4Z66D

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
94
structure length
94
Chain Sequence
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 37
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4z66D00
5E5AD 2YFWB 4HGAC 3REHA 3REJA 3REIC 4JJNB 4LD9A 5CPID 1P3LD 5B32G 4LD9C 5B31A 4E44A 3UT9D 2F8NG 5B24B 4KUDA 3B0CT 3RELB 3TU4D 5GSUC 1AOIA 4J8XD 1P34B 4H9RB 5AV5A 1M18D 3AZGD 2IO5B 1KX4B 3WKJC 3AZLA 4Z66A 3LELC 5B2IC 3AN2C 4WNNB 1A7WA 5DNMB 5C3IB 4KHAA 5CPJC 5JA4B 3REHC 3REJC 5B1MA 1KX3A 3REKB 3NQUB 3W96C 5JRGD 3WAAB 2CV5C 1P3KC 3AZFC 4Z5TC 3UTAB 1M19A 3AZND 2HIOC 3WTPC 3B0DB 4ZUXD 3UT9A 3AFAA 5B24D 4X23A 1P3PB 3W98B 4X23C 4KGCB 3MGPB 3VH6W 3LZ0B 5B0ZA 1P3MA 3WA9B 4J8XA 4R8PC 5AY8B 4Z5TB 1P3AC 1P3KB 4R8PD 1P3BB 2F8NK 4H9SC 1KX5C 1H3OA 1N1JA 5GXQC 4WU9C 3X1UC 1ZLAD 5GSUD 1ULYA 5GXQA 4WU9A 3C1CD 3RELD 5JA4A 5GT0A 4XUJD 2NQBD 3LZ0C 2NQBC 3WKJD 3C1BC 5JRGA 3MGSC 3AV2D 5AV8C 3AZKA 4M6BA 3W99B 5AV8A 2LY8A 2BYMA 5B1LC 3O62A 5CPKD 2FJ7A 1ID3A 5CPIB 1P3LB 3AZFB 5GSUB 3MGPA 3B6GA 3R45A 4ZUXA 3AZJB 4YS3D 1P3MB 3WA9A 3X1TB 4NE3A 1P3IB 5B24C 2YFWA 1TAFA 2F8NA 5B33A 3W97B 3VH6T 4LD9B 1P3GC 5BNVB 3W99D 3B6FB 3AV1C 5B40C 1HQ3D 2IO5C 4WU8C 4J8WB 5GXQD 4WU9D 3RELA 5GT0D 3AZGC 2AROA 2HUEC 3A6NA 4YS3B 3KWQB 1P34C 5AV6A 2NQBA 2CV5A 2BYMB 3X1UD 1ZLAC 1M1AC 3X1SA 5B2ID 3AN2D 3AV2A 5CPIA 1P3LA 1P3PD 4J8UA 4EO5B 3VH5W 1Q9CA 3UTBC 3LJAC 3AZMC 3AZED 5CPKA 1P3OD 5FUGB 3LJAA 3AZMA 4Z2MH 5AY8C 3V9RB 4E45A 3MGPD 3W96A 4H9OA 5B0ZC 3AZEB 4HGAB 3WTPE 3NQJA 5B2JA 3WTPD 1ZLAB 1B67A 5AV5D 4G91C 3MGQA 5F99D 2CWEA 3LZ1A 3AZGB 1P3FA 3UTAA 1M19B 3X1VB 3AYWC 3WAAD 3B6FD 2F8NH 3UT9B 1KX4D 2L5AA 3WAAC 1P3AD 1EQZC 5DNMC 4CSRB 5B1MD 5AVCA 1F66C 4H9SA 5B40D 1KX5A 2CV5D 3MNNC 3X1UA 5B2IA 3X1SD 3AN2A 5B0YA 3TU4B 5E5AC 5B0YC 3V9RA 3AZNC 2BYKA 1M19D 5CP6A 3MVDA 3AZNA 4YM6C 2NZDA 3AZEA 5BS7C 5GT0B 1P3OA 3LJAD 3AZMD 5B24A 4X23D 4CAYA 1JFIA 4KUDB 1S32C 3AZKC 5GT3C 4H9NB 5B0ZD 3C1BB 2PYOA 3UTBD 4XZQC 1P3MD 3X1VA 5KDMB 5B2JD 3WTPA 4H9RA 3AZHB 4J8WD 5AY8D 5F99A 4H9QB 4J8WC 5GT3B 3LZ1D 1P3FD 3KWQD 1ID3B 1WWSA 4UUZB 5GSUA 1AOIC 5G49B 3AV1B 1KX4A 3B6FC 3X1TA 4G92B 5DNNB 5B32B 1KX5B 1BH8B 4XUJA 1P3AA 4WNNA 1TAFB 5B0YB 2F8NB 5E5AB 4J8VC 4R8PB 3AZID 3WKJA 1KX3B 3KXBC 3MNNB 4KGCC 3W98C 5CPKC 1F66B 3B6GC 3AZIB 3A6NC 5BNXA 2AROC 3REID 1JFIB 2FJ7D 1BH9A 3MGRC 1P34A 1ID3D 5AV9B 2HIOB 1KU5A 3B6GD 4Z5TD 3C1BA 2AROB 3A6NB 4YS3A 3WA9D 3MGSB 5AV6B 3AFAB 2NQBB 2CV5B 1U35B 3X1VC 1M19C 3MGQC 4Z2MG 2PYOD 1HTAA 1M18B 3X1VD 4UUZA 3KUYD 5AY8A 1TZYB 1M18C 5DNNA 5B32A 1H3OB 1N1JB 5B1MB 1HQ3A 3KUYB 5AVBD 4J8XC 4XUJC 4NFTA 5AV6C 3LELD 4AWLC 5AV6D 3MNNA 4EO5C 4WZSB 3AYWD 3AV2C 5CPJD 4Z66C 3AZIA 1P3PC 1P3PA 4J8UD 4YM6A 3AZKB 5AV5B 5DNMD 1P3KD 3LZ0A 4J8VD 5B1LD 5AVBB 3AZFA 5JRGC 4Z5TA 3W96D 5BO0A 3KXBD 3R45B 3AZLB 1P3IA 3MGRD 1ID3C 5C3IC 5CPJB 5F99C 3MGQD 5B33B 3KUYA 1S32D 3UTAD 3NQUA 4DRAA 5BNVA 3AZHC 3WAAA 1KX4C 3B6FA 2NZDB 5DNND 5B32D 3X1TC 4XZQD 3KSYA 1P3MC 3AZJC 2PYOC 3VH5T 5JRGB 5AVBC 1U35D 3C1CC 4WU8D 3LZ1C 1P3FC 3O62B 5AVCD 5GT0C 5B40A 3MNND 1KX5D 3AYWA 4YM6B 3W98A 5AV9D 1B6WA 5CP6C 3MVDC 3RELC 5B0YD 4H9QA 4Z66B 2NZDC 3AZEC 3AV2B 3MGSD 4YM6D 5CP6D 3MVDD 5BO0B 2YFVA 2NZDD 5DNMA 1P3KA 3LZ0D 4KHAB 1P3BA 4J8VA 4NE6A 1M1AA 1BH8A 4XUJB 3REIB 1EQZB 3REKA 4ZBJC 5GXQB 1TZYD 4WU9B 4J8UC 5E5AA 4H9OB 3REHD 3REJD 3UTBA 1TZYC 1P3ID 4J8WA 3MGRA 4ZUXC 3WA9C 3KWQC 1F1EA 5AV5C 2HUEB 5BNXB 4YS3C 3KWQA 1BH9B 4X23B 4KUDD 1P3GD 2JSSA 3AV1D 4XZQA 4H9PB 3X1TD 5B40B 5B0ZB 2RVQC 3W97D 1U35A 1P3GB 3UTAC 4WU8A 5BT1C 4AWLB 3AZIC 2RVQD 3B0BA 3W97C 5CPKB 1M18A 3LJAB 3AZMB 5BT1D 1HQ3C 4JJNA 3W98D 2YFVB 5B1MC 3W96B 1KX3C 4J8VB 5B31B 1M1AB 1EQZA 3REIA 3X1SC 2BYKB 1P34D 3NQJB 5B2JB 5CPIC 1P3LC 4QLCD 4G92C 3O62C 3C1BD 1P3BD 1P3OB 3MGQB 1M1AD 5B1LB 1AOIB 5AV8B 4QLCB 4WV4B 3AZHA 4H9PA 4XZQB 3B6GB 5B2JC 5B33C 3AZJA 5F99B 3X1SB 5GT3A 1R4VA 5AVBA 1S32B 1P3GA 3AFAD 4KUDC 5G49A 1P3IC 3X1UB 3AV1A 3AZLC 3LELA 3W97A 1P3AB 3AZNB 5DNNC 5B32C 4JJNC 5CPJA 4R8PA 1WWIA 4JJND 4NE5A 3W99C 3VH6A 1ZLAA 1BFMA 3C1CA 5AVCC 1F66A 1EQZD 3B0DC 5B1LA 3WTPB 5KDMA 3AZFD 2HIOA 3KXBA 4QLCA 3VH5A 2FJ7C 4KGCA 4QLCC 3UT9C 5BS7A 3AYWB 4J8XB 4LD9D 3KUYC 4J8UB 3AZKD 1P3OC 4ZBJB 5AV8D 3REHB 4G91B 5B31D 3REJB 3O62D 1P3BC 5FUGA 1S32A 3AZHD 3B0CW 5B31C 3TU4C 3AZJD 5B2IB 3LELB 3AN2B 5GT3D 3TU4A 3WKJB 1HQ3B 3MGPC 1U35C 1AOID 5CP6B 3MVDB 3AFAC 3UTBB 2F8ND 5B33D 5AV9C 3LZ1B 3AZGA 4CAYB 1P3FB 3MGRB 5AV9A 5CHLB 3C1CB 3W99A 4DRBA 4H9NA 2PYOB 3AZLD 4Z66D 3MGSA 2FJ7B 3KXBB 3REKC 1F66D 5B31G 4ZUXB 2AROD 3A6ND 5AVCB 4CSRA 3REKD 1KX3D 2HIOD 4WU8B 1TZYA 4KGCD
chains in the Genus database with same CATH superfamily
5E5AD 2YFWB 4HGAC 3REHA 3REJA 3REIC 4JJNB 4LD9A 5CPID 1P3LD 5B32G 4LD9C 5B31A 4E44A 3UT9D 2F8NG 3F6TA 5B24B 4KUDA 3B0CT 2ZM5A 3RELB 3TU4D 5GSUC 1AOIA 4J8XD 2XD1A 1P34B 4H9RB 5AV5A 1M18D 3AZGD 2Y2QA 2IO5B 3P5JB 3EPJA 1KX4B 3WKJC 3AZLA 4Z66A 3LELC 5B2IC 3AN2C 4WNNB 1A7WA 5DNMB 5C3IB 4KHAA 5CPJC 5JA4B 3REHC 3REJC 5B1MA 1KX3A 3REKB 3NQUB 3W96C 5JRGD 3WAAB 2CV5C 1P3KC 3AZFC 4Z5TC 3UTAB 1M19A 3AZND 2HIOC 3WTPC 3B0DB 4ZUXD 3UT9A 2Y2MA 3AFAA 5B24D 4X23A 1P3PB 3W98B 4X23C 4KGCB 3MGPB 3VH6W 3LZ0B 5B0ZA 1P3MA 3WA9B 4J8XA 4R8PC 5AY8B 4Z5TB 1P3AC 1P3KB 4R8PD 1P3BB 2F8NK 4H9SC 1KX5C 1H3OA 1N1JA 5GXQC 4WU9C 3X1UC 1ZLAD 5GSUD 1ULYA 5GXQA 4WU9A 3C1CD 3RELD 5JA4A 5GT0A 2UWXA 4XUJD 2Y2HA 2NQBD 3LZ0C 3FDDA 3A1IA 2NQBC 3WKJD 3C1BC 5JRGA 3MGSC 3AV2D 5AV8C 3AZKA 4M6BA 3W99B 5AV8A 2LY8A 2BYMA 5B1LC 3O62A 5CPKD 2FJ7A 1ID3A 5CPIB 1P3LB 3AZFB 5GSUB 3MGPA 3B6GA 3R45A 4ZUXA 3AZJB 4YS3D 1P3MB 3WA9A 3EPLA 3X1TB 4NE3A 1P3IB 5B24C 2YFWA 1TAFA 2F8NA 5B33A 3W97B 3VH6T 4LD9B 1P3GC 5BNVB 3W99D 3B6FB 3AV1C 5B40C 1HQ3D 2IO5C 4WU8C 4J8WB 5GXQD 4WU9D 3RELA 3H0LC 5GT0D 3AZGC 2AROA 2HUEC 3A6NA 4YS3B 3KWQB 1P34C 5AV6A 2NQBA 2CV5A 2BYMB 3X1UD 1ZLAC 1M1AC 3X1SA 5B2ID 3AN2D 3AV2A 5CPIA 1P3LA 1P3PD 4J8UA 4EO5B 3VH5W 1Q9CA 3UTBC 3LJAC 3AZMC 3AZED 5CPKA 1P3OD 5FUGB 3LJAA 3AZMA 4Z2MH 5AY8C 3V9RB 4E45A 3MGPD 1PZRA 3W96A 4H9OA 5B0ZC 3AZEB 4HGAB 3WTPE 3NQJA 5B2JA 3WTPD 1ZLAB 1B67A 5AV5D 3AL0C 4G91C 3MGQA 5F99D 2CWEA 3LZ1A 3AZGB 1P3FA 2Y2NA 3UTAA 3X1VB 1M19B 3AYWC 3WAAD 3B6FD 2F8NH 3UT9B 1KX4D 2L5AA 3WAAC 1P3AD 1Z2CB 2ZY3A 3H0MC 1EQZC 5DNMC 4CSRB 5B1MD 2ZY2A 5AVCA 1F66C 4H9SA 5B40D 1KX5A 2CV5D 3MNNC 3X1UA 5B2IA 3X1SD 3AN2A 5B0YA 3TU4B 5E5AC 5B0YC 3V9RA 3EPKA 3AZNC 2BYKA 1M19D 5CP6A 3MVDA 3AZNA 4YM6C 2G5HC 2NZDA 3AZEA 5BS7C 5GT0B 1P3OA 3LJAD 3AZMD 5B24A 4X23D 4CAYA 1JFIA 4KUDB 1S32C 3AZKC 5GT3C 4H9NB 5B0ZD 3C1BB 2PYOA 3UTBD 4XZQC 1P3MD 3X1VA 5KDMB 5B2JD 3WTPA 4H9RA 3AZHB 4J8WD 5AY8D 2Y2JA 5F99A 4H9QB 4J8WC 5GT3B 3LZ1D 1P3FD 3KWQD 1ID3B 1WWSA 4UUZB 5GSUA 1AOIC 5G49B 3AV1B 1KX4A 3B6FC 3X1TA 4G92B 5DNNB 5B32B 1KX5B 1BH8B 4XUJA 1P3AA 4WNNA 1TAFB 5B0YB 2F8NB 5E5AB 4J8VC 4R8PB 3AZID 3WKJA 1KX3B 3KXBC 3MNNB 4KGCC 3W98C 5CPKC 1F66B 3B6GC 3AZIB 5BNXA 2AROC 3A6NC 3REID 1JFIB 2FJ7D 1BH9A 3MGRC 1P34A 1ID3D 5AV9B 2HIOB 1KU5A 3B6GD 4Z5TD 3C1BA 2AROB 3A6NB 4YS3A 3WA9D 1W2EA 3MGSB 5AV6B 3AFAB 2NQBB 2CV5B 1U35B 3X1VC 1M19C 3MGQC 4Z2MG 2PYOD 1HTAA 1M18B 3X1VD 4UUZA 3KUYD 2RIQA 5AY8A 1TZYB 1M18C 5DNNA 5B32A 1H3OB 1N1JB 2DQNC 1HQ3A 5B1MB 3KUYB 5AVBD 4J8XC 4XUJC 4NFTA 5AV6C 3LELD 4AWLC 5AV6D 3MNNA 4EO5C 4WZSB 3AYWD 3AV2C 5CPJD 4Z66C 3AZIA 1P3PC 1P3PA 4J8UD 4YM6A 3AZKB 5AV5B 3EPHA 5DNMD 1P3KD 3LZ0A 4J8VD 5B1LD 1T3UA 2VQRA 5AVBB 3AZFA 5JRGC 4Z5TA 3W96D 5BO0A 3KXBD 3R45B 3AZLB 1P3IA 3MGRD 1ID3C 5C3IC 5CPJB 5F99C 3MGQD 5B33B 3KUYA 1S32D 3UTAD 3NQUA 4DRAA 5BNVA 3AZHC 3WAAA 1KX4C 3B6FA 2NZDB 5DNND 5B32D 3X1TC 4XZQD 3KSYA 1P3MC 3AZJC 2PYOC 3VH5T 5JRGB 5AVBC 1U35D 3C1CC 4WU8D 3LZ1C 1P3FC 3O62B 5AVCD 5GT0C 5B40A 3MNND 1KX5D 3AYWA 4YM6B 3W98A 5AV9D 1B6WA 5CP6C 3MVDC 3RELC 5B0YD 2W8SA 4H9QA 4Z66B 2NZDC 3AZEC 3AV2B 3MGSD 4YM6D 5CP6D 3MVDD 5BO0B 2YFVA 2XD5A 2NZDD 2Y2OA 5DNMA 1P3KA 3LZ0D 4KHAB 1P3BA 4J8VA 4NE6A 1M1AA 1BH8A 4XUJB 3REIB 1EQZB 3REKA 3IP4C 4ZBJC 5GXQB 1TZYD 4WU9B 4J8UC 5E5AA 4H9OB 3REHD 3REJD 3UTBA 1TZYC 1P3ID 4J8WA 3MGRA 4ZUXC 2FFFB 3WA9C 3KWQC 1F1EA 5AV5C 2HUEB 5BNXB 4YS3C 3KWQA 1BH9B 4X23B 4KUDD 1P3GD 2JSSA 3AV1D 4XZQA 4H9PB 3X1TD 5B40B 5B0ZB 2RVQC 3W97D 1U35A 1P3GB 3UTAC 4WU8A 5BT1C 4AWLB 3AZIC 2RVQD 3B0BA 3W97C 5CPKB 1M18A 3LJAB 3AZMB 5BT1D 1HQ3C 4JJNA 3W98D 2YFVB 5B1MC 3W96B 1KX3C 4J8VB 5B31B 1M1AB 1EQZA 3REIA 3X1SC 2BYKB 1P34D 3NQJB 5B2JB 5CPIC 1P3LC 4QLCD 4G92C 3O62C 3C1BD 1P3BD 1P3OB 3MGQB 1M1AD 5B1LB 1AOIB 5AV8B 2DF4C 4QLCB 2ZY4A 4WV4B 2Y2IA 4UPKA 4WJ3C 3AZHA 4H9PA 4XZQB 3B6GB 5B2JC 5B33C 3AZJA 2J8PA 5F99B 3X1SB 5GT3A 1R4VA 5AVBA 1S32B 1P3GA 3AFAD 4KUDC 5G49A 1P3IC 3X1UB 3AV1A 2ZY5A 3AZLC 3LELA 3W97A 2Y2GA 2F2AC 1P3AB 3A1KA 2JE5A 3AZNB 5DNNC 5B32C 2Y2KA 4JJNC 5CPJA 4R8PA 1WWIA 4JJND 4NE5A 3W99C 3VH6A 1ZLAA 1BFMA 2BG1A 3C1CA 5AVCC 1F66A 1EQZD 3B0DC 5B1LA 3WTPB 5KDMA 3AZFD 2HIOA 3KXBA 4QLCA 3VH5A 2FJ7C 4KGCA 4QLCC 3UT9C 2G5IC 2Y2PA 5BS7A 3AYWB 4J8XB 4LD9D 3KUYC 4J8UB 3AZKD 1P3OC 4ZBJB 5AV8D 3REHB 4G91B 5B31D 3REJB 3O62D 1P3BC 5FUGA 1S32A 3AZHD 3KFUG 3B0CW 5B31C 3TU4C 3AZJD 5B2IB 3LELB 3AN2B 5GT3D 3TU4A 3WKJB 1HQ3B 3EG5B 3MGPC 1U35C 1AOID 5CP6B 3MVDB 3AFAC 3UTBB 2F8ND 5B33D 5AV9C 3LZ1B 3AZGA 4CAYB 1P3FB 3MGRB 5AV9A 5CHLB 2JCHA 3C1CB 3W99A 4DRBA 4H9NA 3H0RC 3AZLD 2PYOB 4Z66D 3MGSA 2FJ7B 3KXBB 3REKC 1F66D 5B31G 4ZUXB 2AROD 3A6ND 5AVCB 4CSRA 2Y2LA 3REKD 1KX3D 2HIOD 4DQYB 4WU8B 1TZYA 4KGCD
chains in the Genus database with same CATH topology
5E5AD 2YFWB 4HGAC 3REHA 3REJA 3REIC 4JJNB 4LD9A 5CPID 1P3LD 5B32G 4LD9C 5B31A 4E44A 3UT9D 2F8NG 3F6TA 5B24B 4KUDA 3B0CT 2ZM5A 3RELB 3TU4D 5GSUC 1AOIA 4J8XD 2XD1A 1P34B 4H9RB 5AV5A 1M18D 3AZGD 2Y2QA 2IO5B 3P5JB 3EPJA 1KX4B 3WKJC 3AZLA 4Z66A 3LELC 5B2IC 3AN2C 4WNNB 1A7WA 5DNMB 5C3IB 4KHAA 5CPJC 5JA4B 3REHC 3REJC 5B1MA 1KX3A 3REKB 3NQUB 3W96C 5JRGD 3WAAB 2CV5C 1P3KC 3AZFC 4Z5TC 3UTAB 1M19A 3AZND 2HIOC 3WTPC 3B0DB 4ZUXD 3UT9A 2Y2MA 3AFAA 5B24D 4X23A 1P3PB 3W98B 4X23C 4KGCB 3MGPB 3VH6W 3LZ0B 5B0ZA 1P3MA 3WA9B 4J8XA 4R8PC 5AY8B 4Z5TB 1P3AC 1P3KB 4R8PD 1P3BB 2F8NK 4H9SC 1KX5C 1H3OA 1N1JA 5GXQC 4WU9C 3X1UC 1ZLAD 5GSUD 1ULYA 5GXQA 4WU9A 3C1CD 3RELD 5JA4A 5GT0A 2UWXA 4XUJD 2Y2HA 2NQBD 3LZ0C 3FDDA 3A1IA 2NQBC 3WKJD 3C1BC 5JRGA 3MGSC 3AV2D 5AV8C 3AZKA 4M6BA 3W99B 5AV8A 2LY8A 2BYMA 5B1LC 3O62A 5CPKD 2FJ7A 1ID3A 5CPIB 1P3LB 3AZFB 5GSUB 3MGPA 3B6GA 3R45A 4ZUXA 3AZJB 4YS3D 1P3MB 3WA9A 3EPLA 3X1TB 4NE3A 1P3IB 5B24C 2YFWA 1TAFA 2F8NA 5B33A 3W97B 3VH6T 4LD9B 1P3GC 5BNVB 3W99D 3B6FB 3AV1C 5B40C 1HQ3D 2IO5C 4WU8C 4J8WB 5GXQD 4WU9D 3RELA 3H0LC 5GT0D 3AZGC 2AROA 2HUEC 3A6NA 4YS3B 3KWQB 1P34C 5AV6A 2NQBA 2CV5A 2BYMB 3X1UD 1ZLAC 1M1AC 3X1SA 5B2ID 3AN2D 3AV2A 5CPIA 1P3LA 1P3PD 4J8UA 4EO5B 3VH5W 1Q9CA 3UTBC 3LJAC 3AZMC 3AZED 5CPKA 1P3OD 5FUGB 3LJAA 3AZMA 4Z2MH 5AY8C 3V9RB 4E45A 3MGPD 1PZRA 3W96A 4H9OA 5B0ZC 3AZEB 4HGAB 3WTPE 3NQJA 5B2JA 3WTPD 1ZLAB 1B67A 5AV5D 3AL0C 4G91C 3MGQA 5F99D 2CWEA 3LZ1A 3AZGB 1P3FA 2Y2NA 3UTAA 3X1VB 1M19B 3AYWC 3WAAD 3B6FD 2F8NH 3UT9B 1KX4D 2L5AA 3WAAC 1P3AD 1Z2CB 2ZY3A 3H0MC 1EQZC 5DNMC 4CSRB 5B1MD 2ZY2A 5AVCA 1F66C 4H9SA 5B40D 1KX5A 2CV5D 3MNNC 3X1UA 5B2IA 3X1SD 3AN2A 5B0YA 3TU4B 5E5AC 5B0YC 3V9RA 3EPKA 3AZNC 2BYKA 1M19D 5CP6A 3MVDA 3AZNA 4YM6C 2G5HC 2NZDA 3AZEA 5BS7C 5GT0B 1P3OA 3LJAD 3AZMD 5B24A 4X23D 4CAYA 1JFIA 4KUDB 1S32C 3AZKC 5GT3C 4H9NB 5B0ZD 3C1BB 2PYOA 3UTBD 4XZQC 1P3MD 3X1VA 5KDMB 5B2JD 3WTPA 4H9RA 3AZHB 4J8WD 5AY8D 2Y2JA 5F99A 4H9QB 4J8WC 5GT3B 3LZ1D 1P3FD 3KWQD 1ID3B 1WWSA 4UUZB 5GSUA 1AOIC 5G49B 3AV1B 1KX4A 3B6FC 3X1TA 4G92B 5DNNB 5B32B 1KX5B 1BH8B 4XUJA 1P3AA 4WNNA 1TAFB 5B0YB 2F8NB 5E5AB 4J8VC 4R8PB 3AZID 3WKJA 1KX3B 3KXBC 3MNNB 4KGCC 3W98C 5CPKC 1F66B 3B6GC 3AZIB 5BNXA 2AROC 3A6NC 3REID 1JFIB 2FJ7D 1BH9A 3MGRC 1P34A 1ID3D 5AV9B 2HIOB 1KU5A 3B6GD 4Z5TD 3C1BA 2AROB 3A6NB 4YS3A 3WA9D 1W2EA 3MGSB 5AV6B 3AFAB 2NQBB 2CV5B 1U35B 3X1VC 1M19C 3MGQC 4Z2MG 2PYOD 1HTAA 1M18B 3X1VD 4UUZA 3KUYD 2RIQA 5AY8A 1TZYB 1M18C 5DNNA 5B32A 1H3OB 1N1JB 2DQNC 1HQ3A 5B1MB 3KUYB 5AVBD 4J8XC 4XUJC 4NFTA 5AV6C 3LELD 4AWLC 5AV6D 3MNNA 4EO5C 4WZSB 3AYWD 3AV2C 5CPJD 4Z66C 3AZIA 1P3PC 1P3PA 4J8UD 4YM6A 3AZKB 5AV5B 3EPHA 5DNMD 1P3KD 3LZ0A 4J8VD 5B1LD 1T3UA 2VQRA 5AVBB 3AZFA 5JRGC 4Z5TA 3W96D 5BO0A 3KXBD 3R45B 3AZLB 1P3IA 3MGRD 1ID3C 5C3IC 5CPJB 5F99C 3MGQD 5B33B 3KUYA 1S32D 3UTAD 3NQUA 4DRAA 5BNVA 3AZHC 3WAAA 1KX4C 3B6FA 2NZDB 5DNND 5B32D 3X1TC 4XZQD 3KSYA 1P3MC 3AZJC 2PYOC 3VH5T 5JRGB 5AVBC 1U35D 3C1CC 4WU8D 3LZ1C 1P3FC 3O62B 5AVCD 5GT0C 5B40A 3MNND 1KX5D 3AYWA 4YM6B 3W98A 5AV9D 1B6WA 5CP6C 3MVDC 3RELC 5B0YD 2W8SA 4H9QA 4Z66B 2NZDC 3AZEC 3AV2B 3MGSD 4YM6D 5CP6D 3MVDD 5BO0B 2YFVA 2XD5A 2NZDD 2Y2OA 5DNMA 1P3KA 3LZ0D 4KHAB 1P3BA 4J8VA 4NE6A 1M1AA 1BH8A 4XUJB 3REIB 1EQZB 3REKA 3IP4C 4ZBJC 5GXQB 1TZYD 4WU9B 4J8UC 5E5AA 4H9OB 3REHD 3REJD 3UTBA 1TZYC 1P3ID 4J8WA 3MGRA 4ZUXC 2FFFB 3WA9C 3KWQC 1F1EA 5AV5C 2HUEB 5BNXB 4YS3C 3KWQA 1BH9B 4X23B 4KUDD 1P3GD 2JSSA 3AV1D 4XZQA 4H9PB 3X1TD 5B40B 5B0ZB 2RVQC 3W97D 1U35A 1P3GB 3UTAC 4WU8A 5BT1C 4AWLB 3AZIC 2RVQD 3B0BA 3W97C 5CPKB 1M18A 3LJAB 3AZMB 5BT1D 1HQ3C 4JJNA 3W98D 2YFVB 5B1MC 3W96B 1KX3C 4J8VB 5B31B 1M1AB 1EQZA 3REIA 3X1SC 2BYKB 1P34D 3NQJB 5B2JB 5CPIC 1P3LC 4QLCD 4G92C 3O62C 3C1BD 1P3BD 1P3OB 3MGQB 1M1AD 5B1LB 1AOIB 5AV8B 2DF4C 4QLCB 2ZY4A 4WV4B 2Y2IA 4UPKA 4WJ3C 3AZHA 4H9PA 4XZQB 3B6GB 5B2JC 5B33C 3AZJA 2J8PA 5F99B 3X1SB 5GT3A 1R4VA 5AVBA 1S32B 1P3GA 3AFAD 4KUDC 5G49A 1P3IC 3X1UB 3AV1A 2ZY5A 3AZLC 3LELA 3W97A 2Y2GA 2F2AC 1P3AB 3A1KA 2JE5A 3AZNB 5DNNC 5B32C 2Y2KA 4JJNC 5CPJA 4R8PA 1WWIA 4JJND 4NE5A 3W99C 3VH6A 1ZLAA 1BFMA 2BG1A 3C1CA 5AVCC 1F66A 1EQZD 3B0DC 5B1LA 3WTPB 5KDMA 3AZFD 2HIOA 3KXBA 4QLCA 3VH5A 2FJ7C 4KGCA 4QLCC 3UT9C 2G5IC 2Y2PA 5BS7A 3AYWB 4J8XB 4LD9D 3KUYC 4J8UB 3AZKD 1P3OC 4ZBJB 5AV8D 3REHB 4G91B 5B31D 3REJB 3O62D 1P3BC 5FUGA 1S32A 3AZHD 3KFUG 3B0CW 5B31C 3TU4C 3AZJD 5B2IB 3LELB 3AN2B 5GT3D 3TU4A 3WKJB 1HQ3B 3EG5B 3MGPC 1U35C 1AOID 5CP6B 3MVDB 3AFAC 3UTBB 2F8ND 5B33D 5AV9C 3LZ1B 3AZGA 4CAYB 1P3FB 3MGRB 5AV9A 5CHLB 2JCHA 3C1CB 3W99A 4DRBA 4H9NA 3H0RC 3AZLD 2PYOB 4Z66D 3MGSA 2FJ7B 3KXBB 3REKC 1F66D 5B31G 4ZUXB 2AROD 3A6ND 5AVCB 4CSRA 2Y2LA 3REKD 1KX3D 2HIOD 4DQYB 4WU8B 1TZYA 4KGCD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E5A D;  2YFW B;  4HGA C;  3REH A;  3REJ A;  3REI C;  4JJN B;  4LD9 A;  5CPI D;  1P3L D;  5B32 G;  4LD9 C;  5B31 A;  4E44 A;  3UT9 D;  2F8N G;  5B24 B;  4KUD A;  3B0C T;  3REL B;  3TU4 D;  5GSU C;  1AOI A;  4J8X D;  1P34 B;  4H9R B;  5AV5 A;  1M18 D;  3AZG D;  2IO5 B;  1KX4 B;  3WKJ C;  3AZL A;  4Z66 A;  3LEL C;  5B2I C;  3AN2 C;  4WNN B;  1A7W A;  5DNM B;  5C3I B;  4KHA A;  5CPJ C;  5JA4 B;  3REH C;  3REJ C;  5B1M A;  1KX3 A;  3REK B;  3NQU B;  3W96 C;  5JRG D;  3WAA B;  2CV5 C;  1P3K C;  3AZF C;  4Z5T C;  3UTA B;  1M19 A;  3AZN D;  2HIO C;  3WTP C;  3B0D B;  4ZUX D;  3UT9 A;  3AFA A;  5B24 D;  4X23 A;  1P3P B;  3W98 B;  4X23 C;  4KGC B;  3MGP B;  3VH6 W;  3LZ0 B;  5B0Z A;  1P3M A;  3WA9 B;  4J8X A;  4R8P C;  5AY8 B;  4Z5T B;  1P3A C;  1P3K B;  4R8P D;  1P3B B;  2F8N K;  4H9S C;  1KX5 C;  1H3O A;  1N1J A;  5GXQ C;  4WU9 C;  3X1U C;  1ZLA D;  5GSU D;  1ULY A;  5GXQ A;  4WU9 A;  3C1C D;  3REL D;  5JA4 A;  5GT0 A;  4XUJ D;  2NQB D;  3LZ0 C;  2NQB C;  3WKJ D;  3C1B C;  5JRG A;  3MGS C;  3AV2 D;  5AV8 C;  3AZK A;  4M6B A;  3W99 B;  5AV8 A;  2LY8 A;  2BYM A;  5B1L C;  3O62 A;  5CPK D;  2FJ7 A;  1ID3 A;  5CPI B;  1P3L B;  3AZF B;  5GSU B;  3MGP A;  3B6G A;  3R45 A;  4ZUX A;  3AZJ B;  4YS3 D;  1P3M B;  3WA9 A;  3X1T B;  4NE3 A;  1P3I B;  5B24 C;  2YFW A;  1TAF A;  2F8N A;  5B33 A;  3W97 B;  3VH6 T;  4LD9 B;  1P3G C;  5BNV B;  3W99 D;  3B6F B;  3AV1 C;  5B40 C;  1HQ3 D;  2IO5 C;  4WU8 C;  4J8W B;  5GXQ D;  4WU9 D;  3REL A;  5GT0 D;  3AZG C;  2ARO A;  2HUE C;  3A6N A;  4YS3 B;  3KWQ B;  1P34 C;  5AV6 A;  2NQB A;  2CV5 A;  2BYM B;  3X1U D;  1ZLA C;  1M1A C;  3X1S A;  5B2I D;  3AN2 D;  3AV2 A;  5CPI A;  1P3L A;  1P3P D;  4J8U A;  4EO5 B;  3VH5 W;  1Q9C A;  3UTB C;  3LJA C;  3AZM C;  3AZE D;  5CPK A;  1P3O D;  5FUG B;  3LJA A;  3AZM A;  4Z2M H;  5AY8 C;  3V9R B;  4E45 A;  3MGP D;  3W96 A;  4H9O A;  5B0Z C;  3AZE B;  4HGA B;  3WTP E;  3NQJ A;  5B2J A;  3WTP D;  1ZLA B;  1B67 A;  5AV5 D;  4G91 C;  3MGQ A;  5F99 D;  2CWE A;  3LZ1 A;  3AZG B;  1P3F A;  3UTA A;  1M19 B;  3X1V B;  3AYW C;  3WAA D;  3B6F D;  2F8N H;  3UT9 B;  1KX4 D;  2L5A A;  3WAA C;  1P3A D;  1EQZ C;  5DNM C;  4CSR B;  5B1M D;  5AVC A;  1F66 C;  4H9S A;  5B40 D;  1KX5 A;  2CV5 D;  3MNN C;  3X1U A;  5B2I A;  3X1S D;  3AN2 A;  5B0Y A;  3TU4 B;  5E5A C;  5B0Y C;  3V9R A;  3AZN C;  2BYK A;  1M19 D;  5CP6 A;  3MVD A;  3AZN A;  4YM6 C;  2NZD A;  3AZE A;  5BS7 C;  5GT0 B;  1P3O A;  3LJA D;  3AZM D;  5B24 A;  4X23 D;  4CAY A;  1JFI A;  4KUD B;  1S32 C;  3AZK C;  5GT3 C;  4H9N B;  5B0Z D;  3C1B B;  2PYO A;  3UTB D;  4XZQ C;  1P3M D;  3X1V A;  5KDM B;  5B2J D;  3WTP A;  4H9R A;  3AZH B;  4J8W D;  5AY8 D;  5F99 A;  4H9Q B;  4J8W C;  5GT3 B;  3LZ1 D;  1P3F D;  3KWQ D;  1ID3 B;  1WWS A;  4UUZ B;  5GSU A;  1AOI C;  5G49 B;  3AV1 B;  1KX4 A;  3B6F C;  3X1T A;  4G92 B;  5DNN B;  5B32 B;  1KX5 B;  1BH8 B;  4XUJ A;  1P3A A;  4WNN A;  1TAF B;  5B0Y B;  2F8N B;  5E5A B;  4J8V C;  4R8P B;  3AZI D;  3WKJ A;  1KX3 B;  3KXB C;  3MNN B;  4KGC C;  3W98 C;  5CPK C;  1F66 B;  3B6G C;  3AZI B;  3A6N C;  5BNX A;  2ARO C;  3REI D;  1JFI B;  2FJ7 D;  1BH9 A;  3MGR C;  1P34 A;  1ID3 D;  5AV9 B;  2HIO B;  1KU5 A;  3B6G D;  4Z5T D;  3C1B A;  2ARO B;  3A6N B;  4YS3 A;  3WA9 D;  3MGS B;  5AV6 B;  3AFA B;  2NQB B;  2CV5 B;  1U35 B;  3X1V C;  1M19 C;  3MGQ C;  4Z2M G;  2PYO D;  1HTA A;  1M18 B;  3X1V D;  4UUZ A;  3KUY D;  5AY8 A;  1TZY B;  1M18 C;  5DNN A;  5B32 A;  1H3O B;  1N1J B;  5B1M B;  1HQ3 A;  3KUY B;  5AVB D;  4J8X C;  4XUJ C;  4NFT A;  5AV6 C;  3LEL D;  4AWL C;  5AV6 D;  3MNN A;  4EO5 C;  4WZS B;  3AYW D;  3AV2 C;  5CPJ D;  4Z66 C;  3AZI A;  1P3P C;  1P3P A;  4J8U D;  4YM6 A;  3AZK B;  5AV5 B;  5DNM D;  1P3K D;  3LZ0 A;  4J8V D;  5B1L D;  5AVB B;  3AZF A;  5JRG C;  4Z5T A;  3W96 D;  5BO0 A;  3KXB D;  3R45 B;  3AZL B;  1P3I A;  3MGR D;  1ID3 C;  5C3I C;  5CPJ B;  5F99 C;  3MGQ D;  5B33 B;  3KUY A;  1S32 D;  3UTA D;  3NQU A;  4DRA A;  5BNV A;  3AZH C;  3WAA A;  1KX4 C;  3B6F A;  2NZD B;  5DNN D;  5B32 D;  3X1T C;  4XZQ D;  3KSY A;  1P3M C;  3AZJ C;  2PYO C;  3VH5 T;  5JRG B;  5AVB C;  1U35 D;  3C1C C;  4WU8 D;  3LZ1 C;  1P3F C;  3O62 B;  5AVC D;  5GT0 C;  5B40 A;  3MNN D;  1KX5 D;  3AYW A;  4YM6 B;  3W98 A;  5AV9 D;  1B6W A;  5CP6 C;  3MVD C;  3REL C;  5B0Y D;  4H9Q A;  4Z66 B;  2NZD C;  3AZE C;  3AV2 B;  3MGS D;  4YM6 D;  5CP6 D;  3MVD D;  5BO0 B;  2YFV A;  2NZD D;  5DNM A;  1P3K A;  3LZ0 D;  4KHA B;  1P3B A;  4J8V A;  4NE6 A;  1M1A A;  1BH8 A;  4XUJ B;  3REI B;  1EQZ B;  3REK A;  4ZBJ C;  5GXQ B;  1TZY D;  4WU9 B;  4J8U C;  5E5A A;  4H9O B;  3REH D;  3REJ D;  3UTB A;  1TZY C;  1P3I D;  4J8W A;  3MGR A;  4ZUX C;  3WA9 C;  3KWQ C;  1F1E A;  5AV5 C;  2HUE B;  5BNX B;  4YS3 C;  3KWQ A;  1BH9 B;  4X23 B;  4KUD D;  1P3G D;  2JSS A;  3AV1 D;  4XZQ A;  4H9P B;  3X1T D;  5B40 B;  5B0Z B;  2RVQ C;  3W97 D;  1U35 A;  1P3G B;  3UTA C;  4WU8 A;  5BT1 C;  4AWL B;  3AZI C;  2RVQ D;  3B0B A;  3W97 C;  5CPK B;  1M18 A;  3LJA B;  3AZM B;  5BT1 D;  1HQ3 C;  4JJN A;  3W98 D;  2YFV B;  5B1M C;  3W96 B;  1KX3 C;  4J8V B;  5B31 B;  1M1A B;  1EQZ A;  3REI A;  3X1S C;  2BYK B;  1P34 D;  3NQJ B;  5B2J B;  5CPI C;  1P3L C;  4QLC D;  4G92 C;  3O62 C;  3C1B D;  1P3B D;  1P3O B;  3MGQ B;  1M1A D;  5B1L B;  1AOI B;  5AV8 B;  4QLC B;  4WV4 B;  3AZH A;  4H9P A;  4XZQ B;  3B6G B;  5B2J C;  5B33 C;  3AZJ A;  5F99 B;  3X1S B;  5GT3 A;  1R4V A;  5AVB A;  1S32 B;  1P3G A;  3AFA D;  4KUD C;  5G49 A;  1P3I C;  3X1U B;  3AV1 A;  3AZL C;  3LEL A;  3W97 A;  1P3A B;  3AZN B;  5DNN C;  5B32 C;  4JJN C;  5CPJ A;  4R8P A;  1WWI A;  4JJN D;  4NE5 A;  3W99 C;  3VH6 A;  1ZLA A;  1BFM A;  3C1C A;  5AVC C;  1F66 A;  1EQZ D;  3B0D C;  5B1L A;  3WTP B;  5KDM A;  3AZF D;  2HIO A;  3KXB A;  4QLC A;  3VH5 A;  2FJ7 C;  4KGC A;  4QLC C;  3UT9 C;  5BS7 A;  3AYW B;  4J8X B;  4LD9 D;  3KUY C;  4J8U B;  3AZK D;  1P3O C;  4ZBJ B;  5AV8 D;  3REH B;  4G91 B;  5B31 D;  3REJ B;  3O62 D;  1P3B C;  5FUG A;  1S32 A;  3AZH D;  3B0C W;  5B31 C;  3TU4 C;  3AZJ D;  5B2I B;  3LEL B;  3AN2 B;  5GT3 D;  3TU4 A;  3WKJ B;  1HQ3 B;  3MGP C;  1U35 C;  1AOI D;  5CP6 B;  3MVD B;  3AFA C;  3UTB B;  2F8N D;  5B33 D;  5AV9 C;  3LZ1 B;  3AZG A;  4CAY B;  1P3F B;  3MGR B;  5AV9 A;  5CHL B;  3C1C B;  3W99 A;  4DRB A;  4H9N A;  2PYO B;  3AZL D;  4Z66 D;  3MGS A;  2FJ7 B;  3KXB B;  3REK C;  1F66 D;  5B31 G;  4ZUX B;  2ARO D;  3A6N D;  5AVC B;  4CSR A;  3REK D;  1KX3 D;  2HIO D;  4WU8 B;  1TZY A;  4KGC D; 
#chains in the Genus database with same CATH topology
 5E5A D;  2YFW B;  4HGA C;  3REH A;  3REJ A;  3REI C;  4JJN B;  4LD9 A;  5CPI D;  1P3L D;  5B32 G;  4LD9 C;  5B31 A;  4E44 A;  3UT9 D;  2F8N G;  3F6T A;  5B24 B;  4KUD A;  3B0C T;  2ZM5 A;  3REL B;  3TU4 D;  5GSU C;  1AOI A;  4J8X D;  2XD1 A;  1P34 B;  4H9R B;  5AV5 A;  1M18 D;  3AZG D;  2Y2Q A;  2IO5 B;  3P5J B;  3EPJ A;  1KX4 B;  3WKJ C;  3AZL A;  4Z66 A;  3LEL C;  5B2I C;  3AN2 C;  4WNN B;  1A7W A;  5DNM B;  5C3I B;  4KHA A;  5CPJ C;  5JA4 B;  3REH C;  3REJ C;  5B1M A;  1KX3 A;  3REK B;  3NQU B;  3W96 C;  5JRG D;  3WAA B;  2CV5 C;  1P3K C;  3AZF C;  4Z5T C;  3UTA B;  1M19 A;  3AZN D;  2HIO C;  3WTP C;  3B0D B;  4ZUX D;  3UT9 A;  2Y2M A;  3AFA A;  5B24 D;  4X23 A;  1P3P B;  3W98 B;  4X23 C;  4KGC B;  3MGP B;  3VH6 W;  3LZ0 B;  5B0Z A;  1P3M A;  3WA9 B;  4J8X A;  4R8P C;  5AY8 B;  4Z5T B;  1P3A C;  1P3K B;  4R8P D;  1P3B B;  2F8N K;  4H9S C;  1KX5 C;  1H3O A;  1N1J A;  5GXQ C;  4WU9 C;  3X1U C;  1ZLA D;  5GSU D;  1ULY A;  5GXQ A;  4WU9 A;  3C1C D;  3REL D;  5JA4 A;  5GT0 A;  2UWX A;  4XUJ D;  2Y2H A;  2NQB D;  3LZ0 C;  3FDD A;  3A1I A;  2NQB C;  3WKJ D;  3C1B C;  5JRG A;  3MGS C;  3AV2 D;  5AV8 C;  3AZK A;  4M6B A;  3W99 B;  5AV8 A;  2LY8 A;  2BYM A;  5B1L C;  3O62 A;  5CPK D;  2FJ7 A;  1ID3 A;  5CPI B;  1P3L B;  3AZF B;  5GSU B;  3MGP A;  3B6G A;  3R45 A;  4ZUX A;  3AZJ B;  4YS3 D;  1P3M B;  3WA9 A;  3EPL A;  3X1T B;  4NE3 A;  1P3I B;  5B24 C;  2YFW A;  1TAF A;  2F8N A;  5B33 A;  3W97 B;  3VH6 T;  4LD9 B;  1P3G C;  5BNV B;  3W99 D;  3B6F B;  3AV1 C;  5B40 C;  1HQ3 D;  2IO5 C;  4WU8 C;  4J8W B;  5GXQ D;  4WU9 D;  3REL A;  3H0L C;  5GT0 D;  3AZG C;  2ARO A;  2HUE C;  3A6N A;  4YS3 B;  3KWQ B;  1P34 C;  5AV6 A;  2NQB A;  2CV5 A;  2BYM B;  3X1U D;  1ZLA C;  1M1A C;  3X1S A;  5B2I D;  3AN2 D;  3AV2 A;  5CPI A;  1P3L A;  1P3P D;  4J8U A;  4EO5 B;  3VH5 W;  1Q9C A;  3UTB C;  3LJA C;  3AZM C;  3AZE D;  5CPK A;  1P3O D;  5FUG B;  3LJA A;  3AZM A;  4Z2M H;  5AY8 C;  3V9R B;  4E45 A;  3MGP D;  1PZR A;  3W96 A;  4H9O A;  5B0Z C;  3AZE B;  4HGA B;  3WTP E;  3NQJ A;  5B2J A;  3WTP D;  1ZLA B;  1B67 A;  5AV5 D;  3AL0 C;  4G91 C;  3MGQ A;  5F99 D;  2CWE A;  3LZ1 A;  3AZG B;  1P3F A;  2Y2N A;  3UTA A;  3X1V B;  1M19 B;  3AYW C;  3WAA D;  3B6F D;  2F8N H;  3UT9 B;  1KX4 D;  2L5A A;  3WAA C;  1P3A D;  1Z2C B;  2ZY3 A;  3H0M C;  1EQZ C;  5DNM C;  4CSR B;  5B1M D;  2ZY2 A;  5AVC A;  1F66 C;  4H9S A;  5B40 D;  1KX5 A;  2CV5 D;  3MNN C;  3X1U A;  5B2I A;  3X1S D;  3AN2 A;  5B0Y A;  3TU4 B;  5E5A C;  5B0Y C;  3V9R A;  3EPK A;  3AZN C;  2BYK A;  1M19 D;  5CP6 A;  3MVD A;  3AZN A;  4YM6 C;  2G5H C;  2NZD A;  3AZE A;  5BS7 C;  5GT0 B;  1P3O A;  3LJA D;  3AZM D;  5B24 A;  4X23 D;  4CAY A;  1JFI A;  4KUD B;  1S32 C;  3AZK C;  5GT3 C;  4H9N B;  5B0Z D;  3C1B B;  2PYO A;  3UTB D;  4XZQ C;  1P3M D;  3X1V A;  5KDM B;  5B2J D;  3WTP A;  4H9R A;  3AZH B;  4J8W D;  5AY8 D;  2Y2J A;  5F99 A;  4H9Q B;  4J8W C;  5GT3 B;  3LZ1 D;  1P3F D;  3KWQ D;  1ID3 B;  1WWS A;  4UUZ B;  5GSU A;  1AOI C;  5G49 B;  3AV1 B;  1KX4 A;  3B6F C;  3X1T A;  4G92 B;  5DNN B;  5B32 B;  1KX5 B;  1BH8 B;  4XUJ A;  1P3A A;  4WNN A;  1TAF B;  5B0Y B;  2F8N B;  5E5A B;  4J8V C;  4R8P B;  3AZI D;  3WKJ A;  1KX3 B;  3KXB C;  3MNN B;  4KGC C;  3W98 C;  5CPK C;  1F66 B;  3B6G C;  3AZI B;  5BNX A;  2ARO C;  3A6N C;  3REI D;  1JFI B;  2FJ7 D;  1BH9 A;  3MGR C;  1P34 A;  1ID3 D;  5AV9 B;  2HIO B;  1KU5 A;  3B6G D;  4Z5T D;  3C1B A;  2ARO B;  3A6N B;  4YS3 A;  3WA9 D;  1W2E A;  3MGS B;  5AV6 B;  3AFA B;  2NQB B;  2CV5 B;  1U35 B;  3X1V C;  1M19 C;  3MGQ C;  4Z2M G;  2PYO D;  1HTA A;  1M18 B;  3X1V D;  4UUZ A;  3KUY D;  2RIQ A;  5AY8 A;  1TZY B;  1M18 C;  5DNN A;  5B32 A;  1H3O B;  1N1J B;  2DQN C;  1HQ3 A;  5B1M B;  3KUY B;  5AVB D;  4J8X C;  4XUJ C;  4NFT A;  5AV6 C;  3LEL D;  4AWL C;  5AV6 D;  3MNN A;  4EO5 C;  4WZS B;  3AYW D;  3AV2 C;  5CPJ D;  4Z66 C;  3AZI A;  1P3P C;  1P3P A;  4J8U D;  4YM6 A;  3AZK B;  5AV5 B;  3EPH A;  5DNM D;  1P3K D;  3LZ0 A;  4J8V D;  5B1L D;  1T3U A;  2VQR A;  5AVB B;  3AZF A;  5JRG C;  4Z5T A;  3W96 D;  5BO0 A;  3KXB D;  3R45 B;  3AZL B;  1P3I A;  3MGR D;  1ID3 C;  5C3I C;  5CPJ B;  5F99 C;  3MGQ D;  5B33 B;  3KUY A;  1S32 D;  3UTA D;  3NQU A;  4DRA A;  5BNV A;  3AZH C;  3WAA A;  1KX4 C;  3B6F A;  2NZD B;  5DNN D;  5B32 D;  3X1T C;  4XZQ D;  3KSY A;  1P3M C;  3AZJ C;  2PYO C;  3VH5 T;  5JRG B;  5AVB C;  1U35 D;  3C1C C;  4WU8 D;  3LZ1 C;  1P3F C;  3O62 B;  5AVC D;  5GT0 C;  5B40 A;  3MNN D;  1KX5 D;  3AYW A;  4YM6 B;  3W98 A;  5AV9 D;  1B6W A;  5CP6 C;  3MVD C;  3REL C;  5B0Y D;  2W8S A;  4H9Q A;  4Z66 B;  2NZD C;  3AZE C;  3AV2 B;  3MGS D;  4YM6 D;  5CP6 D;  3MVD D;  5BO0 B;  2YFV A;  2XD5 A;  2NZD D;  2Y2O A;  5DNM A;  1P3K A;  3LZ0 D;  4KHA B;  1P3B A;  4J8V A;  4NE6 A;  1M1A A;  1BH8 A;  4XUJ B;  3REI B;  1EQZ B;  3REK A;  3IP4 C;  4ZBJ C;  5GXQ B;  1TZY D;  4WU9 B;  4J8U C;  5E5A A;  4H9O B;  3REH D;  3REJ D;  3UTB A;  1TZY C;  1P3I D;  4J8W A;  3MGR A;  4ZUX C;  2FFF B;  3WA9 C;  3KWQ C;  1F1E A;  5AV5 C;  2HUE B;  5BNX B;  4YS3 C;  3KWQ A;  1BH9 B;  4X23 B;  4KUD D;  1P3G D;  2JSS A;  3AV1 D;  4XZQ A;  4H9P B;  3X1T D;  5B40 B;  5B0Z B;  2RVQ C;  3W97 D;  1U35 A;  1P3G B;  3UTA C;  4WU8 A;  5BT1 C;  4AWL B;  3AZI C;  2RVQ D;  3B0B A;  3W97 C;  5CPK B;  1M18 A;  3LJA B;  3AZM B;  5BT1 D;  1HQ3 C;  4JJN A;  3W98 D;  2YFV B;  5B1M C;  3W96 B;  1KX3 C;  4J8V B;  5B31 B;  1M1A B;  1EQZ A;  3REI A;  3X1S C;  2BYK B;  1P34 D;  3NQJ B;  5B2J B;  5CPI C;  1P3L C;  4QLC D;  4G92 C;  3O62 C;  3C1B D;  1P3B D;  1P3O B;  3MGQ B;  1M1A D;  5B1L B;  1AOI B;  5AV8 B;  2DF4 C;  4QLC B;  2ZY4 A;  4WV4 B;  2Y2I A;  4UPK A;  4WJ3 C;  3AZH A;  4H9P A;  4XZQ B;  3B6G B;  5B2J C;  5B33 C;  3AZJ A;  2J8P A;  5F99 B;  3X1S B;  5GT3 A;  1R4V A;  5AVB A;  1S32 B;  1P3G A;  3AFA D;  4KUD C;  5G49 A;  1P3I C;  3X1U B;  3AV1 A;  2ZY5 A;  3AZL C;  3LEL A;  3W97 A;  2Y2G A;  2F2A C;  1P3A B;  3A1K A;  2JE5 A;  3AZN B;  5DNN C;  5B32 C;  2Y2K A;  4JJN C;  5CPJ A;  4R8P A;  1WWI A;  4JJN D;  4NE5 A;  3W99 C;  3VH6 A;  1ZLA A;  1BFM A;  2BG1 A;  3C1C A;  5AVC C;  1F66 A;  1EQZ D;  3B0D C;  5B1L A;  3WTP B;  5KDM A;  3AZF D;  2HIO A;  3KXB A;  4QLC A;  3VH5 A;  2FJ7 C;  4KGC A;  4QLC C;  3UT9 C;  2G5I C;  2Y2P A;  5BS7 A;  3AYW B;  4J8X B;  4LD9 D;  3KUY C;  4J8U B;  3AZK D;  1P3O C;  4ZBJ B;  5AV8 D;  3REH B;  4G91 B;  5B31 D;  3REJ B;  3O62 D;  1P3B C;  5FUG A;  1S32 A;  3AZH D;  3KFU G;  3B0C W;  5B31 C;  3TU4 C;  3AZJ D;  5B2I B;  3LEL B;  3AN2 B;  5GT3 D;  3TU4 A;  3WKJ B;  1HQ3 B;  3EG5 B;  3MGP C;  1U35 C;  1AOI D;  5CP6 B;  3MVD B;  3AFA C;  3UTB B;  2F8N D;  5B33 D;  5AV9 C;  3LZ1 B;  3AZG A;  4CAY B;  1P3F B;  3MGR B;  5AV9 A;  5CHL B;  2JCH A;  3C1C B;  3W99 A;  4DRB A;  4H9N A;  3H0R C;  3AZL D;  2PYO B;  4Z66 D;  3MGS A;  2FJ7 B;  3KXB B;  3REK C;  1F66 D;  5B31 G;  4ZUX B;  2ARO D;  3A6N D;  5AVC B;  4CSR A;  2Y2L A;  3REK D;  1KX3 D;  2HIO D;  4DQY B;  4WU8 B;  1TZY A;  4KGC D; 
#chains in the Genus database with same CATH homology
 5E5A D;  2YFW B;  4HGA C;  3REH A;  3REJ A;  3REI C;  4JJN B;  4LD9 A;  5CPI D;  1P3L D;  5B32 G;  4LD9 C;  5B31 A;  4E44 A;  3UT9 D;  2F8N G;  3F6T A;  5B24 B;  4KUD A;  3B0C T;  2ZM5 A;  3REL B;  3TU4 D;  5GSU C;  1AOI A;  4J8X D;  2XD1 A;  1P34 B;  4H9R B;  5AV5 A;  1M18 D;  3AZG D;  2Y2Q A;  2IO5 B;  3P5J B;  3EPJ A;  1KX4 B;  3WKJ C;  3AZL A;  4Z66 A;  3LEL C;  5B2I C;  3AN2 C;  4WNN B;  1A7W A;  5DNM B;  5C3I B;  4KHA A;  5CPJ C;  5JA4 B;  3REH C;  3REJ C;  5B1M A;  1KX3 A;  3REK B;  3NQU B;  3W96 C;  5JRG D;  3WAA B;  2CV5 C;  1P3K C;  3AZF C;  4Z5T C;  3UTA B;  1M19 A;  3AZN D;  2HIO C;  3WTP C;  3B0D B;  4ZUX D;  3UT9 A;  2Y2M A;  3AFA A;  5B24 D;  4X23 A;  1P3P B;  3W98 B;  4X23 C;  4KGC B;  3MGP B;  3VH6 W;  3LZ0 B;  5B0Z A;  1P3M A;  3WA9 B;  4J8X A;  4R8P C;  5AY8 B;  4Z5T B;  1P3A C;  1P3K B;  4R8P D;  1P3B B;  2F8N K;  4H9S C;  1KX5 C;  1H3O A;  1N1J A;  5GXQ C;  4WU9 C;  3X1U C;  1ZLA D;  5GSU D;  1ULY A;  5GXQ A;  4WU9 A;  3C1C D;  3REL D;  5JA4 A;  5GT0 A;  2UWX A;  4XUJ D;  2Y2H A;  2NQB D;  3LZ0 C;  3FDD A;  3A1I A;  2NQB C;  3WKJ D;  3C1B C;  5JRG A;  3MGS C;  3AV2 D;  5AV8 C;  3AZK A;  4M6B A;  3W99 B;  5AV8 A;  2LY8 A;  2BYM A;  5B1L C;  3O62 A;  5CPK D;  2FJ7 A;  1ID3 A;  5CPI B;  1P3L B;  3AZF B;  5GSU B;  3MGP A;  3B6G A;  3R45 A;  4ZUX A;  3AZJ B;  4YS3 D;  1P3M B;  3WA9 A;  3EPL A;  3X1T B;  4NE3 A;  1P3I B;  5B24 C;  2YFW A;  1TAF A;  2F8N A;  5B33 A;  3W97 B;  3VH6 T;  4LD9 B;  1P3G C;  5BNV B;  3W99 D;  3B6F B;  3AV1 C;  5B40 C;  1HQ3 D;  2IO5 C;  4WU8 C;  4J8W B;  5GXQ D;  4WU9 D;  3REL A;  3H0L C;  5GT0 D;  3AZG C;  2ARO A;  2HUE C;  3A6N A;  4YS3 B;  3KWQ B;  1P34 C;  5AV6 A;  2NQB A;  2CV5 A;  2BYM B;  3X1U D;  1ZLA C;  1M1A C;  3X1S A;  5B2I D;  3AN2 D;  3AV2 A;  5CPI A;  1P3L A;  1P3P D;  4J8U A;  4EO5 B;  3VH5 W;  1Q9C A;  3UTB C;  3LJA C;  3AZM C;  3AZE D;  5CPK A;  1P3O D;  5FUG B;  3LJA A;  3AZM A;  4Z2M H;  5AY8 C;  3V9R B;  4E45 A;  3MGP D;  1PZR A;  3W96 A;  4H9O A;  5B0Z C;  3AZE B;  4HGA B;  3WTP E;  3NQJ A;  5B2J A;  3WTP D;  1ZLA B;  1B67 A;  5AV5 D;  3AL0 C;  4G91 C;  3MGQ A;  5F99 D;  2CWE A;  3LZ1 A;  3AZG B;  1P3F A;  2Y2N A;  3UTA A;  3X1V B;  1M19 B;  3AYW C;  3WAA D;  3B6F D;  2F8N H;  3UT9 B;  1KX4 D;  2L5A A;  3WAA C;  1P3A D;  1Z2C B;  2ZY3 A;  3H0M C;  1EQZ C;  5DNM C;  4CSR B;  5B1M D;  2ZY2 A;  5AVC A;  1F66 C;  4H9S A;  5B40 D;  1KX5 A;  2CV5 D;  3MNN C;  3X1U A;  5B2I A;  3X1S D;  3AN2 A;  5B0Y A;  3TU4 B;  5E5A C;  5B0Y C;  3V9R A;  3EPK A;  3AZN C;  2BYK A;  1M19 D;  5CP6 A;  3MVD A;  3AZN A;  4YM6 C;  2G5H C;  2NZD A;  3AZE A;  5BS7 C;  5GT0 B;  1P3O A;  3LJA D;  3AZM D;  5B24 A;  4X23 D;  4CAY A;  1JFI A;  4KUD B;  1S32 C;  3AZK C;  5GT3 C;  4H9N B;  5B0Z D;  3C1B B;  2PYO A;  3UTB D;  4XZQ C;  1P3M D;  3X1V A;  5KDM B;  5B2J D;  3WTP A;  4H9R A;  3AZH B;  4J8W D;  5AY8 D;  2Y2J A;  5F99 A;  4H9Q B;  4J8W C;  5GT3 B;  3LZ1 D;  1P3F D;  3KWQ D;  1ID3 B;  1WWS A;  4UUZ B;  5GSU A;  1AOI C;  5G49 B;  3AV1 B;  1KX4 A;  3B6F C;  3X1T A;  4G92 B;  5DNN B;  5B32 B;  1KX5 B;  1BH8 B;  4XUJ A;  1P3A A;  4WNN A;  1TAF B;  5B0Y B;  2F8N B;  5E5A B;  4J8V C;  4R8P B;  3AZI D;  3WKJ A;  1KX3 B;  3KXB C;  3MNN B;  4KGC C;  3W98 C;  5CPK C;  1F66 B;  3B6G C;  3AZI B;  5BNX A;  2ARO C;  3A6N C;  3REI D;  1JFI B;  2FJ7 D;  1BH9 A;  3MGR C;  1P34 A;  1ID3 D;  5AV9 B;  2HIO B;  1KU5 A;  3B6G D;  4Z5T D;  3C1B A;  2ARO B;  3A6N B;  4YS3 A;  3WA9 D;  1W2E A;  3MGS B;  5AV6 B;  3AFA B;  2NQB B;  2CV5 B;  1U35 B;  3X1V C;  1M19 C;  3MGQ C;  4Z2M G;  2PYO D;  1HTA A;  1M18 B;  3X1V D;  4UUZ A;  3KUY D;  2RIQ A;  5AY8 A;  1TZY B;  1M18 C;  5DNN A;  5B32 A;  1H3O B;  1N1J B;  2DQN C;  1HQ3 A;  5B1M B;  3KUY B;  5AVB D;  4J8X C;  4XUJ C;  4NFT A;  5AV6 C;  3LEL D;  4AWL C;  5AV6 D;  3MNN A;  4EO5 C;  4WZS B;  3AYW D;  3AV2 C;  5CPJ D;  4Z66 C;  3AZI A;  1P3P C;  1P3P A;  4J8U D;  4YM6 A;  3AZK B;  5AV5 B;  3EPH A;  5DNM D;  1P3K D;  3LZ0 A;  4J8V D;  5B1L D;  1T3U A;  2VQR A;  5AVB B;  3AZF A;  5JRG C;  4Z5T A;  3W96 D;  5BO0 A;  3KXB D;  3R45 B;  3AZL B;  1P3I A;  3MGR D;  1ID3 C;  5C3I C;  5CPJ B;  5F99 C;  3MGQ D;  5B33 B;  3KUY A;  1S32 D;  3UTA D;  3NQU A;  4DRA A;  5BNV A;  3AZH C;  3WAA A;  1KX4 C;  3B6F A;  2NZD B;  5DNN D;  5B32 D;  3X1T C;  4XZQ D;  3KSY A;  1P3M C;  3AZJ C;  2PYO C;  3VH5 T;  5JRG B;  5AVB C;  1U35 D;  3C1C C;  4WU8 D;  3LZ1 C;  1P3F C;  3O62 B;  5AVC D;  5GT0 C;  5B40 A;  3MNN D;  1KX5 D;  3AYW A;  4YM6 B;  3W98 A;  5AV9 D;  1B6W A;  5CP6 C;  3MVD C;  3REL C;  5B0Y D;  2W8S A;  4H9Q A;  4Z66 B;  2NZD C;  3AZE C;  3AV2 B;  3MGS D;  4YM6 D;  5CP6 D;  3MVD D;  5BO0 B;  2YFV A;  2XD5 A;  2NZD D;  2Y2O A;  5DNM A;  1P3K A;  3LZ0 D;  4KHA B;  1P3B A;  4J8V A;  4NE6 A;  1M1A A;  1BH8 A;  4XUJ B;  3REI B;  1EQZ B;  3REK A;  3IP4 C;  4ZBJ C;  5GXQ B;  1TZY D;  4WU9 B;  4J8U C;  5E5A A;  4H9O B;  3REH D;  3REJ D;  3UTB A;  1TZY C;  1P3I D;  4J8W A;  3MGR A;  4ZUX C;  2FFF B;  3WA9 C;  3KWQ C;  1F1E A;  5AV5 C;  2HUE B;  5BNX B;  4YS3 C;  3KWQ A;  1BH9 B;  4X23 B;  4KUD D;  1P3G D;  2JSS A;  3AV1 D;  4XZQ A;  4H9P B;  3X1T D;  5B40 B;  5B0Z B;  2RVQ C;  3W97 D;  1U35 A;  1P3G B;  3UTA C;  4WU8 A;  5BT1 C;  4AWL B;  3AZI C;  2RVQ D;  3B0B A;  3W97 C;  5CPK B;  1M18 A;  3LJA B;  3AZM B;  5BT1 D;  1HQ3 C;  4JJN A;  3W98 D;  2YFV B;  5B1M C;  3W96 B;  1KX3 C;  4J8V B;  5B31 B;  1M1A B;  1EQZ A;  3REI A;  3X1S C;  2BYK B;  1P34 D;  3NQJ B;  5B2J B;  5CPI C;  1P3L C;  4QLC D;  4G92 C;  3O62 C;  3C1B D;  1P3B D;  1P3O B;  3MGQ B;  1M1A D;  5B1L B;  1AOI B;  5AV8 B;  2DF4 C;  4QLC B;  2ZY4 A;  4WV4 B;  2Y2I A;  4UPK A;  4WJ3 C;  3AZH A;  4H9P A;  4XZQ B;  3B6G B;  5B2J C;  5B33 C;  3AZJ A;  2J8P A;  5F99 B;  3X1S B;  5GT3 A;  1R4V A;  5AVB A;  1S32 B;  1P3G A;  3AFA D;  4KUD C;  5G49 A;  1P3I C;  3X1U B;  3AV1 A;  2ZY5 A;  3AZL C;  3LEL A;  3W97 A;  2Y2G A;  2F2A C;  1P3A B;  3A1K A;  2JE5 A;  3AZN B;  5DNN C;  5B32 C;  2Y2K A;  4JJN C;  5CPJ A;  4R8P A;  1WWI A;  4JJN D;  4NE5 A;  3W99 C;  3VH6 A;  1ZLA A;  1BFM A;  2BG1 A;  3C1C A;  5AVC C;  1F66 A;  1EQZ D;  3B0D C;  5B1L A;  3WTP B;  5KDM A;  3AZF D;  2HIO A;  3KXB A;  4QLC A;  3VH5 A;  2FJ7 C;  4KGC A;  4QLC C;  3UT9 C;  2G5I C;  2Y2P A;  5BS7 A;  3AYW B;  4J8X B;  4LD9 D;  3KUY C;  4J8U B;  3AZK D;  1P3O C;  4ZBJ B;  5AV8 D;  3REH B;  4G91 B;  5B31 D;  3REJ B;  3O62 D;  1P3B C;  5FUG A;  1S32 A;  3AZH D;  3KFU G;  3B0C W;  5B31 C;  3TU4 C;  3AZJ D;  5B2I B;  3LEL B;  3AN2 B;  5GT3 D;  3TU4 A;  3WKJ B;  1HQ3 B;  3EG5 B;  3MGP C;  1U35 C;  1AOI D;  5CP6 B;  3MVD B;  3AFA C;  3UTB B;  2F8N D;  5B33 D;  5AV9 C;  3LZ1 B;  3AZG A;  4CAY B;  1P3F B;  3MGR B;  5AV9 A;  5CHL B;  2JCH A;  3C1C B;  3W99 A;  4DRB A;  4H9N A;  3H0R C;  3AZL D;  2PYO B;  4Z66 D;  3MGS A;  2FJ7 B;  3KXB B;  3REK C;  1F66 D;  5B31 G;  4ZUX B;  2ARO D;  3A6N D;  5AVC B;  4CSR A;  2Y2L A;  3REK D;  1KX3 D;  2HIO D;  4DQY B;  4WU8 B;  1TZY A;  4KGC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...