3AZMA

Crystal structure of human nucleosome core particle containing h4k79q mutation
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azmA00
4KGCB 3WAAA 2PYOD 5B1MB 1P34C 2F8NA 3AZMD 4XUJB 3REIC 5CPID 4XZQA 2AROC 3B6FB 5B0ZB 3LELB 2NZDA 3KXBD 3B0BA 3AZND 1S32A 3KUYB 5B0YB 2CV5A 1KX5B 3RELB 3NQJA 4JJNA 4YS3B 3O62A 3AYWD 3REKB 4KGCD 5B1MD 3AZEB 2HIOC 1P3IA 3AV2B 3MGQA 1A7WA 3MNNB 4XUJD 5CPKA 3UTAB 5B40B 5B32D 1M1AA 4X23B 2FJ7B 5B31B 5B0YD 5FUGA 3KWQB 1KX5D 4CAYB 1P3KB 4HGAC 4Z2MH 4YS3D 5AVBB 3C1CB 3X1TC 3W98A 2BYKB 3C1BA 4ZBJC 4J8XC 3AV2D 1P3BB 3MNND 4YM6B 3UTAD 4E45A 5B2JB 3AV1A 3W97A 4X23D 1EQZB 3VH6A 2FJ7D 3V9RA 5GT3A 4R8PD 5B31D 4G92C 3UT9C 1F66A 3KWQD 5F99C 5E5AB 5CP6A 1P3KD 3W99C 3KSYA 3C1CD 3NQUA 5GXQA 5B1LB 2PYOA 3A6NA 1AOIB 4YM6D 3WAAB 5B33A 5CPIA 4NE6A 5B2JD 3WTPB 1P3MD 1P3PC 1EQZD 2F8NB 1Q9CA 4XZQB 2NQBC 3AZNA 3AZIC 1P3AC 3X1VA 3B0DC 5GSUC 5E5AD 4J8UA 5AY8C 5B1LD 2CV5B 3AYWA 4JJNB 3REJC 4KGCA 3O62B 5BT1D 1AOID 3B6GD 1B6WA 5JRGC 3AZKC 3WTPD 5B32A 3MGQB 4WU8C 2F8ND 5AV5C 3WA9C 3MVDC 5DNMA 3AFAC 3AZGC 1M1AB 5B0YA 1KX5A 4WU9C 4KUDC 5CPJA 4YS3A 4EO5C 2CV5D 4JJND 1WWIA 3W96A 3C1BB 3MNNA 3MGQD 3LZ1B 5GT0C 2FJ7A 4R8PA 3AV1B 5B31A 1M1AD 3AZJC 3TU4B 4Z2MG 3V9RB 4CAYA 1P3KA 1P3OC 1BFMA 3C1CA 1F66B 3AZMC 1KX4C 5CP6B 4ZUXD 1M18A 3NQUB 3KXBC 4H9QA 3C1BD 1P3GB 4QLCC 4YM6A 4AWLB 3MGSA 4H9OA 3A6NB 1P3MA 1KX3B 1KU5A 3LZ1D 1EQZA 5CHLB 1TAFB 3AZFD 5B33B 5CPIB 3AV1D 1BH8A 3AN2D 3X1UB 3TU4D 3AZHD 5B1MC 5AVCD 2BYMB 2HUEB 3AZNB 4H9PA 3X1VB 3B6FC 5B0ZC 1JFIA 4J8UB 3LELC 5B24D 5G49A 3LJAD 1U35C 4Z5TC 3AYWB 1P3GD 1AOIA 3KUYC 3B6GA 3A6ND 3WTPA 1P3LC 3RELC 5B2ID 1KX3D 4LD9A 5B33D 3AZLB 3REKC 5B32B 3UTBB 3X1UD 3VH6T 3LZ0B 1M19D 4J8WB 3AZEC 5DNMB 3AV2C 1ID3C 1N1JA 5AV9C 3X1VD 4J8UD 5B40C 3B0CW 5CPJB 4X23C 3MGRB 3KWQC 3W96B 3WKJD 5C3IB 5AVBC 5BS7A 3AZLD 5F99A 3MGPB 3UTBD 3LZ0D 4Z66A 5AV6B 4J8VC 1ZLAC 4J8WD 5BNVB 5DNMD 4H9NA 4R8PB 1P3BC 5B2JC 4ZUXA 5CPJD 3MGRD 1TZYC 5AV8C 3REHD 1M18B 1P34B 3X1SD 3REIB 4H9QB 3W96D 5E5AC 4WV4B 3LZ1A 1HQ3D 3AZFA 5B1LC 3MGSB 4H9OB 3MGPD 1P3MB 5AV6D 5DNNC 3AN2A 3TU4A 3AZHA 5AVCA 3REJA 1BH8B 3WAAC 5B24A 4H9PB 3LJAA 4XZQC 2HIOB 1JFIB 1M18D 1P34D 1P3GA 5AV5A 5G49B 2NZDC 3REID 1KX3A 1S32C 5B2IA 1TAFA 3B6GB 2CV5C 3MGSD 4LD9B 1M19A 3X1UA 5BO0A 3O62C 2BYMA 3X1TB 4DRBA 1BH9A 1P3IC 3MGQC 1N1JB 5CPKC 2HIOD 1M1AC 3WKJA 3AZLA 4LD9D 4G92B 3UTBA 2IO5C 3LZ0A 4J8WA 4G91B 1KX4A 3W98C 5F99B 3C1BC 4H9RB 3W99B 4Z66B 3X1TD 4H9NB 1H3OA 4E44A 3MGRA 4NFTA 4H9SA 3AV1C 4ZUXB 3REHA 3W97C 3X1SA 5GT3C 1P3PB 1F66C 1P3FA 1HQ3A 2F8NH 3MGPA 5CP6C 3UT9D 5AV6A 5GXQC 5BNVA 3B0DB 5F99D 3AZFB 3W99D 4Z66D 3AN2B 5AY8B 2PYOC 3AZHB 5AVCB 3REJB 5B33C 5CPIC 4KHAA 4UUZB 1P34A 5B24B 3LJAB 3REIA 2AROA 1P3PD 2HUEC 3AZNC 5AV5B 3X1VC 3MVDB 2NQBD 4J8UC 5B2IB 1P3AD 4NE5A 3AYWC 1M19B 5AY8D 4KGCC 5BO0B 4EO5B 3REJD 3VH5A 4XUJC 1BH9B 2HIOA 5B32C 3AZKD 4WU8D 5AV5D 4J8VA 5B0YC 5GXQD 3WA9D 3MVDD 3AZGD 1KX5C 3WKJB 1R4VA 2RVQD 2JSSA 5CPJC 5BNXA 4YS3C 3AZJB 4WU9D 3VH5W 4KUDD 1P3OB 3X1TA 1KX4B 5C3IC 3MNNC 3UTAC 2L5AA 4J8XA 1H3OB 1F1EA 4QLCB 2FJ7C 4R8PC 5B31C 3REHB 1B67A 2YFVA 3X1SB 3UT9A 1P3KC 3C1CC 3AZJD 1P3FB 1HQ3B 1P3OD 4H9RA 3W99A 1M18C 1KX4D 4CSRA 4YM6C 1U35B 4Z5TB 3MGSC 1P3MC 4QLCD 1EQZC 2YFWB 1P3LB 4KHAB 1P3PA 2F8NG 2AROB 2NQBA 3AZIA 1P3AA 1P3FD 5GSUA 4WZSB 1ID3B 5AY8A 5AV9B 3B6FD 5B0ZD 5BT1C 1WWSA 3LELD 1AOIC 1U35D 3WTPE 3B6GC 4Z5TD 4WNNB 3WTPC 4UUZA 4LD9C 3KUYD 5JRGA 3AZKA 1P3LD 3RELD 4WU8A 2AROD 3WA9A 3MVDA 3REKD 3AFAA 3AZGA 1ZLAB 2F8NK 4J8VB 3AZED 4WU9A 4KUDA 5JA4A 1ID3D 4JJNC 5BNXB 5AV9D 5KDMA 5B40D 4HGAB 1TZYB 5AV8B 5BS7C 2CWEA 3R45A 4G91C 4ZBJB 4J8XB 5AVBD 4Z66C 5GT0A 1ZLAD 4J8VD 5DNNB 3AZJA 2YFVB 1P3OA 3VH6W 3UT9B 4ZUXC 1P3BD 3AZMA 4NE3A 1TZYD 5AV8D 3KXBA 1ULYA 4CSRB 3VH5T 4QLCA 3LZ1C 2NZDB 3AZFC 4J8XD 1S32B 3AN2C 3TU4C 3AZHC 3NQJB 5AVCC 5DNND 3B0CT 5B1MA 2NQBB 3AZIB 1P3AB 5B24C 3WAAD 3LJAC 4XUJA 5GSUB 3B6FA 5B0ZA 1P3IB 3LELA 1P3GC 4AWLC 1U35A 4XZQD 4Z5TA 5CPKB 3A6NC 1KX3C 2RVQC 5B2IC 3KUYA 2NZDD 2YFWA 1P3LA 3RELA 1S32D 5FUGB 3X1UC 1M19C 5JRGB 3AZKB 3REKA 5B32G 2IO5B 4WU8B 3O62D 3W98B 3AZEA 3WA9B 3AZGB 3AFAB 3AZID 3AV2A 1ID3A 5AV9A 5GSUD 4WU9B 3UTAA 5B40A 1P3ID 4KUDB 5JA4B 4X23A 1HTAA 5KDMB 5CPKD 4WNNA 3WKJC 3W97B 3KWQA 3AZLC 5GT3B 3UTBC 5AVBA 3LZ0C 5JRGD 3R45B 4J8WC 2BYKA 5DNMC 1ZLAA 5GXQB 5GT0B 3W98D 3AFAD 2LY8A 5B31G 1P3BA 3MGRC 2PYOB 4H9SC 5B2JA 4DRAA 3REHC 1TZYA 5AV8A 3AZMB 3X1SC 3W96C 3W97D 4M6BA 3KXBB 1P3FC 1HQ3C 5GT3D 5E5AA 3MGPC 1F66D 5AV6C 5B1LA 5CP6D 5DNNA 5GT0D
chains in the Genus database with same CATH superfamily
4KGCB 3WAAA 2PYOD 5B1MB 1P34C 2F8NA 3AZMD 4XUJB 3REIC 5CPID 4XZQA 2AROC 3B6FB 5B0ZB 3LELB 2NZDA 3KXBD 3EPKA 3B0BA 3AZND 1S32A 3KUYB 5B0YB 2CV5A 1KX5B 3RELB 3NQJA 4JJNA 4YS3B 3O62A 3AYWD 3REKB 4KGCD 2ZY5A 5B1MD 3AZEB 2HIOC 1P3IA 3AV2B 2W8SA 3MGQA 1A7WA 3MNNB 4XUJD 5CPKA 3UTAB 5B40B 5B32D 1M1AA 4X23B 2FJ7B 5B31B 5B0YD 5FUGA 3KWQB 1KX5D 4CAYB 1P3KB 4HGAC 4Z2MH 4YS3D 5AVBB 3C1CB 3X1TC 3W98A 2BYKB 3C1BA 4ZBJC 4J8XC 3AV2D 1P3BB 3MNND 4YM6B 3UTAD 4E45A 5B2JB 3AV1A 3W97A 4X23D 1EQZB 3VH6A 2FJ7D 3V9RA 5GT3A 4R8PD 5B31D 4G92C 3UT9C 1F66A 3KWQD 5F99C 5E5AB 5CP6A 1P3KD 3W99C 3KSYA 3C1CD 3NQUA 5GXQA 5B1LB 2PYOA 3A6NA 1AOIB 4YM6D 3WAAB 3AL0C 5B33A 5CPIA 4NE6A 5B2JD 3WTPB 1P3MD 1P3PC 1EQZD 2F8NB 1Q9CA 4XZQB 2NQBC 3AZNA 3AZIC 1P3AC 3F6TA 3X1VA 3B0DC 5GSUC 5E5AD 4J8UA 5AY8C 5B1LD 2CV5B 3AYWA 4JJNB 3REJC 4KGCA 3O62B 5BT1D 1AOID 3B6GD 1B6WA 5JRGC 3AZKC 3WTPD 5B32A 2G5IC 3MGQB 4WU8C 2F8ND 5AV5C 3WA9C 3MVDC 5DNMA 3AFAC 3AZGC 1M1AB 5B0YA 1KX5A 4WU9C 4KUDC 5CPJA 4YS3A 4EO5C 2CV5D 4JJND 1WWIA 1T3UA 3W96A 3C1BB 3MNNA 3MGQD 3LZ1B 5GT0C 3P5JB 2FJ7A 4R8PA 3AV1B 5B31A 1M1AD 3AZJC 3TU4B 4Z2MG 3V9RB 4CAYA 1P3KA 1P3OC 1BFMA 3C1CA 1PZRA 1F66B 3AZMC 1KX4C 3H0MC 5CP6B 4ZUXD 1M18A 3NQUB 3KXBC 4H9QA 3C1BD 1P3GB 4QLCC 4YM6A 4AWLB 3MGSA 4H9OA 3A6NB 1P3MA 1KX3B 1KU5A 3LZ1D 1EQZA 5CHLB 1TAFB 3AZFD 5B33B 5CPIB 3AV1D 1BH8A 3AN2D 3X1UB 3TU4D 3AZHD 5B1MC 5AVCD 2BYMB 2HUEB 3AZNB 4H9PA 3X1VB 3B6FC 5B0ZC 1JFIA 4J8UB 3LELC 5B24D 5G49A 3LJAD 1U35C 4Z5TC 3AYWB 1P3GD 1AOIA 3KUYC 3B6GA 3A6ND 3WTPA 1P3LC 3RELC 5B2ID 1KX3D 4LD9A 5B33D 3AZLB 3REKC 5B32B 3UTBB 3X1UD 3VH6T 3LZ0B 1M19D 4J8WB 3AZEC 5DNMB 3AV2C 1ID3C 1N1JA 5AV9C 3X1VD 2Y2QA 4J8UD 5B40C 3B0CW 5CPJB 4X23C 3MGRB 4UPKA 2DQNC 3KWQC 3W96B 3WKJD 5C3IB 5AVBC 5BS7A 3AZLD 5F99A 3MGPB 3UTBD 3LZ0D 4Z66A 5AV6B 4J8VC 1ZLAC 4J8WD 5BNVB 5DNMD 4H9NA 4R8PB 1P3BC 5B2JC 4ZUXA 5CPJD 3MGRD 1TZYC 5AV8C 3REHD 1M18B 1P34B 3X1SD 3REIB 4H9QB 3W96D 5E5AC 4WV4B 3LZ1A 1HQ3D 3AZFA 5B1LC 3MGSB 4H9OB 3MGPD 1P3MB 5AV6D 5DNNC 3AN2A 3TU4A 3AZHA 5AVCA 3REJA 1BH8B 3WAAC 5B24A 4H9PB 3LJAA 4XZQC 2HIOB 1JFIB 1M18D 1P34D 1P3GA 5AV5A 5G49B 2NZDC 3REID 3A1IA 1KX3A 2Y2IA 1S32C 5B2IA 1TAFA 3B6GB 2CV5C 3MGSD 4LD9B 1M19A 3X1UA 5BO0A 3O62C 2JCHA 2BYMA 3X1TB 4DRBA 2G5HC 1BH9A 1P3IC 3MGQC 1N1JB 2VQRA 5CPKC 2HIOD 1M1AC 3WKJA 3AZLA 4LD9D 4G92B 3UTBA 2IO5C 3LZ0A 4J8WA 4G91B 1KX4A 3W98C 5F99B 3C1BC 4H9RB 3W99B 4Z66B 3X1TD 2Y2LA 1H3OA 4H9NB 4E44A 3MGRA 4NFTA 2Y2GA 4H9SA 3AV1C 4ZUXB 3REHA 3W97C 3KFUG 3X1SA 3A1KA 5GT3C 1P3PB 1F66C 1P3FA 1HQ3A 2F2AC 2F8NH 3MGPA 5CP6C 3UT9D 5AV6A 5GXQC 5BNVA 3B0DB 5F99D 3AZFB 3W99D 4Z66D 3AN2B 5AY8B 2PYOC 3AZHB 5AVCB 3REJB 5B33C 5CPIC 4KHAA 4UUZB 1P34A 5B24B 3LJAB 3REIA 2AROA 1P3PD 2HUEC 3AZNC 2Y2MA 5AV5B 2Y2JA 3X1VC 3MVDB 2NQBD 4J8UC 5B2IB 2XD5A 4NE5A 1P3AD 3AYWC 1M19B 5AY8D 4KGCC 5BO0B 4EO5B 3REJD 3VH5A 4XUJC 1BH9B 2HIOA 3EG5B 5B32C 3AZKD 2ZY3A 4WU8D 5AV5D 4J8VA 5B0YC 5GT0D 2FFFB 3WA9D 3MVDD 3AZGD 1KX5C 3EPHA 3WKJB 1R4VA 2RVQD 2JSSA 2Y2PA 5CPJC 5BNXA 4YS3C 3AZJB 4WU9D 3VH5W 4KUDD 1P3OB 3X1TA 1KX4B 4DQYB 5C3IC 3MNNC 3UTAC 2L5AA 4J8XA 1H3OB 1F1EA 4QLCB 3EPJA 2FJ7C 4R8PC 5B31C 3REHB 1B67A 2YFVA 3X1SB 2RIQA 3UT9A 1P3KC 3C1CC 2ZM5A 3AZJD 1P3FB 1HQ3B 1P3OD 4H9RA 3W99A 1M18C 1KX4D 4CSRA 4YM6C 1U35B 4Z5TB 3MGSC 1P3MC 4QLCD 1EQZC 2YFWB 1P3LB 4KHAB 2Y2OA 1P3PA 2F8NG 2AROB 2NQBA 3AZIA 1P3AA 1P3FD 5GSUA 4WZSB 1ID3B 5AY8A 5AV9B 3B6FD 5B0ZD 5BT1C 1WWSA 3LELD 1AOIC 1U35D 3WTPE 3B6GC 4Z5TD 4WNNB 3WTPC 4UUZA 4LD9C 3KUYD 5JRGA 2BG1A 3AZKA 1P3LD 3RELD 4WU8A 2AROD 3WA9A 3MVDA 3REKD 3AFAA 3AZGA 1ZLAB 2F8NK 4J8VB 3AZED 4WU9A 4KUDA 5JA4A 1ID3D 4JJNC 5BNXB 5AV9D 5KDMA 5B40D 3IP4C 4HGAB 2Y2NA 1TZYB 2Y2HA 5AV8B 5BS7C 2CWEA 3R45A 4G91C 4ZBJB 4J8XB 5AVBD 4Z66C 5GT0A 1W2EA 1ZLAD 4J8VD 5DNNB 3AZJA 2YFVB 2ZY2A 4WJ3C 1P3OA 3VH6W 3UT9B 4ZUXC 1P3BD 3AZMA 4NE3A 2XD1A 1TZYD 5AV8D 3KXBA 1ULYA 4CSRB 3VH5T 4QLCA 3LZ1C 2NZDB 2J8PA 3AZFC 4J8XD 1S32B 3AN2C 3TU4C 3AZHC 3NQJB 5AVCC 5DNND 3B0CT 3H0LC 5B1MA 2JE5A 2NQBB 3AZIB 1P3AB 5B24C 3WAAD 3LJAC 4XUJA 5GSUB 3B6FA 5B0ZA 1P3IB 3LELA 1P3GC 4AWLC 1U35A 4XZQD 4Z5TA 5CPKB 3A6NC 1KX3C 2RVQC 5B2IC 3KUYA 2NZDD 2YFWA 1P3LA 3RELA 1S32D 5FUGB 3X1UC 1M19C 5JRGB 3AZKB 3H0RC 3REKA 5B32G 2IO5B 4WU8B 3O62D 3W98B 3AZEA 3WA9B 3AZGB 3AFAB 3AZID 3AV2A 1ID3A 5AV9A 2ZY4A 5GSUD 4WU9B 3UTAA 5B40A 1P3ID 4KUDB 5JA4B 4X23A 1HTAA 5KDMB 5CPKD 4WNNA 2UWXA 3WKJC 3FDDA 3W97B 3KWQA 3AZLC 5GT3B 3UTBC 5AVBA 3LZ0C 5JRGD 3R45B 4J8WC 2BYKA 2Y2KA 5DNMC 1ZLAA 5GXQB 5GT0B 3W98D 3AFAD 2LY8A 5B31G 3EPLA 1P3BA 3MGRC 2PYOB 4H9SC 5B2JA 4DRAA 3REHC 1TZYA 5AV8A 3AZMB 3X1SC 3W96C 3W97D 4M6BA 3KXBB 1P3FC 1HQ3C 1Z2CB 5E5AA 5GT3D 3MGPC 1F66D 5AV6C 2DF4C 5B1LA 5CP6D 5DNNA 5GXQD
chains in the Genus database with same CATH topology
4KGCB 3WAAA 2PYOD 5B1MB 1P34C 2F8NA 3AZMD 4XUJB 3REIC 5CPID 4XZQA 2AROC 3B6FB 5B0ZB 3LELB 2NZDA 3KXBD 3EPKA 3B0BA 3AZND 1S32A 3KUYB 5B0YB 2CV5A 1KX5B 3RELB 3NQJA 4JJNA 4YS3B 3O62A 3AYWD 3REKB 4KGCD 2ZY5A 5B1MD 3AZEB 2HIOC 1P3IA 3AV2B 2W8SA 3MGQA 1A7WA 3MNNB 4XUJD 5CPKA 3UTAB 5B40B 5B32D 1M1AA 4X23B 2FJ7B 5B31B 5B0YD 5FUGA 3KWQB 1KX5D 4CAYB 1P3KB 4HGAC 4Z2MH 4YS3D 5AVBB 3C1CB 3X1TC 3W98A 2BYKB 3C1BA 4ZBJC 4J8XC 3AV2D 1P3BB 3MNND 4YM6B 3UTAD 4E45A 5B2JB 3AV1A 3W97A 4X23D 1EQZB 3VH6A 2FJ7D 3V9RA 5GT3A 4R8PD 5B31D 4G92C 3UT9C 1F66A 3KWQD 5F99C 5E5AB 5CP6A 1P3KD 3W99C 3KSYA 3C1CD 3NQUA 5GXQA 5B1LB 2PYOA 3A6NA 1AOIB 4YM6D 3WAAB 3AL0C 5B33A 5CPIA 4NE6A 5B2JD 3WTPB 1P3MD 1P3PC 1EQZD 2F8NB 1Q9CA 4XZQB 2NQBC 3AZNA 3AZIC 1P3AC 3F6TA 3X1VA 3B0DC 5GSUC 5E5AD 4J8UA 5AY8C 5B1LD 2CV5B 3AYWA 4JJNB 3REJC 4KGCA 3O62B 5BT1D 1AOID 3B6GD 1B6WA 5JRGC 3AZKC 3WTPD 5B32A 2G5IC 3MGQB 4WU8C 2F8ND 5AV5C 3WA9C 3MVDC 5DNMA 3AFAC 3AZGC 1M1AB 5B0YA 1KX5A 4WU9C 4KUDC 5CPJA 4YS3A 4EO5C 2CV5D 4JJND 1WWIA 1T3UA 3W96A 3C1BB 3MNNA 3MGQD 3LZ1B 5GT0C 3P5JB 2FJ7A 4R8PA 3AV1B 5B31A 1M1AD 3AZJC 3TU4B 4Z2MG 3V9RB 4CAYA 1P3KA 1P3OC 1BFMA 3C1CA 1PZRA 1F66B 3AZMC 1KX4C 3H0MC 5CP6B 4ZUXD 1M18A 3NQUB 3KXBC 4H9QA 3C1BD 1P3GB 4QLCC 4YM6A 4AWLB 3MGSA 4H9OA 3A6NB 1P3MA 1KX3B 1KU5A 3LZ1D 1EQZA 5CHLB 1TAFB 3AZFD 5B33B 5CPIB 3AV1D 1BH8A 3AN2D 3X1UB 3TU4D 3AZHD 5B1MC 5AVCD 2BYMB 2HUEB 3AZNB 4H9PA 3X1VB 3B6FC 5B0ZC 1JFIA 4J8UB 3LELC 5B24D 5G49A 3LJAD 1U35C 4Z5TC 3AYWB 1P3GD 1AOIA 3KUYC 3B6GA 3A6ND 3WTPA 1P3LC 3RELC 5B2ID 1KX3D 4LD9A 5B33D 3AZLB 3REKC 5B32B 3UTBB 3X1UD 3VH6T 3LZ0B 1M19D 4J8WB 3AZEC 5DNMB 3AV2C 1ID3C 1N1JA 5AV9C 3X1VD 2Y2QA 4J8UD 5B40C 3B0CW 5CPJB 4X23C 3MGRB 4UPKA 2DQNC 3KWQC 3W96B 3WKJD 5C3IB 5AVBC 5BS7A 3AZLD 5F99A 3MGPB 3UTBD 3LZ0D 4Z66A 5AV6B 4J8VC 1ZLAC 4J8WD 5BNVB 5DNMD 4H9NA 4R8PB 1P3BC 5B2JC 4ZUXA 5CPJD 3MGRD 1TZYC 5AV8C 3REHD 1M18B 1P34B 3X1SD 3REIB 4H9QB 3W96D 5E5AC 4WV4B 3LZ1A 1HQ3D 3AZFA 5B1LC 3MGSB 4H9OB 3MGPD 1P3MB 5AV6D 5DNNC 3AN2A 3TU4A 3AZHA 5AVCA 3REJA 1BH8B 3WAAC 5B24A 4H9PB 3LJAA 4XZQC 2HIOB 1JFIB 1M18D 1P34D 1P3GA 5AV5A 5G49B 2NZDC 3REID 3A1IA 1KX3A 2Y2IA 1S32C 5B2IA 1TAFA 3B6GB 2CV5C 3MGSD 4LD9B 1M19A 3X1UA 5BO0A 3O62C 2JCHA 2BYMA 3X1TB 4DRBA 2G5HC 1BH9A 1P3IC 3MGQC 1N1JB 2VQRA 5CPKC 2HIOD 1M1AC 3WKJA 3AZLA 4LD9D 4G92B 3UTBA 2IO5C 3LZ0A 4J8WA 4G91B 1KX4A 3W98C 5F99B 3C1BC 4H9RB 3W99B 4Z66B 3X1TD 2Y2LA 1H3OA 4H9NB 4E44A 3MGRA 4NFTA 2Y2GA 4H9SA 3AV1C 4ZUXB 3REHA 3W97C 3KFUG 3X1SA 3A1KA 5GT3C 1P3PB 1F66C 1P3FA 1HQ3A 2F2AC 2F8NH 3MGPA 5CP6C 3UT9D 5AV6A 5GXQC 5BNVA 3B0DB 5F99D 3AZFB 3W99D 4Z66D 3AN2B 5AY8B 2PYOC 3AZHB 5AVCB 3REJB 5B33C 5CPIC 4KHAA 4UUZB 1P34A 5B24B 3LJAB 3REIA 2AROA 1P3PD 2HUEC 3AZNC 2Y2MA 5AV5B 2Y2JA 3X1VC 3MVDB 2NQBD 4J8UC 5B2IB 2XD5A 4NE5A 1P3AD 3AYWC 1M19B 5AY8D 4KGCC 5BO0B 4EO5B 3REJD 3VH5A 4XUJC 1BH9B 2HIOA 3EG5B 5B32C 3AZKD 2ZY3A 4WU8D 5AV5D 4J8VA 5B0YC 5GT0D 2FFFB 3WA9D 3MVDD 3AZGD 1KX5C 3EPHA 3WKJB 1R4VA 2RVQD 2JSSA 2Y2PA 5CPJC 5BNXA 4YS3C 3AZJB 4WU9D 3VH5W 4KUDD 1P3OB 3X1TA 1KX4B 4DQYB 5C3IC 3MNNC 3UTAC 2L5AA 4J8XA 1H3OB 1F1EA 4QLCB 3EPJA 2FJ7C 4R8PC 5B31C 3REHB 1B67A 2YFVA 3X1SB 2RIQA 3UT9A 1P3KC 3C1CC 2ZM5A 3AZJD 1P3FB 1HQ3B 1P3OD 4H9RA 3W99A 1M18C 1KX4D 4CSRA 4YM6C 1U35B 4Z5TB 3MGSC 1P3MC 4QLCD 1EQZC 2YFWB 1P3LB 4KHAB 2Y2OA 1P3PA 2F8NG 2AROB 2NQBA 3AZIA 1P3AA 1P3FD 5GSUA 4WZSB 1ID3B 5AY8A 5AV9B 3B6FD 5B0ZD 5BT1C 1WWSA 3LELD 1AOIC 1U35D 3WTPE 3B6GC 4Z5TD 4WNNB 3WTPC 4UUZA 4LD9C 3KUYD 5JRGA 2BG1A 3AZKA 1P3LD 3RELD 4WU8A 2AROD 3WA9A 3MVDA 3REKD 3AFAA 3AZGA 1ZLAB 2F8NK 4J8VB 3AZED 4WU9A 4KUDA 5JA4A 1ID3D 4JJNC 5BNXB 5AV9D 5KDMA 5B40D 3IP4C 4HGAB 2Y2NA 1TZYB 2Y2HA 5AV8B 5BS7C 2CWEA 3R45A 4G91C 4ZBJB 4J8XB 5AVBD 4Z66C 5GT0A 1W2EA 1ZLAD 4J8VD 5DNNB 3AZJA 2YFVB 2ZY2A 4WJ3C 1P3OA 3VH6W 3UT9B 4ZUXC 1P3BD 3AZMA 4NE3A 2XD1A 1TZYD 5AV8D 3KXBA 1ULYA 4CSRB 3VH5T 4QLCA 3LZ1C 2NZDB 2J8PA 3AZFC 4J8XD 1S32B 3AN2C 3TU4C 3AZHC 3NQJB 5AVCC 5DNND 3B0CT 3H0LC 5B1MA 2JE5A 2NQBB 3AZIB 1P3AB 5B24C 3WAAD 3LJAC 4XUJA 5GSUB 3B6FA 5B0ZA 1P3IB 3LELA 1P3GC 4AWLC 1U35A 4XZQD 4Z5TA 5CPKB 3A6NC 1KX3C 2RVQC 5B2IC 3KUYA 2NZDD 2YFWA 1P3LA 3RELA 1S32D 5FUGB 3X1UC 1M19C 5JRGB 3AZKB 3H0RC 3REKA 5B32G 2IO5B 4WU8B 3O62D 3W98B 3AZEA 3WA9B 3AZGB 3AFAB 3AZID 3AV2A 1ID3A 5AV9A 2ZY4A 5GSUD 4WU9B 3UTAA 5B40A 1P3ID 4KUDB 5JA4B 4X23A 1HTAA 5KDMB 5CPKD 4WNNA 2UWXA 3WKJC 3FDDA 3W97B 3KWQA 3AZLC 5GT3B 3UTBC 5AVBA 3LZ0C 5JRGD 3R45B 4J8WC 2BYKA 2Y2KA 5DNMC 1ZLAA 5GXQB 5GT0B 3W98D 3AFAD 2LY8A 5B31G 3EPLA 1P3BA 3MGRC 2PYOB 4H9SC 5B2JA 4DRAA 3REHC 1TZYA 5AV8A 3AZMB 3X1SC 3W96C 3W97D 4M6BA 3KXBB 1P3FC 1HQ3C 1Z2CB 5E5AA 5GT3D 3MGPC 1F66D 5AV6C 2DF4C 5B1LA 5CP6D 5DNNA 5GXQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KGC B;  3WAA A;  2PYO D;  5B1M B;  1P34 C;  2F8N A;  3AZM D;  4XUJ B;  3REI C;  5CPI D;  4XZQ A;  2ARO C;  3B6F B;  5B0Z B;  3LEL B;  2NZD A;  3KXB D;  3B0B A;  3AZN D;  1S32 A;  3KUY B;  5B0Y B;  2CV5 A;  1KX5 B;  3REL B;  3NQJ A;  4JJN A;  4YS3 B;  3O62 A;  3AYW D;  3REK B;  4KGC D;  5B1M D;  3AZE B;  2HIO C;  1P3I A;  3AV2 B;  3MGQ A;  1A7W A;  3MNN B;  4XUJ D;  5CPK A;  3UTA B;  5B40 B;  5B32 D;  1M1A A;  4X23 B;  2FJ7 B;  5B31 B;  5B0Y D;  5FUG A;  3KWQ B;  1KX5 D;  4CAY B;  1P3K B;  4HGA C;  4Z2M H;  4YS3 D;  5AVB B;  3C1C B;  3X1T C;  3W98 A;  2BYK B;  3C1B A;  4ZBJ C;  4J8X C;  3AV2 D;  1P3B B;  3MNN D;  4YM6 B;  3UTA D;  4E45 A;  5B2J B;  3AV1 A;  3W97 A;  4X23 D;  1EQZ B;  3VH6 A;  2FJ7 D;  3V9R A;  5GT3 A;  4R8P D;  5B31 D;  4G92 C;  3UT9 C;  1F66 A;  3KWQ D;  5F99 C;  5E5A B;  5CP6 A;  1P3K D;  3W99 C;  3KSY A;  3C1C D;  3NQU A;  5GXQ A;  5B1L B;  2PYO A;  3A6N A;  1AOI B;  4YM6 D;  3WAA B;  5B33 A;  5CPI A;  4NE6 A;  5B2J D;  3WTP B;  1P3M D;  1P3P C;  1EQZ D;  2F8N B;  1Q9C A;  4XZQ B;  2NQB C;  3AZN A;  3AZI C;  1P3A C;  3X1V A;  3B0D C;  5GSU C;  5E5A D;  4J8U A;  5AY8 C;  5B1L D;  2CV5 B;  3AYW A;  4JJN B;  3REJ C;  4KGC A;  3O62 B;  5BT1 D;  1AOI D;  3B6G D;  1B6W A;  5JRG C;  3AZK C;  3WTP D;  5B32 A;  3MGQ B;  4WU8 C;  2F8N D;  5AV5 C;  3WA9 C;  3MVD C;  5DNM A;  3AFA C;  3AZG C;  1M1A B;  5B0Y A;  1KX5 A;  4WU9 C;  4KUD C;  5CPJ A;  4YS3 A;  4EO5 C;  2CV5 D;  4JJN D;  1WWI A;  3W96 A;  3C1B B;  3MNN A;  3MGQ D;  3LZ1 B;  5GT0 C;  2FJ7 A;  4R8P A;  3AV1 B;  5B31 A;  1M1A D;  3AZJ C;  3TU4 B;  4Z2M G;  3V9R B;  4CAY A;  1P3K A;  1P3O C;  1BFM A;  3C1C A;  1F66 B;  3AZM C;  1KX4 C;  5CP6 B;  4ZUX D;  1M18 A;  3NQU B;  3KXB C;  4H9Q A;  3C1B D;  1P3G B;  4QLC C;  4YM6 A;  4AWL B;  3MGS A;  4H9O A;  3A6N B;  1P3M A;  1KX3 B;  1KU5 A;  3LZ1 D;  1EQZ A;  5CHL B;  1TAF B;  3AZF D;  5B33 B;  5CPI B;  3AV1 D;  1BH8 A;  3AN2 D;  3X1U B;  3TU4 D;  3AZH D;  5B1M C;  5AVC D;  2BYM B;  2HUE B;  3AZN B;  4H9P A;  3X1V B;  3B6F C;  5B0Z C;  1JFI A;  4J8U B;  3LEL C;  5B24 D;  5G49 A;  3LJA D;  1U35 C;  4Z5T C;  3AYW B;  1P3G D;  1AOI A;  3KUY C;  3B6G A;  3A6N D;  3WTP A;  1P3L C;  3REL C;  5B2I D;  1KX3 D;  4LD9 A;  5B33 D;  3AZL B;  3REK C;  5B32 B;  3UTB B;  3X1U D;  3VH6 T;  3LZ0 B;  1M19 D;  4J8W B;  3AZE C;  5DNM B;  3AV2 C;  1ID3 C;  1N1J A;  5AV9 C;  3X1V D;  4J8U D;  5B40 C;  3B0C W;  5CPJ B;  4X23 C;  3MGR B;  3KWQ C;  3W96 B;  3WKJ D;  5C3I B;  5AVB C;  5BS7 A;  3AZL D;  5F99 A;  3MGP B;  3UTB D;  3LZ0 D;  4Z66 A;  5AV6 B;  4J8V C;  1ZLA C;  4J8W D;  5BNV B;  5DNM D;  4H9N A;  4R8P B;  1P3B C;  5B2J C;  4ZUX A;  5CPJ D;  3MGR D;  1TZY C;  5AV8 C;  3REH D;  1M18 B;  1P34 B;  3X1S D;  3REI B;  4H9Q B;  3W96 D;  5E5A C;  4WV4 B;  3LZ1 A;  1HQ3 D;  3AZF A;  5B1L C;  3MGS B;  4H9O B;  3MGP D;  1P3M B;  5AV6 D;  5DNN C;  3AN2 A;  3TU4 A;  3AZH A;  5AVC A;  3REJ A;  1BH8 B;  3WAA C;  5B24 A;  4H9P B;  3LJA A;  4XZQ C;  2HIO B;  1JFI B;  1M18 D;  1P34 D;  1P3G A;  5AV5 A;  5G49 B;  2NZD C;  3REI D;  1KX3 A;  1S32 C;  5B2I A;  1TAF A;  3B6G B;  2CV5 C;  3MGS D;  4LD9 B;  1M19 A;  3X1U A;  5BO0 A;  3O62 C;  2BYM A;  3X1T B;  4DRB A;  1BH9 A;  1P3I C;  3MGQ C;  1N1J B;  5CPK C;  2HIO D;  1M1A C;  3WKJ A;  3AZL A;  4LD9 D;  4G92 B;  3UTB A;  2IO5 C;  3LZ0 A;  4J8W A;  4G91 B;  1KX4 A;  3W98 C;  5F99 B;  3C1B C;  4H9R B;  3W99 B;  4Z66 B;  3X1T D;  4H9N B;  1H3O A;  4E44 A;  3MGR A;  4NFT A;  4H9S A;  3AV1 C;  4ZUX B;  3REH A;  3W97 C;  3X1S A;  5GT3 C;  1P3P B;  1F66 C;  1P3F A;  1HQ3 A;  2F8N H;  3MGP A;  5CP6 C;  3UT9 D;  5AV6 A;  5GXQ C;  5BNV A;  3B0D B;  5F99 D;  3AZF B;  3W99 D;  4Z66 D;  3AN2 B;  5AY8 B;  2PYO C;  3AZH B;  5AVC B;  3REJ B;  5B33 C;  5CPI C;  4KHA A;  4UUZ B;  1P34 A;  5B24 B;  3LJA B;  3REI A;  2ARO A;  1P3P D;  2HUE C;  3AZN C;  5AV5 B;  3X1V C;  3MVD B;  2NQB D;  4J8U C;  5B2I B;  1P3A D;  4NE5 A;  3AYW C;  1M19 B;  5AY8 D;  4KGC C;  5BO0 B;  4EO5 B;  3REJ D;  3VH5 A;  4XUJ C;  1BH9 B;  2HIO A;  5B32 C;  3AZK D;  4WU8 D;  5AV5 D;  4J8V A;  5B0Y C;  5GXQ D;  3WA9 D;  3MVD D;  3AZG D;  1KX5 C;  3WKJ B;  1R4V A;  2RVQ D;  2JSS A;  5CPJ C;  5BNX A;  4YS3 C;  3AZJ B;  4WU9 D;  3VH5 W;  4KUD D;  1P3O B;  3X1T A;  1KX4 B;  5C3I C;  3MNN C;  3UTA C;  2L5A A;  4J8X A;  1H3O B;  1F1E A;  4QLC B;  2FJ7 C;  4R8P C;  5B31 C;  3REH B;  1B67 A;  2YFV A;  3X1S B;  3UT9 A;  1P3K C;  3C1C C;  3AZJ D;  1P3F B;  1HQ3 B;  1P3O D;  4H9R A;  3W99 A;  1M18 C;  1KX4 D;  4CSR A;  4YM6 C;  1U35 B;  4Z5T B;  3MGS C;  1P3M C;  4QLC D;  1EQZ C;  2YFW B;  1P3L B;  4KHA B;  1P3P A;  2F8N G;  2ARO B;  2NQB A;  3AZI A;  1P3A A;  1P3F D;  5GSU A;  4WZS B;  1ID3 B;  5AY8 A;  5AV9 B;  3B6F D;  5B0Z D;  5BT1 C;  1WWS A;  3LEL D;  1AOI C;  1U35 D;  3WTP E;  3B6G C;  4Z5T D;  4WNN B;  3WTP C;  4UUZ A;  4LD9 C;  3KUY D;  5JRG A;  3AZK A;  1P3L D;  3REL D;  4WU8 A;  2ARO D;  3WA9 A;  3MVD A;  3REK D;  3AFA A;  3AZG A;  1ZLA B;  2F8N K;  4J8V B;  3AZE D;  4WU9 A;  4KUD A;  5JA4 A;  1ID3 D;  4JJN C;  5BNX B;  5AV9 D;  5KDM A;  5B40 D;  4HGA B;  1TZY B;  5AV8 B;  5BS7 C;  2CWE A;  3R45 A;  4G91 C;  4ZBJ B;  4J8X B;  5AVB D;  4Z66 C;  5GT0 A;  1ZLA D;  4J8V D;  5DNN B;  3AZJ A;  2YFV B;  1P3O A;  3VH6 W;  3UT9 B;  4ZUX C;  1P3B D;  3AZM A;  4NE3 A;  1TZY D;  5AV8 D;  3KXB A;  1ULY A;  4CSR B;  3VH5 T;  4QLC A;  3LZ1 C;  2NZD B;  3AZF C;  4J8X D;  1S32 B;  3AN2 C;  3TU4 C;  3AZH C;  3NQJ B;  5AVC C;  5DNN D;  3B0C T;  5B1M A;  2NQB B;  3AZI B;  1P3A B;  5B24 C;  3WAA D;  3LJA C;  4XUJ A;  5GSU B;  3B6F A;  5B0Z A;  1P3I B;  3LEL A;  1P3G C;  4AWL C;  1U35 A;  4XZQ D;  4Z5T A;  5CPK B;  3A6N C;  1KX3 C;  2RVQ C;  5B2I C;  3KUY A;  2NZD D;  2YFW A;  1P3L A;  3REL A;  1S32 D;  5FUG B;  3X1U C;  1M19 C;  5JRG B;  3AZK B;  3REK A;  5B32 G;  2IO5 B;  4WU8 B;  3O62 D;  3W98 B;  3AZE A;  3WA9 B;  3AZG B;  3AFA B;  3AZI D;  3AV2 A;  1ID3 A;  5AV9 A;  5GSU D;  4WU9 B;  3UTA A;  5B40 A;  1P3I D;  4KUD B;  5JA4 B;  4X23 A;  1HTA A;  5KDM B;  5CPK D;  4WNN A;  3WKJ C;  3W97 B;  3KWQ A;  3AZL C;  5GT3 B;  3UTB C;  5AVB A;  3LZ0 C;  5JRG D;  3R45 B;  4J8W C;  2BYK A;  5DNM C;  1ZLA A;  5GXQ B;  5GT0 B;  3W98 D;  3AFA D;  2LY8 A;  5B31 G;  1P3B A;  3MGR C;  2PYO B;  4H9S C;  5B2J A;  4DRA A;  3REH C;  1TZY A;  5AV8 A;  3AZM B;  3X1S C;  3W96 C;  3W97 D;  4M6B A;  3KXB B;  1P3F C;  1HQ3 C;  5GT3 D;  5E5A A;  3MGP C;  1F66 D;  5AV6 C;  5B1L A;  5CP6 D;  5DNN A;  5GT0 D; 
#chains in the Genus database with same CATH topology
 4KGC B;  3WAA A;  2PYO D;  5B1M B;  1P34 C;  2F8N A;  3AZM D;  4XUJ B;  3REI C;  5CPI D;  4XZQ A;  2ARO C;  3B6F B;  5B0Z B;  3LEL B;  2NZD A;  3KXB D;  3EPK A;  3B0B A;  3AZN D;  1S32 A;  3KUY B;  5B0Y B;  2CV5 A;  1KX5 B;  3REL B;  3NQJ A;  4JJN A;  4YS3 B;  3O62 A;  3AYW D;  3REK B;  4KGC D;  2ZY5 A;  5B1M D;  3AZE B;  2HIO C;  1P3I A;  3AV2 B;  2W8S A;  3MGQ A;  1A7W A;  3MNN B;  4XUJ D;  5CPK A;  3UTA B;  5B40 B;  5B32 D;  1M1A A;  4X23 B;  2FJ7 B;  5B31 B;  5B0Y D;  5FUG A;  3KWQ B;  1KX5 D;  4CAY B;  1P3K B;  4HGA C;  4Z2M H;  4YS3 D;  5AVB B;  3C1C B;  3X1T C;  3W98 A;  2BYK B;  3C1B A;  4ZBJ C;  4J8X C;  3AV2 D;  1P3B B;  3MNN D;  4YM6 B;  3UTA D;  4E45 A;  5B2J B;  3AV1 A;  3W97 A;  4X23 D;  1EQZ B;  3VH6 A;  2FJ7 D;  3V9R A;  5GT3 A;  4R8P D;  5B31 D;  4G92 C;  3UT9 C;  1F66 A;  3KWQ D;  5F99 C;  5E5A B;  5CP6 A;  1P3K D;  3W99 C;  3KSY A;  3C1C D;  3NQU A;  5GXQ A;  5B1L B;  2PYO A;  3A6N A;  1AOI B;  4YM6 D;  3WAA B;  3AL0 C;  5B33 A;  5CPI A;  4NE6 A;  5B2J D;  3WTP B;  1P3M D;  1P3P C;  1EQZ D;  2F8N B;  1Q9C A;  4XZQ B;  2NQB C;  3AZN A;  3AZI C;  1P3A C;  3F6T A;  3X1V A;  3B0D C;  5GSU C;  5E5A D;  4J8U A;  5AY8 C;  5B1L D;  2CV5 B;  3AYW A;  4JJN B;  3REJ C;  4KGC A;  3O62 B;  5BT1 D;  1AOI D;  3B6G D;  1B6W A;  5JRG C;  3AZK C;  3WTP D;  5B32 A;  2G5I C;  3MGQ B;  4WU8 C;  2F8N D;  5AV5 C;  3WA9 C;  3MVD C;  5DNM A;  3AFA C;  3AZG C;  1M1A B;  5B0Y A;  1KX5 A;  4WU9 C;  4KUD C;  5CPJ A;  4YS3 A;  4EO5 C;  2CV5 D;  4JJN D;  1WWI A;  1T3U A;  3W96 A;  3C1B B;  3MNN A;  3MGQ D;  3LZ1 B;  5GT0 C;  3P5J B;  2FJ7 A;  4R8P A;  3AV1 B;  5B31 A;  1M1A D;  3AZJ C;  3TU4 B;  4Z2M G;  3V9R B;  4CAY A;  1P3K A;  1P3O C;  1BFM A;  3C1C A;  1PZR A;  1F66 B;  3AZM C;  1KX4 C;  3H0M C;  5CP6 B;  4ZUX D;  1M18 A;  3NQU B;  3KXB C;  4H9Q A;  3C1B D;  1P3G B;  4QLC C;  4YM6 A;  4AWL B;  3MGS A;  4H9O A;  3A6N B;  1P3M A;  1KX3 B;  1KU5 A;  3LZ1 D;  1EQZ A;  5CHL B;  1TAF B;  3AZF D;  5B33 B;  5CPI B;  3AV1 D;  1BH8 A;  3AN2 D;  3X1U B;  3TU4 D;  3AZH D;  5B1M C;  5AVC D;  2BYM B;  2HUE B;  3AZN B;  4H9P A;  3X1V B;  3B6F C;  5B0Z C;  1JFI A;  4J8U B;  3LEL C;  5B24 D;  5G49 A;  3LJA D;  1U35 C;  4Z5T C;  3AYW B;  1P3G D;  1AOI A;  3KUY C;  3B6G A;  3A6N D;  3WTP A;  1P3L C;  3REL C;  5B2I D;  1KX3 D;  4LD9 A;  5B33 D;  3AZL B;  3REK C;  5B32 B;  3UTB B;  3X1U D;  3VH6 T;  3LZ0 B;  1M19 D;  4J8W B;  3AZE C;  5DNM B;  3AV2 C;  1ID3 C;  1N1J A;  5AV9 C;  3X1V D;  2Y2Q A;  4J8U D;  5B40 C;  3B0C W;  5CPJ B;  4X23 C;  3MGR B;  4UPK A;  2DQN C;  3KWQ C;  3W96 B;  3WKJ D;  5C3I B;  5AVB C;  5BS7 A;  3AZL D;  5F99 A;  3MGP B;  3UTB D;  3LZ0 D;  4Z66 A;  5AV6 B;  4J8V C;  1ZLA C;  4J8W D;  5BNV B;  5DNM D;  4H9N A;  4R8P B;  1P3B C;  5B2J C;  4ZUX A;  5CPJ D;  3MGR D;  1TZY C;  5AV8 C;  3REH D;  1M18 B;  1P34 B;  3X1S D;  3REI B;  4H9Q B;  3W96 D;  5E5A C;  4WV4 B;  3LZ1 A;  1HQ3 D;  3AZF A;  5B1L C;  3MGS B;  4H9O B;  3MGP D;  1P3M B;  5AV6 D;  5DNN C;  3AN2 A;  3TU4 A;  3AZH A;  5AVC A;  3REJ A;  1BH8 B;  3WAA C;  5B24 A;  4H9P B;  3LJA A;  4XZQ C;  2HIO B;  1JFI B;  1M18 D;  1P34 D;  1P3G A;  5AV5 A;  5G49 B;  2NZD C;  3REI D;  3A1I A;  1KX3 A;  2Y2I A;  1S32 C;  5B2I A;  1TAF A;  3B6G B;  2CV5 C;  3MGS D;  4LD9 B;  1M19 A;  3X1U A;  5BO0 A;  3O62 C;  2JCH A;  2BYM A;  3X1T B;  4DRB A;  2G5H C;  1BH9 A;  1P3I C;  3MGQ C;  1N1J B;  2VQR A;  5CPK C;  2HIO D;  1M1A C;  3WKJ A;  3AZL A;  4LD9 D;  4G92 B;  3UTB A;  2IO5 C;  3LZ0 A;  4J8W A;  4G91 B;  1KX4 A;  3W98 C;  5F99 B;  3C1B C;  4H9R B;  3W99 B;  4Z66 B;  3X1T D;  2Y2L A;  1H3O A;  4H9N B;  4E44 A;  3MGR A;  4NFT A;  2Y2G A;  4H9S A;  3AV1 C;  4ZUX B;  3REH A;  3W97 C;  3KFU G;  3X1S A;  3A1K A;  5GT3 C;  1P3P B;  1F66 C;  1P3F A;  1HQ3 A;  2F2A C;  2F8N H;  3MGP A;  5CP6 C;  3UT9 D;  5AV6 A;  5GXQ C;  5BNV A;  3B0D B;  5F99 D;  3AZF B;  3W99 D;  4Z66 D;  3AN2 B;  5AY8 B;  2PYO C;  3AZH B;  5AVC B;  3REJ B;  5B33 C;  5CPI C;  4KHA A;  4UUZ B;  1P34 A;  5B24 B;  3LJA B;  3REI A;  2ARO A;  1P3P D;  2HUE C;  3AZN C;  2Y2M A;  5AV5 B;  2Y2J A;  3X1V C;  3MVD B;  2NQB D;  4J8U C;  5B2I B;  2XD5 A;  4NE5 A;  1P3A D;  3AYW C;  1M19 B;  5AY8 D;  4KGC C;  5BO0 B;  4EO5 B;  3REJ D;  3VH5 A;  4XUJ C;  1BH9 B;  2HIO A;  3EG5 B;  5B32 C;  3AZK D;  2ZY3 A;  4WU8 D;  5AV5 D;  4J8V A;  5B0Y C;  5GT0 D;  2FFF B;  3WA9 D;  3MVD D;  3AZG D;  1KX5 C;  3EPH A;  3WKJ B;  1R4V A;  2RVQ D;  2JSS A;  2Y2P A;  5CPJ C;  5BNX A;  4YS3 C;  3AZJ B;  4WU9 D;  3VH5 W;  4KUD D;  1P3O B;  3X1T A;  1KX4 B;  4DQY B;  5C3I C;  3MNN C;  3UTA C;  2L5A A;  4J8X A;  1H3O B;  1F1E A;  4QLC B;  3EPJ A;  2FJ7 C;  4R8P C;  5B31 C;  3REH B;  1B67 A;  2YFV A;  3X1S B;  2RIQ A;  3UT9 A;  1P3K C;  3C1C C;  2ZM5 A;  3AZJ D;  1P3F B;  1HQ3 B;  1P3O D;  4H9R A;  3W99 A;  1M18 C;  1KX4 D;  4CSR A;  4YM6 C;  1U35 B;  4Z5T B;  3MGS C;  1P3M C;  4QLC D;  1EQZ C;  2YFW B;  1P3L B;  4KHA B;  2Y2O A;  1P3P A;  2F8N G;  2ARO B;  2NQB A;  3AZI A;  1P3A A;  1P3F D;  5GSU A;  4WZS B;  1ID3 B;  5AY8 A;  5AV9 B;  3B6F D;  5B0Z D;  5BT1 C;  1WWS A;  3LEL D;  1AOI C;  1U35 D;  3WTP E;  3B6G C;  4Z5T D;  4WNN B;  3WTP C;  4UUZ A;  4LD9 C;  3KUY D;  5JRG A;  2BG1 A;  3AZK A;  1P3L D;  3REL D;  4WU8 A;  2ARO D;  3WA9 A;  3MVD A;  3REK D;  3AFA A;  3AZG A;  1ZLA B;  2F8N K;  4J8V B;  3AZE D;  4WU9 A;  4KUD A;  5JA4 A;  1ID3 D;  4JJN C;  5BNX B;  5AV9 D;  5KDM A;  5B40 D;  3IP4 C;  4HGA B;  2Y2N A;  1TZY B;  2Y2H A;  5AV8 B;  5BS7 C;  2CWE A;  3R45 A;  4G91 C;  4ZBJ B;  4J8X B;  5AVB D;  4Z66 C;  5GT0 A;  1W2E A;  1ZLA D;  4J8V D;  5DNN B;  3AZJ A;  2YFV B;  2ZY2 A;  4WJ3 C;  1P3O A;  3VH6 W;  3UT9 B;  4ZUX C;  1P3B D;  3AZM A;  4NE3 A;  2XD1 A;  1TZY D;  5AV8 D;  3KXB A;  1ULY A;  4CSR B;  3VH5 T;  4QLC A;  3LZ1 C;  2NZD B;  2J8P A;  3AZF C;  4J8X D;  1S32 B;  3AN2 C;  3TU4 C;  3AZH C;  3NQJ B;  5AVC C;  5DNN D;  3B0C T;  3H0L C;  5B1M A;  2JE5 A;  2NQB B;  3AZI B;  1P3A B;  5B24 C;  3WAA D;  3LJA C;  4XUJ A;  5GSU B;  3B6F A;  5B0Z A;  1P3I B;  3LEL A;  1P3G C;  4AWL C;  1U35 A;  4XZQ D;  4Z5T A;  5CPK B;  3A6N C;  1KX3 C;  2RVQ C;  5B2I C;  3KUY A;  2NZD D;  2YFW A;  1P3L A;  3REL A;  1S32 D;  5FUG B;  3X1U C;  1M19 C;  5JRG B;  3AZK B;  3H0R C;  3REK A;  5B32 G;  2IO5 B;  4WU8 B;  3O62 D;  3W98 B;  3AZE A;  3WA9 B;  3AZG B;  3AFA B;  3AZI D;  3AV2 A;  1ID3 A;  5AV9 A;  2ZY4 A;  5GSU D;  4WU9 B;  3UTA A;  5B40 A;  1P3I D;  4KUD B;  5JA4 B;  4X23 A;  1HTA A;  5KDM B;  5CPK D;  4WNN A;  2UWX A;  3WKJ C;  3FDD A;  3W97 B;  3KWQ A;  3AZL C;  5GT3 B;  3UTB C;  5AVB A;  3LZ0 C;  5JRG D;  3R45 B;  4J8W C;  2BYK A;  2Y2K A;  5DNM C;  1ZLA A;  5GXQ B;  5GT0 B;  3W98 D;  3AFA D;  2LY8 A;  5B31 G;  3EPL A;  1P3B A;  3MGR C;  2PYO B;  4H9S C;  5B2J A;  4DRA A;  3REH C;  1TZY A;  5AV8 A;  3AZM B;  3X1S C;  3W96 C;  3W97 D;  4M6B A;  3KXB B;  1P3F C;  1HQ3 C;  1Z2C B;  5E5A A;  5GT3 D;  3MGP C;  1F66 D;  5AV6 C;  2DF4 C;  5B1L A;  5CP6 D;  5DNN A;  5GXQ D; 
#chains in the Genus database with same CATH homology
 4KGC B;  3WAA A;  2PYO D;  5B1M B;  1P34 C;  2F8N A;  3AZM D;  4XUJ B;  3REI C;  5CPI D;  4XZQ A;  2ARO C;  3B6F B;  5B0Z B;  3LEL B;  2NZD A;  3KXB D;  3EPK A;  3B0B A;  3AZN D;  1S32 A;  3KUY B;  5B0Y B;  2CV5 A;  1KX5 B;  3REL B;  3NQJ A;  4JJN A;  4YS3 B;  3O62 A;  3AYW D;  3REK B;  4KGC D;  2ZY5 A;  5B1M D;  3AZE B;  2HIO C;  1P3I A;  3AV2 B;  2W8S A;  3MGQ A;  1A7W A;  3MNN B;  4XUJ D;  5CPK A;  3UTA B;  5B40 B;  5B32 D;  1M1A A;  4X23 B;  2FJ7 B;  5B31 B;  5B0Y D;  5FUG A;  3KWQ B;  1KX5 D;  4CAY B;  1P3K B;  4HGA C;  4Z2M H;  4YS3 D;  5AVB B;  3C1C B;  3X1T C;  3W98 A;  2BYK B;  3C1B A;  4ZBJ C;  4J8X C;  3AV2 D;  1P3B B;  3MNN D;  4YM6 B;  3UTA D;  4E45 A;  5B2J B;  3AV1 A;  3W97 A;  4X23 D;  1EQZ B;  3VH6 A;  2FJ7 D;  3V9R A;  5GT3 A;  4R8P D;  5B31 D;  4G92 C;  3UT9 C;  1F66 A;  3KWQ D;  5F99 C;  5E5A B;  5CP6 A;  1P3K D;  3W99 C;  3KSY A;  3C1C D;  3NQU A;  5GXQ A;  5B1L B;  2PYO A;  3A6N A;  1AOI B;  4YM6 D;  3WAA B;  3AL0 C;  5B33 A;  5CPI A;  4NE6 A;  5B2J D;  3WTP B;  1P3M D;  1P3P C;  1EQZ D;  2F8N B;  1Q9C A;  4XZQ B;  2NQB C;  3AZN A;  3AZI C;  1P3A C;  3F6T A;  3X1V A;  3B0D C;  5GSU C;  5E5A D;  4J8U A;  5AY8 C;  5B1L D;  2CV5 B;  3AYW A;  4JJN B;  3REJ C;  4KGC A;  3O62 B;  5BT1 D;  1AOI D;  3B6G D;  1B6W A;  5JRG C;  3AZK C;  3WTP D;  5B32 A;  2G5I C;  3MGQ B;  4WU8 C;  2F8N D;  5AV5 C;  3WA9 C;  3MVD C;  5DNM A;  3AFA C;  3AZG C;  1M1A B;  5B0Y A;  1KX5 A;  4WU9 C;  4KUD C;  5CPJ A;  4YS3 A;  4EO5 C;  2CV5 D;  4JJN D;  1WWI A;  1T3U A;  3W96 A;  3C1B B;  3MNN A;  3MGQ D;  3LZ1 B;  5GT0 C;  3P5J B;  2FJ7 A;  4R8P A;  3AV1 B;  5B31 A;  1M1A D;  3AZJ C;  3TU4 B;  4Z2M G;  3V9R B;  4CAY A;  1P3K A;  1P3O C;  1BFM A;  3C1C A;  1PZR A;  1F66 B;  3AZM C;  1KX4 C;  3H0M C;  5CP6 B;  4ZUX D;  1M18 A;  3NQU B;  3KXB C;  4H9Q A;  3C1B D;  1P3G B;  4QLC C;  4YM6 A;  4AWL B;  3MGS A;  4H9O A;  3A6N B;  1P3M A;  1KX3 B;  1KU5 A;  3LZ1 D;  1EQZ A;  5CHL B;  1TAF B;  3AZF D;  5B33 B;  5CPI B;  3AV1 D;  1BH8 A;  3AN2 D;  3X1U B;  3TU4 D;  3AZH D;  5B1M C;  5AVC D;  2BYM B;  2HUE B;  3AZN B;  4H9P A;  3X1V B;  3B6F C;  5B0Z C;  1JFI A;  4J8U B;  3LEL C;  5B24 D;  5G49 A;  3LJA D;  1U35 C;  4Z5T C;  3AYW B;  1P3G D;  1AOI A;  3KUY C;  3B6G A;  3A6N D;  3WTP A;  1P3L C;  3REL C;  5B2I D;  1KX3 D;  4LD9 A;  5B33 D;  3AZL B;  3REK C;  5B32 B;  3UTB B;  3X1U D;  3VH6 T;  3LZ0 B;  1M19 D;  4J8W B;  3AZE C;  5DNM B;  3AV2 C;  1ID3 C;  1N1J A;  5AV9 C;  3X1V D;  2Y2Q A;  4J8U D;  5B40 C;  3B0C W;  5CPJ B;  4X23 C;  3MGR B;  4UPK A;  2DQN C;  3KWQ C;  3W96 B;  3WKJ D;  5C3I B;  5AVB C;  5BS7 A;  3AZL D;  5F99 A;  3MGP B;  3UTB D;  3LZ0 D;  4Z66 A;  5AV6 B;  4J8V C;  1ZLA C;  4J8W D;  5BNV B;  5DNM D;  4H9N A;  4R8P B;  1P3B C;  5B2J C;  4ZUX A;  5CPJ D;  3MGR D;  1TZY C;  5AV8 C;  3REH D;  1M18 B;  1P34 B;  3X1S D;  3REI B;  4H9Q B;  3W96 D;  5E5A C;  4WV4 B;  3LZ1 A;  1HQ3 D;  3AZF A;  5B1L C;  3MGS B;  4H9O B;  3MGP D;  1P3M B;  5AV6 D;  5DNN C;  3AN2 A;  3TU4 A;  3AZH A;  5AVC A;  3REJ A;  1BH8 B;  3WAA C;  5B24 A;  4H9P B;  3LJA A;  4XZQ C;  2HIO B;  1JFI B;  1M18 D;  1P34 D;  1P3G A;  5AV5 A;  5G49 B;  2NZD C;  3REI D;  3A1I A;  1KX3 A;  2Y2I A;  1S32 C;  5B2I A;  1TAF A;  3B6G B;  2CV5 C;  3MGS D;  4LD9 B;  1M19 A;  3X1U A;  5BO0 A;  3O62 C;  2JCH A;  2BYM A;  3X1T B;  4DRB A;  2G5H C;  1BH9 A;  1P3I C;  3MGQ C;  1N1J B;  2VQR A;  5CPK C;  2HIO D;  1M1A C;  3WKJ A;  3AZL A;  4LD9 D;  4G92 B;  3UTB A;  2IO5 C;  3LZ0 A;  4J8W A;  4G91 B;  1KX4 A;  3W98 C;  5F99 B;  3C1B C;  4H9R B;  3W99 B;  4Z66 B;  3X1T D;  2Y2L A;  1H3O A;  4H9N B;  4E44 A;  3MGR A;  4NFT A;  2Y2G A;  4H9S A;  3AV1 C;  4ZUX B;  3REH A;  3W97 C;  3KFU G;  3X1S A;  3A1K A;  5GT3 C;  1P3P B;  1F66 C;  1P3F A;  1HQ3 A;  2F2A C;  2F8N H;  3MGP A;  5CP6 C;  3UT9 D;  5AV6 A;  5GXQ C;  5BNV A;  3B0D B;  5F99 D;  3AZF B;  3W99 D;  4Z66 D;  3AN2 B;  5AY8 B;  2PYO C;  3AZH B;  5AVC B;  3REJ B;  5B33 C;  5CPI C;  4KHA A;  4UUZ B;  1P34 A;  5B24 B;  3LJA B;  3REI A;  2ARO A;  1P3P D;  2HUE C;  3AZN C;  2Y2M A;  5AV5 B;  2Y2J A;  3X1V C;  3MVD B;  2NQB D;  4J8U C;  5B2I B;  2XD5 A;  4NE5 A;  1P3A D;  3AYW C;  1M19 B;  5AY8 D;  4KGC C;  5BO0 B;  4EO5 B;  3REJ D;  3VH5 A;  4XUJ C;  1BH9 B;  2HIO A;  3EG5 B;  5B32 C;  3AZK D;  2ZY3 A;  4WU8 D;  5AV5 D;  4J8V A;  5B0Y C;  5GT0 D;  2FFF B;  3WA9 D;  3MVD D;  3AZG D;  1KX5 C;  3EPH A;  3WKJ B;  1R4V A;  2RVQ D;  2JSS A;  2Y2P A;  5CPJ C;  5BNX A;  4YS3 C;  3AZJ B;  4WU9 D;  3VH5 W;  4KUD D;  1P3O B;  3X1T A;  1KX4 B;  4DQY B;  5C3I C;  3MNN C;  3UTA C;  2L5A A;  4J8X A;  1H3O B;  1F1E A;  4QLC B;  3EPJ A;  2FJ7 C;  4R8P C;  5B31 C;  3REH B;  1B67 A;  2YFV A;  3X1S B;  2RIQ A;  3UT9 A;  1P3K C;  3C1C C;  2ZM5 A;  3AZJ D;  1P3F B;  1HQ3 B;  1P3O D;  4H9R A;  3W99 A;  1M18 C;  1KX4 D;  4CSR A;  4YM6 C;  1U35 B;  4Z5T B;  3MGS C;  1P3M C;  4QLC D;  1EQZ C;  2YFW B;  1P3L B;  4KHA B;  2Y2O A;  1P3P A;  2F8N G;  2ARO B;  2NQB A;  3AZI A;  1P3A A;  1P3F D;  5GSU A;  4WZS B;  1ID3 B;  5AY8 A;  5AV9 B;  3B6F D;  5B0Z D;  5BT1 C;  1WWS A;  3LEL D;  1AOI C;  1U35 D;  3WTP E;  3B6G C;  4Z5T D;  4WNN B;  3WTP C;  4UUZ A;  4LD9 C;  3KUY D;  5JRG A;  2BG1 A;  3AZK A;  1P3L D;  3REL D;  4WU8 A;  2ARO D;  3WA9 A;  3MVD A;  3REK D;  3AFA A;  3AZG A;  1ZLA B;  2F8N K;  4J8V B;  3AZE D;  4WU9 A;  4KUD A;  5JA4 A;  1ID3 D;  4JJN C;  5BNX B;  5AV9 D;  5KDM A;  5B40 D;  3IP4 C;  4HGA B;  2Y2N A;  1TZY B;  2Y2H A;  5AV8 B;  5BS7 C;  2CWE A;  3R45 A;  4G91 C;  4ZBJ B;  4J8X B;  5AVB D;  4Z66 C;  5GT0 A;  1W2E A;  1ZLA D;  4J8V D;  5DNN B;  3AZJ A;  2YFV B;  2ZY2 A;  4WJ3 C;  1P3O A;  3VH6 W;  3UT9 B;  4ZUX C;  1P3B D;  3AZM A;  4NE3 A;  2XD1 A;  1TZY D;  5AV8 D;  3KXB A;  1ULY A;  4CSR B;  3VH5 T;  4QLC A;  3LZ1 C;  2NZD B;  2J8P A;  3AZF C;  4J8X D;  1S32 B;  3AN2 C;  3TU4 C;  3AZH C;  3NQJ B;  5AVC C;  5DNN D;  3B0C T;  3H0L C;  5B1M A;  2JE5 A;  2NQB B;  3AZI B;  1P3A B;  5B24 C;  3WAA D;  3LJA C;  4XUJ A;  5GSU B;  3B6F A;  5B0Z A;  1P3I B;  3LEL A;  1P3G C;  4AWL C;  1U35 A;  4XZQ D;  4Z5T A;  5CPK B;  3A6N C;  1KX3 C;  2RVQ C;  5B2I C;  3KUY A;  2NZD D;  2YFW A;  1P3L A;  3REL A;  1S32 D;  5FUG B;  3X1U C;  1M19 C;  5JRG B;  3AZK B;  3H0R C;  3REK A;  5B32 G;  2IO5 B;  4WU8 B;  3O62 D;  3W98 B;  3AZE A;  3WA9 B;  3AZG B;  3AFA B;  3AZI D;  3AV2 A;  1ID3 A;  5AV9 A;  2ZY4 A;  5GSU D;  4WU9 B;  3UTA A;  5B40 A;  1P3I D;  4KUD B;  5JA4 B;  4X23 A;  1HTA A;  5KDM B;  5CPK D;  4WNN A;  2UWX A;  3WKJ C;  3FDD A;  3W97 B;  3KWQ A;  3AZL C;  5GT3 B;  3UTB C;  5AVB A;  3LZ0 C;  5JRG D;  3R45 B;  4J8W C;  2BYK A;  2Y2K A;  5DNM C;  1ZLA A;  5GXQ B;  5GT0 B;  3W98 D;  3AFA D;  2LY8 A;  5B31 G;  3EPL A;  1P3B A;  3MGR C;  2PYO B;  4H9S C;  5B2J A;  4DRA A;  3REH C;  1TZY A;  5AV8 A;  3AZM B;  3X1S C;  3W96 C;  3W97 D;  4M6B A;  3KXB B;  1P3F C;  1HQ3 C;  1Z2C B;  5E5A A;  5GT3 D;  3MGP C;  1F66 D;  5AV6 C;  2DF4 C;  5B1L A;  5CP6 D;  5DNN A;  5GXQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...