4Z66D

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
94
structure length
94
Chain Sequence
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
total genus 37
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4z66D00
5B24C 3W96C 4J8UC 3AV2A 3AZGB 5B2IC 3LZ0A 1EQZC 1KX4C 5B0ZD 2RVQC 5B1MD 1WWIA 3B0DB 5AY8D 3MVDA 1P3LD 5JRGA 4H9RB 1P3GB 3LZ1A 3AZFA 3AZHA 3AZID 3X1VA 1P3AA 5CP6D 4LD9D 2PYOB 5DNNC 5BO0B 4XUJA 4HGAB 4KGCB 5B2JD 3AZND 1ULYA 3KWQC 3MGSC 2FJ7A 5B40D 4WZSB 3UTAA 5B0YD 1HQ3B 2CV5B 1P3PD 1F66B 3AFAB 3AZEA 4ZUXC 1P3IB 3A6NC 5CPIB 3AN2B 5GT0D 3O62D 3WTPA 3B6GD 3W96D 1BH8A 4G92C 3C1CB 3AYWB 1EQZD 3VH6T 1KX4D 1M1AC 2RVQD 5KDMB 1S32A 1P3BB 2CWEA 3W97B 5GSUA 4Z5TC 5AV8D 4YM6B 1P3OA 3AV2C 3LZ0C 4H9OB 2F8NH 5DNND 3MGRA 2LY8A 3AZKB 1JFIB 4XZQC 5AV6A 1B67A 5CHLB 1P3KC 3KWQD 3UTBC 5CPKA 3W98B 4AWLC 3W98C 4G91B 3C1BD 5JRGC 3AZLB 3REHA 1ID3B 4H9SC 1KX5B 3LELA 1KX5C 3A6ND 3AZFC 2HUEB 4DRAA 4DRBA 1WWSA 3MNNB 3X1SA 3WA9D 4X23D 5AVBB 2HIOA 4CAYA 5B33A 2AROD 5DNMA 3X1TC 1U35A 1M1AD 3AV1A 1P3MD 3B6FB 4R8PC 3REIA 4Z5TD 1M19B 1BH9A 4WNNA 1R4VA 3AV2D 4J8VB 5AV5A 1B6WA 3LZ0D 3MGQA 4H9QB 5BNXA 4WU8B 3LJAA 4Z66C 3KSYA 5E5AC 3MVDD 3RELA 5JRGD 1M18A 3TU4B 4QLCC 1P3OC 3AZFD 3AZHD 3X1VD 1P3AD 3R45B 5BT1C 5G49B 4KUDA 5B0ZB 3AZJA 5B1MB 4XUJD 5B1MC 5AY8B 2IO5C 5JA4B 5CPKC 2YFWB 5B32B 1P3LB 3UTAD 1P3LC 3W99C 3WKJA 4CSRB 3AZIB 4LD9B 5CP6C 4Z2MG 5BNVA 5AV9B 3WTPD 1ZLAA 3AZNB 5F99B 5B2JC 1P3GA 1F1EA 2F8NK 1KX3B 5B40B 4J8XA 2HIOC 5B0YB 1P3PB 5B33C 5AVCB 2PYOA 1S32D 5GT3A 4KGCA 5GT0B 2NQBA 3MGPB 5GSUD 3O62B 3REIC 4J8UB 3W96B 3B6GC 1HQ3A 3NQUB 2CV5A 3AFAA 4QLCD 1P3OD 5FUGB 3KUYC 5B2IB 5BT1D 5CPIA 3AN2A 4E45A 4YS3A 1EQZB 1KX4B 3VH5W 2NZDA 3MGRD 4ZBJC 5AV6D 5B31G 3LJAC 2BYKB 5CPKD 3C1CA 3UT9A 3RELC 3X1UA 5CPJA 3W99D 3AYWA 5AV8C 3REHD 3LELD 5B32G 5DNNB 3WAAA 1P3FA 3KWQB 3X1SD 3MGSB 4JJNC 4NE3A 3REJA 2HIOD 5B33D 1TZYA 5B1LA 3C1BC 1U35D 4ZUXB 3AZKA 3AV1D 3A6NB 3REID 4KHAA 1H3OA 1ZLAC 3AZLA 4G92B 1ID3A 3WA9C 4X23C 3KUYD 5AV5D 4J8XC 2AROC 1M1AB 3B0CW 1P3MB 1P3MC 5GT3C 3LJAD 2NQBC 4Z5TB 3RELD 5GXQA 1M18D 3AV2B 3NQJA 3LZ0B 1HTAA 4KUDD 4XZQB 3AZMA 2NZDC 3AZJD 2F8NB 1P3KB 3UTBB 1AOIA 4JJND 4J8WA 3MVDB 4AWLB 3MVDC 3UT9C 5JRGB 3X1UC 4H9QA 3LZ1C 3WKJD 3AZFB 3AZHB 3X1VB 3AZHC 3X1VC 1P3AC 1ZLAD 4XUJB 3V9RA 4XUJC 1TAFA 3TU4A 4UUZB 1P34A 4J8XD 2FJ7C 3X1TB 3UTAC 1TZYC 5B1LC 5B31A 2PYOD 3KXBA 3AZEC 5GT3D 4WU9A 4KGCD 3REKA 2NQBD 4R8PB 5JA4A 3WTPC 3VH5T 5B32A 1HQ3D 1BH8B 3AFAD 3AZIA 5CPID 3AN2D 4YS3D 2NZDD 5AV9A 3B0BA 1S32C 4H9NA 5F99A 4Z66B 5E5AB 5GSUB 5GSUC 1KX3A 3UT9D 2F8NG 4Z2MH 5CPJD 3X1UD 5GXQC 5AVCA 3LZ1D 4QLCB 1P3OB 3VH6A 3MGPA 1M19A 3MGRB 3WAAD 5B24A 4EO5C 3MGRC 4J8UA 1P3FD 2IO5B 5AV6C 3AZGA 5CPKB 1AOIC 5FUGA 4J8WC 5B2IA 3REJD 2FJ7D 1TZYD 3W99B 5B1LD 3REHC 3AZED 3LELB 3LELC 5CP6B 5B2JB 3B0CT 4H9RA 3AZLD 4NE5A 3X1SC 1ID3D 1P34C 2HIOB 4CAYB 5B33B 4M6BA 1U35B 5DNMC 5DNNA 5B31C 3AV1B 1U35C 5BO0A 3AV1C 3KXBC 3KWQA 3MGSA 3REIB 3B6GB 5GXQD 1F66A 4WNNB 2YFVB 5C3IC 4ZUXA 3KUYB 1P3IA 3A6NA 5AV5B 5AV5C 3MGQC 5BNXB 4WV4B 4ZBJB 3AZMD 3LJAB 1AOID 4J8WD 3RELB 1A7WA 1M18B 5AV8B 1M18C 5KDMA 1P3BA 3W97A 4Z5TA 1M19C 4KUDC 3AZJB 3AZJC 4YM6A 4JJNB 3TU4D 1P34D 3AZGC 3C1BB 5DNMD 4H9OA 5B31D 3WKJB 4XZQA 3KXBD 1JFIA 3WKJC 2F8NA 1P3KA 4WU9D 3REKD 3UTBA 3B0DC 5BNVB 3W98A 2BYMB 1ZLAB 5B32D 3WA9B 4H9SA 1P3GC 4X23B 1KX5A 4J8XB 2AROB 4H9PB 1N1JB 3MGQD 2PYOC 5AV9D 3MNNA 5GT3B 4HGAC 5F99D 4KGCC 2NQBB 3WTPE 4UUZA 5AVBA 1KX3D 3X1TA 1HQ3C 2CV5C 5AVCD 1F66C 3AFAC 1P3IC 5CPIC 4YS3B 4R8PA 3MGPD 4YS3C 3AN2C 3B6FA 1M19D 2NZDB 5B24D 4J8UD 3AZGD 4J8VA 3UT9B 5B2ID 3C1CC 3X1UB 5CPJB 5CPJC 1Q9CA 3LZ1B 3AYWC 4WU8A 1P3AB 4Z66A 1P3BC 3W97C 5E5AA 3WAAB 3WAAC 1P3FB 1P3FC 1P3GD 4QLCA 4YM6C 3REJB 2FJ7B 3REJC 3UTAB 3R45A 1TZYB 1BFMA 5B1LB 5G49A 5B0ZA 3AZEB 5B1MA 3AZKC 5AY8A 3MGSD 3WTPB 4KHAB 2YFWA 1H3OB 1P3LA 3W99A 2CV5D 4G91C 1F66D 3AZLC 1KU5A 1ID3C 4ZUXD 4CSRA 1P3ID 4NE6A 5CP6A 4LD9A 2HUEC 1S32B 5B2JA 3MNNC 3AZNA 5BS7A 4E44A 3C1CD 5AVBC 5B40A 1P3PA 5B0YA 5GXQB 3AYWD 3NQJB 1P3BD 5GT0A 3W97D 3B6FC 3O62A 4EO5B 3AZMB 3B6GA 3W96A 3AZMC 3NQUA 5AV6B 4YM6D 2YFVA 1AOIB 4J8WB 3KUYA 4J8VC 2L5AA 1EQZA 3REHB 1KX4A 4XZQD 3AZKD 4WU8C 2F8ND 1P3KD 3UTBD 2BYKA 4NFTA 3W98D 3V9RB 3VH6W 1TAFB 5AV8A 3X1SB 1P34B 1KX5D 3TU4C 5DNMB 5B31B 3KXBB 5B0ZC 3MNND 4WU9B 3REKB 4WU9C 5AY8C 4JJNA 3REKC 5AVBD 3C1BA 5B32C 3X1TD 1BH9B 5C3IB 2JSSA 3AZIC 3MGQB 3B6FD 4LD9C 4R8PD 2BYMA 5AV9C 4H9NB 3VH5A 3WA9A 3AZNC 5F99C 4X23A 5BS7C 4J8VD 1KX3C 2AROA 5B40C 4H9PA 5B0YC 1P3PC 1N1JA 1M1AA 5AVCC 4WU8D 1P3MA 4Z66D 5GT0C 5E5AD 3MGPC 4KUDB 3O62C 5B24B
chains in the Genus database with same CATH superfamily
5B24C 3W96C 4J8UC 3AV2A 3AZGB 3EG5B 5B2IC 2Y2PA 3LZ0A 1EQZC 1KX4C 5B0ZD 2RVQC 5B1MD 1WWIA 2DQNC 3B0DB 5AY8D 3MVDA 1P3LD 5JRGA 4H9RB 1P3GB 3LZ1A 3AZFA 3AZHA 3AZID 3X1VA 1P3AA 5CP6D 4LD9D 2PYOB 5DNNC 5BO0B 4XUJA 4HGAB 4KGCB 5B2JD 3AZND 1ULYA 3KWQC 3MGSC 2FJ7A 2UWXA 5B40D 4WZSB 5B0YD 1HQ3B 3UTAA 2CV5B 1P3PD 1F66B 3AFAB 3AZEA 4ZUXC 1P3IB 3A6NC 5CPIB 3AN2B 5GT0D 3O62D 3WTPA 3B6GD 3W96D 1BH8A 4G92C 3C1CB 3AYWB 1EQZD 3VH6T 1KX4D 1M1AC 2RVQD 5KDMB 1S32A 2J8PA 1P3BB 2CWEA 2ZM5A 3W97B 1PZRA 5GSUA 3AL0C 4Z5TC 5AV8D 4YM6B 1P3OA 3AV2C 2JCHA 3LZ0C 4H9OB 2F8NH 2Y2KA 5DNND 2LY8A 3MGRA 3AZKB 1JFIB 4XZQC 5AV6A 1B67A 5CHLB 1P3KC 3KWQD 3UTBC 5CPKA 3W98B 4AWLC 3W98C 4G91B 3C1BD 5JRGC 3AZLB 3REHA 1ID3B 4H9SC 1KX5B 3LELA 1KX5C 3A6ND 3AZFC 2HUEB 4DRAA 4DRBA 1WWSA 3MNNB 3X1SA 3WA9D 4X23D 5AVBB 2HIOA 4CAYA 5B33A 2AROD 2G5HC 5DNMA 3X1TC 1U35A 1M1AD 3AV1A 3A1IA 1P3MD 3B6FB 4R8PC 3REIA 4Z5TD 1M19B 1BH9A 4WNNA 1R4VA 3AV2D 4J8VB 5AV5A 1B6WA 3LZ0D 3MGQA 4H9QB 5BNXA 4WU8B 3LJAA 4Z66C 3KSYA 5E5AC 3MVDD 3RELA 4WJ3C 5JRGD 1M18A 3TU4B 4QLCC 1P3OC 3AZFD 3AZHD 3X1VD 1P3AD 3R45B 5BT1C 5G49B 2ZY4A 4KUDA 5B0ZB 3AZJA 2Y2OA 5B1MB 4XUJD 5B1MC 5AY8B 2IO5C 5JA4B 5CPKC 2YFWB 5B32B 1P3LB 3UTAD 1P3LC 3W99C 3H0RC 3WKJA 4CSRB 3AZIB 4LD9B 5CP6C 4Z2MG 5BNVA 5AV9B 2F2AC 3WTPD 1ZLAA 3AZNB 5F99B 5B2JC 1P3GA 1F1EA 2F8NK 1KX3B 5B40B 4J8XA 2HIOC 5B0YB 1P3PB 5B33C 5AVCB 2PYOA 1S32D 5GT3A 4KGCA 5GT0B 2NQBA 3MGPB 5GSUD 3O62B 3REIC 4J8UB 3W96B 1T3UA 3B6GC 1HQ3A 3NQUB 2CV5A 3AFAA 4QLCD 1P3OD 5FUGB 2JE5A 5B2IB 3KUYC 5BT1D 5CPIA 3AN2A 4E45A 4YS3A 1EQZB 1KX4B 3VH5W 2NZDA 2Y2MA 3MGRD 3EPJA 4ZBJC 5AV6D 5B31G 3LJAC 2BYKB 5CPKD 3C1CA 3UT9A 3RELC 3X1UA 5CPJA 3W99D 3AYWA 5AV8C 3REHD 3LELD 5B32G 5DNNB 3WAAA 1P3FA 3KWQB 3X1SD 3MGSB 4JJNC 3IP4C 4NE3A 3REJA 2HIOD 3F6TA 5B33D 1TZYA 5B1LA 3C1BC 1U35D 4ZUXB 3AZKA 3AV1D 3A6NB 3REID 4KHAA 1H3OA 3H0MC 1ZLAC 3AZLA 3EPHA 4G92B 1ID3A 3WA9C 2Y2LA 4X23C 3KUYD 5AV5D 4J8XC 2AROC 1M1AB 3B0CW 1P3MB 1P3MC 5GT3C 3LJAD 2Y2JA 2NQBC 4Z5TB 3RELD 5GXQA 1M18D 3AV2B 3NQJA 3LZ0B 1HTAA 4KUDD 4XZQB 3AZMA 2NZDC 3AZJD 2F8NB 1P3KB 3UTBB 1AOIA 4JJND 4J8WA 3MVDB 4AWLB 3MVDC 3UT9C 5JRGB 3X1UC 4H9QA 3LZ1C 3WKJD 3AZFB 3AZHB 3X1VB 3AZHC 3X1VC 1P3AC 1ZLAD 4XUJB 3V9RA 4XUJC 1TAFA 3TU4A 4UUZB 1P34A 4J8XD 2FJ7C 3X1TB 3UTAC 1TZYC 5B1LC 5B31A 2Y2IA 2PYOD 3KXBA 3AZEC 5GT3D 3EPLA 4WU9A 3REKA 4KGCD 2NQBD 4R8PB 5JA4A 3WTPC 3VH5T 5B32A 1HQ3D 1BH8B 3AFAD 3AZIA 5CPID 3AN2D 4YS3D 2ZY2A 2NZDD 5AV9A 3B0BA 1S32C 4H9NA 5F99A 4Z66B 5E5AB 5GSUB 5GSUC 1KX3A 3UT9D 2F8NG 4Z2MH 5CPJD 3X1UD 5GXQC 5AVCA 3LZ1D 4QLCB 1P3OB 3VH6A 1W2EA 3MGPA 2XD5A 1M19A 3MGRB 3WAAD 5B24A 4EO5C 3MGRC 4J8UA 2ZY5A 1P3FD 2IO5B 5AV6C 4DQYB 3AZGA 5CPKB 1AOIC 5FUGA 4J8WC 5B2IA 3REJD 2FJ7D 1TZYD 3W99B 5B1LD 2Y2NA 3REHC 3AZED 3LELB 3LELC 5CP6B 3H0LC 5B2JB 3B0CT 4H9RA 3AZLD 2FFFB 4NE5A 3X1SC 1ID3D 1P34C 4UPKA 2HIOB 4CAYB 5B33B 4M6BA 1U35B 5DNMC 5DNNA 5B31C 3AV1B 1U35C 5BO0A 3AV1C 3KXBC 3KFUG 3KWQA 3MGSA 3REIB 2RIQA 3B6GB 5GXQD 1F66A 4WNNB 2YFVB 5C3IC 4ZUXA 2VQRA 3KUYB 1P3IA 3A6NA 5AV5B 5AV5C 3MGQC 5BNXB 4WV4B 4ZBJB 3AZMD 3LJAB 1AOID 4J8WD 3RELB 1A7WA 1M18B 5AV8B 1M18C 5KDMA 3P5JB 1P3BA 3W97A 4Z5TA 1M19C 4KUDC 3AZJB 3FDDA 3AZJC 4YM6A 4JJNB 3TU4D 1P34D 3EPKA 3AZGC 3C1BB 5DNMD 4H9OA 5B31D 3WKJB 4XZQA 3KXBD 1JFIA 3WKJC 2F8NA 1P3KA 4WU9D 3REKD 3UTBA 3B0DC 5BNVB 3W98A 2BYMB 1ZLAB 5B32D 3WA9B 4H9SA 2Y2HA 1P3GC 4X23B 1KX5A 1Z2CB 4J8XB 2AROB 4H9PB 1N1JB 3MGQD 2PYOC 5AV9D 3MNNA 5GT3B 4HGAC 5F99D 4KGCC 2NQBB 3WTPE 4UUZA 5AVBA 1KX3D 3X1TA 1HQ3C 2CV5C 5AVCD 1F66C 3AFAC 1P3IC 5CPIC 4YS3B 4R8PA 3MGPD 4YS3C 3AN2C 3B6FA 1M19D 2NZDB 5B24D 4J8UD 3AZGD 4J8VA 3UT9B 5B2ID 3C1CC 3X1UB 5CPJB 5CPJC 1Q9CA 3LZ1B 3AYWC 4WU8A 2Y2GA 1P3AB 4Z66A 1P3BC 3W97C 5E5AA 3WAAB 2W8SA 3WAAC 1P3FB 1P3FC 2Y2QA 1P3GD 4QLCA 4YM6C 3REJB 2DF4C 2FJ7B 3REJC 3UTAB 3R45A 1TZYB 1BFMA 5B1LB 5G49A 2ZY3A 5B0ZA 3AZEB 5B1MA 3AZKC 5AY8A 3MGSD 3WTPB 4KHAB 2YFWA 1H3OB 1P3LA 3W99A 2CV5D 4G91C 1F66D 3AZLC 1KU5A 1ID3C 4ZUXD 4CSRA 1P3ID 4NE6A 5CP6A 4LD9A 2HUEC 1S32B 5B2JA 3MNNC 3AZNA 5BS7A 4E44A 3C1CD 5AVBC 5B40A 1P3PA 5B0YA 5GXQB 3AYWD 3A1KA 3NQJB 1P3BD 5GT0A 3W97D 3B6FC 3O62A 4EO5B 3AZMB 3B6GA 3W96A 3AZMC 3NQUA 5AV6B 4YM6D 2YFVA 1AOIB 4J8WB 3KUYA 4J8VC 2L5AA 1EQZA 3REHB 1KX4A 4XZQD 3AZKD 4WU8C 2F8ND 1P3KD 3UTBD 2BYKA 4NFTA 3W98D 2G5IC 3V9RB 3VH6W 1TAFB 5AV8A 3X1SB 1P34B 1KX5D 3TU4C 2BG1A 5DNMB 5B31B 3KXBB 5B0ZC 3MNND 4WU9B 3REKB 4WU9C 5AY8C 4JJNA 3REKC 5AVBD 2XD1A 3C1BA 5B32C 3X1TD 1BH9B 5C3IB 2JSSA 3AZIC 3MGQB 3B6FD 4LD9C 4R8PD 2BYMA 5AV9C 4H9NB 3VH5A 3WA9A 3AZNC 5F99C 4X23A 5BS7C 4J8VD 1KX3C 2AROA 5B40C 4H9PA 5B0YC 1P3PC 1N1JA 1M1AA 5AVCC 4WU8D 1P3MA 4Z66D 5GT0C 5E5AD 3MGPC 4KUDB 3O62C 5B24B
chains in the Genus database with same CATH topology
5B24C 3W96C 4J8UC 3AV2A 3AZGB 3EG5B 5B2IC 2Y2PA 3LZ0A 1EQZC 1KX4C 5B0ZD 2RVQC 5B1MD 1WWIA 2DQNC 3B0DB 5AY8D 3MVDA 1P3LD 5JRGA 4H9RB 1P3GB 3LZ1A 3AZFA 3AZHA 3AZID 3X1VA 1P3AA 5CP6D 4LD9D 2PYOB 5DNNC 5BO0B 4XUJA 4HGAB 4KGCB 5B2JD 3AZND 1ULYA 3KWQC 3MGSC 2FJ7A 2UWXA 5B40D 4WZSB 5B0YD 1HQ3B 3UTAA 2CV5B 1P3PD 1F66B 3AFAB 3AZEA 4ZUXC 1P3IB 3A6NC 5CPIB 3AN2B 5GT0D 3O62D 3WTPA 3B6GD 3W96D 1BH8A 4G92C 3C1CB 3AYWB 1EQZD 3VH6T 1KX4D 1M1AC 2RVQD 5KDMB 1S32A 2J8PA 1P3BB 2CWEA 2ZM5A 3W97B 1PZRA 5GSUA 3AL0C 4Z5TC 5AV8D 4YM6B 1P3OA 3AV2C 2JCHA 3LZ0C 4H9OB 2F8NH 2Y2KA 5DNND 2LY8A 3MGRA 3AZKB 1JFIB 4XZQC 5AV6A 1B67A 5CHLB 1P3KC 3KWQD 3UTBC 5CPKA 3W98B 4AWLC 3W98C 4G91B 3C1BD 5JRGC 3AZLB 3REHA 1ID3B 4H9SC 1KX5B 3LELA 1KX5C 3A6ND 3AZFC 2HUEB 4DRAA 4DRBA 1WWSA 3MNNB 3X1SA 3WA9D 4X23D 5AVBB 2HIOA 4CAYA 5B33A 2AROD 2G5HC 5DNMA 3X1TC 1U35A 1M1AD 3AV1A 3A1IA 1P3MD 3B6FB 4R8PC 3REIA 4Z5TD 1M19B 1BH9A 4WNNA 1R4VA 3AV2D 4J8VB 5AV5A 1B6WA 3LZ0D 3MGQA 4H9QB 5BNXA 4WU8B 3LJAA 4Z66C 3KSYA 5E5AC 3MVDD 3RELA 4WJ3C 5JRGD 1M18A 3TU4B 4QLCC 1P3OC 3AZFD 3AZHD 3X1VD 1P3AD 3R45B 5BT1C 5G49B 2ZY4A 4KUDA 5B0ZB 3AZJA 2Y2OA 5B1MB 4XUJD 5B1MC 5AY8B 2IO5C 5JA4B 5CPKC 2YFWB 5B32B 1P3LB 3UTAD 1P3LC 3W99C 3H0RC 3WKJA 4CSRB 3AZIB 4LD9B 5CP6C 4Z2MG 5BNVA 5AV9B 2F2AC 3WTPD 1ZLAA 3AZNB 5F99B 5B2JC 1P3GA 1F1EA 2F8NK 1KX3B 5B40B 4J8XA 2HIOC 5B0YB 1P3PB 5B33C 5AVCB 2PYOA 1S32D 5GT3A 4KGCA 5GT0B 2NQBA 3MGPB 5GSUD 3O62B 3REIC 4J8UB 3W96B 1T3UA 3B6GC 1HQ3A 3NQUB 2CV5A 3AFAA 4QLCD 1P3OD 5FUGB 2JE5A 5B2IB 3KUYC 5BT1D 5CPIA 3AN2A 4E45A 4YS3A 1EQZB 1KX4B 3VH5W 2NZDA 2Y2MA 3MGRD 3EPJA 4ZBJC 5AV6D 5B31G 3LJAC 2BYKB 5CPKD 3C1CA 3UT9A 3RELC 3X1UA 5CPJA 3W99D 3AYWA 5AV8C 3REHD 3LELD 5B32G 5DNNB 3WAAA 1P3FA 3KWQB 3X1SD 3MGSB 4JJNC 3IP4C 4NE3A 3REJA 2HIOD 3F6TA 5B33D 1TZYA 5B1LA 3C1BC 1U35D 4ZUXB 3AZKA 3AV1D 3A6NB 3REID 4KHAA 1H3OA 3H0MC 1ZLAC 3AZLA 3EPHA 4G92B 1ID3A 3WA9C 2Y2LA 4X23C 3KUYD 5AV5D 4J8XC 2AROC 1M1AB 3B0CW 1P3MB 1P3MC 5GT3C 3LJAD 2Y2JA 2NQBC 4Z5TB 3RELD 5GXQA 1M18D 3AV2B 3NQJA 3LZ0B 1HTAA 4KUDD 4XZQB 3AZMA 2NZDC 3AZJD 2F8NB 1P3KB 3UTBB 1AOIA 4JJND 4J8WA 3MVDB 4AWLB 3MVDC 3UT9C 5JRGB 3X1UC 4H9QA 3LZ1C 3WKJD 3AZFB 3AZHB 3X1VB 3AZHC 3X1VC 1P3AC 1ZLAD 4XUJB 3V9RA 4XUJC 1TAFA 3TU4A 4UUZB 1P34A 4J8XD 2FJ7C 3X1TB 3UTAC 1TZYC 5B1LC 5B31A 2Y2IA 2PYOD 3KXBA 3AZEC 5GT3D 3EPLA 4WU9A 3REKA 4KGCD 2NQBD 4R8PB 5JA4A 3WTPC 3VH5T 5B32A 1HQ3D 1BH8B 3AFAD 3AZIA 5CPID 3AN2D 4YS3D 2ZY2A 2NZDD 5AV9A 3B0BA 1S32C 4H9NA 5F99A 4Z66B 5E5AB 5GSUB 5GSUC 1KX3A 3UT9D 2F8NG 4Z2MH 5CPJD 3X1UD 5GXQC 5AVCA 3LZ1D 4QLCB 1P3OB 3VH6A 1W2EA 3MGPA 2XD5A 1M19A 3MGRB 3WAAD 5B24A 4EO5C 3MGRC 4J8UA 2ZY5A 1P3FD 2IO5B 5AV6C 4DQYB 3AZGA 5CPKB 1AOIC 5FUGA 4J8WC 5B2IA 3REJD 2FJ7D 1TZYD 3W99B 5B1LD 2Y2NA 3REHC 3AZED 3LELB 3LELC 5CP6B 3H0LC 5B2JB 3B0CT 4H9RA 3AZLD 2FFFB 4NE5A 3X1SC 1ID3D 1P34C 4UPKA 2HIOB 4CAYB 5B33B 4M6BA 1U35B 5DNMC 5DNNA 5B31C 3AV1B 1U35C 5BO0A 3AV1C 3KXBC 3KFUG 3KWQA 3MGSA 3REIB 2RIQA 3B6GB 5GXQD 1F66A 4WNNB 2YFVB 5C3IC 4ZUXA 2VQRA 3KUYB 1P3IA 3A6NA 5AV5B 5AV5C 3MGQC 5BNXB 4WV4B 4ZBJB 3AZMD 3LJAB 1AOID 4J8WD 3RELB 1A7WA 1M18B 5AV8B 1M18C 5KDMA 3P5JB 1P3BA 3W97A 4Z5TA 1M19C 4KUDC 3AZJB 3FDDA 3AZJC 4YM6A 4JJNB 3TU4D 1P34D 3EPKA 3AZGC 3C1BB 5DNMD 4H9OA 5B31D 3WKJB 4XZQA 3KXBD 1JFIA 3WKJC 2F8NA 1P3KA 4WU9D 3REKD 3UTBA 3B0DC 5BNVB 3W98A 2BYMB 1ZLAB 5B32D 3WA9B 4H9SA 2Y2HA 1P3GC 4X23B 1KX5A 1Z2CB 4J8XB 2AROB 4H9PB 1N1JB 3MGQD 2PYOC 5AV9D 3MNNA 5GT3B 4HGAC 5F99D 4KGCC 2NQBB 3WTPE 4UUZA 5AVBA 1KX3D 3X1TA 1HQ3C 2CV5C 5AVCD 1F66C 3AFAC 1P3IC 5CPIC 4YS3B 4R8PA 3MGPD 4YS3C 3AN2C 3B6FA 1M19D 2NZDB 5B24D 4J8UD 3AZGD 4J8VA 3UT9B 5B2ID 3C1CC 3X1UB 5CPJB 5CPJC 1Q9CA 3LZ1B 3AYWC 4WU8A 2Y2GA 1P3AB 4Z66A 1P3BC 3W97C 5E5AA 3WAAB 2W8SA 3WAAC 1P3FB 1P3FC 2Y2QA 1P3GD 4QLCA 4YM6C 3REJB 2DF4C 2FJ7B 3REJC 3UTAB 3R45A 1TZYB 1BFMA 5B1LB 5G49A 2ZY3A 5B0ZA 3AZEB 5B1MA 3AZKC 5AY8A 3MGSD 3WTPB 4KHAB 2YFWA 1H3OB 1P3LA 3W99A 2CV5D 4G91C 1F66D 3AZLC 1KU5A 1ID3C 4ZUXD 4CSRA 1P3ID 4NE6A 5CP6A 4LD9A 2HUEC 1S32B 5B2JA 3MNNC 3AZNA 5BS7A 4E44A 3C1CD 5AVBC 5B40A 1P3PA 5B0YA 5GXQB 3AYWD 3A1KA 3NQJB 1P3BD 5GT0A 3W97D 3B6FC 3O62A 4EO5B 3AZMB 3B6GA 3W96A 3AZMC 3NQUA 5AV6B 4YM6D 2YFVA 1AOIB 4J8WB 3KUYA 4J8VC 2L5AA 1EQZA 3REHB 1KX4A 4XZQD 3AZKD 4WU8C 2F8ND 1P3KD 3UTBD 2BYKA 4NFTA 3W98D 2G5IC 3V9RB 3VH6W 1TAFB 5AV8A 3X1SB 1P34B 1KX5D 3TU4C 2BG1A 5DNMB 5B31B 3KXBB 5B0ZC 3MNND 4WU9B 3REKB 4WU9C 5AY8C 4JJNA 3REKC 5AVBD 2XD1A 3C1BA 5B32C 3X1TD 1BH9B 5C3IB 2JSSA 3AZIC 3MGQB 3B6FD 4LD9C 4R8PD 2BYMA 5AV9C 4H9NB 3VH5A 3WA9A 3AZNC 5F99C 4X23A 5BS7C 4J8VD 1KX3C 2AROA 5B40C 4H9PA 5B0YC 1P3PC 1N1JA 1M1AA 5AVCC 4WU8D 1P3MA 4Z66D 5GT0C 5E5AD 3MGPC 4KUDB 3O62C 5B24B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B24 C;  3W96 C;  4J8U C;  3AV2 A;  3AZG B;  5B2I C;  3LZ0 A;  1EQZ C;  1KX4 C;  5B0Z D;  2RVQ C;  5B1M D;  1WWI A;  3B0D B;  5AY8 D;  3MVD A;  1P3L D;  5JRG A;  4H9R B;  1P3G B;  3LZ1 A;  3AZF A;  3AZH A;  3AZI D;  3X1V A;  1P3A A;  5CP6 D;  4LD9 D;  2PYO B;  5DNN C;  5BO0 B;  4XUJ A;  4HGA B;  4KGC B;  5B2J D;  3AZN D;  1ULY A;  3KWQ C;  3MGS C;  2FJ7 A;  5B40 D;  4WZS B;  3UTA A;  5B0Y D;  1HQ3 B;  2CV5 B;  1P3P D;  1F66 B;  3AFA B;  3AZE A;  4ZUX C;  1P3I B;  3A6N C;  5CPI B;  3AN2 B;  5GT0 D;  3O62 D;  3WTP A;  3B6G D;  3W96 D;  1BH8 A;  4G92 C;  3C1C B;  3AYW B;  1EQZ D;  3VH6 T;  1KX4 D;  1M1A C;  2RVQ D;  5KDM B;  1S32 A;  1P3B B;  2CWE A;  3W97 B;  5GSU A;  4Z5T C;  5AV8 D;  4YM6 B;  1P3O A;  3AV2 C;  3LZ0 C;  4H9O B;  2F8N H;  5DNN D;  3MGR A;  2LY8 A;  3AZK B;  1JFI B;  4XZQ C;  5AV6 A;  1B67 A;  5CHL B;  1P3K C;  3KWQ D;  3UTB C;  5CPK A;  3W98 B;  4AWL C;  3W98 C;  4G91 B;  3C1B D;  5JRG C;  3AZL B;  3REH A;  1ID3 B;  4H9S C;  1KX5 B;  3LEL A;  1KX5 C;  3A6N D;  3AZF C;  2HUE B;  4DRA A;  4DRB A;  1WWS A;  3MNN B;  3X1S A;  3WA9 D;  4X23 D;  5AVB B;  2HIO A;  4CAY A;  5B33 A;  2ARO D;  5DNM A;  3X1T C;  1U35 A;  1M1A D;  3AV1 A;  1P3M D;  3B6F B;  4R8P C;  3REI A;  4Z5T D;  1M19 B;  1BH9 A;  4WNN A;  1R4V A;  3AV2 D;  4J8V B;  5AV5 A;  1B6W A;  3LZ0 D;  3MGQ A;  4H9Q B;  5BNX A;  4WU8 B;  3LJA A;  4Z66 C;  3KSY A;  5E5A C;  3MVD D;  3REL A;  5JRG D;  1M18 A;  3TU4 B;  4QLC C;  1P3O C;  3AZF D;  3AZH D;  3X1V D;  1P3A D;  3R45 B;  5BT1 C;  5G49 B;  4KUD A;  5B0Z B;  3AZJ A;  5B1M B;  4XUJ D;  5B1M C;  5AY8 B;  2IO5 C;  5JA4 B;  5CPK C;  2YFW B;  5B32 B;  1P3L B;  3UTA D;  1P3L C;  3W99 C;  3WKJ A;  4CSR B;  3AZI B;  4LD9 B;  5CP6 C;  4Z2M G;  5BNV A;  5AV9 B;  3WTP D;  1ZLA A;  3AZN B;  5F99 B;  5B2J C;  1P3G A;  1F1E A;  2F8N K;  1KX3 B;  5B40 B;  4J8X A;  2HIO C;  5B0Y B;  1P3P B;  5B33 C;  5AVC B;  2PYO A;  1S32 D;  5GT3 A;  4KGC A;  5GT0 B;  2NQB A;  3MGP B;  5GSU D;  3O62 B;  3REI C;  4J8U B;  3W96 B;  3B6G C;  1HQ3 A;  3NQU B;  2CV5 A;  3AFA A;  4QLC D;  1P3O D;  5FUG B;  3KUY C;  5B2I B;  5BT1 D;  5CPI A;  3AN2 A;  4E45 A;  4YS3 A;  1EQZ B;  1KX4 B;  3VH5 W;  2NZD A;  3MGR D;  4ZBJ C;  5AV6 D;  5B31 G;  3LJA C;  2BYK B;  5CPK D;  3C1C A;  3UT9 A;  3REL C;  3X1U A;  5CPJ A;  3W99 D;  3AYW A;  5AV8 C;  3REH D;  3LEL D;  5B32 G;  5DNN B;  3WAA A;  1P3F A;  3KWQ B;  3X1S D;  3MGS B;  4JJN C;  4NE3 A;  3REJ A;  2HIO D;  5B33 D;  1TZY A;  5B1L A;  3C1B C;  1U35 D;  4ZUX B;  3AZK A;  3AV1 D;  3A6N B;  3REI D;  4KHA A;  1H3O A;  1ZLA C;  3AZL A;  4G92 B;  1ID3 A;  3WA9 C;  4X23 C;  3KUY D;  5AV5 D;  4J8X C;  2ARO C;  1M1A B;  3B0C W;  1P3M B;  1P3M C;  5GT3 C;  3LJA D;  2NQB C;  4Z5T B;  3REL D;  5GXQ A;  1M18 D;  3AV2 B;  3NQJ A;  3LZ0 B;  1HTA A;  4KUD D;  4XZQ B;  3AZM A;  2NZD C;  3AZJ D;  2F8N B;  1P3K B;  3UTB B;  1AOI A;  4JJN D;  4J8W A;  3MVD B;  4AWL B;  3MVD C;  3UT9 C;  5JRG B;  3X1U C;  4H9Q A;  3LZ1 C;  3WKJ D;  3AZF B;  3AZH B;  3X1V B;  3AZH C;  3X1V C;  1P3A C;  1ZLA D;  4XUJ B;  3V9R A;  4XUJ C;  1TAF A;  3TU4 A;  4UUZ B;  1P34 A;  4J8X D;  2FJ7 C;  3X1T B;  3UTA C;  1TZY C;  5B1L C;  5B31 A;  2PYO D;  3KXB A;  3AZE C;  5GT3 D;  4WU9 A;  4KGC D;  3REK A;  2NQB D;  4R8P B;  5JA4 A;  3WTP C;  3VH5 T;  5B32 A;  1HQ3 D;  1BH8 B;  3AFA D;  3AZI A;  5CPI D;  3AN2 D;  4YS3 D;  2NZD D;  5AV9 A;  3B0B A;  1S32 C;  4H9N A;  5F99 A;  4Z66 B;  5E5A B;  5GSU B;  5GSU C;  1KX3 A;  3UT9 D;  2F8N G;  4Z2M H;  5CPJ D;  3X1U D;  5GXQ C;  5AVC A;  3LZ1 D;  4QLC B;  1P3O B;  3VH6 A;  3MGP A;  1M19 A;  3MGR B;  3WAA D;  5B24 A;  4EO5 C;  3MGR C;  4J8U A;  1P3F D;  2IO5 B;  5AV6 C;  3AZG A;  5CPK B;  1AOI C;  5FUG A;  4J8W C;  5B2I A;  3REJ D;  2FJ7 D;  1TZY D;  3W99 B;  5B1L D;  3REH C;  3AZE D;  3LEL B;  3LEL C;  5CP6 B;  5B2J B;  3B0C T;  4H9R A;  3AZL D;  4NE5 A;  3X1S C;  1ID3 D;  1P34 C;  2HIO B;  4CAY B;  5B33 B;  4M6B A;  1U35 B;  5DNM C;  5DNN A;  5B31 C;  3AV1 B;  1U35 C;  5BO0 A;  3AV1 C;  3KXB C;  3KWQ A;  3MGS A;  3REI B;  3B6G B;  5GXQ D;  1F66 A;  4WNN B;  2YFV B;  5C3I C;  4ZUX A;  3KUY B;  1P3I A;  3A6N A;  5AV5 B;  5AV5 C;  3MGQ C;  5BNX B;  4WV4 B;  4ZBJ B;  3AZM D;  3LJA B;  1AOI D;  4J8W D;  3REL B;  1A7W A;  1M18 B;  5AV8 B;  1M18 C;  5KDM A;  1P3B A;  3W97 A;  4Z5T A;  1M19 C;  4KUD C;  3AZJ B;  3AZJ C;  4YM6 A;  4JJN B;  3TU4 D;  1P34 D;  3AZG C;  3C1B B;  5DNM D;  4H9O A;  5B31 D;  3WKJ B;  4XZQ A;  3KXB D;  1JFI A;  3WKJ C;  2F8N A;  1P3K A;  4WU9 D;  3REK D;  3UTB A;  3B0D C;  5BNV B;  3W98 A;  2BYM B;  1ZLA B;  5B32 D;  3WA9 B;  4H9S A;  1P3G C;  4X23 B;  1KX5 A;  4J8X B;  2ARO B;  4H9P B;  1N1J B;  3MGQ D;  2PYO C;  5AV9 D;  3MNN A;  5GT3 B;  4HGA C;  5F99 D;  4KGC C;  2NQB B;  3WTP E;  4UUZ A;  5AVB A;  1KX3 D;  3X1T A;  1HQ3 C;  2CV5 C;  5AVC D;  1F66 C;  3AFA C;  1P3I C;  5CPI C;  4YS3 B;  4R8P A;  3MGP D;  4YS3 C;  3AN2 C;  3B6F A;  1M19 D;  2NZD B;  5B24 D;  4J8U D;  3AZG D;  4J8V A;  3UT9 B;  5B2I D;  3C1C C;  3X1U B;  5CPJ B;  5CPJ C;  1Q9C A;  3LZ1 B;  3AYW C;  4WU8 A;  1P3A B;  4Z66 A;  1P3B C;  3W97 C;  5E5A A;  3WAA B;  3WAA C;  1P3F B;  1P3F C;  1P3G D;  4QLC A;  4YM6 C;  3REJ B;  2FJ7 B;  3REJ C;  3UTA B;  3R45 A;  1TZY B;  1BFM A;  5B1L B;  5G49 A;  5B0Z A;  3AZE B;  5B1M A;  3AZK C;  5AY8 A;  3MGS D;  3WTP B;  4KHA B;  2YFW A;  1H3O B;  1P3L A;  3W99 A;  2CV5 D;  4G91 C;  1F66 D;  3AZL C;  1KU5 A;  1ID3 C;  4ZUX D;  4CSR A;  1P3I D;  4NE6 A;  5CP6 A;  4LD9 A;  2HUE C;  1S32 B;  5B2J A;  3MNN C;  3AZN A;  5BS7 A;  4E44 A;  3C1C D;  5AVB C;  5B40 A;  1P3P A;  5B0Y A;  5GXQ B;  3AYW D;  3NQJ B;  1P3B D;  5GT0 A;  3W97 D;  3B6F C;  3O62 A;  4EO5 B;  3AZM B;  3B6G A;  3W96 A;  3AZM C;  3NQU A;  5AV6 B;  4YM6 D;  2YFV A;  1AOI B;  4J8W B;  3KUY A;  4J8V C;  2L5A A;  1EQZ A;  3REH B;  1KX4 A;  4XZQ D;  3AZK D;  4WU8 C;  2F8N D;  1P3K D;  3UTB D;  2BYK A;  4NFT A;  3W98 D;  3V9R B;  3VH6 W;  1TAF B;  5AV8 A;  3X1S B;  1P34 B;  1KX5 D;  3TU4 C;  5DNM B;  5B31 B;  3KXB B;  5B0Z C;  3MNN D;  4WU9 B;  3REK B;  4WU9 C;  5AY8 C;  4JJN A;  3REK C;  5AVB D;  3C1B A;  5B32 C;  3X1T D;  1BH9 B;  5C3I B;  2JSS A;  3AZI C;  3MGQ B;  3B6F D;  4LD9 C;  4R8P D;  2BYM A;  5AV9 C;  4H9N B;  3VH5 A;  3WA9 A;  3AZN C;  5F99 C;  4X23 A;  5BS7 C;  4J8V D;  1KX3 C;  2ARO A;  5B40 C;  4H9P A;  5B0Y C;  1P3P C;  1N1J A;  1M1A A;  5AVC C;  4WU8 D;  1P3M A;  4Z66 D;  5GT0 C;  5E5A D;  3MGP C;  4KUD B;  3O62 C;  5B24 B; 
#chains in the Genus database with same CATH topology
 5B24 C;  3W96 C;  4J8U C;  3AV2 A;  3AZG B;  3EG5 B;  5B2I C;  2Y2P A;  3LZ0 A;  1EQZ C;  1KX4 C;  5B0Z D;  2RVQ C;  5B1M D;  1WWI A;  2DQN C;  3B0D B;  5AY8 D;  3MVD A;  1P3L D;  5JRG A;  4H9R B;  1P3G B;  3LZ1 A;  3AZF A;  3AZH A;  3AZI D;  3X1V A;  1P3A A;  5CP6 D;  4LD9 D;  2PYO B;  5DNN C;  5BO0 B;  4XUJ A;  4HGA B;  4KGC B;  5B2J D;  3AZN D;  1ULY A;  3KWQ C;  3MGS C;  2FJ7 A;  2UWX A;  5B40 D;  4WZS B;  5B0Y D;  1HQ3 B;  3UTA A;  2CV5 B;  1P3P D;  1F66 B;  3AFA B;  3AZE A;  4ZUX C;  1P3I B;  3A6N C;  5CPI B;  3AN2 B;  5GT0 D;  3O62 D;  3WTP A;  3B6G D;  3W96 D;  1BH8 A;  4G92 C;  3C1C B;  3AYW B;  1EQZ D;  3VH6 T;  1KX4 D;  1M1A C;  2RVQ D;  5KDM B;  1S32 A;  2J8P A;  1P3B B;  2CWE A;  2ZM5 A;  3W97 B;  1PZR A;  5GSU A;  3AL0 C;  4Z5T C;  5AV8 D;  4YM6 B;  1P3O A;  3AV2 C;  2JCH A;  3LZ0 C;  4H9O B;  2F8N H;  2Y2K A;  5DNN D;  2LY8 A;  3MGR A;  3AZK B;  1JFI B;  4XZQ C;  5AV6 A;  1B67 A;  5CHL B;  1P3K C;  3KWQ D;  3UTB C;  5CPK A;  3W98 B;  4AWL C;  3W98 C;  4G91 B;  3C1B D;  5JRG C;  3AZL B;  3REH A;  1ID3 B;  4H9S C;  1KX5 B;  3LEL A;  1KX5 C;  3A6N D;  3AZF C;  2HUE B;  4DRA A;  4DRB A;  1WWS A;  3MNN B;  3X1S A;  3WA9 D;  4X23 D;  5AVB B;  2HIO A;  4CAY A;  5B33 A;  2ARO D;  2G5H C;  5DNM A;  3X1T C;  1U35 A;  1M1A D;  3AV1 A;  3A1I A;  1P3M D;  3B6F B;  4R8P C;  3REI A;  4Z5T D;  1M19 B;  1BH9 A;  4WNN A;  1R4V A;  3AV2 D;  4J8V B;  5AV5 A;  1B6W A;  3LZ0 D;  3MGQ A;  4H9Q B;  5BNX A;  4WU8 B;  3LJA A;  4Z66 C;  3KSY A;  5E5A C;  3MVD D;  3REL A;  4WJ3 C;  5JRG D;  1M18 A;  3TU4 B;  4QLC C;  1P3O C;  3AZF D;  3AZH D;  3X1V D;  1P3A D;  3R45 B;  5BT1 C;  5G49 B;  2ZY4 A;  4KUD A;  5B0Z B;  3AZJ A;  2Y2O A;  5B1M B;  4XUJ D;  5B1M C;  5AY8 B;  2IO5 C;  5JA4 B;  5CPK C;  2YFW B;  5B32 B;  1P3L B;  3UTA D;  1P3L C;  3W99 C;  3H0R C;  3WKJ A;  4CSR B;  3AZI B;  4LD9 B;  5CP6 C;  4Z2M G;  5BNV A;  5AV9 B;  2F2A C;  3WTP D;  1ZLA A;  3AZN B;  5F99 B;  5B2J C;  1P3G A;  1F1E A;  2F8N K;  1KX3 B;  5B40 B;  4J8X A;  2HIO C;  5B0Y B;  1P3P B;  5B33 C;  5AVC B;  2PYO A;  1S32 D;  5GT3 A;  4KGC A;  5GT0 B;  2NQB A;  3MGP B;  5GSU D;  3O62 B;  3REI C;  4J8U B;  3W96 B;  1T3U A;  3B6G C;  1HQ3 A;  3NQU B;  2CV5 A;  3AFA A;  4QLC D;  1P3O D;  5FUG B;  2JE5 A;  5B2I B;  3KUY C;  5BT1 D;  5CPI A;  3AN2 A;  4E45 A;  4YS3 A;  1EQZ B;  1KX4 B;  3VH5 W;  2NZD A;  2Y2M A;  3MGR D;  3EPJ A;  4ZBJ C;  5AV6 D;  5B31 G;  3LJA C;  2BYK B;  5CPK D;  3C1C A;  3UT9 A;  3REL C;  3X1U A;  5CPJ A;  3W99 D;  3AYW A;  5AV8 C;  3REH D;  3LEL D;  5B32 G;  5DNN B;  3WAA A;  1P3F A;  3KWQ B;  3X1S D;  3MGS B;  4JJN C;  3IP4 C;  4NE3 A;  3REJ A;  2HIO D;  3F6T A;  5B33 D;  1TZY A;  5B1L A;  3C1B C;  1U35 D;  4ZUX B;  3AZK A;  3AV1 D;  3A6N B;  3REI D;  4KHA A;  1H3O A;  3H0M C;  1ZLA C;  3AZL A;  3EPH A;  4G92 B;  1ID3 A;  3WA9 C;  2Y2L A;  4X23 C;  3KUY D;  5AV5 D;  4J8X C;  2ARO C;  1M1A B;  3B0C W;  1P3M B;  1P3M C;  5GT3 C;  3LJA D;  2Y2J A;  2NQB C;  4Z5T B;  3REL D;  5GXQ A;  1M18 D;  3AV2 B;  3NQJ A;  3LZ0 B;  1HTA A;  4KUD D;  4XZQ B;  3AZM A;  2NZD C;  3AZJ D;  2F8N B;  1P3K B;  3UTB B;  1AOI A;  4JJN D;  4J8W A;  3MVD B;  4AWL B;  3MVD C;  3UT9 C;  5JRG B;  3X1U C;  4H9Q A;  3LZ1 C;  3WKJ D;  3AZF B;  3AZH B;  3X1V B;  3AZH C;  3X1V C;  1P3A C;  1ZLA D;  4XUJ B;  3V9R A;  4XUJ C;  1TAF A;  3TU4 A;  4UUZ B;  1P34 A;  4J8X D;  2FJ7 C;  3X1T B;  3UTA C;  1TZY C;  5B1L C;  5B31 A;  2Y2I A;  2PYO D;  3KXB A;  3AZE C;  5GT3 D;  3EPL A;  4WU9 A;  3REK A;  4KGC D;  2NQB D;  4R8P B;  5JA4 A;  3WTP C;  3VH5 T;  5B32 A;  1HQ3 D;  1BH8 B;  3AFA D;  3AZI A;  5CPI D;  3AN2 D;  4YS3 D;  2ZY2 A;  2NZD D;  5AV9 A;  3B0B A;  1S32 C;  4H9N A;  5F99 A;  4Z66 B;  5E5A B;  5GSU B;  5GSU C;  1KX3 A;  3UT9 D;  2F8N G;  4Z2M H;  5CPJ D;  3X1U D;  5GXQ C;  5AVC A;  3LZ1 D;  4QLC B;  1P3O B;  3VH6 A;  1W2E A;  3MGP A;  2XD5 A;  1M19 A;  3MGR B;  3WAA D;  5B24 A;  4EO5 C;  3MGR C;  4J8U A;  2ZY5 A;  1P3F D;  2IO5 B;  5AV6 C;  4DQY B;  3AZG A;  5CPK B;  1AOI C;  5FUG A;  4J8W C;  5B2I A;  3REJ D;  2FJ7 D;  1TZY D;  3W99 B;  5B1L D;  2Y2N A;  3REH C;  3AZE D;  3LEL B;  3LEL C;  5CP6 B;  3H0L C;  5B2J B;  3B0C T;  4H9R A;  3AZL D;  2FFF B;  4NE5 A;  3X1S C;  1ID3 D;  1P34 C;  4UPK A;  2HIO B;  4CAY B;  5B33 B;  4M6B A;  1U35 B;  5DNM C;  5DNN A;  5B31 C;  3AV1 B;  1U35 C;  5BO0 A;  3AV1 C;  3KXB C;  3KFU G;  3KWQ A;  3MGS A;  3REI B;  2RIQ A;  3B6G B;  5GXQ D;  1F66 A;  4WNN B;  2YFV B;  5C3I C;  4ZUX A;  2VQR A;  3KUY B;  1P3I A;  3A6N A;  5AV5 B;  5AV5 C;  3MGQ C;  5BNX B;  4WV4 B;  4ZBJ B;  3AZM D;  3LJA B;  1AOI D;  4J8W D;  3REL B;  1A7W A;  1M18 B;  5AV8 B;  1M18 C;  5KDM A;  3P5J B;  1P3B A;  3W97 A;  4Z5T A;  1M19 C;  4KUD C;  3AZJ B;  3FDD A;  3AZJ C;  4YM6 A;  4JJN B;  3TU4 D;  1P34 D;  3EPK A;  3AZG C;  3C1B B;  5DNM D;  4H9O A;  5B31 D;  3WKJ B;  4XZQ A;  3KXB D;  1JFI A;  3WKJ C;  2F8N A;  1P3K A;  4WU9 D;  3REK D;  3UTB A;  3B0D C;  5BNV B;  3W98 A;  2BYM B;  1ZLA B;  5B32 D;  3WA9 B;  4H9S A;  2Y2H A;  1P3G C;  4X23 B;  1KX5 A;  1Z2C B;  4J8X B;  2ARO B;  4H9P B;  1N1J B;  3MGQ D;  2PYO C;  5AV9 D;  3MNN A;  5GT3 B;  4HGA C;  5F99 D;  4KGC C;  2NQB B;  3WTP E;  4UUZ A;  5AVB A;  1KX3 D;  3X1T A;  1HQ3 C;  2CV5 C;  5AVC D;  1F66 C;  3AFA C;  1P3I C;  5CPI C;  4YS3 B;  4R8P A;  3MGP D;  4YS3 C;  3AN2 C;  3B6F A;  1M19 D;  2NZD B;  5B24 D;  4J8U D;  3AZG D;  4J8V A;  3UT9 B;  5B2I D;  3C1C C;  3X1U B;  5CPJ B;  5CPJ C;  1Q9C A;  3LZ1 B;  3AYW C;  4WU8 A;  2Y2G A;  1P3A B;  4Z66 A;  1P3B C;  3W97 C;  5E5A A;  3WAA B;  2W8S A;  3WAA C;  1P3F B;  1P3F C;  2Y2Q A;  1P3G D;  4QLC A;  4YM6 C;  3REJ B;  2DF4 C;  2FJ7 B;  3REJ C;  3UTA B;  3R45 A;  1TZY B;  1BFM A;  5B1L B;  5G49 A;  2ZY3 A;  5B0Z A;  3AZE B;  5B1M A;  3AZK C;  5AY8 A;  3MGS D;  3WTP B;  4KHA B;  2YFW A;  1H3O B;  1P3L A;  3W99 A;  2CV5 D;  4G91 C;  1F66 D;  3AZL C;  1KU5 A;  1ID3 C;  4ZUX D;  4CSR A;  1P3I D;  4NE6 A;  5CP6 A;  4LD9 A;  2HUE C;  1S32 B;  5B2J A;  3MNN C;  3AZN A;  5BS7 A;  4E44 A;  3C1C D;  5AVB C;  5B40 A;  1P3P A;  5B0Y A;  5GXQ B;  3AYW D;  3A1K A;  3NQJ B;  1P3B D;  5GT0 A;  3W97 D;  3B6F C;  3O62 A;  4EO5 B;  3AZM B;  3B6G A;  3W96 A;  3AZM C;  3NQU A;  5AV6 B;  4YM6 D;  2YFV A;  1AOI B;  4J8W B;  3KUY A;  4J8V C;  2L5A A;  1EQZ A;  3REH B;  1KX4 A;  4XZQ D;  3AZK D;  4WU8 C;  2F8N D;  1P3K D;  3UTB D;  2BYK A;  4NFT A;  3W98 D;  2G5I C;  3V9R B;  3VH6 W;  1TAF B;  5AV8 A;  3X1S B;  1P34 B;  1KX5 D;  3TU4 C;  2BG1 A;  5DNM B;  5B31 B;  3KXB B;  5B0Z C;  3MNN D;  4WU9 B;  3REK B;  4WU9 C;  5AY8 C;  4JJN A;  3REK C;  5AVB D;  2XD1 A;  3C1B A;  5B32 C;  3X1T D;  1BH9 B;  5C3I B;  2JSS A;  3AZI C;  3MGQ B;  3B6F D;  4LD9 C;  4R8P D;  2BYM A;  5AV9 C;  4H9N B;  3VH5 A;  3WA9 A;  3AZN C;  5F99 C;  4X23 A;  5BS7 C;  4J8V D;  1KX3 C;  2ARO A;  5B40 C;  4H9P A;  5B0Y C;  1P3P C;  1N1J A;  1M1A A;  5AVC C;  4WU8 D;  1P3M A;  4Z66 D;  5GT0 C;  5E5A D;  3MGP C;  4KUD B;  3O62 C;  5B24 B; 
#chains in the Genus database with same CATH homology
 5B24 C;  3W96 C;  4J8U C;  3AV2 A;  3AZG B;  3EG5 B;  5B2I C;  2Y2P A;  3LZ0 A;  1EQZ C;  1KX4 C;  5B0Z D;  2RVQ C;  5B1M D;  1WWI A;  2DQN C;  3B0D B;  5AY8 D;  3MVD A;  1P3L D;  5JRG A;  4H9R B;  1P3G B;  3LZ1 A;  3AZF A;  3AZH A;  3AZI D;  3X1V A;  1P3A A;  5CP6 D;  4LD9 D;  2PYO B;  5DNN C;  5BO0 B;  4XUJ A;  4HGA B;  4KGC B;  5B2J D;  3AZN D;  1ULY A;  3KWQ C;  3MGS C;  2FJ7 A;  2UWX A;  5B40 D;  4WZS B;  5B0Y D;  1HQ3 B;  3UTA A;  2CV5 B;  1P3P D;  1F66 B;  3AFA B;  3AZE A;  4ZUX C;  1P3I B;  3A6N C;  5CPI B;  3AN2 B;  5GT0 D;  3O62 D;  3WTP A;  3B6G D;  3W96 D;  1BH8 A;  4G92 C;  3C1C B;  3AYW B;  1EQZ D;  3VH6 T;  1KX4 D;  1M1A C;  2RVQ D;  5KDM B;  1S32 A;  2J8P A;  1P3B B;  2CWE A;  2ZM5 A;  3W97 B;  1PZR A;  5GSU A;  3AL0 C;  4Z5T C;  5AV8 D;  4YM6 B;  1P3O A;  3AV2 C;  2JCH A;  3LZ0 C;  4H9O B;  2F8N H;  2Y2K A;  5DNN D;  2LY8 A;  3MGR A;  3AZK B;  1JFI B;  4XZQ C;  5AV6 A;  1B67 A;  5CHL B;  1P3K C;  3KWQ D;  3UTB C;  5CPK A;  3W98 B;  4AWL C;  3W98 C;  4G91 B;  3C1B D;  5JRG C;  3AZL B;  3REH A;  1ID3 B;  4H9S C;  1KX5 B;  3LEL A;  1KX5 C;  3A6N D;  3AZF C;  2HUE B;  4DRA A;  4DRB A;  1WWS A;  3MNN B;  3X1S A;  3WA9 D;  4X23 D;  5AVB B;  2HIO A;  4CAY A;  5B33 A;  2ARO D;  2G5H C;  5DNM A;  3X1T C;  1U35 A;  1M1A D;  3AV1 A;  3A1I A;  1P3M D;  3B6F B;  4R8P C;  3REI A;  4Z5T D;  1M19 B;  1BH9 A;  4WNN A;  1R4V A;  3AV2 D;  4J8V B;  5AV5 A;  1B6W A;  3LZ0 D;  3MGQ A;  4H9Q B;  5BNX A;  4WU8 B;  3LJA A;  4Z66 C;  3KSY A;  5E5A C;  3MVD D;  3REL A;  4WJ3 C;  5JRG D;  1M18 A;  3TU4 B;  4QLC C;  1P3O C;  3AZF D;  3AZH D;  3X1V D;  1P3A D;  3R45 B;  5BT1 C;  5G49 B;  2ZY4 A;  4KUD A;  5B0Z B;  3AZJ A;  2Y2O A;  5B1M B;  4XUJ D;  5B1M C;  5AY8 B;  2IO5 C;  5JA4 B;  5CPK C;  2YFW B;  5B32 B;  1P3L B;  3UTA D;  1P3L C;  3W99 C;  3H0R C;  3WKJ A;  4CSR B;  3AZI B;  4LD9 B;  5CP6 C;  4Z2M G;  5BNV A;  5AV9 B;  2F2A C;  3WTP D;  1ZLA A;  3AZN B;  5F99 B;  5B2J C;  1P3G A;  1F1E A;  2F8N K;  1KX3 B;  5B40 B;  4J8X A;  2HIO C;  5B0Y B;  1P3P B;  5B33 C;  5AVC B;  2PYO A;  1S32 D;  5GT3 A;  4KGC A;  5GT0 B;  2NQB A;  3MGP B;  5GSU D;  3O62 B;  3REI C;  4J8U B;  3W96 B;  1T3U A;  3B6G C;  1HQ3 A;  3NQU B;  2CV5 A;  3AFA A;  4QLC D;  1P3O D;  5FUG B;  2JE5 A;  5B2I B;  3KUY C;  5BT1 D;  5CPI A;  3AN2 A;  4E45 A;  4YS3 A;  1EQZ B;  1KX4 B;  3VH5 W;  2NZD A;  2Y2M A;  3MGR D;  3EPJ A;  4ZBJ C;  5AV6 D;  5B31 G;  3LJA C;  2BYK B;  5CPK D;  3C1C A;  3UT9 A;  3REL C;  3X1U A;  5CPJ A;  3W99 D;  3AYW A;  5AV8 C;  3REH D;  3LEL D;  5B32 G;  5DNN B;  3WAA A;  1P3F A;  3KWQ B;  3X1S D;  3MGS B;  4JJN C;  3IP4 C;  4NE3 A;  3REJ A;  2HIO D;  3F6T A;  5B33 D;  1TZY A;  5B1L A;  3C1B C;  1U35 D;  4ZUX B;  3AZK A;  3AV1 D;  3A6N B;  3REI D;  4KHA A;  1H3O A;  3H0M C;  1ZLA C;  3AZL A;  3EPH A;  4G92 B;  1ID3 A;  3WA9 C;  2Y2L A;  4X23 C;  3KUY D;  5AV5 D;  4J8X C;  2ARO C;  1M1A B;  3B0C W;  1P3M B;  1P3M C;  5GT3 C;  3LJA D;  2Y2J A;  2NQB C;  4Z5T B;  3REL D;  5GXQ A;  1M18 D;  3AV2 B;  3NQJ A;  3LZ0 B;  1HTA A;  4KUD D;  4XZQ B;  3AZM A;  2NZD C;  3AZJ D;  2F8N B;  1P3K B;  3UTB B;  1AOI A;  4JJN D;  4J8W A;  3MVD B;  4AWL B;  3MVD C;  3UT9 C;  5JRG B;  3X1U C;  4H9Q A;  3LZ1 C;  3WKJ D;  3AZF B;  3AZH B;  3X1V B;  3AZH C;  3X1V C;  1P3A C;  1ZLA D;  4XUJ B;  3V9R A;  4XUJ C;  1TAF A;  3TU4 A;  4UUZ B;  1P34 A;  4J8X D;  2FJ7 C;  3X1T B;  3UTA C;  1TZY C;  5B1L C;  5B31 A;  2Y2I A;  2PYO D;  3KXB A;  3AZE C;  5GT3 D;  3EPL A;  4WU9 A;  3REK A;  4KGC D;  2NQB D;  4R8P B;  5JA4 A;  3WTP C;  3VH5 T;  5B32 A;  1HQ3 D;  1BH8 B;  3AFA D;  3AZI A;  5CPI D;  3AN2 D;  4YS3 D;  2ZY2 A;  2NZD D;  5AV9 A;  3B0B A;  1S32 C;  4H9N A;  5F99 A;  4Z66 B;  5E5A B;  5GSU B;  5GSU C;  1KX3 A;  3UT9 D;  2F8N G;  4Z2M H;  5CPJ D;  3X1U D;  5GXQ C;  5AVC A;  3LZ1 D;  4QLC B;  1P3O B;  3VH6 A;  1W2E A;  3MGP A;  2XD5 A;  1M19 A;  3MGR B;  3WAA D;  5B24 A;  4EO5 C;  3MGR C;  4J8U A;  2ZY5 A;  1P3F D;  2IO5 B;  5AV6 C;  4DQY B;  3AZG A;  5CPK B;  1AOI C;  5FUG A;  4J8W C;  5B2I A;  3REJ D;  2FJ7 D;  1TZY D;  3W99 B;  5B1L D;  2Y2N A;  3REH C;  3AZE D;  3LEL B;  3LEL C;  5CP6 B;  3H0L C;  5B2J B;  3B0C T;  4H9R A;  3AZL D;  2FFF B;  4NE5 A;  3X1S C;  1ID3 D;  1P34 C;  4UPK A;  2HIO B;  4CAY B;  5B33 B;  4M6B A;  1U35 B;  5DNM C;  5DNN A;  5B31 C;  3AV1 B;  1U35 C;  5BO0 A;  3AV1 C;  3KXB C;  3KFU G;  3KWQ A;  3MGS A;  3REI B;  2RIQ A;  3B6G B;  5GXQ D;  1F66 A;  4WNN B;  2YFV B;  5C3I C;  4ZUX A;  2VQR A;  3KUY B;  1P3I A;  3A6N A;  5AV5 B;  5AV5 C;  3MGQ C;  5BNX B;  4WV4 B;  4ZBJ B;  3AZM D;  3LJA B;  1AOI D;  4J8W D;  3REL B;  1A7W A;  1M18 B;  5AV8 B;  1M18 C;  5KDM A;  3P5J B;  1P3B A;  3W97 A;  4Z5T A;  1M19 C;  4KUD C;  3AZJ B;  3FDD A;  3AZJ C;  4YM6 A;  4JJN B;  3TU4 D;  1P34 D;  3EPK A;  3AZG C;  3C1B B;  5DNM D;  4H9O A;  5B31 D;  3WKJ B;  4XZQ A;  3KXB D;  1JFI A;  3WKJ C;  2F8N A;  1P3K A;  4WU9 D;  3REK D;  3UTB A;  3B0D C;  5BNV B;  3W98 A;  2BYM B;  1ZLA B;  5B32 D;  3WA9 B;  4H9S A;  2Y2H A;  1P3G C;  4X23 B;  1KX5 A;  1Z2C B;  4J8X B;  2ARO B;  4H9P B;  1N1J B;  3MGQ D;  2PYO C;  5AV9 D;  3MNN A;  5GT3 B;  4HGA C;  5F99 D;  4KGC C;  2NQB B;  3WTP E;  4UUZ A;  5AVB A;  1KX3 D;  3X1T A;  1HQ3 C;  2CV5 C;  5AVC D;  1F66 C;  3AFA C;  1P3I C;  5CPI C;  4YS3 B;  4R8P A;  3MGP D;  4YS3 C;  3AN2 C;  3B6F A;  1M19 D;  2NZD B;  5B24 D;  4J8U D;  3AZG D;  4J8V A;  3UT9 B;  5B2I D;  3C1C C;  3X1U B;  5CPJ B;  5CPJ C;  1Q9C A;  3LZ1 B;  3AYW C;  4WU8 A;  2Y2G A;  1P3A B;  4Z66 A;  1P3B C;  3W97 C;  5E5A A;  3WAA B;  2W8S A;  3WAA C;  1P3F B;  1P3F C;  2Y2Q A;  1P3G D;  4QLC A;  4YM6 C;  3REJ B;  2DF4 C;  2FJ7 B;  3REJ C;  3UTA B;  3R45 A;  1TZY B;  1BFM A;  5B1L B;  5G49 A;  2ZY3 A;  5B0Z A;  3AZE B;  5B1M A;  3AZK C;  5AY8 A;  3MGS D;  3WTP B;  4KHA B;  2YFW A;  1H3O B;  1P3L A;  3W99 A;  2CV5 D;  4G91 C;  1F66 D;  3AZL C;  1KU5 A;  1ID3 C;  4ZUX D;  4CSR A;  1P3I D;  4NE6 A;  5CP6 A;  4LD9 A;  2HUE C;  1S32 B;  5B2J A;  3MNN C;  3AZN A;  5BS7 A;  4E44 A;  3C1C D;  5AVB C;  5B40 A;  1P3P A;  5B0Y A;  5GXQ B;  3AYW D;  3A1K A;  3NQJ B;  1P3B D;  5GT0 A;  3W97 D;  3B6F C;  3O62 A;  4EO5 B;  3AZM B;  3B6G A;  3W96 A;  3AZM C;  3NQU A;  5AV6 B;  4YM6 D;  2YFV A;  1AOI B;  4J8W B;  3KUY A;  4J8V C;  2L5A A;  1EQZ A;  3REH B;  1KX4 A;  4XZQ D;  3AZK D;  4WU8 C;  2F8N D;  1P3K D;  3UTB D;  2BYK A;  4NFT A;  3W98 D;  2G5I C;  3V9R B;  3VH6 W;  1TAF B;  5AV8 A;  3X1S B;  1P34 B;  1KX5 D;  3TU4 C;  2BG1 A;  5DNM B;  5B31 B;  3KXB B;  5B0Z C;  3MNN D;  4WU9 B;  3REK B;  4WU9 C;  5AY8 C;  4JJN A;  3REK C;  5AVB D;  2XD1 A;  3C1B A;  5B32 C;  3X1T D;  1BH9 B;  5C3I B;  2JSS A;  3AZI C;  3MGQ B;  3B6F D;  4LD9 C;  4R8P D;  2BYM A;  5AV9 C;  4H9N B;  3VH5 A;  3WA9 A;  3AZN C;  5F99 C;  4X23 A;  5BS7 C;  4J8V D;  1KX3 C;  2ARO A;  5B40 C;  4H9P A;  5B0Y C;  1P3P C;  1N1J A;  1M1A A;  5AVC C;  4WU8 D;  1P3M A;  4Z66 D;  5GT0 C;  5E5A D;  3MGP C;  4KUD B;  3O62 C;  5B24 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...