4Z66D

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
94
structure length
94
Chain Sequence
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 37
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4z66D00
3MGQD 1Q9CA 5AV8D 3TU4C 3C1CD 3WTPA 3AZFB 4H9NB 3B6GC 3X1TD 4JJND 4WU9A 5GXQB 1ZLAC 3AZHB 3UTAC 1M18B 5AVCB 4R8PA 3AZLB 1P3PB 3KWQB 1ID3A 3UT9C 3W99C 1AOID 5GT3B 3C1BA 3AZMB 3MVDB 1M1AB 2FJ7A 5DNNA 5BT1D 4WU8B 5KDMB 1P3AC 4X23C 3KUYA 4QLCA 3C1BD 1KX3A 5DNND 3LELB 5BNVB 5JRGD 3REIC 4EO5C 5CP6B 3AZGB 3V9RA 1P3KA 3AYWB 1KX4C 1EQZC 4XUJC 5B1MC 3X1SC 1P3FC 3VH5W 1B67A 3KXBB 3AZFA 1KX3D 1S32B 4H9NA 3AZIB 3LJAC 3WA9C 5B40B 3W98C 2AROC 5GXQA 2PYOC 4G92C 1M18A 4ZBJB 5AVCA 3WAAD 3B6GB 1WWIA 4YS3B 5B32C 1P3BD 1ZLAB 3A6ND 5BS7C 1P3MB 5GT3A 2CV5D 1M1AA 4WU8A 1N1JB 3W99B 5CPKA 5KDMA 3AZNA 3RELD 5B33A 3AV1B 5B24C 5B1LD 1U35B 5BNVA 2NQBD 5CP6A 3AZGA 1HQ3B 4J8XB 4NE5A 5CPKD 4XZQB 5B33D 3AZKB 2NZDD 4Z5TC 4H9OB 3KXBA 1ID3C 3REIB 3X1UC 3LZ1D 1S32A 4XUJB 3AZIA 5B1MB 5CPID 2BYMA 3TU4A 3REJB 5FUGB 4DRAA 3WKJB 3B6GA 3KUYC 4YS3A 4E45A 5BO0A 5B32G 5AVBB 2AROB 2RVQC 3AFAB 1ZLAA 1P3MA 5B0ZB 3TU4D 3AV2C 5B32B 2F8NG 4YM6B 3UT9A 1N1JA 3W99A 1TAFB 4Z66B 4CAYA 2F8NB 3AZFC 3W96C 3UTAD 3AZHC 2LY8A 3B0DC 4CSRB 3UT9D 1M18C 1HQ3A 3AZLC 1P3LB 1BH9A 3REHB 4H9OA 1P3PC 3KWQC 4ZUXB 3REIA 1EQZA 1KX4A 4AWLB 3WTPE 1TZYD 3MVDC 4XUJA 3AZMC 5B1MA 4X23D 3X1SA 1P3AD 1P3FA 1M1AC 5BNXB 4KGCB 4G91B 3REJA 2IO5B 3X1UB 5CPJC 4KHAB 1EQZD 1KX4D 4DRBA 2AROA 3AFAA 3NQUB 5DNMD 2PYOA 3X1SD 1P3FD 1KU5A 3LELC 4HGAB 5B0ZA 4J8VD 5CP6C 5B32A 1P3GC 3AYWC 1HTAA 3AZEB 3LJAD 3WA9D 1F66B 1TAFA 2YFVB 3W98D 2PYOD 1S32C 1P3IB 3AZIC 5B40C 3AN2D 1KX5D 4CSRA 4ZBJC 3W96B 4KUDC 4YS3C 5B24A 3VH6T 3B0DB 2HIOC 3LZ0B 5B2IB 1P3MC 3WTPD 2L5AA 4Z5TA 3NQJB 1WWSA 5BNXA 1P3OB 5B24D 1R4VA 4WU9D 3X1UA 5AV6B 4KHAA 4M6BA 3AV1C 3W97B 4R8PD 3NQUA 5CPJB 4Z5TD 5AV9C 1U35C 3MNNC 1ID3D 1HQ3C 4J8XC 4XZQC 3AZKC 2FJ7D 3AZEA 2BYKB 2YFVA 3AV2A 1P3GB 5B0YB 5E5AB 3KUYD 4QLCD 4J8WB 3REJC 4WNNB 3W96A 3WKJC 5G49B 3O62B 4H9SC 4H9QB 5AY8B 3AV2D 1P3KD 5AVBC 5AV5C 3AFAC 3AZHA 5B2IA 5B0ZC 4UUZB 4KUDB 3AZLA 3UTBC 3AZFD 3MGPB 1H3OB 4YM6C 1P3PA 3KWQA 1P3OA 2HIOB 3B0BA 3MGRB 3AZMA 4Z66C 3MVDA 5GXQD 3AZJC 3AZHD 3B6FB 3MGSB 1M18D 3W97A 5AVCD 3AZLD 5CPJA 1P3PD 3KWQD 5F99B 4H9PB 3X1VB 5GT3D 3AZMD 3MVDD 1P3LC 1M1AD 3VH6A 2BYKA 3LELA 3REHC 5AV9B 3MNNB 4ZUXC 4WU8D 4H9RB 1M19B 1P3GA 4AWLC 3AYWA 3AZND 5JA4B 5CHLB 3C1CC 4KGCC 4G91C 5B31G 2IO5C 2F8NK 4WNNA 3LELD 4Z2MH 5G49A 3O62A 5CP6D 5GT0B 5B40A 3AZGD 3R45B 3AYWD 5B31B 4HGAC 4UUZA 3KXBD 4KUDA 5GSUB 1H3OA 1S32D 5AV5B 3AZID 3AZEC 2HIOA 5B40D 1F66C 4J8UB 3UTBB 3B6FA 4LD9B 5B2JB 1P3IC 1P34B 3B6GD 4YS3D 3AZJB 1ZLAD 3REKB 4H9PA 3AV1A 1P3MD 5JRGC 5AV9A 1U35A 3MNNA 3W99D 3LZ0C 5B2IC 4J8XA 4XZQA 3AZKA 1P3OC 5AV6C 3MGQB 1U35D 3AN2B 5AV8B 1HQ3D 3R45A 5B31A 3C1CB 4XZQD 4J8XD 3W97C 5FUGA 3WAAC 3AZKD 3X1TB 3WKJA 4JJNB 3REID 4H9SA 1P3BC 5AVBA 5AV5A 4XUJD 3B0CT 5B1MD 1A7WA 2JSSA 3UTBA 3REJD 4YM6A 5B0YC 5E5AC 1JFIB 1AOIB 3WKJD 3RELC 5AVBD 2AROD 4Z66A 3AFAD 4J8WC 3AZJA 3REKA 2F8NA 5B0ZD 3O62C 5B1LC 5AY8C 5B32D 4YM6D 2NQBC 4WV4B 3C1BB 2NZDC 4Z66D 1P3LA 2F8ND 5DNNB 3MGPC 3REHA 5JRGB 4ZUXA 3MGRC 3MGQA 3B6FC 5CPIC 4QLCB 3MGSC 5AV8A 3C1CA 4KGCA 1P3LD 1KX3B 3REHD 1P3KB 4ZUXD 5F99C 3X1VC 3WAAB 1M19C 4KGCD 3X1UD 1P3BB 1AOIA 1JFIA 3A6NB 2CV5B 1F66A 2HUEB 1P3IA 3VH5A 5GT0C 1BH8B 3RELB 5B31C 2RVQD 3AZED 1F66D 5B1LB 5GSUC 2YFWB 5JRGA 2NQBB 1P3ID 5CPKB 3LZ0A 1TZYC 3AZNB 5B33B 2NZDB 4J8UC 4LD9C 5B2JC 3NQJA 1P34C 3W96D 3LZ1B 5AV6A 5C3IB 3REKC 5CPIB 3LZ0D 5B2ID 4Z2MG 5DNMC 3WAAA 4NE3A 4J8VC 1P3OD 4NFTA 1P3BA 5AV6D 3A6NA 2BYMB 2CV5A 3TU4B 3W97D 3B0CW 5CPJD 3MGQC 5B0YA 5E5AA 3AN2C 5BO0B 1KX5C 1BH8A 5AV8C 3RELA 4J8WA 3UTAB 3X1TC 4JJNC 4H9QA 5B1LA 5AY8A 1P3GD 2YFWA 2NQBA 3UT9B 5B0YD 5E5AD 4CAYB 3WTPC 4J8WD 2NZDA 3MGPA 1AOIC 3O62D 4WU9C 3LZ1A 1TZYB 5AY8D 3VH6W 3MGRA 1P3AB 4X23B 5BT1C 3MGSA 5CPIA 4R8PC 4KUDD 1BH9B 1ULYA 3MGPD 4EO5B 1EQZB 5F99A 1KX4B 2HIOD 3C1BC 3X1VA 3MGRD 5DNMB 2FJ7C 3X1SB 5DNNC 1P3FB 3B6FD 3MGSD 4J8VB 1M19A 4H9RA 5JA4A 3LJAB 4QLCC 3WA9B 5F99D 3AV1D 3X1VD 3W98B 2PYOB 1KX3C 4G92B 3UTAA 2CWEA 5AV9D 3MNND 1P3KC 1B6WA 3VH5T 1M19D 5GT0A 1KX5B 1F1EA 5GSUA 3A6NC 5GT0D 1TZYA 2CV5C 5GXQC 1P3AA 5B31D 4X23A 2HUEC 3WTPB 4J8UA 3KSYA 5AVCC 5B2JA 4LD9A 1P34A 5B24B 4WU9B 4WZSB 5GSUD 5AV5D 2F8NH 5GT3C 4R8PB 5DNMA 4J8UD 3UTBD 4Z5TB 4J8VA 5B2JD 4WU8C 1ID3B 4E44A 1P34D 4LD9D 5CPKC 3AZNC 1BFMA 5B33C 2FJ7B 3AZJD 3LJAA 3WA9A 3REKD 4NE6A 3W98A 3LZ1C 5C3IC 3KUYB 3AZGC 3AN2A 1KX5A 5BS7A 3KXBC 3X1TA 4JJNA 3AV2B 3V9RB
chains in the Genus database with same CATH superfamily
3MGQD 1Q9CA 5AV8D 3TU4C 3C1CD 3WTPA 3AZFB 2XD5A 4H9NB 3B6GC 3X1TD 4JJND 4WU9A 5GXQB 1ZLAC 3AZHB 3UTAC 1M18B 5AVCB 4R8PA 3AZLB 1P3PB 3KWQB 1ID3A 3UT9C 3W99C 1AOID 5GT3B 3C1BA 3AZMB 3MVDB 1M1AB 2FJ7A 5DNNA 5BT1D 4WU8B 5KDMB 1P3AC 1T3UA 4X23C 3KUYA 4QLCA 3EPKA 3C1BD 1KX3A 5DNND 3LELB 5BNVB 5JRGD 3REIC 4EO5C 5CP6B 3AZGB 3V9RA 1P3KA 3AYWB 1KX4C 1EQZC 4XUJC 5B1MC 3X1SC 1P3FC 3VH5W 1B67A 3KXBB 3AZFA 1KX3D 1S32B 4H9NA 3AZIB 2G5HC 3LJAC 3WA9C 5B40B 3W98C 2AROC 5GXQA 2PYOC 4G92C 1M18A 4ZBJB 5AVCA 3WAAD 3B6GB 1WWIA 4YS3B 5B32C 1P3BD 1ZLAB 3A6ND 5BS7C 1P3MB 5GT3A 2CV5D 1M1AA 4WU8A 1N1JB 3W99B 1W2EA 5CPKA 5KDMA 3AZNA 3RELD 5B33A 3AV1B 5B24C 5B1LD 1U35B 5BNVA 2NQBD 5CP6A 3AZGA 1HQ3B 4J8XB 3A1KA 4NE5A 4XZQB 5CPKD 5B33D 3AZKB 2NZDD 4Z5TC 4H9OB 3KXBA 1ID3C 3REIB 3X1UC 3LZ1D 1S32A 4XUJB 3AZIA 5B1MB 5CPID 2BYMA 2Y2QA 3TU4A 2ZM5A 3REJB 5FUGB 3H0LC 2W8SA 4DRAA 3WKJB 3B6GA 3KUYC 4YS3A 4E45A 5BO0A 5B32G 5AVBB 2AROB 2RVQC 3AFAB 1ZLAA 1P3MA 5B0ZB 3TU4D 3AV2C 5B32B 2F8NG 4YM6B 3UT9A 1N1JA 3W99A 1TAFB 4Z66B 4CAYA 2F8NB 3AZFC 3W96C 3UTAD 3AZHC 2LY8A 3B0DC 4CSRB 3UT9D 1M18C 1HQ3A 3AZLC 1P3LB 1BH9A 3REHB 4H9OA 1P3PC 3KWQC 2JE5A 4ZUXB 3REIA 1EQZA 1KX4A 4AWLB 3WTPE 1TZYD 3MVDC 4XUJA 3AZMC 5B1MA 4X23D 3X1SA 1P3AD 1P3FA 1M1AC 5BNXB 4KGCB 4G91B 3REJA 2IO5B 3X1UB 5CPJC 4KHAB 1EQZD 1KX4D 4DRBA 2AROA 3AFAA 3NQUB 5DNMD 2PYOA 3X1SD 1P3FD 1KU5A 3LELC 4HGAB 5B0ZA 4J8VD 5CP6C 5B32A 1P3GC 3AYWC 2Y2HA 1HTAA 3A1IA 3AZEB 3LJAD 3WA9D 1F66B 1TAFA 2YFVB 3W98D 4UPKA 2PYOD 1S32C 1P3IB 3AZIC 2Y2LA 5B40C 3AN2D 1KX5D 4CSRA 4ZBJC 3W96B 4KUDC 4YS3C 5B24A 3VH6T 3EPJA 3B0DB 2HIOC 3LZ0B 5B2IB 1P3MC 3WTPD 2L5AA 4Z5TA 3NQJB 3P5JB 1WWSA 5BNXA 1P3OB 5B24D 1R4VA 4WU9D 3X1UA 5AV6B 4KHAA 4M6BA 3AV1C 3W97B 4R8PD 3NQUA 5CPJB 4Z5TD 5AV9C 1U35C 3MNNC 1ID3D 1HQ3C 4J8XC 4XZQC 2DQNC 3AZKC 2FJ7D 3AZEA 3AL0C 2BYKB 2YFVA 3AV2A 1P3GB 5B0YB 5E5AB 3KUYD 4QLCD 3H0MC 4J8WB 2F2AC 3REJC 3H0RC 4WNNB 3W96A 3WKJC 5G49B 3O62B 4H9SC 4H9QB 5AY8B 3AV2D 1P3KD 5AVBC 5AV5C 3AFAC 3AZHA 5B2IA 5B0ZC 4UUZB 4KUDB 3AZLA 3UTBC 3AZFD 3MGPB 1H3OB 4YM6C 1P3PA 3KWQA 1P3OA 2HIOB 3B0BA 3MGRB 3AZMA 4Z66C 3MVDA 5GXQD 3AZJC 3AZHD 3B6FB 3MGSB 1M18D 3W97A 5AVCD 3AZLD 5CPJA 1P3PD 3KWQD 3EPHA 5F99B 4H9PB 3X1VB 3EPLA 5GT3D 3AZMD 3MVDD 1P3LC 1M1AD 3VH6A 2BYKA 3LELA 3REHC 5AV9B 3MNNB 4ZUXC 4WU8D 4H9RB 1M19B 1P3GA 4AWLC 3AYWA 3AZND 2FFFB 5JA4B 5CHLB 3C1CC 4KGCC 4G91C 5B31G 2IO5C 2F8NK 4WNNA 3LELD 4Z2MH 5G49A 3O62A 2G5IC 5CP6D 5GT0B 5B40A 2DF4C 3AZGD 3R45B 3AYWD 5B31B 4HGAC 3KFUG 4UUZA 3KXBD 4KUDA 5GSUB 1H3OA 1S32D 5AV5B 3AZID 3AZEC 2HIOA 5B40D 1F66C 4J8UB 3UTBB 3B6FA 4LD9B 5B2JB 1P3IC 1P34B 3B6GD 4YS3D 3AZJB 1ZLAD 3REKB 4H9PA 3AV1A 1P3MD 5JRGC 5AV9A 1U35A 3MNNA 3W99D 3LZ0C 5B2IC 4J8XA 4XZQA 3AZKA 1P3OC 5AV6C 3MGQB 1Z2CB 1U35D 3AN2B 5AV8B 1HQ3D 3R45A 5B31A 3C1CB 4XZQD 4J8XD 3W97C 5FUGA 3WAAC 3AZKD 2J8PA 3X1TB 3WKJA 4JJNB 3REID 4H9SA 1P3BC 5AVBA 5AV5A 4XUJD 3B0CT 5B1MD 1A7WA 2JSSA 3UTBA 3REJD 4YM6A 5B0YC 5E5AC 1JFIB 1AOIB 3WKJD 3RELC 5AVBD 2AROD 4Z66A 3AFAD 4J8WC 3AZJA 3REKA 2F8NA 5B0ZD 3O62C 5B1LC 5AY8C 5B32D 4YM6D 2NQBC 3F6TA 4WV4B 3C1BB 2NZDC 4Z66D 1P3LA 2F8ND 5DNNB 3MGPC 3REHA 5JRGB 4ZUXA 3MGRC 3MGQA 3B6FC 5CPIC 4QLCB 2Y2PA 3MGSC 5AV8A 3C1CA 4KGCA 1P3LD 1KX3B 3REHD 1P3KB 4ZUXD 5F99C 3X1VC 3WAAB 1M19C 2BG1A 4KGCD 3X1UD 1P3BB 1AOIA 1JFIA 3A6NB 2CV5B 1F66A 2HUEB 2Y2GA 1P3IA 3VH5A 5GT0C 1BH8B 3RELB 5B31C 2RVQD 2Y2NA 3AZED 1F66D 5B1LB 5GSUC 2YFWB 5JRGA 2NQBB 1P3ID 5CPKB 3LZ0A 1TZYC 3AZNB 5B33B 2NZDB 4J8UC 4LD9C 5B2JC 3NQJA 1P34C 3W96D 3LZ1B 5AV6A 5C3IB 4WJ3C 2RIQA 3REKC 5CPIB 3LZ0D 5B2ID 4Z2MG 5DNMC 3WAAA 4NE3A 4J8VC 1P3OD 4NFTA 1P3BA 5AV6D 3A6NA 2BYMB 2CV5A 3TU4B 3W97D 3B0CW 5CPJD 3MGQC 5B0YA 5E5AA 3AN2C 5BO0B 1KX5C 1BH8A 5AV8C 3RELA 4J8WA 3EG5B 3UTAB 3X1TC 4JJNC 4H9QA 5B1LA 5AY8A 2UWXA 1P3GD 2YFWA 2NQBA 3UT9B 5B0YD 5E5AD 2XD1A 4CAYB 3WTPC 4J8WD 2NZDA 3MGPA 1AOIC 3O62D 4WU9C 3LZ1A 1TZYB 5AY8D 3VH6W 3MGRA 1P3AB 4X23B 5BT1C 3MGSA 5CPIA 4R8PC 4KUDD 1BH9B 1ULYA 3MGPD 4EO5B 1EQZB 5F99A 1KX4B 2HIOD 3C1BC 3X1VA 3MGRD 5DNMB 2FJ7C 3X1SB 5DNNC 1P3FB 3B6FD 3MGSD 4J8VB 1M19A 4H9RA 2Y2JA 5JA4A 3LJAB 4QLCC 3WA9B 5F99D 3AV1D 3X1VD 3W98B 2Y2KA 2PYOB 1KX3C 4G92B 3UTAA 2CWEA 5AV9D 2JCHA 3MNND 1P3KC 1B6WA 3VH5T 2ZY2A 3FDDA 5GT0A 1M19D 1KX5B 1F1EA 5GSUA 3A6NC 2ZY4A 5GT0D 1TZYA 2CV5C 5GXQC 1P3AA 5B31D 4X23A 2HUEC 3WTPB 4J8UA 3KSYA 5AVCC 5B2JA 4LD9A 1P34A 5B24B 4WU9B 4WZSB 5GSUD 5AV5D 2F8NH 5GT3C 4R8PB 5DNMA 4J8UD 2VQRA 3UTBD 4Z5TB 4J8VA 5B2JD 2ZY5A 4WU8C 4E44A 1P34D 1ID3B 4LD9D 5CPKC 3AZNC 1PZRA 1BFMA 4DQYB 5B33C 2FJ7B 3AZJD 2ZY3A 3LJAA 3WA9A 3REKD 4NE6A 3W98A 3IP4C 3LZ1C 2Y2IA 5C3IC 3KUYB 3AZGC 3AN2A 1KX5A 2Y2MA 2Y2OA 5BS7A 3KXBC 3X1TA 4JJNA 3AV2B 3V9RB
chains in the Genus database with same CATH topology
3MGQD 1Q9CA 5AV8D 3TU4C 3C1CD 3WTPA 3AZFB 2XD5A 4H9NB 3B6GC 3X1TD 4JJND 4WU9A 5GXQB 1ZLAC 3AZHB 3UTAC 1M18B 5AVCB 4R8PA 3AZLB 1P3PB 3KWQB 1ID3A 3UT9C 3W99C 1AOID 5GT3B 3C1BA 3AZMB 3MVDB 1M1AB 2FJ7A 5DNNA 5BT1D 4WU8B 5KDMB 1P3AC 1T3UA 4X23C 3KUYA 4QLCA 3EPKA 3C1BD 1KX3A 5DNND 3LELB 5BNVB 5JRGD 3REIC 4EO5C 5CP6B 3AZGB 3V9RA 1P3KA 3AYWB 1KX4C 1EQZC 4XUJC 5B1MC 3X1SC 1P3FC 3VH5W 1B67A 3KXBB 3AZFA 1KX3D 1S32B 4H9NA 3AZIB 2G5HC 3LJAC 3WA9C 5B40B 3W98C 2AROC 5GXQA 2PYOC 4G92C 1M18A 4ZBJB 5AVCA 3WAAD 3B6GB 1WWIA 4YS3B 5B32C 1P3BD 1ZLAB 3A6ND 5BS7C 1P3MB 5GT3A 2CV5D 1M1AA 4WU8A 1N1JB 3W99B 1W2EA 5CPKA 5KDMA 3AZNA 3RELD 5B33A 3AV1B 5B24C 5B1LD 1U35B 5BNVA 2NQBD 5CP6A 3AZGA 1HQ3B 4J8XB 3A1KA 4NE5A 4XZQB 5CPKD 5B33D 3AZKB 2NZDD 4Z5TC 4H9OB 3KXBA 1ID3C 3REIB 3X1UC 3LZ1D 1S32A 4XUJB 3AZIA 5B1MB 5CPID 2BYMA 2Y2QA 3TU4A 2ZM5A 3REJB 5FUGB 3H0LC 2W8SA 4DRAA 3WKJB 3B6GA 3KUYC 4YS3A 4E45A 5BO0A 5B32G 5AVBB 2AROB 2RVQC 3AFAB 1ZLAA 1P3MA 5B0ZB 3TU4D 3AV2C 5B32B 2F8NG 4YM6B 3UT9A 1N1JA 3W99A 1TAFB 4Z66B 4CAYA 2F8NB 3AZFC 3W96C 3UTAD 3AZHC 2LY8A 3B0DC 4CSRB 3UT9D 1M18C 1HQ3A 3AZLC 1P3LB 1BH9A 3REHB 4H9OA 1P3PC 3KWQC 2JE5A 4ZUXB 3REIA 1EQZA 1KX4A 4AWLB 3WTPE 1TZYD 3MVDC 4XUJA 3AZMC 5B1MA 4X23D 3X1SA 1P3AD 1P3FA 1M1AC 5BNXB 4KGCB 4G91B 3REJA 2IO5B 3X1UB 5CPJC 4KHAB 1EQZD 1KX4D 4DRBA 2AROA 3AFAA 3NQUB 5DNMD 2PYOA 3X1SD 1P3FD 1KU5A 3LELC 4HGAB 5B0ZA 4J8VD 5CP6C 5B32A 1P3GC 3AYWC 2Y2HA 1HTAA 3A1IA 3AZEB 3LJAD 3WA9D 1F66B 1TAFA 2YFVB 3W98D 4UPKA 2PYOD 1S32C 1P3IB 3AZIC 2Y2LA 5B40C 3AN2D 1KX5D 4CSRA 4ZBJC 3W96B 4KUDC 4YS3C 5B24A 3VH6T 3EPJA 3B0DB 2HIOC 3LZ0B 5B2IB 1P3MC 3WTPD 2L5AA 4Z5TA 3NQJB 3P5JB 1WWSA 5BNXA 1P3OB 5B24D 1R4VA 4WU9D 3X1UA 5AV6B 4KHAA 4M6BA 3AV1C 3W97B 4R8PD 3NQUA 5CPJB 4Z5TD 5AV9C 1U35C 3MNNC 1ID3D 1HQ3C 4J8XC 4XZQC 2DQNC 3AZKC 2FJ7D 3AZEA 3AL0C 2BYKB 2YFVA 3AV2A 1P3GB 5B0YB 5E5AB 3KUYD 4QLCD 3H0MC 4J8WB 2F2AC 3REJC 3H0RC 4WNNB 3W96A 3WKJC 5G49B 3O62B 4H9SC 4H9QB 5AY8B 3AV2D 1P3KD 5AVBC 5AV5C 3AFAC 3AZHA 5B2IA 5B0ZC 4UUZB 4KUDB 3AZLA 3UTBC 3AZFD 3MGPB 1H3OB 4YM6C 1P3PA 3KWQA 1P3OA 2HIOB 3B0BA 3MGRB 3AZMA 4Z66C 3MVDA 5GXQD 3AZJC 3AZHD 3B6FB 3MGSB 1M18D 3W97A 5AVCD 3AZLD 5CPJA 1P3PD 3KWQD 3EPHA 5F99B 4H9PB 3X1VB 3EPLA 5GT3D 3AZMD 3MVDD 1P3LC 1M1AD 3VH6A 2BYKA 3LELA 3REHC 5AV9B 3MNNB 4ZUXC 4WU8D 4H9RB 1M19B 1P3GA 4AWLC 3AYWA 3AZND 2FFFB 5JA4B 5CHLB 3C1CC 4KGCC 4G91C 5B31G 2IO5C 2F8NK 4WNNA 3LELD 4Z2MH 5G49A 3O62A 2G5IC 5CP6D 5GT0B 5B40A 2DF4C 3AZGD 3R45B 3AYWD 5B31B 4HGAC 3KFUG 4UUZA 3KXBD 4KUDA 5GSUB 1H3OA 1S32D 5AV5B 3AZID 3AZEC 2HIOA 5B40D 1F66C 4J8UB 3UTBB 3B6FA 4LD9B 5B2JB 1P3IC 1P34B 3B6GD 4YS3D 3AZJB 1ZLAD 3REKB 4H9PA 3AV1A 1P3MD 5JRGC 5AV9A 1U35A 3MNNA 3W99D 3LZ0C 5B2IC 4J8XA 4XZQA 3AZKA 1P3OC 5AV6C 3MGQB 1Z2CB 1U35D 3AN2B 5AV8B 1HQ3D 3R45A 5B31A 3C1CB 4XZQD 4J8XD 3W97C 5FUGA 3WAAC 3AZKD 2J8PA 3X1TB 3WKJA 4JJNB 3REID 4H9SA 1P3BC 5AVBA 5AV5A 4XUJD 3B0CT 5B1MD 1A7WA 2JSSA 3UTBA 3REJD 4YM6A 5B0YC 5E5AC 1JFIB 1AOIB 3WKJD 3RELC 5AVBD 2AROD 4Z66A 3AFAD 4J8WC 3AZJA 3REKA 2F8NA 5B0ZD 3O62C 5B1LC 5AY8C 5B32D 4YM6D 2NQBC 3F6TA 4WV4B 3C1BB 2NZDC 4Z66D 1P3LA 2F8ND 5DNNB 3MGPC 3REHA 5JRGB 4ZUXA 3MGRC 3MGQA 3B6FC 5CPIC 4QLCB 2Y2PA 3MGSC 5AV8A 3C1CA 4KGCA 1P3LD 1KX3B 3REHD 1P3KB 4ZUXD 5F99C 3X1VC 3WAAB 1M19C 2BG1A 4KGCD 3X1UD 1P3BB 1AOIA 1JFIA 3A6NB 2CV5B 1F66A 2HUEB 2Y2GA 1P3IA 3VH5A 5GT0C 1BH8B 3RELB 5B31C 2RVQD 2Y2NA 3AZED 1F66D 5B1LB 5GSUC 2YFWB 5JRGA 2NQBB 1P3ID 5CPKB 3LZ0A 1TZYC 3AZNB 5B33B 2NZDB 4J8UC 4LD9C 5B2JC 3NQJA 1P34C 3W96D 3LZ1B 5AV6A 5C3IB 4WJ3C 2RIQA 3REKC 5CPIB 3LZ0D 5B2ID 4Z2MG 5DNMC 3WAAA 4NE3A 4J8VC 1P3OD 4NFTA 1P3BA 5AV6D 3A6NA 2BYMB 2CV5A 3TU4B 3W97D 3B0CW 5CPJD 3MGQC 5B0YA 5E5AA 3AN2C 5BO0B 1KX5C 1BH8A 5AV8C 3RELA 4J8WA 3EG5B 3UTAB 3X1TC 4JJNC 4H9QA 5B1LA 5AY8A 2UWXA 1P3GD 2YFWA 2NQBA 3UT9B 5B0YD 5E5AD 2XD1A 4CAYB 3WTPC 4J8WD 2NZDA 3MGPA 1AOIC 3O62D 4WU9C 3LZ1A 1TZYB 5AY8D 3VH6W 3MGRA 1P3AB 4X23B 5BT1C 3MGSA 5CPIA 4R8PC 4KUDD 1BH9B 1ULYA 3MGPD 4EO5B 1EQZB 5F99A 1KX4B 2HIOD 3C1BC 3X1VA 3MGRD 5DNMB 2FJ7C 3X1SB 5DNNC 1P3FB 3B6FD 3MGSD 4J8VB 1M19A 4H9RA 2Y2JA 5JA4A 3LJAB 4QLCC 3WA9B 5F99D 3AV1D 3X1VD 3W98B 2Y2KA 2PYOB 1KX3C 4G92B 3UTAA 2CWEA 5AV9D 2JCHA 3MNND 1P3KC 1B6WA 3VH5T 2ZY2A 3FDDA 5GT0A 1M19D 1KX5B 1F1EA 5GSUA 3A6NC 2ZY4A 5GT0D 1TZYA 2CV5C 5GXQC 1P3AA 5B31D 4X23A 2HUEC 3WTPB 4J8UA 3KSYA 5AVCC 5B2JA 4LD9A 1P34A 5B24B 4WU9B 4WZSB 5GSUD 5AV5D 2F8NH 5GT3C 4R8PB 5DNMA 4J8UD 2VQRA 3UTBD 4Z5TB 4J8VA 5B2JD 2ZY5A 4WU8C 4E44A 1P34D 1ID3B 4LD9D 5CPKC 3AZNC 1PZRA 1BFMA 4DQYB 5B33C 2FJ7B 3AZJD 2ZY3A 3LJAA 3WA9A 3REKD 4NE6A 3W98A 3IP4C 3LZ1C 2Y2IA 5C3IC 3KUYB 3AZGC 3AN2A 1KX5A 2Y2MA 2Y2OA 5BS7A 3KXBC 3X1TA 4JJNA 3AV2B 3V9RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGQ D;  1Q9C A;  5AV8 D;  3TU4 C;  3C1C D;  3WTP A;  3AZF B;  4H9N B;  3B6G C;  3X1T D;  4JJN D;  4WU9 A;  5GXQ B;  1ZLA C;  3AZH B;  3UTA C;  1M18 B;  5AVC B;  4R8P A;  3AZL B;  1P3P B;  3KWQ B;  1ID3 A;  3UT9 C;  3W99 C;  1AOI D;  5GT3 B;  3C1B A;  3AZM B;  3MVD B;  1M1A B;  2FJ7 A;  5DNN A;  5BT1 D;  4WU8 B;  5KDM B;  1P3A C;  4X23 C;  3KUY A;  4QLC A;  3C1B D;  1KX3 A;  5DNN D;  3LEL B;  5BNV B;  5JRG D;  3REI C;  4EO5 C;  5CP6 B;  3AZG B;  3V9R A;  1P3K A;  3AYW B;  1KX4 C;  1EQZ C;  4XUJ C;  5B1M C;  3X1S C;  1P3F C;  3VH5 W;  1B67 A;  3KXB B;  3AZF A;  1KX3 D;  1S32 B;  4H9N A;  3AZI B;  3LJA C;  3WA9 C;  5B40 B;  3W98 C;  2ARO C;  5GXQ A;  2PYO C;  4G92 C;  1M18 A;  4ZBJ B;  5AVC A;  3WAA D;  3B6G B;  1WWI A;  4YS3 B;  5B32 C;  1P3B D;  1ZLA B;  3A6N D;  5BS7 C;  1P3M B;  5GT3 A;  2CV5 D;  1M1A A;  4WU8 A;  1N1J B;  3W99 B;  5CPK A;  5KDM A;  3AZN A;  3REL D;  5B33 A;  3AV1 B;  5B24 C;  5B1L D;  1U35 B;  5BNV A;  2NQB D;  5CP6 A;  3AZG A;  1HQ3 B;  4J8X B;  4NE5 A;  5CPK D;  4XZQ B;  5B33 D;  3AZK B;  2NZD D;  4Z5T C;  4H9O B;  3KXB A;  1ID3 C;  3REI B;  3X1U C;  3LZ1 D;  1S32 A;  4XUJ B;  3AZI A;  5B1M B;  5CPI D;  2BYM A;  3TU4 A;  3REJ B;  5FUG B;  4DRA A;  3WKJ B;  3B6G A;  3KUY C;  4YS3 A;  4E45 A;  5BO0 A;  5B32 G;  5AVB B;  2ARO B;  2RVQ C;  3AFA B;  1ZLA A;  1P3M A;  5B0Z B;  3TU4 D;  3AV2 C;  5B32 B;  2F8N G;  4YM6 B;  3UT9 A;  1N1J A;  3W99 A;  1TAF B;  4Z66 B;  4CAY A;  2F8N B;  3AZF C;  3W96 C;  3UTA D;  3AZH C;  2LY8 A;  3B0D C;  4CSR B;  3UT9 D;  1M18 C;  1HQ3 A;  3AZL C;  1P3L B;  1BH9 A;  3REH B;  4H9O A;  1P3P C;  3KWQ C;  4ZUX B;  3REI A;  1EQZ A;  1KX4 A;  4AWL B;  3WTP E;  1TZY D;  3MVD C;  4XUJ A;  3AZM C;  5B1M A;  4X23 D;  3X1S A;  1P3A D;  1P3F A;  1M1A C;  5BNX B;  4KGC B;  4G91 B;  3REJ A;  2IO5 B;  3X1U B;  5CPJ C;  4KHA B;  1EQZ D;  1KX4 D;  4DRB A;  2ARO A;  3AFA A;  3NQU B;  5DNM D;  2PYO A;  3X1S D;  1P3F D;  1KU5 A;  3LEL C;  4HGA B;  5B0Z A;  4J8V D;  5CP6 C;  5B32 A;  1P3G C;  3AYW C;  1HTA A;  3AZE B;  3LJA D;  3WA9 D;  1F66 B;  1TAF A;  2YFV B;  3W98 D;  2PYO D;  1S32 C;  1P3I B;  3AZI C;  5B40 C;  3AN2 D;  1KX5 D;  4CSR A;  4ZBJ C;  3W96 B;  4KUD C;  4YS3 C;  5B24 A;  3VH6 T;  3B0D B;  2HIO C;  3LZ0 B;  5B2I B;  1P3M C;  3WTP D;  2L5A A;  4Z5T A;  3NQJ B;  1WWS A;  5BNX A;  1P3O B;  5B24 D;  1R4V A;  4WU9 D;  3X1U A;  5AV6 B;  4KHA A;  4M6B A;  3AV1 C;  3W97 B;  4R8P D;  3NQU A;  5CPJ B;  4Z5T D;  5AV9 C;  1U35 C;  3MNN C;  1ID3 D;  1HQ3 C;  4J8X C;  4XZQ C;  3AZK C;  2FJ7 D;  3AZE A;  2BYK B;  2YFV A;  3AV2 A;  1P3G B;  5B0Y B;  5E5A B;  3KUY D;  4QLC D;  4J8W B;  3REJ C;  4WNN B;  3W96 A;  3WKJ C;  5G49 B;  3O62 B;  4H9S C;  4H9Q B;  5AY8 B;  3AV2 D;  1P3K D;  5AVB C;  5AV5 C;  3AFA C;  3AZH A;  5B2I A;  5B0Z C;  4UUZ B;  4KUD B;  3AZL A;  3UTB C;  3AZF D;  3MGP B;  1H3O B;  4YM6 C;  1P3P A;  3KWQ A;  1P3O A;  2HIO B;  3B0B A;  3MGR B;  3AZM A;  4Z66 C;  3MVD A;  5GXQ D;  3AZJ C;  3AZH D;  3B6F B;  3MGS B;  1M18 D;  3W97 A;  5AVC D;  3AZL D;  5CPJ A;  1P3P D;  3KWQ D;  5F99 B;  4H9P B;  3X1V B;  5GT3 D;  3AZM D;  3MVD D;  1P3L C;  1M1A D;  3VH6 A;  2BYK A;  3LEL A;  3REH C;  5AV9 B;  3MNN B;  4ZUX C;  4WU8 D;  4H9R B;  1M19 B;  1P3G A;  4AWL C;  3AYW A;  3AZN D;  5JA4 B;  5CHL B;  3C1C C;  4KGC C;  4G91 C;  5B31 G;  2IO5 C;  2F8N K;  4WNN A;  3LEL D;  4Z2M H;  5G49 A;  3O62 A;  5CP6 D;  5GT0 B;  5B40 A;  3AZG D;  3R45 B;  3AYW D;  5B31 B;  4HGA C;  4UUZ A;  3KXB D;  4KUD A;  5GSU B;  1H3O A;  1S32 D;  5AV5 B;  3AZI D;  3AZE C;  2HIO A;  5B40 D;  1F66 C;  4J8U B;  3UTB B;  3B6F A;  4LD9 B;  5B2J B;  1P3I C;  1P34 B;  3B6G D;  4YS3 D;  3AZJ B;  1ZLA D;  3REK B;  4H9P A;  3AV1 A;  1P3M D;  5JRG C;  5AV9 A;  1U35 A;  3MNN A;  3W99 D;  3LZ0 C;  5B2I C;  4J8X A;  4XZQ A;  3AZK A;  1P3O C;  5AV6 C;  3MGQ B;  1U35 D;  3AN2 B;  5AV8 B;  1HQ3 D;  3R45 A;  5B31 A;  3C1C B;  4XZQ D;  4J8X D;  3W97 C;  5FUG A;  3WAA C;  3AZK D;  3X1T B;  3WKJ A;  4JJN B;  3REI D;  4H9S A;  1P3B C;  5AVB A;  5AV5 A;  4XUJ D;  3B0C T;  5B1M D;  1A7W A;  2JSS A;  3UTB A;  3REJ D;  4YM6 A;  5B0Y C;  5E5A C;  1JFI B;  1AOI B;  3WKJ D;  3REL C;  5AVB D;  2ARO D;  4Z66 A;  3AFA D;  4J8W C;  3AZJ A;  3REK A;  2F8N A;  5B0Z D;  3O62 C;  5B1L C;  5AY8 C;  5B32 D;  4YM6 D;  2NQB C;  4WV4 B;  3C1B B;  2NZD C;  4Z66 D;  1P3L A;  2F8N D;  5DNN B;  3MGP C;  3REH A;  5JRG B;  4ZUX A;  3MGR C;  3MGQ A;  3B6F C;  5CPI C;  4QLC B;  3MGS C;  5AV8 A;  3C1C A;  4KGC A;  1P3L D;  1KX3 B;  3REH D;  1P3K B;  4ZUX D;  5F99 C;  3X1V C;  3WAA B;  1M19 C;  4KGC D;  3X1U D;  1P3B B;  1AOI A;  1JFI A;  3A6N B;  2CV5 B;  1F66 A;  2HUE B;  1P3I A;  3VH5 A;  5GT0 C;  1BH8 B;  3REL B;  5B31 C;  2RVQ D;  3AZE D;  1F66 D;  5B1L B;  5GSU C;  2YFW B;  5JRG A;  2NQB B;  1P3I D;  5CPK B;  3LZ0 A;  1TZY C;  3AZN B;  5B33 B;  2NZD B;  4J8U C;  4LD9 C;  5B2J C;  3NQJ A;  1P34 C;  3W96 D;  3LZ1 B;  5AV6 A;  5C3I B;  3REK C;  5CPI B;  3LZ0 D;  5B2I D;  4Z2M G;  5DNM C;  3WAA A;  4NE3 A;  4J8V C;  1P3O D;  4NFT A;  1P3B A;  5AV6 D;  3A6N A;  2BYM B;  2CV5 A;  3TU4 B;  3W97 D;  3B0C W;  5CPJ D;  3MGQ C;  5B0Y A;  5E5A A;  3AN2 C;  5BO0 B;  1KX5 C;  1BH8 A;  5AV8 C;  3REL A;  4J8W A;  3UTA B;  3X1T C;  4JJN C;  4H9Q A;  5B1L A;  5AY8 A;  1P3G D;  2YFW A;  2NQB A;  3UT9 B;  5B0Y D;  5E5A D;  4CAY B;  3WTP C;  4J8W D;  2NZD A;  3MGP A;  1AOI C;  3O62 D;  4WU9 C;  3LZ1 A;  1TZY B;  5AY8 D;  3VH6 W;  3MGR A;  1P3A B;  4X23 B;  5BT1 C;  3MGS A;  5CPI A;  4R8P C;  4KUD D;  1BH9 B;  1ULY A;  3MGP D;  4EO5 B;  1EQZ B;  5F99 A;  1KX4 B;  2HIO D;  3C1B C;  3X1V A;  3MGR D;  5DNM B;  2FJ7 C;  3X1S B;  5DNN C;  1P3F B;  3B6F D;  3MGS D;  4J8V B;  1M19 A;  4H9R A;  5JA4 A;  3LJA B;  4QLC C;  3WA9 B;  5F99 D;  3AV1 D;  3X1V D;  3W98 B;  2PYO B;  1KX3 C;  4G92 B;  3UTA A;  2CWE A;  5AV9 D;  3MNN D;  1P3K C;  1B6W A;  3VH5 T;  1M19 D;  5GT0 A;  1KX5 B;  1F1E A;  5GSU A;  3A6N C;  5GT0 D;  1TZY A;  2CV5 C;  5GXQ C;  1P3A A;  5B31 D;  4X23 A;  2HUE C;  3WTP B;  4J8U A;  3KSY A;  5AVC C;  5B2J A;  4LD9 A;  1P34 A;  5B24 B;  4WU9 B;  4WZS B;  5GSU D;  5AV5 D;  2F8N H;  5GT3 C;  4R8P B;  5DNM A;  4J8U D;  3UTB D;  4Z5T B;  4J8V A;  5B2J D;  4WU8 C;  1ID3 B;  4E44 A;  1P34 D;  4LD9 D;  5CPK C;  3AZN C;  1BFM A;  5B33 C;  2FJ7 B;  3AZJ D;  3LJA A;  3WA9 A;  3REK D;  4NE6 A;  3W98 A;  3LZ1 C;  5C3I C;  3KUY B;  3AZG C;  3AN2 A;  1KX5 A;  5BS7 A;  3KXB C;  3X1T A;  4JJN A;  3AV2 B;  3V9R B; 
#chains in the Genus database with same CATH topology
 3MGQ D;  1Q9C A;  5AV8 D;  3TU4 C;  3C1C D;  3WTP A;  3AZF B;  2XD5 A;  4H9N B;  3B6G C;  3X1T D;  4JJN D;  4WU9 A;  5GXQ B;  1ZLA C;  3AZH B;  3UTA C;  1M18 B;  5AVC B;  4R8P A;  3AZL B;  1P3P B;  3KWQ B;  1ID3 A;  3UT9 C;  3W99 C;  1AOI D;  5GT3 B;  3C1B A;  3AZM B;  3MVD B;  1M1A B;  2FJ7 A;  5DNN A;  5BT1 D;  4WU8 B;  5KDM B;  1P3A C;  1T3U A;  4X23 C;  3KUY A;  4QLC A;  3EPK A;  3C1B D;  1KX3 A;  5DNN D;  3LEL B;  5BNV B;  5JRG D;  3REI C;  4EO5 C;  5CP6 B;  3AZG B;  3V9R A;  1P3K A;  3AYW B;  1KX4 C;  1EQZ C;  4XUJ C;  5B1M C;  3X1S C;  1P3F C;  3VH5 W;  1B67 A;  3KXB B;  3AZF A;  1KX3 D;  1S32 B;  4H9N A;  3AZI B;  2G5H C;  3LJA C;  3WA9 C;  5B40 B;  3W98 C;  2ARO C;  5GXQ A;  2PYO C;  4G92 C;  1M18 A;  4ZBJ B;  5AVC A;  3WAA D;  3B6G B;  1WWI A;  4YS3 B;  5B32 C;  1P3B D;  1ZLA B;  3A6N D;  5BS7 C;  1P3M B;  5GT3 A;  2CV5 D;  1M1A A;  4WU8 A;  1N1J B;  3W99 B;  1W2E A;  5CPK A;  5KDM A;  3AZN A;  3REL D;  5B33 A;  3AV1 B;  5B24 C;  5B1L D;  1U35 B;  5BNV A;  2NQB D;  5CP6 A;  3AZG A;  1HQ3 B;  4J8X B;  3A1K A;  4NE5 A;  4XZQ B;  5CPK D;  5B33 D;  3AZK B;  2NZD D;  4Z5T C;  4H9O B;  3KXB A;  1ID3 C;  3REI B;  3X1U C;  3LZ1 D;  1S32 A;  4XUJ B;  3AZI A;  5B1M B;  5CPI D;  2BYM A;  2Y2Q A;  3TU4 A;  2ZM5 A;  3REJ B;  5FUG B;  3H0L C;  2W8S A;  4DRA A;  3WKJ B;  3B6G A;  3KUY C;  4YS3 A;  4E45 A;  5BO0 A;  5B32 G;  5AVB B;  2ARO B;  2RVQ C;  3AFA B;  1ZLA A;  1P3M A;  5B0Z B;  3TU4 D;  3AV2 C;  5B32 B;  2F8N G;  4YM6 B;  3UT9 A;  1N1J A;  3W99 A;  1TAF B;  4Z66 B;  4CAY A;  2F8N B;  3AZF C;  3W96 C;  3UTA D;  3AZH C;  2LY8 A;  3B0D C;  4CSR B;  3UT9 D;  1M18 C;  1HQ3 A;  3AZL C;  1P3L B;  1BH9 A;  3REH B;  4H9O A;  1P3P C;  3KWQ C;  2JE5 A;  4ZUX B;  3REI A;  1EQZ A;  1KX4 A;  4AWL B;  3WTP E;  1TZY D;  3MVD C;  4XUJ A;  3AZM C;  5B1M A;  4X23 D;  3X1S A;  1P3A D;  1P3F A;  1M1A C;  5BNX B;  4KGC B;  4G91 B;  3REJ A;  2IO5 B;  3X1U B;  5CPJ C;  4KHA B;  1EQZ D;  1KX4 D;  4DRB A;  2ARO A;  3AFA A;  3NQU B;  5DNM D;  2PYO A;  3X1S D;  1P3F D;  1KU5 A;  3LEL C;  4HGA B;  5B0Z A;  4J8V D;  5CP6 C;  5B32 A;  1P3G C;  3AYW C;  2Y2H A;  1HTA A;  3A1I A;  3AZE B;  3LJA D;  3WA9 D;  1F66 B;  1TAF A;  2YFV B;  3W98 D;  4UPK A;  2PYO D;  1S32 C;  1P3I B;  3AZI C;  2Y2L A;  5B40 C;  3AN2 D;  1KX5 D;  4CSR A;  4ZBJ C;  3W96 B;  4KUD C;  4YS3 C;  5B24 A;  3VH6 T;  3EPJ A;  3B0D B;  2HIO C;  3LZ0 B;  5B2I B;  1P3M C;  3WTP D;  2L5A A;  4Z5T A;  3NQJ B;  3P5J B;  1WWS A;  5BNX A;  1P3O B;  5B24 D;  1R4V A;  4WU9 D;  3X1U A;  5AV6 B;  4KHA A;  4M6B A;  3AV1 C;  3W97 B;  4R8P D;  3NQU A;  5CPJ B;  4Z5T D;  5AV9 C;  1U35 C;  3MNN C;  1ID3 D;  1HQ3 C;  4J8X C;  4XZQ C;  2DQN C;  3AZK C;  2FJ7 D;  3AZE A;  3AL0 C;  2BYK B;  2YFV A;  3AV2 A;  1P3G B;  5B0Y B;  5E5A B;  3KUY D;  4QLC D;  3H0M C;  4J8W B;  2F2A C;  3REJ C;  3H0R C;  4WNN B;  3W96 A;  3WKJ C;  5G49 B;  3O62 B;  4H9S C;  4H9Q B;  5AY8 B;  3AV2 D;  1P3K D;  5AVB C;  5AV5 C;  3AFA C;  3AZH A;  5B2I A;  5B0Z C;  4UUZ B;  4KUD B;  3AZL A;  3UTB C;  3AZF D;  3MGP B;  1H3O B;  4YM6 C;  1P3P A;  3KWQ A;  1P3O A;  2HIO B;  3B0B A;  3MGR B;  3AZM A;  4Z66 C;  3MVD A;  5GXQ D;  3AZJ C;  3AZH D;  3B6F B;  3MGS B;  1M18 D;  3W97 A;  5AVC D;  3AZL D;  5CPJ A;  1P3P D;  3KWQ D;  3EPH A;  5F99 B;  4H9P B;  3X1V B;  3EPL A;  5GT3 D;  3AZM D;  3MVD D;  1P3L C;  1M1A D;  3VH6 A;  2BYK A;  3LEL A;  3REH C;  5AV9 B;  3MNN B;  4ZUX C;  4WU8 D;  4H9R B;  1M19 B;  1P3G A;  4AWL C;  3AYW A;  3AZN D;  2FFF B;  5JA4 B;  5CHL B;  3C1C C;  4KGC C;  4G91 C;  5B31 G;  2IO5 C;  2F8N K;  4WNN A;  3LEL D;  4Z2M H;  5G49 A;  3O62 A;  2G5I C;  5CP6 D;  5GT0 B;  5B40 A;  2DF4 C;  3AZG D;  3R45 B;  3AYW D;  5B31 B;  4HGA C;  3KFU G;  4UUZ A;  3KXB D;  4KUD A;  5GSU B;  1H3O A;  1S32 D;  5AV5 B;  3AZI D;  3AZE C;  2HIO A;  5B40 D;  1F66 C;  4J8U B;  3UTB B;  3B6F A;  4LD9 B;  5B2J B;  1P3I C;  1P34 B;  3B6G D;  4YS3 D;  3AZJ B;  1ZLA D;  3REK B;  4H9P A;  3AV1 A;  1P3M D;  5JRG C;  5AV9 A;  1U35 A;  3MNN A;  3W99 D;  3LZ0 C;  5B2I C;  4J8X A;  4XZQ A;  3AZK A;  1P3O C;  5AV6 C;  3MGQ B;  1Z2C B;  1U35 D;  3AN2 B;  5AV8 B;  1HQ3 D;  3R45 A;  5B31 A;  3C1C B;  4XZQ D;  4J8X D;  3W97 C;  5FUG A;  3WAA C;  3AZK D;  2J8P A;  3X1T B;  3WKJ A;  4JJN B;  3REI D;  4H9S A;  1P3B C;  5AVB A;  5AV5 A;  4XUJ D;  3B0C T;  5B1M D;  1A7W A;  2JSS A;  3UTB A;  3REJ D;  4YM6 A;  5B0Y C;  5E5A C;  1JFI B;  1AOI B;  3WKJ D;  3REL C;  5AVB D;  2ARO D;  4Z66 A;  3AFA D;  4J8W C;  3AZJ A;  3REK A;  2F8N A;  5B0Z D;  3O62 C;  5B1L C;  5AY8 C;  5B32 D;  4YM6 D;  2NQB C;  3F6T A;  4WV4 B;  3C1B B;  2NZD C;  4Z66 D;  1P3L A;  2F8N D;  5DNN B;  3MGP C;  3REH A;  5JRG B;  4ZUX A;  3MGR C;  3MGQ A;  3B6F C;  5CPI C;  4QLC B;  2Y2P A;  3MGS C;  5AV8 A;  3C1C A;  4KGC A;  1P3L D;  1KX3 B;  3REH D;  1P3K B;  4ZUX D;  5F99 C;  3X1V C;  3WAA B;  1M19 C;  2BG1 A;  4KGC D;  3X1U D;  1P3B B;  1AOI A;  1JFI A;  3A6N B;  2CV5 B;  1F66 A;  2HUE B;  2Y2G A;  1P3I A;  3VH5 A;  5GT0 C;  1BH8 B;  3REL B;  5B31 C;  2RVQ D;  2Y2N A;  3AZE D;  1F66 D;  5B1L B;  5GSU C;  2YFW B;  5JRG A;  2NQB B;  1P3I D;  5CPK B;  3LZ0 A;  1TZY C;  3AZN B;  5B33 B;  2NZD B;  4J8U C;  4LD9 C;  5B2J C;  3NQJ A;  1P34 C;  3W96 D;  3LZ1 B;  5AV6 A;  5C3I B;  4WJ3 C;  2RIQ A;  3REK C;  5CPI B;  3LZ0 D;  5B2I D;  4Z2M G;  5DNM C;  3WAA A;  4NE3 A;  4J8V C;  1P3O D;  4NFT A;  1P3B A;  5AV6 D;  3A6N A;  2BYM B;  2CV5 A;  3TU4 B;  3W97 D;  3B0C W;  5CPJ D;  3MGQ C;  5B0Y A;  5E5A A;  3AN2 C;  5BO0 B;  1KX5 C;  1BH8 A;  5AV8 C;  3REL A;  4J8W A;  3EG5 B;  3UTA B;  3X1T C;  4JJN C;  4H9Q A;  5B1L A;  5AY8 A;  2UWX A;  1P3G D;  2YFW A;  2NQB A;  3UT9 B;  5B0Y D;  5E5A D;  2XD1 A;  4CAY B;  3WTP C;  4J8W D;  2NZD A;  3MGP A;  1AOI C;  3O62 D;  4WU9 C;  3LZ1 A;  1TZY B;  5AY8 D;  3VH6 W;  3MGR A;  1P3A B;  4X23 B;  5BT1 C;  3MGS A;  5CPI A;  4R8P C;  4KUD D;  1BH9 B;  1ULY A;  3MGP D;  4EO5 B;  1EQZ B;  5F99 A;  1KX4 B;  2HIO D;  3C1B C;  3X1V A;  3MGR D;  5DNM B;  2FJ7 C;  3X1S B;  5DNN C;  1P3F B;  3B6F D;  3MGS D;  4J8V B;  1M19 A;  4H9R A;  2Y2J A;  5JA4 A;  3LJA B;  4QLC C;  3WA9 B;  5F99 D;  3AV1 D;  3X1V D;  3W98 B;  2Y2K A;  2PYO B;  1KX3 C;  4G92 B;  3UTA A;  2CWE A;  5AV9 D;  2JCH A;  3MNN D;  1P3K C;  1B6W A;  3VH5 T;  2ZY2 A;  3FDD A;  5GT0 A;  1M19 D;  1KX5 B;  1F1E A;  5GSU A;  3A6N C;  2ZY4 A;  5GT0 D;  1TZY A;  2CV5 C;  5GXQ C;  1P3A A;  5B31 D;  4X23 A;  2HUE C;  3WTP B;  4J8U A;  3KSY A;  5AVC C;  5B2J A;  4LD9 A;  1P34 A;  5B24 B;  4WU9 B;  4WZS B;  5GSU D;  5AV5 D;  2F8N H;  5GT3 C;  4R8P B;  5DNM A;  4J8U D;  2VQR A;  3UTB D;  4Z5T B;  4J8V A;  5B2J D;  2ZY5 A;  4WU8 C;  4E44 A;  1P34 D;  1ID3 B;  4LD9 D;  5CPK C;  3AZN C;  1PZR A;  1BFM A;  4DQY B;  5B33 C;  2FJ7 B;  3AZJ D;  2ZY3 A;  3LJA A;  3WA9 A;  3REK D;  4NE6 A;  3W98 A;  3IP4 C;  3LZ1 C;  2Y2I A;  5C3I C;  3KUY B;  3AZG C;  3AN2 A;  1KX5 A;  2Y2M A;  2Y2O A;  5BS7 A;  3KXB C;  3X1T A;  4JJN A;  3AV2 B;  3V9R B; 
#chains in the Genus database with same CATH homology
 3MGQ D;  1Q9C A;  5AV8 D;  3TU4 C;  3C1C D;  3WTP A;  3AZF B;  2XD5 A;  4H9N B;  3B6G C;  3X1T D;  4JJN D;  4WU9 A;  5GXQ B;  1ZLA C;  3AZH B;  3UTA C;  1M18 B;  5AVC B;  4R8P A;  3AZL B;  1P3P B;  3KWQ B;  1ID3 A;  3UT9 C;  3W99 C;  1AOI D;  5GT3 B;  3C1B A;  3AZM B;  3MVD B;  1M1A B;  2FJ7 A;  5DNN A;  5BT1 D;  4WU8 B;  5KDM B;  1P3A C;  1T3U A;  4X23 C;  3KUY A;  4QLC A;  3EPK A;  3C1B D;  1KX3 A;  5DNN D;  3LEL B;  5BNV B;  5JRG D;  3REI C;  4EO5 C;  5CP6 B;  3AZG B;  3V9R A;  1P3K A;  3AYW B;  1KX4 C;  1EQZ C;  4XUJ C;  5B1M C;  3X1S C;  1P3F C;  3VH5 W;  1B67 A;  3KXB B;  3AZF A;  1KX3 D;  1S32 B;  4H9N A;  3AZI B;  2G5H C;  3LJA C;  3WA9 C;  5B40 B;  3W98 C;  2ARO C;  5GXQ A;  2PYO C;  4G92 C;  1M18 A;  4ZBJ B;  5AVC A;  3WAA D;  3B6G B;  1WWI A;  4YS3 B;  5B32 C;  1P3B D;  1ZLA B;  3A6N D;  5BS7 C;  1P3M B;  5GT3 A;  2CV5 D;  1M1A A;  4WU8 A;  1N1J B;  3W99 B;  1W2E A;  5CPK A;  5KDM A;  3AZN A;  3REL D;  5B33 A;  3AV1 B;  5B24 C;  5B1L D;  1U35 B;  5BNV A;  2NQB D;  5CP6 A;  3AZG A;  1HQ3 B;  4J8X B;  3A1K A;  4NE5 A;  4XZQ B;  5CPK D;  5B33 D;  3AZK B;  2NZD D;  4Z5T C;  4H9O B;  3KXB A;  1ID3 C;  3REI B;  3X1U C;  3LZ1 D;  1S32 A;  4XUJ B;  3AZI A;  5B1M B;  5CPI D;  2BYM A;  2Y2Q A;  3TU4 A;  2ZM5 A;  3REJ B;  5FUG B;  3H0L C;  2W8S A;  4DRA A;  3WKJ B;  3B6G A;  3KUY C;  4YS3 A;  4E45 A;  5BO0 A;  5B32 G;  5AVB B;  2ARO B;  2RVQ C;  3AFA B;  1ZLA A;  1P3M A;  5B0Z B;  3TU4 D;  3AV2 C;  5B32 B;  2F8N G;  4YM6 B;  3UT9 A;  1N1J A;  3W99 A;  1TAF B;  4Z66 B;  4CAY A;  2F8N B;  3AZF C;  3W96 C;  3UTA D;  3AZH C;  2LY8 A;  3B0D C;  4CSR B;  3UT9 D;  1M18 C;  1HQ3 A;  3AZL C;  1P3L B;  1BH9 A;  3REH B;  4H9O A;  1P3P C;  3KWQ C;  2JE5 A;  4ZUX B;  3REI A;  1EQZ A;  1KX4 A;  4AWL B;  3WTP E;  1TZY D;  3MVD C;  4XUJ A;  3AZM C;  5B1M A;  4X23 D;  3X1S A;  1P3A D;  1P3F A;  1M1A C;  5BNX B;  4KGC B;  4G91 B;  3REJ A;  2IO5 B;  3X1U B;  5CPJ C;  4KHA B;  1EQZ D;  1KX4 D;  4DRB A;  2ARO A;  3AFA A;  3NQU B;  5DNM D;  2PYO A;  3X1S D;  1P3F D;  1KU5 A;  3LEL C;  4HGA B;  5B0Z A;  4J8V D;  5CP6 C;  5B32 A;  1P3G C;  3AYW C;  2Y2H A;  1HTA A;  3A1I A;  3AZE B;  3LJA D;  3WA9 D;  1F66 B;  1TAF A;  2YFV B;  3W98 D;  4UPK A;  2PYO D;  1S32 C;  1P3I B;  3AZI C;  2Y2L A;  5B40 C;  3AN2 D;  1KX5 D;  4CSR A;  4ZBJ C;  3W96 B;  4KUD C;  4YS3 C;  5B24 A;  3VH6 T;  3EPJ A;  3B0D B;  2HIO C;  3LZ0 B;  5B2I B;  1P3M C;  3WTP D;  2L5A A;  4Z5T A;  3NQJ B;  3P5J B;  1WWS A;  5BNX A;  1P3O B;  5B24 D;  1R4V A;  4WU9 D;  3X1U A;  5AV6 B;  4KHA A;  4M6B A;  3AV1 C;  3W97 B;  4R8P D;  3NQU A;  5CPJ B;  4Z5T D;  5AV9 C;  1U35 C;  3MNN C;  1ID3 D;  1HQ3 C;  4J8X C;  4XZQ C;  2DQN C;  3AZK C;  2FJ7 D;  3AZE A;  3AL0 C;  2BYK B;  2YFV A;  3AV2 A;  1P3G B;  5B0Y B;  5E5A B;  3KUY D;  4QLC D;  3H0M C;  4J8W B;  2F2A C;  3REJ C;  3H0R C;  4WNN B;  3W96 A;  3WKJ C;  5G49 B;  3O62 B;  4H9S C;  4H9Q B;  5AY8 B;  3AV2 D;  1P3K D;  5AVB C;  5AV5 C;  3AFA C;  3AZH A;  5B2I A;  5B0Z C;  4UUZ B;  4KUD B;  3AZL A;  3UTB C;  3AZF D;  3MGP B;  1H3O B;  4YM6 C;  1P3P A;  3KWQ A;  1P3O A;  2HIO B;  3B0B A;  3MGR B;  3AZM A;  4Z66 C;  3MVD A;  5GXQ D;  3AZJ C;  3AZH D;  3B6F B;  3MGS B;  1M18 D;  3W97 A;  5AVC D;  3AZL D;  5CPJ A;  1P3P D;  3KWQ D;  3EPH A;  5F99 B;  4H9P B;  3X1V B;  3EPL A;  5GT3 D;  3AZM D;  3MVD D;  1P3L C;  1M1A D;  3VH6 A;  2BYK A;  3LEL A;  3REH C;  5AV9 B;  3MNN B;  4ZUX C;  4WU8 D;  4H9R B;  1M19 B;  1P3G A;  4AWL C;  3AYW A;  3AZN D;  2FFF B;  5JA4 B;  5CHL B;  3C1C C;  4KGC C;  4G91 C;  5B31 G;  2IO5 C;  2F8N K;  4WNN A;  3LEL D;  4Z2M H;  5G49 A;  3O62 A;  2G5I C;  5CP6 D;  5GT0 B;  5B40 A;  2DF4 C;  3AZG D;  3R45 B;  3AYW D;  5B31 B;  4HGA C;  3KFU G;  4UUZ A;  3KXB D;  4KUD A;  5GSU B;  1H3O A;  1S32 D;  5AV5 B;  3AZI D;  3AZE C;  2HIO A;  5B40 D;  1F66 C;  4J8U B;  3UTB B;  3B6F A;  4LD9 B;  5B2J B;  1P3I C;  1P34 B;  3B6G D;  4YS3 D;  3AZJ B;  1ZLA D;  3REK B;  4H9P A;  3AV1 A;  1P3M D;  5JRG C;  5AV9 A;  1U35 A;  3MNN A;  3W99 D;  3LZ0 C;  5B2I C;  4J8X A;  4XZQ A;  3AZK A;  1P3O C;  5AV6 C;  3MGQ B;  1Z2C B;  1U35 D;  3AN2 B;  5AV8 B;  1HQ3 D;  3R45 A;  5B31 A;  3C1C B;  4XZQ D;  4J8X D;  3W97 C;  5FUG A;  3WAA C;  3AZK D;  2J8P A;  3X1T B;  3WKJ A;  4JJN B;  3REI D;  4H9S A;  1P3B C;  5AVB A;  5AV5 A;  4XUJ D;  3B0C T;  5B1M D;  1A7W A;  2JSS A;  3UTB A;  3REJ D;  4YM6 A;  5B0Y C;  5E5A C;  1JFI B;  1AOI B;  3WKJ D;  3REL C;  5AVB D;  2ARO D;  4Z66 A;  3AFA D;  4J8W C;  3AZJ A;  3REK A;  2F8N A;  5B0Z D;  3O62 C;  5B1L C;  5AY8 C;  5B32 D;  4YM6 D;  2NQB C;  3F6T A;  4WV4 B;  3C1B B;  2NZD C;  4Z66 D;  1P3L A;  2F8N D;  5DNN B;  3MGP C;  3REH A;  5JRG B;  4ZUX A;  3MGR C;  3MGQ A;  3B6F C;  5CPI C;  4QLC B;  2Y2P A;  3MGS C;  5AV8 A;  3C1C A;  4KGC A;  1P3L D;  1KX3 B;  3REH D;  1P3K B;  4ZUX D;  5F99 C;  3X1V C;  3WAA B;  1M19 C;  2BG1 A;  4KGC D;  3X1U D;  1P3B B;  1AOI A;  1JFI A;  3A6N B;  2CV5 B;  1F66 A;  2HUE B;  2Y2G A;  1P3I A;  3VH5 A;  5GT0 C;  1BH8 B;  3REL B;  5B31 C;  2RVQ D;  2Y2N A;  3AZE D;  1F66 D;  5B1L B;  5GSU C;  2YFW B;  5JRG A;  2NQB B;  1P3I D;  5CPK B;  3LZ0 A;  1TZY C;  3AZN B;  5B33 B;  2NZD B;  4J8U C;  4LD9 C;  5B2J C;  3NQJ A;  1P34 C;  3W96 D;  3LZ1 B;  5AV6 A;  5C3I B;  4WJ3 C;  2RIQ A;  3REK C;  5CPI B;  3LZ0 D;  5B2I D;  4Z2M G;  5DNM C;  3WAA A;  4NE3 A;  4J8V C;  1P3O D;  4NFT A;  1P3B A;  5AV6 D;  3A6N A;  2BYM B;  2CV5 A;  3TU4 B;  3W97 D;  3B0C W;  5CPJ D;  3MGQ C;  5B0Y A;  5E5A A;  3AN2 C;  5BO0 B;  1KX5 C;  1BH8 A;  5AV8 C;  3REL A;  4J8W A;  3EG5 B;  3UTA B;  3X1T C;  4JJN C;  4H9Q A;  5B1L A;  5AY8 A;  2UWX A;  1P3G D;  2YFW A;  2NQB A;  3UT9 B;  5B0Y D;  5E5A D;  2XD1 A;  4CAY B;  3WTP C;  4J8W D;  2NZD A;  3MGP A;  1AOI C;  3O62 D;  4WU9 C;  3LZ1 A;  1TZY B;  5AY8 D;  3VH6 W;  3MGR A;  1P3A B;  4X23 B;  5BT1 C;  3MGS A;  5CPI A;  4R8P C;  4KUD D;  1BH9 B;  1ULY A;  3MGP D;  4EO5 B;  1EQZ B;  5F99 A;  1KX4 B;  2HIO D;  3C1B C;  3X1V A;  3MGR D;  5DNM B;  2FJ7 C;  3X1S B;  5DNN C;  1P3F B;  3B6F D;  3MGS D;  4J8V B;  1M19 A;  4H9R A;  2Y2J A;  5JA4 A;  3LJA B;  4QLC C;  3WA9 B;  5F99 D;  3AV1 D;  3X1V D;  3W98 B;  2Y2K A;  2PYO B;  1KX3 C;  4G92 B;  3UTA A;  2CWE A;  5AV9 D;  2JCH A;  3MNN D;  1P3K C;  1B6W A;  3VH5 T;  2ZY2 A;  3FDD A;  5GT0 A;  1M19 D;  1KX5 B;  1F1E A;  5GSU A;  3A6N C;  2ZY4 A;  5GT0 D;  1TZY A;  2CV5 C;  5GXQ C;  1P3A A;  5B31 D;  4X23 A;  2HUE C;  3WTP B;  4J8U A;  3KSY A;  5AVC C;  5B2J A;  4LD9 A;  1P34 A;  5B24 B;  4WU9 B;  4WZS B;  5GSU D;  5AV5 D;  2F8N H;  5GT3 C;  4R8P B;  5DNM A;  4J8U D;  2VQR A;  3UTB D;  4Z5T B;  4J8V A;  5B2J D;  2ZY5 A;  4WU8 C;  4E44 A;  1P34 D;  1ID3 B;  4LD9 D;  5CPK C;  3AZN C;  1PZR A;  1BFM A;  4DQY B;  5B33 C;  2FJ7 B;  3AZJ D;  2ZY3 A;  3LJA A;  3WA9 A;  3REK D;  4NE6 A;  3W98 A;  3IP4 C;  3LZ1 C;  2Y2I A;  5C3I C;  3KUY B;  3AZG C;  3AN2 A;  1KX5 A;  2Y2M A;  2Y2O A;  5BS7 A;  3KXB C;  3X1T A;  4JJN A;  3AV2 B;  3V9R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...