 B;  3MVD C;  4JJN A;  5B2I C;  1P3G A;  3WKJ C;  3MGS A;  5DNN A;  3C1B A;  4YM6 C;  5CP6 B;  3AZL B;  1N1J B;  4H9N B;  3MNN D;  1P3M D;  5JRG D;  4XZQ B;  3AZM D;  1ZLA C;  4Z5T B;  4J8W C;  1U35 B;  3W98 A;  5DNM C;  4DRB A;  5CPK D;  3UT9 C;  1HTA A;  3X1U A;  1KX3 A;  5B40 A;  4WU9 D;  1ZLA D;  1S32 C;  2CV5 C;  3A6N C;  3AV2 A;  5FUG A;  5B0Z C;  4HGA C;  2FJ7 A;  3B0C W;  3VH6 W;  1M1A C;  3TU4 D;  3AZJ A;  5GT0 D;  2NZD D;  5JRG B;  2CV5 D;  3AZM B;  4E45 A;  4R8P C;  3A6N D;  3LEL C;  1P3G B;  4J8V C;  5B0Z D;  4J8X A;  1M1A D;  3AZE D;  5DNN B;  3VH5 W;  4G92 B;  5CPK B;  4G91 B;  5GXQ D;  4EO5 B;  3X1V C;  3REH A;  3REL C;  5AV9 A;  4WU9 B;  4J8V D;  3KSY A;  5CHL B;  3AYW D;  4KUD A;  5B1M D;  3X1U B;  3KWQ C;  5B40 B;  1TAF A;  3REL D;  3TU4 B;  5B32 A;  3REK C;  1HQ3 D;  5BS7 C;  1P34 A;  5GT0 B;  2NZD B;  3X1T A;  3B6F A;  3AV2 B;  4WZS B;  5FUG B; 
#chains in the Genus database with same CATH topology
 1F66 C;  3P5J B;  2FJ7 B;  3WAA A;  3AZE B;  4H9R B;  3AZJ B;  3REK D;  3AZG C;  5GXQ B;  3WTP C;  2XD1 A;  2RIQ A;  2YFW A;  2ZM5 A;  5AV8 C;  2IO5 C;  4J8X B;  1F66 D;  3UTA C;  3C1C A;  5GT3 D;  3AYW B;  1P3I A;  3W99 A;  3X1S C;  5AVB C;  3MGP A;  3AZG D;  3WTP D;  1HQ3 B;  1EQZ A;  2F2A C;  3H0M C;  4X23 D;  2YFV A;  4WV4 B;  1Z2C B;  5CPI D;  3B6G A;  3AZF D;  1P3A D;  3X1S D;  5AVB D;  1TAF B;  5B0Y A;  4AWL C;  5B32 B;  1BH8 A;  1B6W A;  4WU8 C;  5G49 A;  3B6F B;  1P3L D;  5B24 B;  3R45 B;  3WAA B;  3LJA C;  4DQY B;  1P3K D;  1M19 A;  5GT3 B;  5F99 A;  3KXB A;  3W96 D;  3B0B A;  3O62 C;  4WU8 D;  1JFI A;  2LY8 A;  5BO0 B;  5CPI B;  2RVQ D;  5AV5 D;  3AZF B;  2ARO A;  5CP6 C;  3LJA D;  3AZL C;  3AFA A;  1P3I B;  3W99 B;  3MGQ A;  1P3A B;  4XZQ C;  5JA4 B;  3AZN D;  4YS3 A;  4Z5T C;  3O62 D;  5BNV A;  3NQJ B;  1U35 C;  2YFV B;  3EPH A;  3B6G B;  1P3L B;  2HUE B;  3H0L C;  5CP6 D;  3NQU A;  3AZL D;  4QLC A;  2PYO A;  1P3K B;  5B0Y B;  4Z5T D;  4XUJ D;  3W96 B;  5E5A A;  5CPJ A;  5C3I B;  1H3O A;  3EPL A;  2F8N A;  3AN2 D;  1P3B D;  5B1L A;  2ZY4 A;  4KGC A;  1KU5 A;  5AV5 B;  5JRG C;  3KXB B;  3UTB A;  3AZI A;  3AZM C;  3AZN B;  4Z66 D;  2BYK A;  5B2J D;  3LZ0 A;  3MGR A;  4H9S C;  3AZH A;  1P3P A;  5DNN C;  2NQB A;  4G92 C;  5CPK C;  3REJ A;  2ARO B;  4G91 C;  4EO5 C;  3AFA B;  3MGQ B;  4WU9 C;  3AZK A;  4XUJ B;  4JJN D;  1P3G D;  5BNV B;  3MGS D;  5DNN D;  5B32 G;  3C1B D;  1TZY A;  5B33 A;  2G5I C;  5B40 C;  3AN2 B;  3REI A;  3TU4 C;  4J8U A;  1P3B B;  2PYO B;  4UUZ A;  4NE5 A;  5GT0 C;  2NZD C;  1P3O A;  3H0R C;  3W98 D;  1H3O B;  3AV2 C;  3MVD A;  4Z66 B;  2Y2K A;  5B2J B;  5B2I A;  2FJ7 C;  1AOI A;  3WKJ A;  3X1U D;  4ZBJ B;  1KX3 D;  5B1L B;  5B40 D;  3AZE C;  3AZJ C;  4KGC B;  3VH5 A;  4YM6 A;  5GXQ C;  3UTB B;  1T3U A;  5KDM B;  2BYK B;  3LZ0 B;  3MGR B;  4J8W A;  4JJN B;  4J8X C;  3AV2 D;  3MGS B;  2Y2O A;  5DNM A;  3AZH B;  2FJ7 D;  1P3P B;  3AYW C;  2NQB B;  5B1M C;  3UT9 A;  3C1B B;  3REJ B;  3AZJ D;  1HQ3 C;  2BG1 A;  1S32 A;  4J8X D;  3W98 B;  3B0D B;  1KX4 A;  1P3F A;  1KX3 B;  3REH D;  5GSU A;  5B32 C;  5AV9 D;  3KFU G;  1P3O B;  2Y2I A;  4R8P A;  5B24 C;  3LEL A;  4KUD D;  1AOI B;  3WAA C;  2Y2M A;  1F1E A;  5GT3 C;  5B32 D;  2J8P A;  4NE3 A;  1P34 D;  4KHA A;  3X1V A;  3X1T D;  3A1K A;  3B6F D;  4X23 C;  5B24 D;  4WJ3 C;  5CPI C;  3WAA D;  3AZF C;  1P3I C;  3WA9 A;  3EPK A;  1P3A C;  3KWQ A;  4CSR A;  3REH B;  5AV9 B;  1ID3 A;  4LD9 A;  3B6G C;  4H9Q A;  5AV6 A;  1P3L C;  3C1C D;  2HUE C;  2JCH A;  1P3I D;  3FDD A;  1KX4 B;  3W99 D;  3LZ1 A;  1P3F B;  4KUD B;  3MGP D;  1P3K C;  5B0Y C;  3W97 A;  5GSU B;  3W96 C;  1EQZ D;  1P34 B;  2F8N G;  5C3I C;  4ZUX A;  5BT1 D;  3X1T B;  3KUY A;  3B6G D;  5AV8 A;  5B31 A;  2RVQ C;  3UTA A;  5AV5 C;  2Y2N A;  5B0Y D;  2Y2P A;  3KXB C;  1A7W A;  3AZN C;  2Y2Q A;  4NE6 A;  1M18 A;  2YFW B;  4WNN A;  2ARO C;  3V9R A;  3C1C B;  3AFA C;  1M19 D;  2HIO A;  5F99 D;  3WA9 B;  3MGQ C;  3KXB D;  2F8N H;  5BNX A;  3MGP B;  4CSR B;  4XUJ C;  1ID3 B;  1EQZ B;  4LD9 B;  5AV6 B;  2ARO D;  4CAY A;  3AN2 C;  3AFA D;  1P3B C;  3LZ1 B;  2BYM A;  3MGQ D;  2PYO C;  4YS3 D;  5AY8 A;  3W97 B;  5AVC A;  1BH9 A;  1BH8 B;  4ZUX B;  3O62 A;  4Z66 C;  5B2J C;  5G49 B;  3KUY B;  4M6B A;  4ZBJ C;  5B31 B;  5B1L C;  1WWI A;  4KGC C;  1WWS A;  4QLC D;  2PYO D;  1B67 A;  1M19 B;  5F99 B;  3B0C T;  3UTB C;  4XZQ A;  5E5A D;  5CPJ D;  2ZY3 A;  2ZY5 A;  3LZ0 C;  2JE5 A;  3MGR C;  4JJN C;  1P3G C;  4WNN B;  1M18 B;  3MGS C;  3AZH C;  1U35 A;  1JFI B;  1P3P C;  2F8N D;  2NQB C;  5B1L D;  3C1B C;  3REJ C;  4KGC D;  4NFT A;  1KX5 A;  2HIO B;  3UTB D;  3AZI D;  4H9P A;  4E44 A;  4YS3 B;  3AV1 A;  3LZ0 D;  3MGR D;  3W98 C;  3AZH D;  1P3P D;  2NQB D;  3REJ D;  3X1U C;  1KX3 C;  3VH6 A;  3NQU B;  4QLC B;  3AZK D;  5AY8 B;  5AVC B;  1P3O C;  1P3M A;  3MNN A;  5JRG A;  3AZM A;  5E5A B;  5CPJ B;  1AOI C;  1TZY D;  4H9S A;  5B33 D;  2F8N B;  3REI D;  4J8U D;  5CPK A;  1P3O D;  4WU9 A;  3AZI B;  1ZLA A;  2DF4 C;  3MVD D;  5B2I D;  3WKJ D;  1AOI D;  4YM6 D;  1KX5 B;  3TU4 A;  3REH C;  5AV9 C;  4H9P B;  3AZK B;  5GT0 A;  2NZD A;  3AV1 B;  4J8W D;  2G5H C;  2CV5 A;  5DNM D;  3A6N A;  4KUD C;  1KX4 C;  5B0Z A;  3UT9 D;  1P3F C;  1TZY B;  5B33 B;  1M1A A;  3AZE A;  4H9R A;  5GSU C;  3REI B;  4J8U B;  4UUZ B;  5GXQ A;  5B31 G;  3MNN B;  1S32 D;  1P34 C;  1P3M B;  3X1T C;  3A1I A;  3B6F C;  3MVD B;  5B2I B;  4J8V A;  1KX4 D;  3WKJ B;  1P3F D;  3AYW A;  2CWE A;  5B1M A;  5GSU D;  4YM6 B;  3REL A;  1HQ3 A;  1ZLA B;  4R8P D;  3LEL D;  4J8W B;  5DNM B;  3C1C C;  3WA9 C;  3W99 C;  3UT9 B;  3MGP C;  3X1V D;  1ID3 C;  3REK A;  5BS7 A;  1EQZ C;  3WTP E;  1S32 B;  4LD9 C;  5BT1 C;  2CV5 B;  5AV6 C;  3A6N B;  4Z2M G;  3R45 A;  5B0Z B;  3LZ1 C;  4HGA B;  3WA9 D;  1F66 A;  3KWQ D;  1M1A B;  5GT3 A;  3W97 C;  1ID3 D;  3EPJ A;  2Y2G A;  3AZG A;  4ZUX C;  2XD5 A;  3WTP A;  3EG5 B;  1ULY A;  4LD9 D;  3KUY C;  5BO0 A;  2Y2J A;  5AV6 D;  4X23 A;  4R8P B;  5B31 C;  3LEL B;  4J8V B;  1W2E A;  3LZ1 D;  5CPI A;  3AZF A;  1M19 C;  5B1M B;  5F99 C;  3W97 D;  2F8N K;  1P3A A;  4DRA A;  5JA4 A;  3X1S A;  5AVB A;  4KHA B;  3REL B;  3X1V B;  4ZUX D;  1M18 C;  3NQJ A;  4Z2M H;  3KUY D;  5AV8 D;  5B31 D;  3UTA D;  1P3L A;  2HIO C;  2L5A A;  3KWQ B;  1P3K A;  4YS3 C;  1Q9C A;  3F6T A;  3W96 A;  3REK B;  1M18 D;  2W8S A;  4WU8 A;  4H9Q B;  2HIO D;  1F66 B;  4QLC C;  5AV5 A;  5AY8 C;  3LJA A;  5AVC C;  4H9O A;  5E5A C;  3AZN A;  2FFF B;  3AZG B;  5CPJ C;  3WTP B;  4X23 B;  1R4V A;  5AV8 B;  4UPK A;  2IO5 B;  1PZR A;  3UTA B;  5AY8 D;  5CP6 A;  5AVC D;  1N1J A;  4H9N A;  3AZL A;  3AZI C;  3VH6 T;  3X1S B;  5AVB B;  4Z5T A;  4XUJ A;  1BFM A;  2VQR A;  1KX5 C;  3V9R B;  3AN2 A;  1P3B A;  4XZQ D;  2ZY2 A;  5BNX B;  3AZK C;  4AWL B;  3AV1 C;  3VH5 T;  2JSS A;  1U35 D;  3B0D C;  4WU8 B;  4Z66 A;  5B2J A;  1TZY C;  5B33 C;  1KX5 D;  4CAY B;  3REI C;  4J8U C;  2BYM B;  3LJA B;  1P3M C;  2DQN C;  3MNN C;  1BH9 B;  3AV1 D;  4H9O B;  5KDM A;  3O62 B;  3MVD C;  4JJN A;  5B2I C;  1P3G A;  3WKJ C;  3MGS A;  5DNN A;  3C1B A;  4YM6 C;  2Y2H A;  5CP6 B;  3AZL B;  1N1J B;  4H9N B;  3MNN D;  1P3M D;  5JRG D;  4XZQ B;  3AZM D;  1ZLA C;  4Z5T B;  4J8W C;  1U35 B;  3W98 A;  5DNM C;  4DRB A;  5CPK D;  3UT9 C;  1HTA A;  3X1U A;  4WZS B;  1KX3 A;  5B40 A;  4WU9 D;  1ZLA D;  1S32 C;  2CV5 C;  3A6N C;  3AV2 A;  5FUG A;  5B0Z C;  4HGA C;  2FJ7 A;  3B0C W;  3VH6 W;  1M1A C;  3TU4 D;  3AZJ A;  5GT0 D;  2NZD D;  3IP4 C;  5JRG B;  3AL0 C;  2CV5 D;  3AZM B;  4E45 A;  4R8P C;  3A6N D;  3LEL C;  1P3G B;  4J8V C;  5B0Z D;  4J8X A;  1M1A D;  3AZE D;  5DNN B;  3VH5 W;  4G92 B;  2Y2L A;  5CPK B;  4G91 B;  5GXQ D;  4EO5 B;  3X1V C;  3REH A;  3REL C;  5AV9 A;  4WU9 B;  2UWX A;  4J8V D;  3KSY A;  5CHL B;  3AYW D;  4KUD A;  5B1M D;  3X1U B;  3KWQ C;  5B40 B;  1TAF A;  3REL D;  3TU4 B;  5B32 A;  3REK C;  1HQ3 D;  5BS7 C;  1P34 A;  5GT0 B;  2NZD B;  3X1T A;  3B6F A;  3AV2 B;  5B24 A;  5FUG B; 
#chains in the Genus database with same CATH homology
 1F66 C;  3P5J B;  2FJ7 B;  3WAA A;  3AZE B;  4H9R B;  3AZJ B;  3REK D;  3AZG C;  5GXQ B;  3WTP C;  2XD1 A;  2RIQ A;  2YFW A;  2ZM5 A;  5AV8 C;  2IO5 C;  4J8X B;  1F66 D;  3UTA C;  3C1C A;  5GT3 D;  3AYW B;  1P3I A;  3W99 A;  3X1S C;  5AVB C;  3MGP A;  3AZG D;  3WTP D;  1HQ3 B;  1EQZ A;  2F2A C;  3H0M C;  4X23 D;  2YFV A;  4WV4 B;  1Z2C B;  5CPI D;  3B6G A;  3AZF D;  1P3A D;  3X1S D;  5AVB D;  1TAF B;  5B0Y A;  4AWL C;  5B32 B;  1BH8 A;  1B6W A;  4WU8 C;  5G49 A;  3B6F B;  1P3L D;  5B24 B;  3R45 B;  3WAA B;  3LJA C;  4DQY B;  1P3K D;  1M19 A;  5GT3 B;  5F99 A;  3KXB A;  3W96 D;  3B0B A;  3O62 C;  4WU8 D;  1JFI A;  2LY8 A;  5BO0 B;  5CPI B;  2RVQ D;  5AV5 D;  3AZF B;  2ARO A;  5CP6 C;  3LJA D;  3AZL C;  3AFA A;  1P3I B;  3W99 B;  3MGQ A;  1P3A B;  4XZQ C;  5JA4 B;  3AZN D;  4YS3 A;  4Z5T C;  3O62 D;  5BNV A;  3NQJ B;  1U35 C;  2YFV B;  3EPH A;  3B6G B;  1P3L B;  2HUE B;  3H0L C;  5CP6 D;  3NQU A;  3AZL D;  4QLC A;  2PYO A;  1P3K B;  5B0Y B;  4Z5T D;  4XUJ D;  3W96 B;  5E5A A;  5CPJ A;  5C3I B;  1H3O A;  3EPL A;  2F8N A;  3AN2 D;  1P3B D;  5B1L A;  2ZY4 A;  4KGC A;  1KU5 A;  5AV5 B;  5JRG C;  3KXB B;  3UTB A;  3AZI A;  3AZM C;  3AZN B;  4Z66 D;  2BYK A;  5B2J D;  3LZ0 A;  3MGR A;  4H9S C;  3AZH A;  1P3P A;  5DNN C;  2NQB A;  4G92 C;  5CPK C;  3REJ A;  2ARO B;  4G91 C;  4EO5 C;  3AFA B;  3MGQ B;  4WU9 C;  3AZK A;  4XUJ B;  4JJN D;  1P3G D;  5BNV B;  3MGS D;  5DNN D;  5B32 G;  3C1B D;  1TZY A;  5B33 A;  2G5I C;  5B40 C;  3AN2 B;  3REI A;  3TU4 C;  4J8U A;  1P3B B;  2PYO B;  4UUZ A;  4NE5 A;  5GT0 C;  2NZD C;  1P3O A;  3H0R C;  3W98 D;  1H3O B;  3AV2 C;  3MVD A;  4Z66 B;  2Y2K A;  5B2J B;  5B2I A;  2FJ7 C;  1AOI A;  3WKJ A;  3X1U D;  4ZBJ B;  1KX3 D;  5B1L B;  5B40 D;  3AZE C;  3AZJ C;  4KGC B;  3VH5 A;  4YM6 A;  5GXQ C;  3UTB B;  1T3U A;  5KDM B;  2BYK B;  3LZ0 B;  3MGR B;  4J8W A;  4JJN B;  4J8X C;  3AV2 D;  3MGS B;  2Y2O A;  5DNM A;  3AZH B;  2FJ7 D;  1P3P B;  3AYW C;  2NQB B;  5B1M C;  3UT9 A;  3C1B B;  3REJ B;  3AZJ D;  1HQ3 C;  2BG1 A;  1S32 A;  4J8X D;  3W98 B;  3B0D B;  1KX4 A;  1P3F A;  1KX3 B;  3REH D;  5GSU A;  5B32 C;  5AV9 D;  3KFU G;  1P3O B;  2Y2I A;  4R8P A;  5B24 C;  3LEL A;  4KUD D;  1AOI B;  3WAA C;  2Y2M A;  1F1E A;  5GT3 C;  5B32 D;  2J8P A;  4NE3 A;  1P34 D;  4KHA A;  3X1V A;  3X1T D;  3A1K A;  3B6F D;  4X23 C;  5B24 D;  4WJ3 C;  5CPI C;  3WAA D;  3AZF C;  1P3I C;  3WA9 A;  3EPK A;  1P3A C;  3KWQ A;  4CSR A;  3REH B;  5AV9 B;  1ID3 A;  4LD9 A;  3B6G C;  4H9Q A;  5AV6 A;  1P3L C;  3C1C D;  2HUE C;  2JCH A;  1P3I D;  3FDD A;  1KX4 B;  3W99 D;  3LZ1 A;  1P3F B;  4KUD B;  3MGP D;  1P3K C;  5B0Y C;  3W97 A;  5GSU B;  3W96 C;  1EQZ D;  1P34 B;  2F8N G;  5C3I C;  4ZUX A;  5BT1 D;  3X1T B;  3KUY A;  3B6G D;  5AV8 A;  5B31 A;  2RVQ C;  3UTA A;  5AV5 C;  2Y2N A;  5B0Y D;  2Y2P A;  3KXB C;  1A7W A;  3AZN C;  2Y2Q A;  4NE6 A;  1M18 A;  2YFW B;  4WNN A;  2ARO C;  3V9R A;  3C1C B;  3AFA C;  1M19 D;  2HIO A;  5F99 D;  3WA9 B;  3MGQ C;  3KXB D;  2F8N H;  5BNX A;  3MGP B;  4CSR B;  4XUJ C;  1ID3 B;  1EQZ B;  4LD9 B;  5AV6 B;  2ARO D;  4CAY A;  3AN2 C;  3AFA D;  1P3B C;  3LZ1 B;  2BYM A;  3MGQ D;  2PYO C;  4YS3 D;  5AY8 A;  3W97 B;  5AVC A;  1BH9 A;  1BH8 B;  4ZUX B;  3O62 A;  4Z66 C;  5B2J C;  5G49 B;  3KUY B;  4M6B A;  4ZBJ C;  5B31 B;  5B1L C;  1WWI A;  4KGC C;  1WWS A;  4QLC D;  2PYO D;  1B67 A;  1M19 B;  5F99 B;  3B0C T;  3UTB C;  4XZQ A;  5E5A D;  5CPJ D;  2ZY3 A;  2ZY5 A;  3LZ0 C;  2JE5 A;  3MGR C;  4JJN C;  1P3G C;  4WNN B;  1M18 B;  3MGS C;  3AZH C;  1U35 A;  1JFI B;  1P3P C;  2F8N D;  2NQB C;  5B1L D;  3C1B C;  3REJ C;  4KGC D;  4NFT A;  1KX5 A;  2HIO B;  3UTB D;  3AZI D;  4H9P A;  4E44 A;  4YS3 B;  3AV1 A;  3LZ0 D;  3MGR D;  3W98 C;  3AZH D;  1P3P D;  2NQB D;  3REJ D;  3X1U C;  1KX3 C;  3VH6 A;  3NQU B;  4QLC B;  3AZK D;  5AY8 B;  5AVC B;  1P3O C;  1P3M A;  3MNN A;  5JRG A;  3AZM A;  5E5A B;  5CPJ B;  1AOI C;  1TZY D;  4H9S A;  5B33 D;  2F8N B;  3REI D;  4J8U D;  5CPK A;  1P3O D;  4WU9 A;  3AZI B;  1ZLA A;  2DF4 C;  3MVD D;  5B2I D;  3WKJ D;  1AOI D;  4YM6 D;  1KX5 B;  3TU4 A;  3REH C;  5AV9 C;  4H9P B;  3AZK B;  5GT0 A;  2NZD A;  3AV1 B;  4J8W D;  2G5H C;  2CV5 A;  5DNM D;  3A6N A;  4KUD C;  1KX4 C;  5B0Z A;  3UT9 D;  1P3F C;  1TZY B;  5B33 B;  1M1A A;  3AZE A;  4H9R A;  5GSU C;  3REI B;  4J8U B;  4UUZ B;  5GXQ A;  5B31 G;  3MNN B;  1S32 D;  1P34 C;  1P3M B;  3X1T C;  3A1I A;  3B6F C;  3MVD B;  5B2I B;  4J8V A;  1KX4 D;  3WKJ B;  1P3F D;  3AYW A;  2CWE A;  5B1M A;  5GSU D;  4YM6 B;  3REL A;  1HQ3 A;  1ZLA B;  4R8P D;  3LEL D;  4J8W B;  5DNM B;  3C1C C;  3WA9 C;  3W99 C;  3UT9 B;  3MGP C;  3X1V D;  1ID3 C;  3REK A;  5BS7 A;  1EQZ C;  3WTP E;  1S32 B;  4LD9 C;  5BT1 C;  2CV5 B;  5AV6 C;  3A6N B;  4Z2M G;  3R45 A;  5B0Z B;  3LZ1 C;  4HGA B;  3WA9 D;  1F66 A;  3KWQ D;  1M1A B;  5GT3 A;  3W97 C;  1ID3 D;  3EPJ A;  2Y2G A;  3AZG A;  4ZUX C;  2XD5 A;  3WTP A;  3EG5 B;  1ULY A;  4LD9 D;  3KUY C;  5BO0 A;  2Y2J A;  5AV6 D;  4X23 A;  4R8P B;  5B31 C;  3LEL B;  4J8V B;  1W2E A;  3LZ1 D;  5CPI A;  3AZF A;  1M19 C;  5B1M B;  5F99 C;  3W97 D;  2F8N K;  1P3A A;  4DRA A;  5JA4 A;  3X1S A;  5AVB A;  4KHA B;  3REL B;  3X1V B;  4ZUX D;  1M18 C;  3NQJ A;  4Z2M H;  3KUY D;  5AV8 D;  5B31 D;  3UTA D;  1P3L A;  2HIO C;  2L5A A;  3KWQ B;  1P3K A;  4YS3 C;  1Q9C A;  3F6T A;  3W96 A;  3REK B;  1M18 D;  2W8S A;  4WU8 A;  4H9Q B;  2HIO D;  1F66 B;  4QLC C;  5AV5 A;  5AY8 C;  3LJA A;  5AVC C;  4H9O A;  5E5A C;  3AZN A;  2FFF B;  3AZG B;  5CPJ C;  3WTP B;  4X23 B;  1R4V A;  5AV8 B;  4UPK A;  2IO5 B;  1PZR A;  3UTA B;  5AY8 D;  5CP6 A;  5AVC D;  1N1J A;  4H9N A;  3AZL A;  3AZI C;  3VH6 T;  3X1S B;  5AVB B;  4Z5T A;  4XUJ A;  1BFM A;  2VQR A;  1KX5 C;  3V9R B;  3AN2 A;  1P3B A;  4XZQ D;  2ZY2 A;  5BNX B;  3AZK C;  4AWL B;  3AV1 C;  3VH5 T;  2JSS A;  1U35 D;  3B0D C;  4WU8 B;  4Z66 A;  5B2J A;  1TZY C;  5B33 C;  1KX5 D;  4CAY B;  3REI C;  4J8U C;  2BYM B;  3LJA B;  1P3M C;  2DQN C;  3MNN C;  1BH9 B;  3AV1 D;  4H9O B;  5KDM A;  3O62 B;  3MVD C;  4JJN A;  5B2I C;  1P3G A;  3WKJ C;  3MGS A;  5DNN A;  3C1B A;  4YM6 C;  2Y2H A;  5CP6 B;  3AZL B;  1N1J B;  4H9N B;  3MNN D;  1P3M D;  5JRG D;  4XZQ B;  3AZM D;  1ZLA C;  4Z5T B;  4J8W C;  1U35 B;  3W98 A;  5DNM C;  4DRB A;  5CPK D;  3UT9 C;  1HTA A;  3X1U A;  4WZS B;  1KX3 A;  5B40 A;  4WU9 D;  1ZLA D;  1S32 C;  2CV5 C;  3A6N C;  3AV2 A;  5FUG A;  5B0Z C;  4HGA C;  2FJ7 A;  3B0C W;  3VH6 W;  1M1A C;  3TU4 D;  3AZJ A;  5GT0 D;  2NZD D;  3IP4 C;  5JRG B;  3AL0 C;  2CV5 D;  3AZM B;  4E45 A;  4R8P C;  3A6N D;  3LEL C;  1P3G B;  4J8V C;  5B0Z D;  4J8X A;  1M1A D;  3AZE D;  5DNN B;  3VH5 W;  4G92 B;  2Y2L A;  5CPK B;  4G91 B;  5GXQ D;  4EO5 B;  3X1V C;  3REH A;  3REL C;  5AV9 A;  4WU9 B;  2UWX A;  4J8V D;  3KSY A;  5CHL B;  3AYW D;  4KUD A;  5B1M D;  3X1U B;  3KWQ C;  5B40 B;  1TAF A;  3REL D;  3TU4 B;  5B32 A;  3REK C;  1HQ3 D;  5BS7 C;  1P34 A;  5GT0 B;  2NZD B;  3X1T A;  3B6F A;  3AV2 B;  5B24 A;  5FUG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...