3AZMA

Crystal structure of human nucleosome core particle containing h4k79q mutation
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 29
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azmA00
5AVCD 3UTBB 3A6NC 4H9OA 3X1TC 3W97C 5AV8B 3MNNA 4JJNB 3B6FB 3KUYC 5GSUB 5AVCA 3WTPC 4WV4B 4J8UD 5B33A 5B0ZD 5C3IB 3KXBD 4UUZA 3W97B 5B0ZA 4H9PA 3RELA 4LD9B 5DNNB 3AZIB 3AZHC 5B40D 4E45A 4XUJB 3WAAC 1TZYB 5B40A 4WU8C 5G49A 1EQZC 3W99B 1P3OB 3B6GB 3MVDB 3AYWB 4Z66C 3O62B 1P3AC 4XZQA 4WU8B 4CSRA 5AV6B 3V9RA 1P3ID 3VH5W 5AV5C 3UT9B 4ZBJC 5F99B 5B1MB 1S32D 4WNNB 1P3IA 2NZDB 3AZLD 4Z66B 4Z5TA 3AFAD 1S32A 1P3PC 4YS3C 5BNVA 1M1AB 1P34A 4H9NB 5GXQA 3AFAA 3WA9C 5GT0D 3C1BC 3REHD 2F8NG 3B0CW 2NQBB 5B2IC 3REHA 5FUGB 3WKJA 3AV1D 3LJAD 1P3GD 3MGSD 4Z2MH 1P3BC 1KX4C 1KX5C 3AZMD 3AV1A 3MGSA 5B24C 5E5AB 2PYOD 4KUDC 1BH9B 2HIOD 3AZMA 3MNNC 1P3MC 2F8NK 2PYOA 1P3BB 2HIOA 5KDMB 5BNXB 5AVCC 3X1UB 3W96A 4WU9B 1H3OA 1KU5A 3KSYA 1HQ3D 3A6ND 5B0ZC 3AZEB 3AN2B 1P3MB 2IO5C 3KUYD 4M6BA 3AZKB 4R8PB 3LELD 5B40C 3TU4D 4J8UB 3LELA 3MGPD 2IO5B 3TU4A 3AZGA 3LZ0B 3KXBB 1TAFB 4G91C 4EO5B 3KWQD 3MGPA 4XZQC 1BFMA 3B0BA 3KWQA 4YM6D 4DRAA 2FJ7B 1P3IC 4G91B 4J8XA 1ID3D 3C1CB 4Z5TC 1S32C 1P34C 5GXQC 3AZLC 2RVQD 3AFAC 5JRGA 5AY8B 3B0DB 2L5AA 1N1JA 3MGRB 4HGAC 5GT0C 5CPJB 3REHC 2F8NH 3R45B 3WKJC 3AZLB 3C1BD 5B0YB 3AV1C 3LJAC 3MGSC 5GT0B 3AZMC 2PYOC 2LY8A 2HIOC 2HUEC 3W96C 3AZFD 3AV1B 3LJAB 1P3GB 3MGSB 5B2JB 3W98B 3AZFA 1R4VA 4X23D 5AVBB 4ZUXB 3MNND 2YFVA 2BYKB 1P3FD 3VH5A 5B32B 1HQ3C 4X23A 1BH8A 5B33D 1P3FA 5DNMA 3AZNB 4KHAB 4H9RB 3NQUA 5CPIB 3VH6A 3LELC 3RELD 3X1SD 3TU4C 3AZGC 3X1TB 1HQ3B 3A6NB 3REKD 3UTAA 3MGPC 3X1SA 3KUYB 3X1VA 3WTPB 3REIA 3REKA 1M19D 3KWQC 3TU4B 1M19A 5BO0A 5AV9D 4YM6C 3AZHB 4XZQD 5AV9A 4G92C 3REJD 1ID3C 3WAAB 1EQZB 5B31D 3REJA 2RVQC 4H9QA 4Z5TD 4YM6B 5B31A 1P34D 5B1LD 5GXQD 2CWEA 1P3LD 1F66A 1ID3B 1F1EA 1P3AB 5B1LA 3AZJD 1U35D 3VH6W 3LZ1A 1P3LA 5AV5B 1KX3D 1WWSA 4ZBJB 3AZJA 1U35A 3WKJD 1JFIB 5JA4B 1KX3A 2BYMA 1P3PB 4YS3B 3WA9B 3C1BB 4CAYA 1AOID 3AZFC 3AV2D 5B2IB 5CP6A 4KGCD 4DRBA 1AOIA 4X23C 3AV2A 1P3FC 5DNMC 2CV5A 3W96D 4KGCA 1KX4B 1KX5B 5B33C 3AZFB 2AROD 2YFVB 5B24B 4KUDB 2F8NB 4J8VD 4H9OB 3B0CT 3NQJA 2AROA 3MNNB 3RELC 3X1SC 5GT3D 3X1VC 5AVCB 4J8VA 3REKC 5B33B 1ZLAD 1B67A 3MGQD 5GT3A 3AZGD 1M19C 1ZLAA 3UTBD 4UUZB 5B31G 5B0ZB 3MGQA 4H9PB 4JJND 3RELB 4WZSB 3B6FD 3UTBA 5AV8A 5AV9C 4JJNA 3B6FA 5GSUA 5B40B 5G49B 4NFTA 3REJC 4J8XD 4E44A 4LD9D 1Q9CA 5DNND 5B31C 3W97A 1F66C 5AV9B 4XUJD 5JRGD 4LD9A 5DNNA 3AZIA 5B1LC 4XZQB 4CSRB 3V9RB 1P3LC 4XUJA 4H9QB 1TZYA 5CPKD 3AZJC 2YFWA 1U35C 1P3OD 1P3IB 3B6GD 3W99A 3AYWD 1KX3C 4Z5TB 5CPKA 1S32B 1P3OA 5BNVB 3MVDA 1P34B 3B6GA 5GXQB 3AYWA 3O62A 3AFAB 3UT9D 4AWLC 5CP6C 5AV6A 4HGAB 2NZDD 1AOIC 3REHB 3UT9A 5F99A 5B1MA 3AV2C 4WNNA 1M1AD 3WKJB 1ULYA 4KGCC 2NZDA 4Z66A 1M1AA 2NQBD 1M18D 5CHLB 3AZMB 2AROC 2NQBA 5DNMD 2PYOB 1M18A 4H9SA 2HIOB 5BS7A 4J8VC 2HUEB 1A7WA 3W96B 1H3OB 5FUGA 1P3KD 5GT3C 5E5AD 1ZLAC 3UTAD 3MGQC 1P3KA 5E5AA 3X1VD 4Z2MG 3UTBC 3X1UD 3REID 5AV8C 4JJNC 4WU9D 3B6FC 1P3BA 5KDMA 5BNXA 3X1UA 4WU9A 1HTAA 3LELB 3AZED 3AN2D 3AZGB 5C3IC 4J8XC 3AZKD 4R8PD 3AZEA 3AN2A 3MGPB 1P3MA 4LD9C 5DNNC 3AZIC 3AZKA 4R8PA 3KWQB 4XUJC 5JRGC 1TZYC 3W99C 4J8UA 3LZ0D 4J8XB 1F66D 5CPKC 1P3OC 5BT1D 3MVDC 3LZ0A 3B6GC 3KXBA 1TAFA 3AYWC 3LZ1D 4G92B 3O62C 5JRGB 4J8WD 2FJ7D 2YFWB 5AV6C 1N1JB 3UT9C 3C1CD 5F99C 5B1MC 4J8WA 5CPKB 2FJ7A 2NZDC 3C1CA 1M1AC 5AY8D 4QLCD 5CP6D 3MGRD 5CPJD 5AY8A 4QLCA 2NQBC 2CV5D 3VH5T 3MGRA 1M18C 4H9SC 5CPJA 5BS7C 3R45A 5B0YD 3AZLA 5B0YA 3VH6T 1P3KC 5E5AC 1M18B 5GT0A 4X23B 1BH8B 3UTAC 1P3FB 5DNMB 5B2JD 3X1UC 3REIC 3W98D 3NQUB 4WU9C 5AVBD 4ZUXD 3LJAA 1P3GA 1P3KB 5B2JA 5B32D 1WWIA 3W98A 5AVBA 4ZUXA 5AV8D 3UTAB 2BYKA 3AZEC 3AZND 3AN2C 5B32A 3X1SB 3X1VB 5GSUD 3REIB 3REKB 3AZKC 4R8PC 1B6WA 3AZNA 5CPID 4KHAA 4H9RA 1M19B 4J8UC 3X1TD 5BO0B 5CPIA 3W97D 3AZID 3LZ0C 3X1TA 1HQ3A 3KXBC 3WTPD 3A6NA 4EO5C 4NE3A 5BT1C 3KUYA 1TZYD 3W99D 3WTPA 3LZ1C 3REJB 4J8WC 2FJ7C 4NE6A 5B31B 3MVDD 3AZHD 1F66B 3O62D 3WAAD 3C1CC 5B1LB 3AZHA 4WU8D 1EQZD 3LZ1B 5AV6D 1P3LB 3WAAA 5AY8C 5F99D 5B1MD 4QLCC 4WU8A 4J8WB 3B0DC 3AZJB 1U35B 1EQZA 3MGRC 5CPJC 1KX3B 2BYMB 4Z66D 4YM6A 1P3AD 2CV5C 5AV5D 1ID3A 4CAYB 1P3AA 4AWLB 4H9NA 5B0YC 4QLCB 5CP6B 5AV5A 1AOIB 5B32G 3AV2B 1P3PD 4NE5A 4YS3D 2CV5B 4KGCB 1JFIA 5JA4A 1P3PA 3WA9D 4YS3A 1P3GC 5B2ID 5B2JC 3WA9A 3C1BA 3W98C 3NQJB 5AVBC 2AROB 4ZUXC 3WTPE 5B2IA 5B32C 2JSSA 1BH9A 4J8VB 1P3BD 1KX4D 1KX5D 3AZNC 5B24D 5GT3B 5GSUC 1KX4A 1KX5A 4KUDD 2F8ND 1ZLAB 5CPIC 3MGQB 5B24A 1P3MD 4KUDA 2F8NA
chains in the Genus database with same CATH superfamily
5AVCD 3UTBB 3A6NC 4H9OA 3X1TC 3W97C 5AV8B 3MNNA 4JJNB 3B6FB 3KUYC 5GSUB 3P5JB 5AVCA 3WTPC 4WV4B 4J8UD 5B33A 5B0ZD 2Y2GA 5C3IB 3KXBD 4UUZA 3W97B 5B0ZA 4H9PA 3RELA 4LD9B 5DNNB 3AZIB 3AZHC 5B40D 4E45A 4XUJB 3WAAC 1TZYB 5B40A 4WU8C 5G49A 1EQZC 3W99B 1P3OB 3B6GB 3MVDB 3AYWB 3A1KA 4Z66C 2JE5A 3O62B 1P3AC 4XZQA 4WU8B 4CSRA 5AV6B 3V9RA 1P3ID 3VH5W 5AV5C 3UT9B 4ZBJC 5F99B 5B1MB 1S32D 4WNNB 1P3IA 3A1IA 2NZDB 3AZLD 4Z66B 1Z2CB 4Z5TA 3AFAD 1S32A 4YS3C 5BNVA 1P3PC 1P34A 2Y2IA 4H9NB 5GXQA 3AFAA 3WA9C 5GT0D 3C1BC 3REHD 2F8NG 3B0CW 2NQBB 5B2IC 3REHA 2ZY3A 1W2EA 5FUGB 3WKJA 3AV1D 3LJAD 1P3GD 3MGSD 4Z2MH 1P3BC 1KX4C 1KX5C 3AZMD 3AV1A 3MGSA 5B24C 5E5AB 2PYOD 4KUDC 1BH9B 2HIOD 3AZMA 3MNNC 1P3MC 2F8NK 2PYOA 1P3BB 2HIOA 5KDMB 5BNXB 5AVCC 3X1UB 3W96A 4WU9B 1H3OA 3EPHA 1KU5A 3KSYA 1HQ3D 3A6ND 5B0ZC 3AZEB 3AN2B 1P3MB 2IO5C 3KUYD 4M6BA 3AZKB 4R8PB 3LELD 5B40C 3TU4D 4J8UB 2UWXA 3LELA 3MGPD 2IO5B 3TU4A 3AZGA 3LZ0B 3KXBB 1TAFB 4G91C 4EO5B 3KWQD 3MGPA 4XZQC 1BFMA 3B0BA 3KWQA 2Y2LA 4YM6D 4DRAA 2FJ7B 1P3IC 4G91B 4J8XA 1ID3D 3C1CB 4Z5TC 1S32C 1PZRA 1P34C 5GXQC 3AZLC 2RVQD 3AFAC 5JRGA 5AY8B 3B0DB 2L5AA 1N1JA 3MGRB 4HGAC 5GT0C 5CPJB 3REHC 2F8NH 3R45B 3WKJC 3AZLB 3C1BD 5B0YB 3AV1C 3LJAC 4WJ3C 3MGSC 5GT0B 3AZMC 3H0LC 2PYOC 2LY8A 2HIOC 2HUEC 3W96C 3AZFD 3AV1B 3LJAB 1P3GB 3MGSB 2ZY2A 5B2JB 3W98B 3AZFA 1R4VA 4X23D 5AVBB 4ZUXB 3MNND 2YFVA 2BYKB 4DQYB 1P3FD 3VH5A 5B32B 1HQ3C 4X23A 1BH8A 5B33D 1P3FA 5DNMA 3AZNB 4KHAB 4H9RB 3NQUA 5CPIB 3VH6A 3LELC 3RELD 3X1SD 3TU4C 3AZGC 3X1TB 1HQ3B 3A6NB 3REKD 3UTAA 2RIQA 3MGPC 3X1SA 3KUYB 3X1VA 2W8SA 3WTPB 3REIA 3REKA 1M19D 3KWQC 2ZM5A 3TU4B 1M19A 5BO0A 5AV9D 4YM6C 3AZHB 4XZQD 5AV9A 4G92C 3REJD 1ID3C 3WAAB 3KFUG 1EQZB 5B31D 3REJA 2RVQC 4H9QA 4Z5TD 4YM6B 5B31A 1P34D 5B1LD 5GXQD 4UPKA 2CWEA 1P3LD 1F66A 1ID3B 1F1EA 2XD1A 1P3AB 5B1LA 3AZJD 1U35D 3VH6W 3LZ1A 1P3LA 5AV5B 1KX3D 1WWSA 4ZBJB 3AZJA 1U35A 3WKJD 1JFIB 5JA4B 1KX3A 2BYMA 1P3PB 4YS3B 2DF4C 1T3UA 3AL0C 2Y2PA 2ZY4A 3WA9B 3C1BB 4CAYA 1AOID 3AZFC 3AV2D 5B2IB 5CP6A 4KGCD 4DRBA 1AOIA 4X23C 3AV2A 1P3FC 5DNMC 2CV5A 3W96D 4KGCA 1KX4B 1KX5B 5B33C 3AZFB 2AROD 2YFVB 5B24B 4KUDB 2F8NB 3H0RC 4J8VD 4H9OB 3B0CT 3NQJA 2AROA 3MNNB 3RELC 3X1SC 5GT3D 3X1VC 5AVCB 4J8VA 2J8PA 3REKC 5B33B 1ZLAD 1B67A 3MGQD 5GT3A 3AZGD 1M19C 2Y2NA 1ZLAA 3UTBD 4UUZB 5B31G 5B0ZB 3MGQA 4H9PB 4JJND 3RELB 4WZSB 3B6FD 3UTBA 5AV8A 5AV9C 4JJNA 3B6FA 5GSUA 5B40B 5G49B 4NFTA 3REJC 4J8XD 4E44A 4LD9D 1Q9CA 5DNND 5B31C 3W97A 1F66C 5AV9B 4XUJD 5JRGD 4LD9A 5DNNA 2JCHA 5B1LC 4XZQB 3AZIA 4CSRB 3V9RB 1P3LC 4XUJA 1M1AB 4H9QB 1TZYA 5CPKD 3AZJC 2YFWA 1U35C 1P3OD 1P3IB 3B6GD 3W99A 3AYWD 1KX3C 4Z5TB 5CPKA 1S32B 1P3OA 5BNVB 2BG1A 3MVDA 1P34B 5GXQB 3B6GA 3AYWA 3O62A 3AFAB 3UT9D 4AWLC 5CP6C 5AV6A 4HGAB 2NZDD 1AOIC 3REHB 3UT9A 5F99A 5B1MA 3AV2C 2Y2KA 4WNNA 1M1AD 1ULYA 3WKJB 4KGCC 3EPJA 2G5IC 2NZDA 4Z66A 2Y2HA 1M1AA 2NQBD 1M18D 5CHLB 2DQNC 3AZMB 2AROC 2NQBA 5DNMD 2PYOB 1M18A 3IP4C 4H9SA 2HIOB 5BS7A 4J8VC 3H0MC 2HUEB 1A7WA 3W96B 1H3OB 2FFFB 5FUGA 1P3KD 5GT3C 5E5AD 1ZLAC 3UTAD 3MGQC 2VQRA 1P3KA 5E5AA 2F2AC 3X1VD 4Z2MG 3UTBC 3X1UD 3REID 5AV8C 4JJNC 4WU9D 2XD5A 3B6FC 1P3BA 5KDMA 5BNXA 3X1UA 2ZY5A 4WU9A 1HTAA 3LELB 3AZED 3AN2D 3AZGB 5C3IC 4J8XC 3AZKD 4R8PD 3AZEA 3AN2A 3MGPB 1P3MA 4LD9C 5DNNC 3AZIC 3AZKA 4R8PA 3KWQB 4XUJC 5JRGC 1TZYC 3W99C 4J8UA 3LZ0D 4J8XB 1F66D 5CPKC 1P3OC 5BT1D 3MVDC 3LZ0A 3B6GC 3KXBA 1TAFA 3AYWC 3LZ1D 4G92B 3O62C 5JRGB 4J8WD 2FJ7D 2YFWB 5AV6C 1N1JB 3UT9C 3C1CD 5F99C 5B1MC 4J8WA 5CPKB 2FJ7A 2NZDC 3C1CA 1M1AC 5AY8D 4QLCD 2Y2MA 5CP6D 3MGRD 5CPJD 5AY8A 4QLCA 2NQBC 2CV5D 3VH5T 3MGRA 1M18C 4H9SC 5CPJA 5BS7C 3R45A 5B0YD 3AZLA 5B0YA 3F6TA 3VH6T 1P3KC 5E5AC 1M18B 5GT0A 4X23B 1BH8B 3UTAC 1P3FB 5DNMB 5B2JD 3X1UC 3REIC 3W98D 3NQUB 4WU9C 5AVBD 4ZUXD 3LJAA 3EPKA 1P3KB 1P3GA 5B2JA 5B32D 1WWIA 3W98A 5AVBA 4ZUXA 5AV8D 3UTAB 2BYKA 3AZEC 3AZND 3AN2C 5B32A 3X1SB 3X1VB 5GSUD 3REIB 3REKB 3AZKC 4R8PC 1B6WA 3AZNA 5CPID 4KHAA 2Y2OA 4H9RA 1M19B 4J8UC 3X1TD 5BO0B 5CPIA 3W97D 3AZID 3LZ0C 3X1TA 1HQ3A 3KXBC 3WTPD 3A6NA 4EO5C 4NE3A 5BT1C 3KUYA 1TZYD 3W99D 3WTPA 3LZ1C 3REJB 2G5HC 4J8WC 2FJ7C 4NE6A 5B31B 3MVDD 3AZHD 1F66B 3O62D 3WAAD 3C1CC 5B1LB 3AZHA 4WU8D 1EQZD 3LZ1B 5AV6D 1P3LB 3WAAA 2Y2JA 5AY8C 4QLCC 5B1MD 5F99D 4WU8A 4J8WB 3B0DC 3AZJB 1U35B 1EQZA 3MGRC 5CPJC 3EG5B 1KX3B 2BYMB 4Z66D 4YM6A 1P3AD 2CV5C 2Y2QA 5AV5D 1ID3A 4CAYB 1P3AA 3EPLA 4AWLB 4H9NA 5B0YC 4QLCB 5CP6B 5AV5A 1AOIB 5B32G 3AV2B 1P3PD 4NE5A 4YS3D 2CV5B 4KGCB 1JFIA 5JA4A 1P3PA 3WA9D 4YS3A 1P3GC 5B2ID 5B2JC 3WA9A 3C1BA 3W98C 3NQJB 5AVBC 2AROB 4ZUXC 3WTPE 5B2IA 5B32C 2JSSA 1BH9A 3FDDA 4J8VB 1P3BD 1KX4D 1KX5D 3AZNC 5GT3B 5B24D 5GSUC 1KX4A 1KX5A 4KUDD 2F8ND 1ZLAB 5CPIC 3MGQB 5B24A 1P3MD 4KUDA 2F8NA
chains in the Genus database with same CATH topology
5AVCD 3UTBB 3A6NC 4H9OA 3X1TC 3W97C 5AV8B 3MNNA 4JJNB 3B6FB 3KUYC 5GSUB 3P5JB 5AVCA 3WTPC 4WV4B 4J8UD 5B33A 5B0ZD 2Y2GA 5C3IB 3KXBD 4UUZA 3W97B 5B0ZA 4H9PA 3RELA 4LD9B 5DNNB 3AZIB 3AZHC 5B40D 4E45A 4XUJB 3WAAC 1TZYB 5B40A 4WU8C 5G49A 1EQZC 3W99B 1P3OB 3B6GB 3MVDB 3AYWB 3A1KA 4Z66C 2JE5A 3O62B 1P3AC 4XZQA 4WU8B 4CSRA 5AV6B 3V9RA 1P3ID 3VH5W 5AV5C 3UT9B 4ZBJC 5F99B 5B1MB 1S32D 4WNNB 1P3IA 3A1IA 2NZDB 3AZLD 4Z66B 1Z2CB 4Z5TA 3AFAD 1S32A 4YS3C 5BNVA 1P3PC 1P34A 2Y2IA 4H9NB 5GXQA 3AFAA 3WA9C 5GT0D 3C1BC 3REHD 2F8NG 3B0CW 2NQBB 5B2IC 3REHA 2ZY3A 1W2EA 5FUGB 3WKJA 3AV1D 3LJAD 1P3GD 3MGSD 4Z2MH 1P3BC 1KX4C 1KX5C 3AZMD 3AV1A 3MGSA 5B24C 5E5AB 2PYOD 4KUDC 1BH9B 2HIOD 3AZMA 3MNNC 1P3MC 2F8NK 2PYOA 1P3BB 2HIOA 5KDMB 5BNXB 5AVCC 3X1UB 3W96A 4WU9B 1H3OA 3EPHA 1KU5A 3KSYA 1HQ3D 3A6ND 5B0ZC 3AZEB 3AN2B 1P3MB 2IO5C 3KUYD 4M6BA 3AZKB 4R8PB 3LELD 5B40C 3TU4D 4J8UB 2UWXA 3LELA 3MGPD 2IO5B 3TU4A 3AZGA 3LZ0B 3KXBB 1TAFB 4G91C 4EO5B 3KWQD 3MGPA 4XZQC 1BFMA 3B0BA 3KWQA 2Y2LA 4YM6D 4DRAA 2FJ7B 1P3IC 4G91B 4J8XA 1ID3D 3C1CB 4Z5TC 1S32C 1PZRA 1P34C 5GXQC 3AZLC 2RVQD 3AFAC 5JRGA 5AY8B 3B0DB 2L5AA 1N1JA 3MGRB 4HGAC 5GT0C 5CPJB 3REHC 2F8NH 3R45B 3WKJC 3AZLB 3C1BD 5B0YB 3AV1C 3LJAC 4WJ3C 3MGSC 5GT0B 3AZMC 3H0LC 2PYOC 2LY8A 2HIOC 2HUEC 3W96C 3AZFD 3AV1B 3LJAB 1P3GB 3MGSB 2ZY2A 5B2JB 3W98B 3AZFA 1R4VA 4X23D 5AVBB 4ZUXB 3MNND 2YFVA 2BYKB 4DQYB 1P3FD 3VH5A 5B32B 1HQ3C 4X23A 1BH8A 5B33D 1P3FA 5DNMA 3AZNB 4KHAB 4H9RB 3NQUA 5CPIB 3VH6A 3LELC 3RELD 3X1SD 3TU4C 3AZGC 3X1TB 1HQ3B 3A6NB 3REKD 3UTAA 2RIQA 3MGPC 3X1SA 3KUYB 3X1VA 2W8SA 3WTPB 3REIA 3REKA 1M19D 3KWQC 2ZM5A 3TU4B 1M19A 5BO0A 5AV9D 4YM6C 3AZHB 4XZQD 5AV9A 4G92C 3REJD 1ID3C 3WAAB 3KFUG 1EQZB 5B31D 3REJA 2RVQC 4H9QA 4Z5TD 4YM6B 5B31A 1P34D 5B1LD 5GXQD 4UPKA 2CWEA 1P3LD 1F66A 1ID3B 1F1EA 2XD1A 1P3AB 5B1LA 3AZJD 1U35D 3VH6W 3LZ1A 1P3LA 5AV5B 1KX3D 1WWSA 4ZBJB 3AZJA 1U35A 3WKJD 1JFIB 5JA4B 1KX3A 2BYMA 1P3PB 4YS3B 2DF4C 1T3UA 3AL0C 2Y2PA 2ZY4A 3WA9B 3C1BB 4CAYA 1AOID 3AZFC 3AV2D 5B2IB 5CP6A 4KGCD 4DRBA 1AOIA 4X23C 3AV2A 1P3FC 5DNMC 2CV5A 3W96D 4KGCA 1KX4B 1KX5B 5B33C 3AZFB 2AROD 2YFVB 5B24B 4KUDB 2F8NB 3H0RC 4J8VD 4H9OB 3B0CT 3NQJA 2AROA 3MNNB 3RELC 3X1SC 5GT3D 3X1VC 5AVCB 4J8VA 2J8PA 3REKC 5B33B 1ZLAD 1B67A 3MGQD 5GT3A 3AZGD 1M19C 2Y2NA 1ZLAA 3UTBD 4UUZB 5B31G 5B0ZB 3MGQA 4H9PB 4JJND 3RELB 4WZSB 3B6FD 3UTBA 5AV8A 5AV9C 4JJNA 3B6FA 5GSUA 5B40B 5G49B 4NFTA 3REJC 4J8XD 4E44A 4LD9D 1Q9CA 5DNND 5B31C 3W97A 1F66C 5AV9B 4XUJD 5JRGD 4LD9A 5DNNA 2JCHA 5B1LC 4XZQB 3AZIA 4CSRB 3V9RB 1P3LC 4XUJA 1M1AB 4H9QB 1TZYA 5CPKD 3AZJC 2YFWA 1U35C 1P3OD 1P3IB 3B6GD 3W99A 3AYWD 1KX3C 4Z5TB 5CPKA 1S32B 1P3OA 5BNVB 2BG1A 3MVDA 1P34B 5GXQB 3B6GA 3AYWA 3O62A 3AFAB 3UT9D 4AWLC 5CP6C 5AV6A 4HGAB 2NZDD 1AOIC 3REHB 3UT9A 5F99A 5B1MA 3AV2C 2Y2KA 4WNNA 1M1AD 1ULYA 3WKJB 4KGCC 3EPJA 2G5IC 2NZDA 4Z66A 2Y2HA 1M1AA 2NQBD 1M18D 5CHLB 2DQNC 3AZMB 2AROC 2NQBA 5DNMD 2PYOB 1M18A 3IP4C 4H9SA 2HIOB 5BS7A 4J8VC 3H0MC 2HUEB 1A7WA 3W96B 1H3OB 2FFFB 5FUGA 1P3KD 5GT3C 5E5AD 1ZLAC 3UTAD 3MGQC 2VQRA 1P3KA 5E5AA 2F2AC 3X1VD 4Z2MG 3UTBC 3X1UD 3REID 5AV8C 4JJNC 4WU9D 2XD5A 3B6FC 1P3BA 5KDMA 5BNXA 3X1UA 2ZY5A 4WU9A 1HTAA 3LELB 3AZED 3AN2D 3AZGB 5C3IC 4J8XC 3AZKD 4R8PD 3AZEA 3AN2A 3MGPB 1P3MA 4LD9C 5DNNC 3AZIC 3AZKA 4R8PA 3KWQB 4XUJC 5JRGC 1TZYC 3W99C 4J8UA 3LZ0D 4J8XB 1F66D 5CPKC 1P3OC 5BT1D 3MVDC 3LZ0A 3B6GC 3KXBA 1TAFA 3AYWC 3LZ1D 4G92B 3O62C 5JRGB 4J8WD 2FJ7D 2YFWB 5AV6C 1N1JB 3UT9C 3C1CD 5F99C 5B1MC 4J8WA 5CPKB 2FJ7A 2NZDC 3C1CA 1M1AC 5AY8D 4QLCD 2Y2MA 5CP6D 3MGRD 5CPJD 5AY8A 4QLCA 2NQBC 2CV5D 3VH5T 3MGRA 1M18C 4H9SC 5CPJA 5BS7C 3R45A 5B0YD 3AZLA 5B0YA 3F6TA 3VH6T 1P3KC 5E5AC 1M18B 5GT0A 4X23B 1BH8B 3UTAC 1P3FB 5DNMB 5B2JD 3X1UC 3REIC 3W98D 3NQUB 4WU9C 5AVBD 4ZUXD 3LJAA 3EPKA 1P3KB 1P3GA 5B2JA 5B32D 1WWIA 3W98A 5AVBA 4ZUXA 5AV8D 3UTAB 2BYKA 3AZEC 3AZND 3AN2C 5B32A 3X1SB 3X1VB 5GSUD 3REIB 3REKB 3AZKC 4R8PC 1B6WA 3AZNA 5CPID 4KHAA 2Y2OA 4H9RA 1M19B 4J8UC 3X1TD 5BO0B 5CPIA 3W97D 3AZID 3LZ0C 3X1TA 1HQ3A 3KXBC 3WTPD 3A6NA 4EO5C 4NE3A 5BT1C 3KUYA 1TZYD 3W99D 3WTPA 3LZ1C 3REJB 2G5HC 4J8WC 2FJ7C 4NE6A 5B31B 3MVDD 3AZHD 1F66B 3O62D 3WAAD 3C1CC 5B1LB 3AZHA 4WU8D 1EQZD 3LZ1B 5AV6D 1P3LB 3WAAA 2Y2JA 5AY8C 4QLCC 5B1MD 5F99D 4WU8A 4J8WB 3B0DC 3AZJB 1U35B 1EQZA 3MGRC 5CPJC 3EG5B 1KX3B 2BYMB 4Z66D 4YM6A 1P3AD 2CV5C 2Y2QA 5AV5D 1ID3A 4CAYB 1P3AA 3EPLA 4AWLB 4H9NA 5B0YC 4QLCB 5CP6B 5AV5A 1AOIB 5B32G 3AV2B 1P3PD 4NE5A 4YS3D 2CV5B 4KGCB 1JFIA 5JA4A 1P3PA 3WA9D 4YS3A 1P3GC 5B2ID 5B2JC 3WA9A 3C1BA 3W98C 3NQJB 5AVBC 2AROB 4ZUXC 3WTPE 5B2IA 5B32C 2JSSA 1BH9A 3FDDA 4J8VB 1P3BD 1KX4D 1KX5D 3AZNC 5GT3B 5B24D 5GSUC 1KX4A 1KX5A 4KUDD 2F8ND 1ZLAB 5CPIC 3MGQB 5B24A 1P3MD 4KUDA 2F8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVC D;  3UTB B;  3A6N C;  4H9O A;  3X1T C;  3W97 C;  5AV8 B;  3MNN A;  4JJN B;  3B6F B;  3KUY C;  5GSU B;  5AVC A;  3WTP C;  4WV4 B;  4J8U D;  5B33 A;  5B0Z D;  5C3I B;  3KXB D;  4UUZ A;  3W97 B;  5B0Z A;  4H9P A;  3REL A;  4LD9 B;  5DNN B;  3AZI B;  3AZH C;  5B40 D;  4E45 A;  4XUJ B;  3WAA C;  1TZY B;  5B40 A;  4WU8 C;  5G49 A;  1EQZ C;  3W99 B;  1P3O B;  3B6G B;  3MVD B;  3AYW B;  4Z66 C;  3O62 B;  1P3A C;  4XZQ A;  4WU8 B;  4CSR A;  5AV6 B;  3V9R A;  1P3I D;  3VH5 W;  5AV5 C;  3UT9 B;  4ZBJ C;  5F99 B;  5B1M B;  1S32 D;  4WNN B;  1P3I A;  2NZD B;  3AZL D;  4Z66 B;  4Z5T A;  3AFA D;  1S32 A;  1P3P C;  4YS3 C;  5BNV A;  1M1A B;  1P34 A;  4H9N B;  5GXQ A;  3AFA A;  3WA9 C;  5GT0 D;  3C1B C;  3REH D;  2F8N G;  3B0C W;  2NQB B;  5B2I C;  3REH A;  5FUG B;  3WKJ A;  3AV1 D;  3LJA D;  1P3G D;  3MGS D;  4Z2M H;  1P3B C;  1KX4 C;  1KX5 C;  3AZM D;  3AV1 A;  3MGS A;  5B24 C;  5E5A B;  2PYO D;  4KUD C;  1BH9 B;  2HIO D;  3AZM A;  3MNN C;  1P3M C;  2F8N K;  2PYO A;  1P3B B;  2HIO A;  5KDM B;  5BNX B;  5AVC C;  3X1U B;  3W96 A;  4WU9 B;  1H3O A;  1KU5 A;  3KSY A;  1HQ3 D;  3A6N D;  5B0Z C;  3AZE B;  3AN2 B;  1P3M B;  2IO5 C;  3KUY D;  4M6B A;  3AZK B;  4R8P B;  3LEL D;  5B40 C;  3TU4 D;  4J8U B;  3LEL A;  3MGP D;  2IO5 B;  3TU4 A;  3AZG A;  3LZ0 B;  3KXB B;  1TAF B;  4G91 C;  4EO5 B;  3KWQ D;  3MGP A;  4XZQ C;  1BFM A;  3B0B A;  3KWQ A;  4YM6 D;  4DRA A;  2FJ7 B;  1P3I C;  4G91 B;  4J8X A;  1ID3 D;  3C1C B;  4Z5T C;  1S32 C;  1P34 C;  5GXQ C;  3AZL C;  2RVQ D;  3AFA C;  5JRG A;  5AY8 B;  3B0D B;  2L5A A;  1N1J A;  3MGR B;  4HGA C;  5GT0 C;  5CPJ B;  3REH C;  2F8N H;  3R45 B;  3WKJ C;  3AZL B;  3C1B D;  5B0Y B;  3AV1 C;  3LJA C;  3MGS C;  5GT0 B;  3AZM C;  2PYO C;  2LY8 A;  2HIO C;  2HUE C;  3W96 C;  3AZF D;  3AV1 B;  3LJA B;  1P3G B;  3MGS B;  5B2J B;  3W98 B;  3AZF A;  1R4V A;  4X23 D;  5AVB B;  4ZUX B;  3MNN D;  2YFV A;  2BYK B;  1P3F D;  3VH5 A;  5B32 B;  1HQ3 C;  4X23 A;  1BH8 A;  5B33 D;  1P3F A;  5DNM A;  3AZN B;  4KHA B;  4H9R B;  3NQU A;  5CPI B;  3VH6 A;  3LEL C;  3REL D;  3X1S D;  3TU4 C;  3AZG C;  3X1T B;  1HQ3 B;  3A6N B;  3REK D;  3UTA A;  3MGP C;  3X1S A;  3KUY B;  3X1V A;  3WTP B;  3REI A;  3REK A;  1M19 D;  3KWQ C;  3TU4 B;  1M19 A;  5BO0 A;  5AV9 D;  4YM6 C;  3AZH B;  4XZQ D;  5AV9 A;  4G92 C;  3REJ D;  1ID3 C;  3WAA B;  1EQZ B;  5B31 D;  3REJ A;  2RVQ C;  4H9Q A;  4Z5T D;  4YM6 B;  5B31 A;  1P34 D;  5B1L D;  5GXQ D;  2CWE A;  1P3L D;  1F66 A;  1ID3 B;  1F1E A;  1P3A B;  5B1L A;  3AZJ D;  1U35 D;  3VH6 W;  3LZ1 A;  1P3L A;  5AV5 B;  1KX3 D;  1WWS A;  4ZBJ B;  3AZJ A;  1U35 A;  3WKJ D;  1JFI B;  5JA4 B;  1KX3 A;  2BYM A;  1P3P B;  4YS3 B;  3WA9 B;  3C1B B;  4CAY A;  1AOI D;  3AZF C;  3AV2 D;  5B2I B;  5CP6 A;  4KGC D;  4DRB A;  1AOI A;  4X23 C;  3AV2 A;  1P3F C;  5DNM C;  2CV5 A;  3W96 D;  4KGC A;  1KX4 B;  1KX5 B;  5B33 C;  3AZF B;  2ARO D;  2YFV B;  5B24 B;  4KUD B;  2F8N B;  4J8V D;  4H9O B;  3B0C T;  3NQJ A;  2ARO A;  3MNN B;  3REL C;  3X1S C;  5GT3 D;  3X1V C;  5AVC B;  4J8V A;  3REK C;  5B33 B;  1ZLA D;  1B67 A;  3MGQ D;  5GT3 A;  3AZG D;  1M19 C;  1ZLA A;  3UTB D;  4UUZ B;  5B31 G;  5B0Z B;  3MGQ A;  4H9P B;  4JJN D;  3REL B;  4WZS B;  3B6F D;  3UTB A;  5AV8 A;  5AV9 C;  4JJN A;  3B6F A;  5GSU A;  5B40 B;  5G49 B;  4NFT A;  3REJ C;  4J8X D;  4E44 A;  4LD9 D;  1Q9C A;  5DNN D;  5B31 C;  3W97 A;  1F66 C;  5AV9 B;  4XUJ D;  5JRG D;  4LD9 A;  5DNN A;  3AZI A;  5B1L C;  4XZQ B;  4CSR B;  3V9R B;  1P3L C;  4XUJ A;  4H9Q B;  1TZY A;  5CPK D;  3AZJ C;  2YFW A;  1U35 C;  1P3O D;  1P3I B;  3B6G D;  3W99 A;  3AYW D;  1KX3 C;  4Z5T B;  5CPK A;  1S32 B;  1P3O A;  5BNV B;  3MVD A;  1P34 B;  3B6G A;  5GXQ B;  3AYW A;  3O62 A;  3AFA B;  3UT9 D;  4AWL C;  5CP6 C;  5AV6 A;  4HGA B;  2NZD D;  1AOI C;  3REH B;  3UT9 A;  5F99 A;  5B1M A;  3AV2 C;  4WNN A;  1M1A D;  3WKJ B;  1ULY A;  4KGC C;  2NZD A;  4Z66 A;  1M1A A;  2NQB D;  1M18 D;  5CHL B;  3AZM B;  2ARO C;  2NQB A;  5DNM D;  2PYO B;  1M18 A;  4H9S A;  2HIO B;  5BS7 A;  4J8V C;  2HUE B;  1A7W A;  3W96 B;  1H3O B;  5FUG A;  1P3K D;  5GT3 C;  5E5A D;  1ZLA C;  3UTA D;  3MGQ C;  1P3K A;  5E5A A;  3X1V D;  4Z2M G;  3UTB C;  3X1U D;  3REI D;  5AV8 C;  4JJN C;  4WU9 D;  3B6F C;  1P3B A;  5KDM A;  5BNX A;  3X1U A;  4WU9 A;  1HTA A;  3LEL B;  3AZE D;  3AN2 D;  3AZG B;  5C3I C;  4J8X C;  3AZK D;  4R8P D;  3AZE A;  3AN2 A;  3MGP B;  1P3M A;  4LD9 C;  5DNN C;  3AZI C;  3AZK A;  4R8P A;  3KWQ B;  4XUJ C;  5JRG C;  1TZY C;  3W99 C;  4J8U A;  3LZ0 D;  4J8X B;  1F66 D;  5CPK C;  1P3O C;  5BT1 D;  3MVD C;  3LZ0 A;  3B6G C;  3KXB A;  1TAF A;  3AYW C;  3LZ1 D;  4G92 B;  3O62 C;  5JRG B;  4J8W D;  2FJ7 D;  2YFW B;  5AV6 C;  1N1J B;  3UT9 C;  3C1C D;  5F99 C;  5B1M C;  4J8W A;  5CPK B;  2FJ7 A;  2NZD C;  3C1C A;  1M1A C;  5AY8 D;  4QLC D;  5CP6 D;  3MGR D;  5CPJ D;  5AY8 A;  4QLC A;  2NQB C;  2CV5 D;  3VH5 T;  3MGR A;  1M18 C;  4H9S C;  5CPJ A;  5BS7 C;  3R45 A;  5B0Y D;  3AZL A;  5B0Y A;  3VH6 T;  1P3K C;  5E5A C;  1M18 B;  5GT0 A;  4X23 B;  1BH8 B;  3UTA C;  1P3F B;  5DNM B;  5B2J D;  3X1U C;  3REI C;  3W98 D;  3NQU B;  4WU9 C;  5AVB D;  4ZUX D;  3LJA A;  1P3G A;  1P3K B;  5B2J A;  5B32 D;  1WWI A;  3W98 A;  5AVB A;  4ZUX A;  5AV8 D;  3UTA B;  2BYK A;  3AZE C;  3AZN D;  3AN2 C;  5B32 A;  3X1S B;  3X1V B;  5GSU D;  3REI B;  3REK B;  3AZK C;  4R8P C;  1B6W A;  3AZN A;  5CPI D;  4KHA A;  4H9R A;  1M19 B;  4J8U C;  3X1T D;  5BO0 B;  5CPI A;  3W97 D;  3AZI D;  3LZ0 C;  3X1T A;  1HQ3 A;  3KXB C;  3WTP D;  3A6N A;  4EO5 C;  4NE3 A;  5BT1 C;  3KUY A;  1TZY D;  3W99 D;  3WTP A;  3LZ1 C;  3REJ B;  4J8W C;  2FJ7 C;  4NE6 A;  5B31 B;  3MVD D;  3AZH D;  1F66 B;  3O62 D;  3WAA D;  3C1C C;  5B1L B;  3AZH A;  4WU8 D;  1EQZ D;  3LZ1 B;  5AV6 D;  1P3L B;  3WAA A;  5AY8 C;  5F99 D;  5B1M D;  4QLC C;  4WU8 A;  4J8W B;  3B0D C;  3AZJ B;  1U35 B;  1EQZ A;  3MGR C;  5CPJ C;  1KX3 B;  2BYM B;  4Z66 D;  4YM6 A;  1P3A D;  2CV5 C;  5AV5 D;  1ID3 A;  4CAY B;  1P3A A;  4AWL B;  4H9N A;  5B0Y C;  4QLC B;  5CP6 B;  5AV5 A;  1AOI B;  5B32 G;  3AV2 B;  1P3P D;  4NE5 A;  4YS3 D;  2CV5 B;  4KGC B;  1JFI A;  5JA4 A;  1P3P A;  3WA9 D;  4YS3 A;  1P3G C;  5B2I D;  5B2J C;  3WA9 A;  3C1B A;  3W98 C;  3NQJ B;  5AVB C;  2ARO B;  4ZUX C;  3WTP E;  5B2I A;  5B32 C;  2JSS A;  1BH9 A;  4J8V B;  1P3B D;  1KX4 D;  1KX5 D;  3AZN C;  5B24 D;  5GT3 B;  5GSU C;  1KX4 A;  1KX5 A;  4KUD D;  2F8N D;  1ZLA B;  5CPI C;  3MGQ B;  5B24 A;  1P3M D;  4KUD A;  2F8N A; 
#chains in the Genus database with same CATH topology
 5AVC D;  3UTB B;  3A6N C;  4H9O A;  3X1T C;  3W97 C;  5AV8 B;  3MNN A;  4JJN B;  3B6F B;  3KUY C;  5GSU B;  3P5J B;  5AVC A;  3WTP C;  4WV4 B;  4J8U D;  5B33 A;  5B0Z D;  2Y2G A;  5C3I B;  3KXB D;  4UUZ A;  3W97 B;  5B0Z A;  4H9P A;  3REL A;  4LD9 B;  5DNN B;  3AZI B;  3AZH C;  5B40 D;  4E45 A;  4XUJ B;  3WAA C;  1TZY B;  5B40 A;  4WU8 C;  5G49 A;  1EQZ C;  3W99 B;  1P3O B;  3B6G B;  3MVD B;  3AYW B;  3A1K A;  4Z66 C;  2JE5 A;  3O62 B;  1P3A C;  4XZQ A;  4WU8 B;  4CSR A;  5AV6 B;  3V9R A;  1P3I D;  3VH5 W;  5AV5 C;  3UT9 B;  4ZBJ C;  5F99 B;  5B1M B;  1S32 D;  4WNN B;  1P3I A;  3A1I A;  2NZD B;  3AZL D;  4Z66 B;  1Z2C B;  4Z5T A;  3AFA D;  1S32 A;  4YS3 C;  5BNV A;  1P3P C;  1P34 A;  2Y2I A;  4H9N B;  5GXQ A;  3AFA A;  3WA9 C;  5GT0 D;  3C1B C;  3REH D;  2F8N G;  3B0C W;  2NQB B;  5B2I C;  3REH A;  2ZY3 A;  1W2E A;  5FUG B;  3WKJ A;  3AV1 D;  3LJA D;  1P3G D;  3MGS D;  4Z2M H;  1P3B C;  1KX4 C;  1KX5 C;  3AZM D;  3AV1 A;  3MGS A;  5B24 C;  5E5A B;  2PYO D;  4KUD C;  1BH9 B;  2HIO D;  3AZM A;  3MNN C;  1P3M C;  2F8N K;  2PYO A;  1P3B B;  2HIO A;  5KDM B;  5BNX B;  5AVC C;  3X1U B;  3W96 A;  4WU9 B;  1H3O A;  3EPH A;  1KU5 A;  3KSY A;  1HQ3 D;  3A6N D;  5B0Z C;  3AZE B;  3AN2 B;  1P3M B;  2IO5 C;  3KUY D;  4M6B A;  3AZK B;  4R8P B;  3LEL D;  5B40 C;  3TU4 D;  4J8U B;  2UWX A;  3LEL A;  3MGP D;  2IO5 B;  3TU4 A;  3AZG A;  3LZ0 B;  3KXB B;  1TAF B;  4G91 C;  4EO5 B;  3KWQ D;  3MGP A;  4XZQ C;  1BFM A;  3B0B A;  3KWQ A;  2Y2L A;  4YM6 D;  4DRA A;  2FJ7 B;  1P3I C;  4G91 B;  4J8X A;  1ID3 D;  3C1C B;  4Z5T C;  1S32 C;  1PZR A;  1P34 C;  5GXQ C;  3AZL C;  2RVQ D;  3AFA C;  5JRG A;  5AY8 B;  3B0D B;  2L5A A;  1N1J A;  3MGR B;  4HGA C;  5GT0 C;  5CPJ B;  3REH C;  2F8N H;  3R45 B;  3WKJ C;  3AZL B;  3C1B D;  5B0Y B;  3AV1 C;  3LJA C;  4WJ3 C;  3MGS C;  5GT0 B;  3AZM C;  3H0L C;  2PYO C;  2LY8 A;  2HIO C;  2HUE C;  3W96 C;  3AZF D;  3AV1 B;  3LJA B;  1P3G B;  3MGS B;  2ZY2 A;  5B2J B;  3W98 B;  3AZF A;  1R4V A;  4X23 D;  5AVB B;  4ZUX B;  3MNN D;  2YFV A;  2BYK B;  4DQY B;  1P3F D;  3VH5 A;  5B32 B;  1HQ3 C;  4X23 A;  1BH8 A;  5B33 D;  1P3F A;  5DNM A;  3AZN B;  4KHA B;  4H9R B;  3NQU A;  5CPI B;  3VH6 A;  3LEL C;  3REL D;  3X1S D;  3TU4 C;  3AZG C;  3X1T B;  1HQ3 B;  3A6N B;  3REK D;  3UTA A;  2RIQ A;  3MGP C;  3X1S A;  3KUY B;  3X1V A;  2W8S A;  3WTP B;  3REI A;  3REK A;  1M19 D;  3KWQ C;  2ZM5 A;  3TU4 B;  1M19 A;  5BO0 A;  5AV9 D;  4YM6 C;  3AZH B;  4XZQ D;  5AV9 A;  4G92 C;  3REJ D;  1ID3 C;  3WAA B;  3KFU G;  1EQZ B;  5B31 D;  3REJ A;  2RVQ C;  4H9Q A;  4Z5T D;  4YM6 B;  5B31 A;  1P34 D;  5B1L D;  5GXQ D;  4UPK A;  2CWE A;  1P3L D;  1F66 A;  1ID3 B;  1F1E A;  2XD1 A;  1P3A B;  5B1L A;  3AZJ D;  1U35 D;  3VH6 W;  3LZ1 A;  1P3L A;  5AV5 B;  1KX3 D;  1WWS A;  4ZBJ B;  3AZJ A;  1U35 A;  3WKJ D;  1JFI B;  5JA4 B;  1KX3 A;  2BYM A;  1P3P B;  4YS3 B;  2DF4 C;  1T3U A;  3AL0 C;  2Y2P A;  2ZY4 A;  3WA9 B;  3C1B B;  4CAY A;  1AOI D;  3AZF C;  3AV2 D;  5B2I B;  5CP6 A;  4KGC D;  4DRB A;  1AOI A;  4X23 C;  3AV2 A;  1P3F C;  5DNM C;  2CV5 A;  3W96 D;  4KGC A;  1KX4 B;  1KX5 B;  5B33 C;  3AZF B;  2ARO D;  2YFV B;  5B24 B;  4KUD B;  2F8N B;  3H0R C;  4J8V D;  4H9O B;  3B0C T;  3NQJ A;  2ARO A;  3MNN B;  3REL C;  3X1S C;  5GT3 D;  3X1V C;  5AVC B;  4J8V A;  2J8P A;  3REK C;  5B33 B;  1ZLA D;  1B67 A;  3MGQ D;  5GT3 A;  3AZG D;  1M19 C;  2Y2N A;  1ZLA A;  3UTB D;  4UUZ B;  5B31 G;  5B0Z B;  3MGQ A;  4H9P B;  4JJN D;  3REL B;  4WZS B;  3B6F D;  3UTB A;  5AV8 A;  5AV9 C;  4JJN A;  3B6F A;  5GSU A;  5B40 B;  5G49 B;  4NFT A;  3REJ C;  4J8X D;  4E44 A;  4LD9 D;  1Q9C A;  5DNN D;  5B31 C;  3W97 A;  1F66 C;  5AV9 B;  4XUJ D;  5JRG D;  4LD9 A;  5DNN A;  2JCH A;  5B1L C;  4XZQ B;  3AZI A;  4CSR B;  3V9R B;  1P3L C;  4XUJ A;  1M1A B;  4H9Q B;  1TZY A;  5CPK D;  3AZJ C;  2YFW A;  1U35 C;  1P3O D;  1P3I B;  3B6G D;  3W99 A;  3AYW D;  1KX3 C;  4Z5T B;  5CPK A;  1S32 B;  1P3O A;  5BNV B;  2BG1 A;  3MVD A;  1P34 B;  5GXQ B;  3B6G A;  3AYW A;  3O62 A;  3AFA B;  3UT9 D;  4AWL C;  5CP6 C;  5AV6 A;  4HGA B;  2NZD D;  1AOI C;  3REH B;  3UT9 A;  5F99 A;  5B1M A;  3AV2 C;  2Y2K A;  4WNN A;  1M1A D;  1ULY A;  3WKJ B;  4KGC C;  3EPJ A;  2G5I C;  2NZD A;  4Z66 A;  2Y2H A;  1M1A A;  2NQB D;  1M18 D;  5CHL B;  2DQN C;  3AZM B;  2ARO C;  2NQB A;  5DNM D;  2PYO B;  1M18 A;  3IP4 C;  4H9S A;  2HIO B;  5BS7 A;  4J8V C;  3H0M C;  2HUE B;  1A7W A;  3W96 B;  1H3O B;  2FFF B;  5FUG A;  1P3K D;  5GT3 C;  5E5A D;  1ZLA C;  3UTA D;  3MGQ C;  2VQR A;  1P3K A;  5E5A A;  2F2A C;  3X1V D;  4Z2M G;  3UTB C;  3X1U D;  3REI D;  5AV8 C;  4JJN C;  4WU9 D;  2XD5 A;  3B6F C;  1P3B A;  5KDM A;  5BNX A;  3X1U A;  2ZY5 A;  4WU9 A;  1HTA A;  3LEL B;  3AZE D;  3AN2 D;  3AZG B;  5C3I C;  4J8X C;  3AZK D;  4R8P D;  3AZE A;  3AN2 A;  3MGP B;  1P3M A;  4LD9 C;  5DNN C;  3AZI C;  3AZK A;  4R8P A;  3KWQ B;  4XUJ C;  5JRG C;  1TZY C;  3W99 C;  4J8U A;  3LZ0 D;  4J8X B;  1F66 D;  5CPK C;  1P3O C;  5BT1 D;  3MVD C;  3LZ0 A;  3B6G C;  3KXB A;  1TAF A;  3AYW C;  3LZ1 D;  4G92 B;  3O62 C;  5JRG B;  4J8W D;  2FJ7 D;  2YFW B;  5AV6 C;  1N1J B;  3UT9 C;  3C1C D;  5F99 C;  5B1M C;  4J8W A;  5CPK B;  2FJ7 A;  2NZD C;  3C1C A;  1M1A C;  5AY8 D;  4QLC D;  2Y2M A;  5CP6 D;  3MGR D;  5CPJ D;  5AY8 A;  4QLC A;  2NQB C;  2CV5 D;  3VH5 T;  3MGR A;  1M18 C;  4H9S C;  5CPJ A;  5BS7 C;  3R45 A;  5B0Y D;  3AZL A;  5B0Y A;  3F6T A;  3VH6 T;  1P3K C;  5E5A C;  1M18 B;  5GT0 A;  4X23 B;  1BH8 B;  3UTA C;  1P3F B;  5DNM B;  5B2J D;  3X1U C;  3REI C;  3W98 D;  3NQU B;  4WU9 C;  5AVB D;  4ZUX D;  3LJA A;  3EPK A;  1P3K B;  1P3G A;  5B2J A;  5B32 D;  1WWI A;  3W98 A;  5AVB A;  4ZUX A;  5AV8 D;  3UTA B;  2BYK A;  3AZE C;  3AZN D;  3AN2 C;  5B32 A;  3X1S B;  3X1V B;  5GSU D;  3REI B;  3REK B;  3AZK C;  4R8P C;  1B6W A;  3AZN A;  5CPI D;  4KHA A;  2Y2O A;  4H9R A;  1M19 B;  4J8U C;  3X1T D;  5BO0 B;  5CPI A;  3W97 D;  3AZI D;  3LZ0 C;  3X1T A;  1HQ3 A;  3KXB C;  3WTP D;  3A6N A;  4EO5 C;  4NE3 A;  5BT1 C;  3KUY A;  1TZY D;  3W99 D;  3WTP A;  3LZ1 C;  3REJ B;  2G5H C;  4J8W C;  2FJ7 C;  4NE6 A;  5B31 B;  3MVD D;  3AZH D;  1F66 B;  3O62 D;  3WAA D;  3C1C C;  5B1L B;  3AZH A;  4WU8 D;  1EQZ D;  3LZ1 B;  5AV6 D;  1P3L B;  3WAA A;  2Y2J A;  5AY8 C;  4QLC C;  5B1M D;  5F99 D;  4WU8 A;  4J8W B;  3B0D C;  3AZJ B;  1U35 B;  1EQZ A;  3MGR C;  5CPJ C;  3EG5 B;  1KX3 B;  2BYM B;  4Z66 D;  4YM6 A;  1P3A D;  2CV5 C;  2Y2Q A;  5AV5 D;  1ID3 A;  4CAY B;  1P3A A;  3EPL A;  4AWL B;  4H9N A;  5B0Y C;  4QLC B;  5CP6 B;  5AV5 A;  1AOI B;  5B32 G;  3AV2 B;  1P3P D;  4NE5 A;  4YS3 D;  2CV5 B;  4KGC B;  1JFI A;  5JA4 A;  1P3P A;  3WA9 D;  4YS3 A;  1P3G C;  5B2I D;  5B2J C;  3WA9 A;  3C1B A;  3W98 C;  3NQJ B;  5AVB C;  2ARO B;  4ZUX C;  3WTP E;  5B2I A;  5B32 C;  2JSS A;  1BH9 A;  3FDD A;  4J8V B;  1P3B D;  1KX4 D;  1KX5 D;  3AZN C;  5GT3 B;  5B24 D;  5GSU C;  1KX4 A;  1KX5 A;  4KUD D;  2F8N D;  1ZLA B;  5CPI C;  3MGQ B;  5B24 A;  1P3M D;  4KUD A;  2F8N A; 
#chains in the Genus database with same CATH homology
 5AVC D;  3UTB B;  3A6N C;  4H9O A;  3X1T C;  3W97 C;  5AV8 B;  3MNN A;  4JJN B;  3B6F B;  3KUY C;  5GSU B;  3P5J B;  5AVC A;  3WTP C;  4WV4 B;  4J8U D;  5B33 A;  5B0Z D;  2Y2G A;  5C3I B;  3KXB D;  4UUZ A;  3W97 B;  5B0Z A;  4H9P A;  3REL A;  4LD9 B;  5DNN B;  3AZI B;  3AZH C;  5B40 D;  4E45 A;  4XUJ B;  3WAA C;  1TZY B;  5B40 A;  4WU8 C;  5G49 A;  1EQZ C;  3W99 B;  1P3O B;  3B6G B;  3MVD B;  3AYW B;  3A1K A;  4Z66 C;  2JE5 A;  3O62 B;  1P3A C;  4XZQ A;  4WU8 B;  4CSR A;  5AV6 B;  3V9R A;  1P3I D;  3VH5 W;  5AV5 C;  3UT9 B;  4ZBJ C;  5F99 B;  5B1M B;  1S32 D;  4WNN B;  1P3I A;  3A1I A;  2NZD B;  3AZL D;  4Z66 B;  1Z2C B;  4Z5T A;  3AFA D;  1S32 A;  4YS3 C;  5BNV A;  1P3P C;  1P34 A;  2Y2I A;  4H9N B;  5GXQ A;  3AFA A;  3WA9 C;  5GT0 D;  3C1B C;  3REH D;  2F8N G;  3B0C W;  2NQB B;  5B2I C;  3REH A;  2ZY3 A;  1W2E A;  5FUG B;  3WKJ A;  3AV1 D;  3LJA D;  1P3G D;  3MGS D;  4Z2M H;  1P3B C;  1KX4 C;  1KX5 C;  3AZM D;  3AV1 A;  3MGS A;  5B24 C;  5E5A B;  2PYO D;  4KUD C;  1BH9 B;  2HIO D;  3AZM A;  3MNN C;  1P3M C;  2F8N K;  2PYO A;  1P3B B;  2HIO A;  5KDM B;  5BNX B;  5AVC C;  3X1U B;  3W96 A;  4WU9 B;  1H3O A;  3EPH A;  1KU5 A;  3KSY A;  1HQ3 D;  3A6N D;  5B0Z C;  3AZE B;  3AN2 B;  1P3M B;  2IO5 C;  3KUY D;  4M6B A;  3AZK B;  4R8P B;  3LEL D;  5B40 C;  3TU4 D;  4J8U B;  2UWX A;  3LEL A;  3MGP D;  2IO5 B;  3TU4 A;  3AZG A;  3LZ0 B;  3KXB B;  1TAF B;  4G91 C;  4EO5 B;  3KWQ D;  3MGP A;  4XZQ C;  1BFM A;  3B0B A;  3KWQ A;  2Y2L A;  4YM6 D;  4DRA A;  2FJ7 B;  1P3I C;  4G91 B;  4J8X A;  1ID3 D;  3C1C B;  4Z5T C;  1S32 C;  1PZR A;  1P34 C;  5GXQ C;  3AZL C;  2RVQ D;  3AFA C;  5JRG A;  5AY8 B;  3B0D B;  2L5A A;  1N1J A;  3MGR B;  4HGA C;  5GT0 C;  5CPJ B;  3REH C;  2F8N H;  3R45 B;  3WKJ C;  3AZL B;  3C1B D;  5B0Y B;  3AV1 C;  3LJA C;  4WJ3 C;  3MGS C;  5GT0 B;  3AZM C;  3H0L C;  2PYO C;  2LY8 A;  2HIO C;  2HUE C;  3W96 C;  3AZF D;  3AV1 B;  3LJA B;  1P3G B;  3MGS B;  2ZY2 A;  5B2J B;  3W98 B;  3AZF A;  1R4V A;  4X23 D;  5AVB B;  4ZUX B;  3MNN D;  2YFV A;  2BYK B;  4DQY B;  1P3F D;  3VH5 A;  5B32 B;  1HQ3 C;  4X23 A;  1BH8 A;  5B33 D;  1P3F A;  5DNM A;  3AZN B;  4KHA B;  4H9R B;  3NQU A;  5CPI B;  3VH6 A;  3LEL C;  3REL D;  3X1S D;  3TU4 C;  3AZG C;  3X1T B;  1HQ3 B;  3A6N B;  3REK D;  3UTA A;  2RIQ A;  3MGP C;  3X1S A;  3KUY B;  3X1V A;  2W8S A;  3WTP B;  3REI A;  3REK A;  1M19 D;  3KWQ C;  2ZM5 A;  3TU4 B;  1M19 A;  5BO0 A;  5AV9 D;  4YM6 C;  3AZH B;  4XZQ D;  5AV9 A;  4G92 C;  3REJ D;  1ID3 C;  3WAA B;  3KFU G;  1EQZ B;  5B31 D;  3REJ A;  2RVQ C;  4H9Q A;  4Z5T D;  4YM6 B;  5B31 A;  1P34 D;  5B1L D;  5GXQ D;  4UPK A;  2CWE A;  1P3L D;  1F66 A;  1ID3 B;  1F1E A;  2XD1 A;  1P3A B;  5B1L A;  3AZJ D;  1U35 D;  3VH6 W;  3LZ1 A;  1P3L A;  5AV5 B;  1KX3 D;  1WWS A;  4ZBJ B;  3AZJ A;  1U35 A;  3WKJ D;  1JFI B;  5JA4 B;  1KX3 A;  2BYM A;  1P3P B;  4YS3 B;  2DF4 C;  1T3U A;  3AL0 C;  2Y2P A;  2ZY4 A;  3WA9 B;  3C1B B;  4CAY A;  1AOI D;  3AZF C;  3AV2 D;  5B2I B;  5CP6 A;  4KGC D;  4DRB A;  1AOI A;  4X23 C;  3AV2 A;  1P3F C;  5DNM C;  2CV5 A;  3W96 D;  4KGC A;  1KX4 B;  1KX5 B;  5B33 C;  3AZF B;  2ARO D;  2YFV B;  5B24 B;  4KUD B;  2F8N B;  3H0R C;  4J8V D;  4H9O B;  3B0C T;  3NQJ A;  2ARO A;  3MNN B;  3REL C;  3X1S C;  5GT3 D;  3X1V C;  5AVC B;  4J8V A;  2J8P A;  3REK C;  5B33 B;  1ZLA D;  1B67 A;  3MGQ D;  5GT3 A;  3AZG D;  1M19 C;  2Y2N A;  1ZLA A;  3UTB D;  4UUZ B;  5B31 G;  5B0Z B;  3MGQ A;  4H9P B;  4JJN D;  3REL B;  4WZS B;  3B6F D;  3UTB A;  5AV8 A;  5AV9 C;  4JJN A;  3B6F A;  5GSU A;  5B40 B;  5G49 B;  4NFT A;  3REJ C;  4J8X D;  4E44 A;  4LD9 D;  1Q9C A;  5DNN D;  5B31 C;  3W97 A;  1F66 C;  5AV9 B;  4XUJ D;  5JRG D;  4LD9 A;  5DNN A;  2JCH A;  5B1L C;  4XZQ B;  3AZI A;  4CSR B;  3V9R B;  1P3L C;  4XUJ A;  1M1A B;  4H9Q B;  1TZY A;  5CPK D;  3AZJ C;  2YFW A;  1U35 C;  1P3O D;  1P3I B;  3B6G D;  3W99 A;  3AYW D;  1KX3 C;  4Z5T B;  5CPK A;  1S32 B;  1P3O A;  5BNV B;  2BG1 A;  3MVD A;  1P34 B;  5GXQ B;  3B6G A;  3AYW A;  3O62 A;  3AFA B;  3UT9 D;  4AWL C;  5CP6 C;  5AV6 A;  4HGA B;  2NZD D;  1AOI C;  3REH B;  3UT9 A;  5F99 A;  5B1M A;  3AV2 C;  2Y2K A;  4WNN A;  1M1A D;  1ULY A;  3WKJ B;  4KGC C;  3EPJ A;  2G5I C;  2NZD A;  4Z66 A;  2Y2H A;  1M1A A;  2NQB D;  1M18 D;  5CHL B;  2DQN C;  3AZM B;  2ARO C;  2NQB A;  5DNM D;  2PYO B;  1M18 A;  3IP4 C;  4H9S A;  2HIO B;  5BS7 A;  4J8V C;  3H0M C;  2HUE B;  1A7W A;  3W96 B;  1H3O B;  2FFF B;  5FUG A;  1P3K D;  5GT3 C;  5E5A D;  1ZLA C;  3UTA D;  3MGQ C;  2VQR A;  1P3K A;  5E5A A;  2F2A C;  3X1V D;  4Z2M G;  3UTB C;  3X1U D;  3REI D;  5AV8 C;  4JJN C;  4WU9 D;  2XD5 A;  3B6F C;  1P3B A;  5KDM A;  5BNX A;  3X1U A;  2ZY5 A;  4WU9 A;  1HTA A;  3LEL B;  3AZE D;  3AN2 D;  3AZG B;  5C3I C;  4J8X C;  3AZK D;  4R8P D;  3AZE A;  3AN2 A;  3MGP B;  1P3M A;  4LD9 C;  5DNN C;  3AZI C;  3AZK A;  4R8P A;  3KWQ B;  4XUJ C;  5JRG C;  1TZY C;  3W99 C;  4J8U A;  3LZ0 D;  4J8X B;  1F66 D;  5CPK C;  1P3O C;  5BT1 D;  3MVD C;  3LZ0 A;  3B6G C;  3KXB A;  1TAF A;  3AYW C;  3LZ1 D;  4G92 B;  3O62 C;  5JRG B;  4J8W D;  2FJ7 D;  2YFW B;  5AV6 C;  1N1J B;  3UT9 C;  3C1C D;  5F99 C;  5B1M C;  4J8W A;  5CPK B;  2FJ7 A;  2NZD C;  3C1C A;  1M1A C;  5AY8 D;  4QLC D;  2Y2M A;  5CP6 D;  3MGR D;  5CPJ D;  5AY8 A;  4QLC A;  2NQB C;  2CV5 D;  3VH5 T;  3MGR A;  1M18 C;  4H9S C;  5CPJ A;  5BS7 C;  3R45 A;  5B0Y D;  3AZL A;  5B0Y A;  3F6T A;  3VH6 T;  1P3K C;  5E5A C;  1M18 B;  5GT0 A;  4X23 B;  1BH8 B;  3UTA C;  1P3F B;  5DNM B;  5B2J D;  3X1U C;  3REI C;  3W98 D;  3NQU B;  4WU9 C;  5AVB D;  4ZUX D;  3LJA A;  3EPK A;  1P3K B;  1P3G A;  5B2J A;  5B32 D;  1WWI A;  3W98 A;  5AVB A;  4ZUX A;  5AV8 D;  3UTA B;  2BYK A;  3AZE C;  3AZN D;  3AN2 C;  5B32 A;  3X1S B;  3X1V B;  5GSU D;  3REI B;  3REK B;  3AZK C;  4R8P C;  1B6W A;  3AZN A;  5CPI D;  4KHA A;  2Y2O A;  4H9R A;  1M19 B;  4J8U C;  3X1T D;  5BO0 B;  5CPI A;  3W97 D;  3AZI D;  3LZ0 C;  3X1T A;  1HQ3 A;  3KXB C;  3WTP D;  3A6N A;  4EO5 C;  4NE3 A;  5BT1 C;  3KUY A;  1TZY D;  3W99 D;  3WTP A;  3LZ1 C;  3REJ B;  2G5H C;  4J8W C;  2FJ7 C;  4NE6 A;  5B31 B;  3MVD D;  3AZH D;  1F66 B;  3O62 D;  3WAA D;  3C1C C;  5B1L B;  3AZH A;  4WU8 D;  1EQZ D;  3LZ1 B;  5AV6 D;  1P3L B;  3WAA A;  2Y2J A;  5AY8 C;  4QLC C;  5B1M D;  5F99 D;  4WU8 A;  4J8W B;  3B0D C;  3AZJ B;  1U35 B;  1EQZ A;  3MGR C;  5CPJ C;  3EG5 B;  1KX3 B;  2BYM B;  4Z66 D;  4YM6 A;  1P3A D;  2CV5 C;  2Y2Q A;  5AV5 D;  1ID3 A;  4CAY B;  1P3A A;  3EPL A;  4AWL B;  4H9N A;  5B0Y C;  4QLC B;  5CP6 B;  5AV5 A;  1AOI B;  5B32 G;  3AV2 B;  1P3P D;  4NE5 A;  4YS3 D;  2CV5 B;  4KGC B;  1JFI A;  5JA4 A;  1P3P A;  3WA9 D;  4YS3 A;  1P3G C;  5B2I D;  5B2J C;  3WA9 A;  3C1B A;  3W98 C;  3NQJ B;  5AVB C;  2ARO B;  4ZUX C;  3WTP E;  5B2I A;  5B32 C;  2JSS A;  1BH9 A;  3FDD A;  4J8V B;  1P3B D;  1KX4 D;  1KX5 D;  3AZN C;  5GT3 B;  5B24 D;  5GSU C;  1KX4 A;  1KX5 A;  4KUD D;  2F8N D;  1ZLA B;  5CPI C;  3MGQ B;  5B24 A;  1P3M D;  4KUD A;  2F8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...