4Z66D

Nucleosome disassembly by rsc and swi/snf is enhanced by h3 acetylation near the nucleosome dyad axis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
94
structure length
94
Chain Sequence
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone H3.2
publication title Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 37
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4z66D00
5AVBA 3B6FC 5GSUB 3AZJB 2BYKA 3AFAD 5AV8D 3REID 3B6GB 1ID3C 1BH9B 3C1BD 4ZUXB 4G91B 1WWSA 5B0YC 3C1CD 3AZKA 5CPJB 4JJNA 3WA9B 5B40B 1P3KA 3AZLA 1KX3C 1TZYC 3B0DB 3WAAD 2IO5B 3MGQA 5B2JD 2BYMA 5B1LA 5B2IC 5AY8B 3MVDB 3AN2B 4WU9A 4X23C 1P3BD 3KWQB 4KUDD 5CPKA 3LZ0B 5FUGA 5KDMB 1H3OA 3REJA 1P3PA 3AZFA 4LD9C 3VH6T 5GT0B 1M1AC 3RELA 3LELD 4AWLB 3UT9A 5B31G 3X1VC 3X1UB 3REKB 1EQZB 3LZ1D 4KGCC 4WU8A 1HQ3C 2FJ7D 2CV5C 1P3FA 1ID3D 4XZQB 3MGSC 5BNVA 1N1JA 1F1EA 5GXQC 5B0YD 5CP6A 3AZHC 1ZLAD 1P3GB 4H9RA 1TZYD 1HTAA 2HIOD 3TU4A 1M19D 4YM6A 5B2ID 1S32C 4XUJB 5AV5B 3AFAA 5AV8A 3REIA 5B31B 1JFIB 3MGRD 3C1BA 5G49A 1M1AD 4LD9D 3X1SB 4R8PB 3C1CA 3KXBB 1P3AD 3WAAA 3X1VD 5B2JA 4J8WD 3KSYA 1P3KC 3B6FB 1P3BA 4KUDA 3MGQC 4KGCD 2PYOC 4WV4B 4WU9C 3MNNA 5BNXB 3W97C 2CV5D 4XUJA 3W98C 5GT3B 5AV6C 1P3PC 3LELA 4H9SA 1KX3B 5AV9B 3NQJB 3RELC 5B24B 5BT1D 3WTPA 3AZHD 4X23B 2HUEB 3LZ1A 1B67A 4H9QB 2FJ7A 4NFTA 3KUYC 1M18C 2NQBB 1U35B 1ID3A 3AZGC 3NQUB 4M6BA 5JA4B 1P3IB 1B6WA 5B0YA 3O62B 3REHD 1ZLAA 1TZYA 4G92B 1M19A 2HIOA 1BH8B 4YS3C 4E45A 5B2IA 4J8XD 3AYWC 2PYOD 3W99C 3V9RB 3W97D 3MGSB 4UUZA 4LD9A 4H9PA 3AFAC 1M1AA 5GXQB 5AV6D 1P3OC 5DNMD 3X1TB 3AZIB 1P3AA 3X1VA 1S32B 4J8WA 3WAAC 3R45B 4QLCC 3VH5A 4KGCA 5AVBB 1HQ3A 4EO5B 2BYKB 2CV5A 3KUYD 1M18D 5AVCC 2RVQC 1P34C 3AZGD 1P3LC 3MGSA 1P3MC 3AZKB 4JJNB 5DNNC 3LELC 1P3KB 3AZLB 5B0ZD 3AZHA 3MGQB 2BYMB 5B1LB 4WU9B 4YS3D 5CPKB 3AYWD 5FUGB 3REJB 1H3OB 1P3PB 3AZFB 1BFMA 5E5AD 3A6NC 3RELB 5CPJD 1P3OD 2YFVA 3VH6W 5B33C 5F99C 3AZNC 2F8NK 3UT9B 3REHA 3UTAD 1ZLAC 4WU8B 1F66D 4HGAB 1M19C 2HIOC 4QLCD 2PYOA 3W97A 3UTBC 1P3FB 4WNNA 3W98A 5AV6A 5DNMA 5AVCD 2RVQD 5BNVB 5B32C 3MGRC 1N1JB 4E44A 1P34D 1P3LD 4Z2MH 2F8NH 1P3MD 3REKD 5CP6B 5DNND 4H9RB 5CPIC 3TU4B 4YM6B 1P3AC 2NZDD 3W99B 4J8WC 2F8ND 3MGPC 5JRGC 3AFAB 5AV8B 3REIB 1KX4C 3KUYA 1M18A 4Z2MG 3C1BB 5G49B 3A6ND 3AZGA 4Z5TD 3C1CB 5B33D 1Q9CA 5F99D 3AZND 3WAAB 5B0ZA 5B2JB 5BT1C 4YS3A 1P3BB 4KUDB 4KHAA 3AYWA 3MNNB 4NE3A 3W99A 5E5AA 3UTBD 4NE5A 3LJAC 3LELB 1P3OA 1AOIC 1A7WA 3AZED 5B32D 3WTPB 2YFWB 5CPID 3REHC 3LZ1B 3UTAA 1F66A 4CAYA 4QLCA 2FJ7B 3MGPD 4J8XC 5BS7C 5JRGD 1KX4D 3AV1C 1ID3B 5AVCA 1P34A 1P3LA 5B0YB 5DNMC 1P3MA 5DNNA 1ZLAB 1TZYB 2AROC 2HIOB 1M19B 5BO0A 5B2IB 2NZDA 3W96C 3AZMC 2F8NA 2YFWA 3AV2C 4J8UC 4UUZB 3MGRB 4H9PB 3A6NA 1M1AB 4ZBJC 4LD9B 3LJAD 1AOID 5B33A 5F99A 3AZNA 1P3AB 4Z66C 5B1MC 3X1VB 4J8WB 4J8VD 3WKJD 5B0ZC 1KX5C 4KGCB 1HQ3B 5GSUC 2CV5B 3B6GC 5CHLB 3UTBA 2L5AA 4ZUXC 3AV1D 5E5AC 3AZEA 5B32A 3MGRA 3WA9C 5CPJC 5B40C 3AZHB 5CPIA 2AROD 3KWQC 3AZMD 3UTAC 3W96D 3MGPA 3LZ0C 1F66C 3AV2D 5JRGA 1KX4A 1R4VA 4J8UD 5GT0C 3AZKD 2YFVB 4AWLC 3REHB 3X1UC 3REKC 4Z66D 5B1MD 1EQZC 4H9OA 4J8XB 1KX5D 2PYOB 3VH6A 2NZDC 5GSUD 3W97B 3AZJD 4WNNB 3B6GD 3W98B 5AV6B 5DNMB 4XZQC 4ZUXD 3LJAA 1AOIA 2LY8A 4Z5TC 3WA9D 2CWEA 5B40D 1P3GC 4J8VA 3WKJA 5AY8D 3MVDD 3AN2D 3KWQD 3LZ0D 4J8XA 5BS7A 5B31C 3KUYB 1M18B 1TAFA 5GT0D 3AV1A 3AZGB 3B0CT 3X1SC 4R8PC 5B0ZB 3AZEC 2AROA 3X1UD 4YS3B 1EQZD 4KHAB 3W96A 3AZMA 3AYWB 3AV2A 3VH5T 5E5AB 4J8UA 5GT3C 1P3OB 2F8NG 4XZQD 5AV9C 5B24C 4CSRA 4Z66A 5B1MA 1P3GD 3UTAB 2HUEC 1F66B 3MNND 4H9NA 1KX5A 4CAYB 4QLCB 4XUJD 5GSUA 5AV5D 3AZJA 3B6GA 2NQBC 5B31D 1U35C 1BH9A 5AVCB 4DRBA 4ZUXA 1P34B 3WTPD 1P3LB 3X1SD 4R8PD 1P3MB 1P3IC 3O62C 3KXBD 5CPJA 5DNNB 3WA9A 5B40A 4G92C 5BO0B 2NZDB 3B6FD 5AY8A 4WZSB 3MVDA 5B32G 4J8VC 3AN2A 2F8NB 3KWQA 3WKJC 1KU5A 3LZ0A 5KDMA 3A6NB 5GT0A 5GT3D 4NE6A 4Z5TB 3X1TC 5B33B 1KX3D 5F99B 3AZNB 3AZIC 5AV9D 5B24D 3X1UA 4X23D 3REKA 1EQZA 5AVBC 4EO5C 1ULYA 3UTBB 2NQBD 1U35D 5C3IC 4XZQA 3AZEB 5B32B 3AZKC 4JJNC 4Z5TA 1P3ID 3O62D 3AZLC 5CPIB 1P3GA 1HQ3D 5B1LC 1WWIA 5CPKC 3MGPB 3REJC 5AV5A 5JRGB 1KX4B 3AZFC 5B31A 1JFIA 3MGSD 3AZJC 5GXQD 3X1SA 3X1TD 4R8PA 3KXBA 3UT9C 4G91C 3AZID 1S32D 4H9OB 3B6FA 4WU8C 3B0DC 4HGAC 2IO5C 5AVBD 5AY8C 3MVDC 3AN2C 5BNXA 1P3FC 3B0BA 5GT3A 3LJAB 1AOIB 1KX3A 5AV9A 3NQJA 5CP6C 4JJND 5B24A 1P3KD 3AZLD 4J8VB 3WKJB 4X23A 3TU4C 3MGQD 4YM6C 5B1LD 4WU9D 4H9QA 5CPKD 3W98D 5AV8C 3REIC 3REJD 1P3PD 3AZFD 1TAFB 2NQBA 3C1BC 1U35A 3AV1B 3NQUA 3RELD 5JA4A 3C1CC 1P3IA 3O62A 3B0CW 3UT9D 2AROB 5B2JC 1BH8A 1P3BC 4KUDC 3AZMB 4WU8D 3W96B 2JSSA 3MNNC 3AV2B 5C3IB 4J8UB 3V9RA 4XUJC 1P3FD 5AV5C 4ZBJB 3VH5W 5GXQA 4H9SC 3X1TA 4DRAA 3WTPC 3AZIA 5CP6D 4CSRB 4Z66B 5B1MB 3KXBC 1S32A 3WTPE 3LZ1C 3TU4D 4H9NB 4YM6D 1KX5B 3R45A 2FJ7C 3W99D
chains in the Genus database with same CATH superfamily
5AVBA 3B6FC 5GSUB 2FFFB 2BYKA 3AZJB 3AFAD 5AV8D 3REID 3B6GB 2JE5A 1ID3C 1BH9B 3C1BD 4ZUXB 4G91B 1WWSA 5B0YC 3C1CD 3AZKA 5CPJB 4JJNA 3WA9B 5B40B 1P3KA 3AZLA 1KX3C 1TZYC 3B0DB 3WAAD 2IO5B 3MGQA 5B2JD 2BYMA 5B1LA 5B2IC 4UPKA 5AY8B 3MVDB 3AN2B 4X23C 4WU9A 3KWQB 1P3BD 5CPKA 4KUDD 3LZ0B 5FUGA 5KDMB 1H3OA 3REJA 1P3PA 3AZFA 4LD9C 3VH6T 5GT0B 1M1AC 3RELA 3LELD 4AWLB 3UT9A 5B31G 3X1VC 3X1UB 3REKB 1EQZB 3P5JB 3LZ1D 4KGCC 4WU8A 1HQ3C 2FJ7D 4DQYB 3H0MC 2CV5C 1P3FA 1ID3D 4XZQB 2VQRA 3MGSC 5BNVA 1N1JA 3AL0C 1F1EA 5GXQC 5B0YD 5CP6A 3AZHC 1ZLAD 1P3GB 4H9RA 1TZYD 1HTAA 2HIOD 1Z2CB 3TU4A 1M19D 4YM6A 3H0RC 5B2ID 1S32C 4XUJB 5AV5B 2XD1A 3AFAA 5AV8A 3REIA 5B31B 1JFIB 3MGRD 3C1BA 5G49A 1M1AD 4LD9D 2XD5A 3X1SB 4R8PB 3C1CA 3KXBB 1P3AD 3WAAA 2ZY2A 3X1VD 5B2JA 4J8WD 3KSYA 1P3KC 3B6FB 1P3BA 4KUDA 3MGQC 4KGCD 2PYOC 4WV4B 4WU9C 3MNNA 1T3UA 5BNXB 3W97C 2CV5D 4XUJA 3W98C 5GT3B 5AV6C 1P3PC 3LELA 4H9SA 1KX3B 5AV9B 3NQJB 3RELC 5B24B 5BT1D 3WTPA 3AZHD 4X23B 2HUEB 3LZ1A 1B67A 4H9QB 2FJ7A 4NFTA 3KUYC 1M18C 2NQBB 1U35B 1ID3A 3AZGC 3NQUB 4M6BA 5JA4B 1P3IB 1B6WA 5B0YA 3O62B 3REHD 1ZLAA 1TZYA 4G92B 1M19A 2HIOA 1BH8B 4YS3C 2Y2IA 4E45A 3IP4C 5B2IA 4J8XD 3AYWC 2PYOD 3W99C 3V9RB 2Y2QA 3W97D 3MGSB 4UUZA 4LD9A 4H9PA 3AFAC 1M1AA 5GXQB 5AV6D 1P3OC 5DNMD 3X1TB 3AZIB 3EPHA 2W8SA 1P3AA 3X1VA 1S32B 4J8WA 3WAAC 3R45B 4QLCC 3VH5A 4KGCA 5AVBB 1HQ3A 4EO5B 2BYKB 2DF4C 2CV5A 3KUYD 1M18D 5AVCC 2RVQC 1P34C 3AZGD 1P3LC 3MGSA 1P3MC 3AZKB 2ZY3A 4JJNB 5DNNC 3LELC 1P3KB 3AZLB 5B0ZD 3AZHA 2Y2NA 3MGQB 2BYMB 5B1LB 4WU9B 4YS3D 5CPKB 3AYWD 5FUGB 3REJB 1H3OB 1P3PB 3AZFB 1PZRA 1BFMA 5E5AD 3A6NC 3RELB 5CPJD 1P3OD 2YFVA 3VH6W 5B33C 5F99C 3AZNC 2F8NK 3UT9B 3REHA 3UTAD 1ZLAC 4WU8B 1F66D 4HGAB 1M19C 2HIOC 4QLCD 2PYOA 3EPJA 3W97A 3UTBC 1P3FB 2Y2HA 4WNNA 3W98A 5AV6A 5DNMA 5AVCD 2RVQD 5BNVB 5B32C 3MGRC 1N1JB 4E44A 1P34D 1P3LD 4Z2MH 2F8NH 1P3MD 3REKD 5CP6B 5DNND 4H9RB 5CPIC 3TU4B 4YM6B 1P3AC 2NZDD 3W99B 4J8WC 2F8ND 3MGPC 5JRGC 3AFAB 5AV8B 3REIB 1KX4C 2ZM5A 3KUYA 1M18A 4Z2MG 3C1BB 5G49B 3A6ND 3AZGA 4Z5TD 3C1CB 5B33D 1Q9CA 5F99D 3AZND 3WAAB 5B0ZA 5B2JB 5BT1C 4YS3A 1P3BB 4KUDB 4KHAA 3AYWA 3MNNB 4NE3A 3W99A 5E5AA 3UTBD 4NE5A 3LJAC 3LELB 1P3OA 1AOIC 1A7WA 3AZED 5B32D 3WTPB 2YFWB 5CPID 3REHC 3LZ1B 3UTAA 1F66A 4CAYA 4QLCA 2FJ7B 3MGPD 4J8XC 5BS7C 5JRGD 1KX4D 3AV1C 1ID3B 5AVCA 1P34A 1P3LA 5B0YB 5DNMC 1P3MA 5DNNA 1ZLAB 2BG1A 1TZYB 2AROC 2HIOB 1M19B 5BO0A 5B2IB 2NZDA 3W96C 3AZMC 2F8NA 2YFWA 3AV2C 4J8UC 4UUZB 3MGRB 4H9PB 3A6NA 1M1AB 4ZBJC 4LD9B 2Y2GA 3LJAD 1AOID 5B33A 3EPLA 5F99A 3AZNA 1P3AB 4Z66C 5B1MC 3X1VB 4J8WB 4J8VD 3WKJD 5B0ZC 1KX5C 4KGCB 1HQ3B 5GSUC 2CV5B 3B6GC 5CHLB 3UTBA 2L5AA 4ZUXC 3AV1D 5E5AC 3AZEA 5B32A 3MGRA 3WA9C 5CPJC 5B40C 3AZHB 5CPIA 2AROD 3KWQC 3EG5B 3AZMD 3UTAC 3W96D 3MGPA 3LZ0C 1F66C 3F6TA 3AV2D 2Y2KA 5JRGA 1KX4A 1R4VA 4J8UD 5GT0C 3AZKD 2YFVB 4AWLC 3REHB 3X1UC 3REKC 4Z66D 5B1MD 1EQZC 4H9OA 4J8XB 1KX5D 2PYOB 3VH6A 2NZDC 5GSUD 3W97B 3AZJD 1W2EA 4WNNB 3B6GD 3W98B 5AV6B 5DNMB 4XZQC 4ZUXD 3LJAA 3EPKA 1AOIA 2LY8A 4Z5TC 3WA9D 2CWEA 5B40D 1P3GC 4J8VA 3WKJA 2JCHA 5AY8D 3MVDD 3AN2D 3KWQD 3LZ0D 4J8XA 5BS7A 5B31C 3KUYB 1M18B 1TAFA 2Y2OA 5GT0D 3AV1A 3AZGB 3B0CT 3X1SC 4R8PC 5B0ZB 3AZEC 2AROA 3X1UD 4YS3B 1EQZD 4KHAB 3W96A 3AZMA 3AYWB 2Y2JA 3AV2A 3VH5T 2Y2MA 5E5AB 4J8UA 5GT3C 1P3OB 2F8NG 4XZQD 5AV9C 5B24C 4CSRA 4Z66A 5B1MA 1P3GD 3UTAB 2HUEC 1F66B 3MNND 4H9NA 1KX5A 4CAYB 4QLCB 4XUJD 5GSUA 5AV5D 3AZJA 3B6GA 2NQBC 5B31D 1U35C 1BH9A 5AVCB 4DRBA 4ZUXA 1P34B 3WTPD 1P3LB 3X1SD 4R8PD 1P3MB 1P3IC 3O62C 3KXBD 5CPJA 2G5IC 5DNNB 3WA9A 3H0LC 5B40A 4G92C 5BO0B 2NZDB 3B6FD 2Y2LA 5AY8A 4WZSB 3MVDA 5B32G 4J8VC 3AN2A 2F8NB 3KWQA 3WKJC 1KU5A 3LZ0A 2F2AC 5KDMA 3A6NB 5GT0A 5GT3D 4NE6A 4Z5TB 3X1TC 5B33B 1KX3D 5F99B 3AZNB 3AZIC 5AV9D 5B24D 2UWXA 3X1UA 4X23D 3REKA 1EQZA 5AVBC 4EO5C 1ULYA 3UTBB 2NQBD 2ZY4A 1U35D 5C3IC 4XZQA 3AZEB 5B32B 3AZKC 4JJNC 4Z5TA 1P3ID 3O62D 3AZLC 2DQNC 5CPIB 1P3GA 1HQ3D 5B1LC 1WWIA 3A1KA 5CPKC 3MGPB 2ZY5A 3REJC 5AV5A 5JRGB 1KX4B 3AZFC 5B31A 1JFIA 3MGSD 3AZJC 5GXQD 3X1SA 3X1TD 4R8PA 3KXBA 3UT9C 4G91C 3AZID 2Y2PA 1S32D 4H9OB 4WJ3C 3B6FA 4WU8C 3B0DC 4HGAC 2IO5C 5AVBD 5AY8C 3MVDC 3AN2C 2RIQA 5BNXA 1P3FC 3B0BA 5GT3A 3LJAB 1AOIB 1KX3A 2G5HC 3NQJA 5CP6C 5AV9A 4JJND 5B24A 1P3KD 3FDDA 3AZLD 4J8VB 3WKJB 4X23A 3TU4C 3MGQD 3KFUG 4YM6C 5B1LD 4WU9D 4H9QA 3A1IA 5CPKD 2J8PA 3W98D 5AV8C 3REIC 3REJD 1P3PD 3AZFD 1TAFB 2NQBA 3C1BC 1U35A 3AV1B 3NQUA 3RELD 5JA4A 3C1CC 1P3IA 3O62A 3B0CW 3UT9D 2AROB 5B2JC 1BH8A 1P3BC 4KUDC 3AZMB 4WU8D 3W96B 2JSSA 3MNNC 3AV2B 5C3IB 4J8UB 3V9RA 4XUJC 1P3FD 5AV5C 4ZBJB 3VH5W 5GXQA 4H9SC 3X1TA 4DRAA 3WTPC 3AZIA 5CP6D 4CSRB 4Z66B 5B1MB 3KXBC 1S32A 3WTPE 3LZ1C 3TU4D 4H9NB 4YM6D 1KX5B 3R45A 2FJ7C 3W99D
chains in the Genus database with same CATH topology
5AVBA 3B6FC 5GSUB 2FFFB 2BYKA 3AZJB 3AFAD 5AV8D 3REID 3B6GB 2JE5A 1ID3C 1BH9B 3C1BD 4ZUXB 4G91B 1WWSA 5B0YC 3C1CD 3AZKA 5CPJB 4JJNA 3WA9B 5B40B 1P3KA 3AZLA 1KX3C 1TZYC 3B0DB 3WAAD 2IO5B 3MGQA 5B2JD 2BYMA 5B1LA 5B2IC 4UPKA 5AY8B 3MVDB 3AN2B 4X23C 4WU9A 3KWQB 1P3BD 5CPKA 4KUDD 3LZ0B 5FUGA 5KDMB 1H3OA 3REJA 1P3PA 3AZFA 4LD9C 3VH6T 5GT0B 1M1AC 3RELA 3LELD 4AWLB 3UT9A 5B31G 3X1VC 3X1UB 3REKB 1EQZB 3P5JB 3LZ1D 4KGCC 4WU8A 1HQ3C 2FJ7D 4DQYB 3H0MC 2CV5C 1P3FA 1ID3D 4XZQB 2VQRA 3MGSC 5BNVA 1N1JA 3AL0C 1F1EA 5GXQC 5B0YD 5CP6A 3AZHC 1ZLAD 1P3GB 4H9RA 1TZYD 1HTAA 2HIOD 1Z2CB 3TU4A 1M19D 4YM6A 3H0RC 5B2ID 1S32C 4XUJB 5AV5B 2XD1A 3AFAA 5AV8A 3REIA 5B31B 1JFIB 3MGRD 3C1BA 5G49A 1M1AD 4LD9D 2XD5A 3X1SB 4R8PB 3C1CA 3KXBB 1P3AD 3WAAA 2ZY2A 3X1VD 5B2JA 4J8WD 3KSYA 1P3KC 3B6FB 1P3BA 4KUDA 3MGQC 4KGCD 2PYOC 4WV4B 4WU9C 3MNNA 1T3UA 5BNXB 3W97C 2CV5D 4XUJA 3W98C 5GT3B 5AV6C 1P3PC 3LELA 4H9SA 1KX3B 5AV9B 3NQJB 3RELC 5B24B 5BT1D 3WTPA 3AZHD 4X23B 2HUEB 3LZ1A 1B67A 4H9QB 2FJ7A 4NFTA 3KUYC 1M18C 2NQBB 1U35B 1ID3A 3AZGC 3NQUB 4M6BA 5JA4B 1P3IB 1B6WA 5B0YA 3O62B 3REHD 1ZLAA 1TZYA 4G92B 1M19A 2HIOA 1BH8B 4YS3C 2Y2IA 4E45A 3IP4C 5B2IA 4J8XD 3AYWC 2PYOD 3W99C 3V9RB 2Y2QA 3W97D 3MGSB 4UUZA 4LD9A 4H9PA 3AFAC 1M1AA 5GXQB 5AV6D 1P3OC 5DNMD 3X1TB 3AZIB 3EPHA 2W8SA 1P3AA 3X1VA 1S32B 4J8WA 3WAAC 3R45B 4QLCC 3VH5A 4KGCA 5AVBB 1HQ3A 4EO5B 2BYKB 2DF4C 2CV5A 3KUYD 1M18D 5AVCC 2RVQC 1P34C 3AZGD 1P3LC 3MGSA 1P3MC 3AZKB 2ZY3A 4JJNB 5DNNC 3LELC 1P3KB 3AZLB 5B0ZD 3AZHA 2Y2NA 3MGQB 2BYMB 5B1LB 4WU9B 4YS3D 5CPKB 3AYWD 5FUGB 3REJB 1H3OB 1P3PB 3AZFB 1PZRA 1BFMA 5E5AD 3A6NC 3RELB 5CPJD 1P3OD 2YFVA 3VH6W 5B33C 5F99C 3AZNC 2F8NK 3UT9B 3REHA 3UTAD 1ZLAC 4WU8B 1F66D 4HGAB 1M19C 2HIOC 4QLCD 2PYOA 3EPJA 3W97A 3UTBC 1P3FB 2Y2HA 4WNNA 3W98A 5AV6A 5DNMA 5AVCD 2RVQD 5BNVB 5B32C 3MGRC 1N1JB 4E44A 1P34D 1P3LD 4Z2MH 2F8NH 1P3MD 3REKD 5CP6B 5DNND 4H9RB 5CPIC 3TU4B 4YM6B 1P3AC 2NZDD 3W99B 4J8WC 2F8ND 3MGPC 5JRGC 3AFAB 5AV8B 3REIB 1KX4C 2ZM5A 3KUYA 1M18A 4Z2MG 3C1BB 5G49B 3A6ND 3AZGA 4Z5TD 3C1CB 5B33D 1Q9CA 5F99D 3AZND 3WAAB 5B0ZA 5B2JB 5BT1C 4YS3A 1P3BB 4KUDB 4KHAA 3AYWA 3MNNB 4NE3A 3W99A 5E5AA 3UTBD 4NE5A 3LJAC 3LELB 1P3OA 1AOIC 1A7WA 3AZED 5B32D 3WTPB 2YFWB 5CPID 3REHC 3LZ1B 3UTAA 1F66A 4CAYA 4QLCA 2FJ7B 3MGPD 4J8XC 5BS7C 5JRGD 1KX4D 3AV1C 1ID3B 5AVCA 1P34A 1P3LA 5B0YB 5DNMC 1P3MA 5DNNA 1ZLAB 2BG1A 1TZYB 2AROC 2HIOB 1M19B 5BO0A 5B2IB 2NZDA 3W96C 3AZMC 2F8NA 2YFWA 3AV2C 4J8UC 4UUZB 3MGRB 4H9PB 3A6NA 1M1AB 4ZBJC 4LD9B 2Y2GA 3LJAD 1AOID 5B33A 3EPLA 5F99A 3AZNA 1P3AB 4Z66C 5B1MC 3X1VB 4J8WB 4J8VD 3WKJD 5B0ZC 1KX5C 4KGCB 1HQ3B 5GSUC 2CV5B 3B6GC 5CHLB 3UTBA 2L5AA 4ZUXC 3AV1D 5E5AC 3AZEA 5B32A 3MGRA 3WA9C 5CPJC 5B40C 3AZHB 5CPIA 2AROD 3KWQC 3EG5B 3AZMD 3UTAC 3W96D 3MGPA 3LZ0C 1F66C 3F6TA 3AV2D 2Y2KA 5JRGA 1KX4A 1R4VA 4J8UD 5GT0C 3AZKD 2YFVB 4AWLC 3REHB 3X1UC 3REKC 4Z66D 5B1MD 1EQZC 4H9OA 4J8XB 1KX5D 2PYOB 3VH6A 2NZDC 5GSUD 3W97B 3AZJD 1W2EA 4WNNB 3B6GD 3W98B 5AV6B 5DNMB 4XZQC 4ZUXD 3LJAA 3EPKA 1AOIA 2LY8A 4Z5TC 3WA9D 2CWEA 5B40D 1P3GC 4J8VA 3WKJA 2JCHA 5AY8D 3MVDD 3AN2D 3KWQD 3LZ0D 4J8XA 5BS7A 5B31C 3KUYB 1M18B 1TAFA 2Y2OA 5GT0D 3AV1A 3AZGB 3B0CT 3X1SC 4R8PC 5B0ZB 3AZEC 2AROA 3X1UD 4YS3B 1EQZD 4KHAB 3W96A 3AZMA 3AYWB 2Y2JA 3AV2A 3VH5T 2Y2MA 5E5AB 4J8UA 5GT3C 1P3OB 2F8NG 4XZQD 5AV9C 5B24C 4CSRA 4Z66A 5B1MA 1P3GD 3UTAB 2HUEC 1F66B 3MNND 4H9NA 1KX5A 4CAYB 4QLCB 4XUJD 5GSUA 5AV5D 3AZJA 3B6GA 2NQBC 5B31D 1U35C 1BH9A 5AVCB 4DRBA 4ZUXA 1P34B 3WTPD 1P3LB 3X1SD 4R8PD 1P3MB 1P3IC 3O62C 3KXBD 5CPJA 2G5IC 5DNNB 3WA9A 3H0LC 5B40A 4G92C 5BO0B 2NZDB 3B6FD 2Y2LA 5AY8A 4WZSB 3MVDA 5B32G 4J8VC 3AN2A 2F8NB 3KWQA 3WKJC 1KU5A 3LZ0A 2F2AC 5KDMA 3A6NB 5GT0A 5GT3D 4NE6A 4Z5TB 3X1TC 5B33B 1KX3D 5F99B 3AZNB 3AZIC 5AV9D 5B24D 2UWXA 3X1UA 4X23D 3REKA 1EQZA 5AVBC 4EO5C 1ULYA 3UTBB 2NQBD 2ZY4A 1U35D 5C3IC 4XZQA 3AZEB 5B32B 3AZKC 4JJNC 4Z5TA 1P3ID 3O62D 3AZLC 2DQNC 5CPIB 1P3GA 1HQ3D 5B1LC 1WWIA 3A1KA 5CPKC 3MGPB 2ZY5A 3REJC 5AV5A 5JRGB 1KX4B 3AZFC 5B31A 1JFIA 3MGSD 3AZJC 5GXQD 3X1SA 3X1TD 4R8PA 3KXBA 3UT9C 4G91C 3AZID 2Y2PA 1S32D 4H9OB 4WJ3C 3B6FA 4WU8C 3B0DC 4HGAC 2IO5C 5AVBD 5AY8C 3MVDC 3AN2C 2RIQA 5BNXA 1P3FC 3B0BA 5GT3A 3LJAB 1AOIB 1KX3A 2G5HC 3NQJA 5CP6C 5AV9A 4JJND 5B24A 1P3KD 3FDDA 3AZLD 4J8VB 3WKJB 4X23A 3TU4C 3MGQD 3KFUG 4YM6C 5B1LD 4WU9D 4H9QA 3A1IA 5CPKD 2J8PA 3W98D 5AV8C 3REIC 3REJD 1P3PD 3AZFD 1TAFB 2NQBA 3C1BC 1U35A 3AV1B 3NQUA 3RELD 5JA4A 3C1CC 1P3IA 3O62A 3B0CW 3UT9D 2AROB 5B2JC 1BH8A 1P3BC 4KUDC 3AZMB 4WU8D 3W96B 2JSSA 3MNNC 3AV2B 5C3IB 4J8UB 3V9RA 4XUJC 1P3FD 5AV5C 4ZBJB 3VH5W 5GXQA 4H9SC 3X1TA 4DRAA 3WTPC 3AZIA 5CP6D 4CSRB 4Z66B 5B1MB 3KXBC 1S32A 3WTPE 3LZ1C 3TU4D 4H9NB 4YM6D 1KX5B 3R45A 2FJ7C 3W99D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVB A;  3B6F C;  5GSU B;  3AZJ B;  2BYK A;  3AFA D;  5AV8 D;  3REI D;  3B6G B;  1ID3 C;  1BH9 B;  3C1B D;  4ZUX B;  4G91 B;  1WWS A;  5B0Y C;  3C1C D;  3AZK A;  5CPJ B;  4JJN A;  3WA9 B;  5B40 B;  1P3K A;  3AZL A;  1KX3 C;  1TZY C;  3B0D B;  3WAA D;  2IO5 B;  3MGQ A;  5B2J D;  2BYM A;  5B1L A;  5B2I C;  5AY8 B;  3MVD B;  3AN2 B;  4WU9 A;  4X23 C;  1P3B D;  3KWQ B;  4KUD D;  5CPK A;  3LZ0 B;  5FUG A;  5KDM B;  1H3O A;  3REJ A;  1P3P A;  3AZF A;  4LD9 C;  3VH6 T;  5GT0 B;  1M1A C;  3REL A;  3LEL D;  4AWL B;  3UT9 A;  5B31 G;  3X1V C;  3X1U B;  3REK B;  1EQZ B;  3LZ1 D;  4KGC C;  4WU8 A;  1HQ3 C;  2FJ7 D;  2CV5 C;  1P3F A;  1ID3 D;  4XZQ B;  3MGS C;  5BNV A;  1N1J A;  1F1E A;  5GXQ C;  5B0Y D;  5CP6 A;  3AZH C;  1ZLA D;  1P3G B;  4H9R A;  1TZY D;  1HTA A;  2HIO D;  3TU4 A;  1M19 D;  4YM6 A;  5B2I D;  1S32 C;  4XUJ B;  5AV5 B;  3AFA A;  5AV8 A;  3REI A;  5B31 B;  1JFI B;  3MGR D;  3C1B A;  5G49 A;  1M1A D;  4LD9 D;  3X1S B;  4R8P B;  3C1C A;  3KXB B;  1P3A D;  3WAA A;  3X1V D;  5B2J A;  4J8W D;  3KSY A;  1P3K C;  3B6F B;  1P3B A;  4KUD A;  3MGQ C;  4KGC D;  2PYO C;  4WV4 B;  4WU9 C;  3MNN A;  5BNX B;  3W97 C;  2CV5 D;  4XUJ A;  3W98 C;  5GT3 B;  5AV6 C;  1P3P C;  3LEL A;  4H9S A;  1KX3 B;  5AV9 B;  3NQJ B;  3REL C;  5B24 B;  5BT1 D;  3WTP A;  3AZH D;  4X23 B;  2HUE B;  3LZ1 A;  1B67 A;  4H9Q B;  2FJ7 A;  4NFT A;  3KUY C;  1M18 C;  2NQB B;  1U35 B;  1ID3 A;  3AZG C;  3NQU B;  4M6B A;  5JA4 B;  1P3I B;  1B6W A;  5B0Y A;  3O62 B;  3REH D;  1ZLA A;  1TZY A;  4G92 B;  1M19 A;  2HIO A;  1BH8 B;  4YS3 C;  4E45 A;  5B2I A;  4J8X D;  3AYW C;  2PYO D;  3W99 C;  3V9R B;  3W97 D;  3MGS B;  4UUZ A;  4LD9 A;  4H9P A;  3AFA C;  1M1A A;  5GXQ B;  5AV6 D;  1P3O C;  5DNM D;  3X1T B;  3AZI B;  1P3A A;  3X1V A;  1S32 B;  4J8W A;  3WAA C;  3R45 B;  4QLC C;  3VH5 A;  4KGC A;  5AVB B;  1HQ3 A;  4EO5 B;  2BYK B;  2CV5 A;  3KUY D;  1M18 D;  5AVC C;  2RVQ C;  1P34 C;  3AZG D;  1P3L C;  3MGS A;  1P3M C;  3AZK B;  4JJN B;  5DNN C;  3LEL C;  1P3K B;  3AZL B;  5B0Z D;  3AZH A;  3MGQ B;  2BYM B;  5B1L B;  4WU9 B;  4YS3 D;  5CPK B;  3AYW D;  5FUG B;  3REJ B;  1H3O B;  1P3P B;  3AZF B;  1BFM A;  5E5A D;  3A6N C;  3REL B;  5CPJ D;  1P3O D;  2YFV A;  3VH6 W;  5B33 C;  5F99 C;  3AZN C;  2F8N K;  3UT9 B;  3REH A;  3UTA D;  1ZLA C;  4WU8 B;  1F66 D;  4HGA B;  1M19 C;  2HIO C;  4QLC D;  2PYO A;  3W97 A;  3UTB C;  1P3F B;  4WNN A;  3W98 A;  5AV6 A;  5DNM A;  5AVC D;  2RVQ D;  5BNV B;  5B32 C;  3MGR C;  1N1J B;  4E44 A;  1P34 D;  1P3L D;  4Z2M H;  2F8N H;  1P3M D;  3REK D;  5CP6 B;  5DNN D;  4H9R B;  5CPI C;  3TU4 B;  4YM6 B;  1P3A C;  2NZD D;  3W99 B;  4J8W C;  2F8N D;  3MGP C;  5JRG C;  3AFA B;  5AV8 B;  3REI B;  1KX4 C;  3KUY A;  1M18 A;  4Z2M G;  3C1B B;  5G49 B;  3A6N D;  3AZG A;  4Z5T D;  3C1C B;  5B33 D;  1Q9C A;  5F99 D;  3AZN D;  3WAA B;  5B0Z A;  5B2J B;  5BT1 C;  4YS3 A;  1P3B B;  4KUD B;  4KHA A;  3AYW A;  3MNN B;  4NE3 A;  3W99 A;  5E5A A;  3UTB D;  4NE5 A;  3LJA C;  3LEL B;  1P3O A;  1AOI C;  1A7W A;  3AZE D;  5B32 D;  3WTP B;  2YFW B;  5CPI D;  3REH C;  3LZ1 B;  3UTA A;  1F66 A;  4CAY A;  4QLC A;  2FJ7 B;  3MGP D;  4J8X C;  5BS7 C;  5JRG D;  1KX4 D;  3AV1 C;  1ID3 B;  5AVC A;  1P34 A;  1P3L A;  5B0Y B;  5DNM C;  1P3M A;  5DNN A;  1ZLA B;  1TZY B;  2ARO C;  2HIO B;  1M19 B;  5BO0 A;  5B2I B;  2NZD A;  3W96 C;  3AZM C;  2F8N A;  2YFW A;  3AV2 C;  4J8U C;  4UUZ B;  3MGR B;  4H9P B;  3A6N A;  1M1A B;  4ZBJ C;  4LD9 B;  3LJA D;  1AOI D;  5B33 A;  5F99 A;  3AZN A;  1P3A B;  4Z66 C;  5B1M C;  3X1V B;  4J8W B;  4J8V D;  3WKJ D;  5B0Z C;  1KX5 C;  4KGC B;  1HQ3 B;  5GSU C;  2CV5 B;  3B6G C;  5CHL B;  3UTB A;  2L5A A;  4ZUX C;  3AV1 D;  5E5A C;  3AZE A;  5B32 A;  3MGR A;  3WA9 C;  5CPJ C;  5B40 C;  3AZH B;  5CPI A;  2ARO D;  3KWQ C;  3AZM D;  3UTA C;  3W96 D;  3MGP A;  3LZ0 C;  1F66 C;  3AV2 D;  5JRG A;  1KX4 A;  1R4V A;  4J8U D;  5GT0 C;  3AZK D;  2YFV B;  4AWL C;  3REH B;  3X1U C;  3REK C;  4Z66 D;  5B1M D;  1EQZ C;  4H9O A;  4J8X B;  1KX5 D;  2PYO B;  3VH6 A;  2NZD C;  5GSU D;  3W97 B;  3AZJ D;  4WNN B;  3B6G D;  3W98 B;  5AV6 B;  5DNM B;  4XZQ C;  4ZUX D;  3LJA A;  1AOI A;  2LY8 A;  4Z5T C;  3WA9 D;  2CWE A;  5B40 D;  1P3G C;  4J8V A;  3WKJ A;  5AY8 D;  3MVD D;  3AN2 D;  3KWQ D;  3LZ0 D;  4J8X A;  5BS7 A;  5B31 C;  3KUY B;  1M18 B;  1TAF A;  5GT0 D;  3AV1 A;  3AZG B;  3B0C T;  3X1S C;  4R8P C;  5B0Z B;  3AZE C;  2ARO A;  3X1U D;  4YS3 B;  1EQZ D;  4KHA B;  3W96 A;  3AZM A;  3AYW B;  3AV2 A;  3VH5 T;  5E5A B;  4J8U A;  5GT3 C;  1P3O B;  2F8N G;  4XZQ D;  5AV9 C;  5B24 C;  4CSR A;  4Z66 A;  5B1M A;  1P3G D;  3UTA B;  2HUE C;  1F66 B;  3MNN D;  4H9N A;  1KX5 A;  4CAY B;  4QLC B;  4XUJ D;  5GSU A;  5AV5 D;  3AZJ A;  3B6G A;  2NQB C;  5B31 D;  1U35 C;  1BH9 A;  5AVC B;  4DRB A;  4ZUX A;  1P34 B;  3WTP D;  1P3L B;  3X1S D;  4R8P D;  1P3M B;  1P3I C;  3O62 C;  3KXB D;  5CPJ A;  5DNN B;  3WA9 A;  5B40 A;  4G92 C;  5BO0 B;  2NZD B;  3B6F D;  5AY8 A;  4WZS B;  3MVD A;  5B32 G;  4J8V C;  3AN2 A;  2F8N B;  3KWQ A;  3WKJ C;  1KU5 A;  3LZ0 A;  5KDM A;  3A6N B;  5GT0 A;  5GT3 D;  4NE6 A;  4Z5T B;  3X1T C;  5B33 B;  1KX3 D;  5F99 B;  3AZN B;  3AZI C;  5AV9 D;  5B24 D;  3X1U A;  4X23 D;  3REK A;  1EQZ A;  5AVB C;  4EO5 C;  1ULY A;  3UTB B;  2NQB D;  1U35 D;  5C3I C;  4XZQ A;  3AZE B;  5B32 B;  3AZK C;  4JJN C;  4Z5T A;  1P3I D;  3O62 D;  3AZL C;  5CPI B;  1P3G A;  1HQ3 D;  5B1L C;  1WWI A;  5CPK C;  3MGP B;  3REJ C;  5AV5 A;  5JRG B;  1KX4 B;  3AZF C;  5B31 A;  1JFI A;  3MGS D;  3AZJ C;  5GXQ D;  3X1S A;  3X1T D;  4R8P A;  3KXB A;  3UT9 C;  4G91 C;  3AZI D;  1S32 D;  4H9O B;  3B6F A;  4WU8 C;  3B0D C;  4HGA C;  2IO5 C;  5AVB D;  5AY8 C;  3MVD C;  3AN2 C;  5BNX A;  1P3F C;  3B0B A;  5GT3 A;  3LJA B;  1AOI B;  1KX3 A;  5AV9 A;  3NQJ A;  5CP6 C;  4JJN D;  5B24 A;  1P3K D;  3AZL D;  4J8V B;  3WKJ B;  4X23 A;  3TU4 C;  3MGQ D;  4YM6 C;  5B1L D;  4WU9 D;  4H9Q A;  5CPK D;  3W98 D;  5AV8 C;  3REI C;  3REJ D;  1P3P D;  3AZF D;  1TAF B;  2NQB A;  3C1B C;  1U35 A;  3AV1 B;  3NQU A;  3REL D;  5JA4 A;  3C1C C;  1P3I A;  3O62 A;  3B0C W;  3UT9 D;  2ARO B;  5B2J C;  1BH8 A;  1P3B C;  4KUD C;  3AZM B;  4WU8 D;  3W96 B;  2JSS A;  3MNN C;  3AV2 B;  5C3I B;  4J8U B;  3V9R A;  4XUJ C;  1P3F D;  5AV5 C;  4ZBJ B;  3VH5 W;  5GXQ A;  4H9S C;  3X1T A;  4DRA A;  3WTP C;  3AZI A;  5CP6 D;  4CSR B;  4Z66 B;  5B1M B;  3KXB C;  1S32 A;  3WTP E;  3LZ1 C;  3TU4 D;  4H9N B;  4YM6 D;  1KX5 B;  3R45 A;  2FJ7 C;  3W99 D; 
#chains in the Genus database with same CATH topology
 5AVB A;  3B6F C;  5GSU B;  2FFF B;  2BYK A;  3AZJ B;  3AFA D;  5AV8 D;  3REI D;  3B6G B;  2JE5 A;  1ID3 C;  1BH9 B;  3C1B D;  4ZUX B;  4G91 B;  1WWS A;  5B0Y C;  3C1C D;  3AZK A;  5CPJ B;  4JJN A;  3WA9 B;  5B40 B;  1P3K A;  3AZL A;  1KX3 C;  1TZY C;  3B0D B;  3WAA D;  2IO5 B;  3MGQ A;  5B2J D;  2BYM A;  5B1L A;  5B2I C;  4UPK A;  5AY8 B;  3MVD B;  3AN2 B;  4X23 C;  4WU9 A;  3KWQ B;  1P3B D;  5CPK A;  4KUD D;  3LZ0 B;  5FUG A;  5KDM B;  1H3O A;  3REJ A;  1P3P A;  3AZF A;  4LD9 C;  3VH6 T;  5GT0 B;  1M1A C;  3REL A;  3LEL D;  4AWL B;  3UT9 A;  5B31 G;  3X1V C;  3X1U B;  3REK B;  1EQZ B;  3P5J B;  3LZ1 D;  4KGC C;  4WU8 A;  1HQ3 C;  2FJ7 D;  4DQY B;  3H0M C;  2CV5 C;  1P3F A;  1ID3 D;  4XZQ B;  2VQR A;  3MGS C;  5BNV A;  1N1J A;  3AL0 C;  1F1E A;  5GXQ C;  5B0Y D;  5CP6 A;  3AZH C;  1ZLA D;  1P3G B;  4H9R A;  1TZY D;  1HTA A;  2HIO D;  1Z2C B;  3TU4 A;  1M19 D;  4YM6 A;  3H0R C;  5B2I D;  1S32 C;  4XUJ B;  5AV5 B;  2XD1 A;  3AFA A;  5AV8 A;  3REI A;  5B31 B;  1JFI B;  3MGR D;  3C1B A;  5G49 A;  1M1A D;  4LD9 D;  2XD5 A;  3X1S B;  4R8P B;  3C1C A;  3KXB B;  1P3A D;  3WAA A;  2ZY2 A;  3X1V D;  5B2J A;  4J8W D;  3KSY A;  1P3K C;  3B6F B;  1P3B A;  4KUD A;  3MGQ C;  4KGC D;  2PYO C;  4WV4 B;  4WU9 C;  3MNN A;  1T3U A;  5BNX B;  3W97 C;  2CV5 D;  4XUJ A;  3W98 C;  5GT3 B;  5AV6 C;  1P3P C;  3LEL A;  4H9S A;  1KX3 B;  5AV9 B;  3NQJ B;  3REL C;  5B24 B;  5BT1 D;  3WTP A;  3AZH D;  4X23 B;  2HUE B;  3LZ1 A;  1B67 A;  4H9Q B;  2FJ7 A;  4NFT A;  3KUY C;  1M18 C;  2NQB B;  1U35 B;  1ID3 A;  3AZG C;  3NQU B;  4M6B A;  5JA4 B;  1P3I B;  1B6W A;  5B0Y A;  3O62 B;  3REH D;  1ZLA A;  1TZY A;  4G92 B;  1M19 A;  2HIO A;  1BH8 B;  4YS3 C;  2Y2I A;  4E45 A;  3IP4 C;  5B2I A;  4J8X D;  3AYW C;  2PYO D;  3W99 C;  3V9R B;  2Y2Q A;  3W97 D;  3MGS B;  4UUZ A;  4LD9 A;  4H9P A;  3AFA C;  1M1A A;  5GXQ B;  5AV6 D;  1P3O C;  5DNM D;  3X1T B;  3AZI B;  3EPH A;  2W8S A;  1P3A A;  3X1V A;  1S32 B;  4J8W A;  3WAA C;  3R45 B;  4QLC C;  3VH5 A;  4KGC A;  5AVB B;  1HQ3 A;  4EO5 B;  2BYK B;  2DF4 C;  2CV5 A;  3KUY D;  1M18 D;  5AVC C;  2RVQ C;  1P34 C;  3AZG D;  1P3L C;  3MGS A;  1P3M C;  3AZK B;  2ZY3 A;  4JJN B;  5DNN C;  3LEL C;  1P3K B;  3AZL B;  5B0Z D;  3AZH A;  2Y2N A;  3MGQ B;  2BYM B;  5B1L B;  4WU9 B;  4YS3 D;  5CPK B;  3AYW D;  5FUG B;  3REJ B;  1H3O B;  1P3P B;  3AZF B;  1PZR A;  1BFM A;  5E5A D;  3A6N C;  3REL B;  5CPJ D;  1P3O D;  2YFV A;  3VH6 W;  5B33 C;  5F99 C;  3AZN C;  2F8N K;  3UT9 B;  3REH A;  3UTA D;  1ZLA C;  4WU8 B;  1F66 D;  4HGA B;  1M19 C;  2HIO C;  4QLC D;  2PYO A;  3EPJ A;  3W97 A;  3UTB C;  1P3F B;  2Y2H A;  4WNN A;  3W98 A;  5AV6 A;  5DNM A;  5AVC D;  2RVQ D;  5BNV B;  5B32 C;  3MGR C;  1N1J B;  4E44 A;  1P34 D;  1P3L D;  4Z2M H;  2F8N H;  1P3M D;  3REK D;  5CP6 B;  5DNN D;  4H9R B;  5CPI C;  3TU4 B;  4YM6 B;  1P3A C;  2NZD D;  3W99 B;  4J8W C;  2F8N D;  3MGP C;  5JRG C;  3AFA B;  5AV8 B;  3REI B;  1KX4 C;  2ZM5 A;  3KUY A;  1M18 A;  4Z2M G;  3C1B B;  5G49 B;  3A6N D;  3AZG A;  4Z5T D;  3C1C B;  5B33 D;  1Q9C A;  5F99 D;  3AZN D;  3WAA B;  5B0Z A;  5B2J B;  5BT1 C;  4YS3 A;  1P3B B;  4KUD B;  4KHA A;  3AYW A;  3MNN B;  4NE3 A;  3W99 A;  5E5A A;  3UTB D;  4NE5 A;  3LJA C;  3LEL B;  1P3O A;  1AOI C;  1A7W A;  3AZE D;  5B32 D;  3WTP B;  2YFW B;  5CPI D;  3REH C;  3LZ1 B;  3UTA A;  1F66 A;  4CAY A;  4QLC A;  2FJ7 B;  3MGP D;  4J8X C;  5BS7 C;  5JRG D;  1KX4 D;  3AV1 C;  1ID3 B;  5AVC A;  1P34 A;  1P3L A;  5B0Y B;  5DNM C;  1P3M A;  5DNN A;  1ZLA B;  2BG1 A;  1TZY B;  2ARO C;  2HIO B;  1M19 B;  5BO0 A;  5B2I B;  2NZD A;  3W96 C;  3AZM C;  2F8N A;  2YFW A;  3AV2 C;  4J8U C;  4UUZ B;  3MGR B;  4H9P B;  3A6N A;  1M1A B;  4ZBJ C;  4LD9 B;  2Y2G A;  3LJA D;  1AOI D;  5B33 A;  3EPL A;  5F99 A;  3AZN A;  1P3A B;  4Z66 C;  5B1M C;  3X1V B;  4J8W B;  4J8V D;  3WKJ D;  5B0Z C;  1KX5 C;  4KGC B;  1HQ3 B;  5GSU C;  2CV5 B;  3B6G C;  5CHL B;  3UTB A;  2L5A A;  4ZUX C;  3AV1 D;  5E5A C;  3AZE A;  5B32 A;  3MGR A;  3WA9 C;  5CPJ C;  5B40 C;  3AZH B;  5CPI A;  2ARO D;  3KWQ C;  3EG5 B;  3AZM D;  3UTA C;  3W96 D;  3MGP A;  3LZ0 C;  1F66 C;  3F6T A;  3AV2 D;  2Y2K A;  5JRG A;  1KX4 A;  1R4V A;  4J8U D;  5GT0 C;  3AZK D;  2YFV B;  4AWL C;  3REH B;  3X1U C;  3REK C;  4Z66 D;  5B1M D;  1EQZ C;  4H9O A;  4J8X B;  1KX5 D;  2PYO B;  3VH6 A;  2NZD C;  5GSU D;  3W97 B;  3AZJ D;  1W2E A;  4WNN B;  3B6G D;  3W98 B;  5AV6 B;  5DNM B;  4XZQ C;  4ZUX D;  3LJA A;  3EPK A;  1AOI A;  2LY8 A;  4Z5T C;  3WA9 D;  2CWE A;  5B40 D;  1P3G C;  4J8V A;  3WKJ A;  2JCH A;  5AY8 D;  3MVD D;  3AN2 D;  3KWQ D;  3LZ0 D;  4J8X A;  5BS7 A;  5B31 C;  3KUY B;  1M18 B;  1TAF A;  2Y2O A;  5GT0 D;  3AV1 A;  3AZG B;  3B0C T;  3X1S C;  4R8P C;  5B0Z B;  3AZE C;  2ARO A;  3X1U D;  4YS3 B;  1EQZ D;  4KHA B;  3W96 A;  3AZM A;  3AYW B;  2Y2J A;  3AV2 A;  3VH5 T;  2Y2M A;  5E5A B;  4J8U A;  5GT3 C;  1P3O B;  2F8N G;  4XZQ D;  5AV9 C;  5B24 C;  4CSR A;  4Z66 A;  5B1M A;  1P3G D;  3UTA B;  2HUE C;  1F66 B;  3MNN D;  4H9N A;  1KX5 A;  4CAY B;  4QLC B;  4XUJ D;  5GSU A;  5AV5 D;  3AZJ A;  3B6G A;  2NQB C;  5B31 D;  1U35 C;  1BH9 A;  5AVC B;  4DRB A;  4ZUX A;  1P34 B;  3WTP D;  1P3L B;  3X1S D;  4R8P D;  1P3M B;  1P3I C;  3O62 C;  3KXB D;  5CPJ A;  2G5I C;  5DNN B;  3WA9 A;  3H0L C;  5B40 A;  4G92 C;  5BO0 B;  2NZD B;  3B6F D;  2Y2L A;  5AY8 A;  4WZS B;  3MVD A;  5B32 G;  4J8V C;  3AN2 A;  2F8N B;  3KWQ A;  3WKJ C;  1KU5 A;  3LZ0 A;  2F2A C;  5KDM A;  3A6N B;  5GT0 A;  5GT3 D;  4NE6 A;  4Z5T B;  3X1T C;  5B33 B;  1KX3 D;  5F99 B;  3AZN B;  3AZI C;  5AV9 D;  5B24 D;  2UWX A;  3X1U A;  4X23 D;  3REK A;  1EQZ A;  5AVB C;  4EO5 C;  1ULY A;  3UTB B;  2NQB D;  2ZY4 A;  1U35 D;  5C3I C;  4XZQ A;  3AZE B;  5B32 B;  3AZK C;  4JJN C;  4Z5T A;  1P3I D;  3O62 D;  3AZL C;  2DQN C;  5CPI B;  1P3G A;  1HQ3 D;  5B1L C;  1WWI A;  3A1K A;  5CPK C;  3MGP B;  2ZY5 A;  3REJ C;  5AV5 A;  5JRG B;  1KX4 B;  3AZF C;  5B31 A;  1JFI A;  3MGS D;  3AZJ C;  5GXQ D;  3X1S A;  3X1T D;  4R8P A;  3KXB A;  3UT9 C;  4G91 C;  3AZI D;  2Y2P A;  1S32 D;  4H9O B;  4WJ3 C;  3B6F A;  4WU8 C;  3B0D C;  4HGA C;  2IO5 C;  5AVB D;  5AY8 C;  3MVD C;  3AN2 C;  2RIQ A;  5BNX A;  1P3F C;  3B0B A;  5GT3 A;  3LJA B;  1AOI B;  1KX3 A;  2G5H C;  3NQJ A;  5CP6 C;  5AV9 A;  4JJN D;  5B24 A;  1P3K D;  3FDD A;  3AZL D;  4J8V B;  3WKJ B;  4X23 A;  3TU4 C;  3MGQ D;  3KFU G;  4YM6 C;  5B1L D;  4WU9 D;  4H9Q A;  3A1I A;  5CPK D;  2J8P A;  3W98 D;  5AV8 C;  3REI C;  3REJ D;  1P3P D;  3AZF D;  1TAF B;  2NQB A;  3C1B C;  1U35 A;  3AV1 B;  3NQU A;  3REL D;  5JA4 A;  3C1C C;  1P3I A;  3O62 A;  3B0C W;  3UT9 D;  2ARO B;  5B2J C;  1BH8 A;  1P3B C;  4KUD C;  3AZM B;  4WU8 D;  3W96 B;  2JSS A;  3MNN C;  3AV2 B;  5C3I B;  4J8U B;  3V9R A;  4XUJ C;  1P3F D;  5AV5 C;  4ZBJ B;  3VH5 W;  5GXQ A;  4H9S C;  3X1T A;  4DRA A;  3WTP C;  3AZI A;  5CP6 D;  4CSR B;  4Z66 B;  5B1M B;  3KXB C;  1S32 A;  3WTP E;  3LZ1 C;  3TU4 D;  4H9N B;  4YM6 D;  1KX5 B;  3R45 A;  2FJ7 C;  3W99 D; 
#chains in the Genus database with same CATH homology
 5AVB A;  3B6F C;  5GSU B;  2FFF B;  2BYK A;  3AZJ B;  3AFA D;  5AV8 D;  3REI D;  3B6G B;  2JE5 A;  1ID3 C;  1BH9 B;  3C1B D;  4ZUX B;  4G91 B;  1WWS A;  5B0Y C;  3C1C D;  3AZK A;  5CPJ B;  4JJN A;  3WA9 B;  5B40 B;  1P3K A;  3AZL A;  1KX3 C;  1TZY C;  3B0D B;  3WAA D;  2IO5 B;  3MGQ A;  5B2J D;  2BYM A;  5B1L A;  5B2I C;  4UPK A;  5AY8 B;  3MVD B;  3AN2 B;  4X23 C;  4WU9 A;  3KWQ B;  1P3B D;  5CPK A;  4KUD D;  3LZ0 B;  5FUG A;  5KDM B;  1H3O A;  3REJ A;  1P3P A;  3AZF A;  4LD9 C;  3VH6 T;  5GT0 B;  1M1A C;  3REL A;  3LEL D;  4AWL B;  3UT9 A;  5B31 G;  3X1V C;  3X1U B;  3REK B;  1EQZ B;  3P5J B;  3LZ1 D;  4KGC C;  4WU8 A;  1HQ3 C;  2FJ7 D;  4DQY B;  3H0M C;  2CV5 C;  1P3F A;  1ID3 D;  4XZQ B;  2VQR A;  3MGS C;  5BNV A;  1N1J A;  3AL0 C;  1F1E A;  5GXQ C;  5B0Y D;  5CP6 A;  3AZH C;  1ZLA D;  1P3G B;  4H9R A;  1TZY D;  1HTA A;  2HIO D;  1Z2C B;  3TU4 A;  1M19 D;  4YM6 A;  3H0R C;  5B2I D;  1S32 C;  4XUJ B;  5AV5 B;  2XD1 A;  3AFA A;  5AV8 A;  3REI A;  5B31 B;  1JFI B;  3MGR D;  3C1B A;  5G49 A;  1M1A D;  4LD9 D;  2XD5 A;  3X1S B;  4R8P B;  3C1C A;  3KXB B;  1P3A D;  3WAA A;  2ZY2 A;  3X1V D;  5B2J A;  4J8W D;  3KSY A;  1P3K C;  3B6F B;  1P3B A;  4KUD A;  3MGQ C;  4KGC D;  2PYO C;  4WV4 B;  4WU9 C;  3MNN A;  1T3U A;  5BNX B;  3W97 C;  2CV5 D;  4XUJ A;  3W98 C;  5GT3 B;  5AV6 C;  1P3P C;  3LEL A;  4H9S A;  1KX3 B;  5AV9 B;  3NQJ B;  3REL C;  5B24 B;  5BT1 D;  3WTP A;  3AZH D;  4X23 B;  2HUE B;  3LZ1 A;  1B67 A;  4H9Q B;  2FJ7 A;  4NFT A;  3KUY C;  1M18 C;  2NQB B;  1U35 B;  1ID3 A;  3AZG C;  3NQU B;  4M6B A;  5JA4 B;  1P3I B;  1B6W A;  5B0Y A;  3O62 B;  3REH D;  1ZLA A;  1TZY A;  4G92 B;  1M19 A;  2HIO A;  1BH8 B;  4YS3 C;  2Y2I A;  4E45 A;  3IP4 C;  5B2I A;  4J8X D;  3AYW C;  2PYO D;  3W99 C;  3V9R B;  2Y2Q A;  3W97 D;  3MGS B;  4UUZ A;  4LD9 A;  4H9P A;  3AFA C;  1M1A A;  5GXQ B;  5AV6 D;  1P3O C;  5DNM D;  3X1T B;  3AZI B;  3EPH A;  2W8S A;  1P3A A;  3X1V A;  1S32 B;  4J8W A;  3WAA C;  3R45 B;  4QLC C;  3VH5 A;  4KGC A;  5AVB B;  1HQ3 A;  4EO5 B;  2BYK B;  2DF4 C;  2CV5 A;  3KUY D;  1M18 D;  5AVC C;  2RVQ C;  1P34 C;  3AZG D;  1P3L C;  3MGS A;  1P3M C;  3AZK B;  2ZY3 A;  4JJN B;  5DNN C;  3LEL C;  1P3K B;  3AZL B;  5B0Z D;  3AZH A;  2Y2N A;  3MGQ B;  2BYM B;  5B1L B;  4WU9 B;  4YS3 D;  5CPK B;  3AYW D;  5FUG B;  3REJ B;  1H3O B;  1P3P B;  3AZF B;  1PZR A;  1BFM A;  5E5A D;  3A6N C;  3REL B;  5CPJ D;  1P3O D;  2YFV A;  3VH6 W;  5B33 C;  5F99 C;  3AZN C;  2F8N K;  3UT9 B;  3REH A;  3UTA D;  1ZLA C;  4WU8 B;  1F66 D;  4HGA B;  1M19 C;  2HIO C;  4QLC D;  2PYO A;  3EPJ A;  3W97 A;  3UTB C;  1P3F B;  2Y2H A;  4WNN A;  3W98 A;  5AV6 A;  5DNM A;  5AVC D;  2RVQ D;  5BNV B;  5B32 C;  3MGR C;  1N1J B;  4E44 A;  1P34 D;  1P3L D;  4Z2M H;  2F8N H;  1P3M D;  3REK D;  5CP6 B;  5DNN D;  4H9R B;  5CPI C;  3TU4 B;  4YM6 B;  1P3A C;  2NZD D;  3W99 B;  4J8W C;  2F8N D;  3MGP C;  5JRG C;  3AFA B;  5AV8 B;  3REI B;  1KX4 C;  2ZM5 A;  3KUY A;  1M18 A;  4Z2M G;  3C1B B;  5G49 B;  3A6N D;  3AZG A;  4Z5T D;  3C1C B;  5B33 D;  1Q9C A;  5F99 D;  3AZN D;  3WAA B;  5B0Z A;  5B2J B;  5BT1 C;  4YS3 A;  1P3B B;  4KUD B;  4KHA A;  3AYW A;  3MNN B;  4NE3 A;  3W99 A;  5E5A A;  3UTB D;  4NE5 A;  3LJA C;  3LEL B;  1P3O A;  1AOI C;  1A7W A;  3AZE D;  5B32 D;  3WTP B;  2YFW B;  5CPI D;  3REH C;  3LZ1 B;  3UTA A;  1F66 A;  4CAY A;  4QLC A;  2FJ7 B;  3MGP D;  4J8X C;  5BS7 C;  5JRG D;  1KX4 D;  3AV1 C;  1ID3 B;  5AVC A;  1P34 A;  1P3L A;  5B0Y B;  5DNM C;  1P3M A;  5DNN A;  1ZLA B;  2BG1 A;  1TZY B;  2ARO C;  2HIO B;  1M19 B;  5BO0 A;  5B2I B;  2NZD A;  3W96 C;  3AZM C;  2F8N A;  2YFW A;  3AV2 C;  4J8U C;  4UUZ B;  3MGR B;  4H9P B;  3A6N A;  1M1A B;  4ZBJ C;  4LD9 B;  2Y2G A;  3LJA D;  1AOI D;  5B33 A;  3EPL A;  5F99 A;  3AZN A;  1P3A B;  4Z66 C;  5B1M C;  3X1V B;  4J8W B;  4J8V D;  3WKJ D;  5B0Z C;  1KX5 C;  4KGC B;  1HQ3 B;  5GSU C;  2CV5 B;  3B6G C;  5CHL B;  3UTB A;  2L5A A;  4ZUX C;  3AV1 D;  5E5A C;  3AZE A;  5B32 A;  3MGR A;  3WA9 C;  5CPJ C;  5B40 C;  3AZH B;  5CPI A;  2ARO D;  3KWQ C;  3EG5 B;  3AZM D;  3UTA C;  3W96 D;  3MGP A;  3LZ0 C;  1F66 C;  3F6T A;  3AV2 D;  2Y2K A;  5JRG A;  1KX4 A;  1R4V A;  4J8U D;  5GT0 C;  3AZK D;  2YFV B;  4AWL C;  3REH B;  3X1U C;  3REK C;  4Z66 D;  5B1M D;  1EQZ C;  4H9O A;  4J8X B;  1KX5 D;  2PYO B;  3VH6 A;  2NZD C;  5GSU D;  3W97 B;  3AZJ D;  1W2E A;  4WNN B;  3B6G D;  3W98 B;  5AV6 B;  5DNM B;  4XZQ C;  4ZUX D;  3LJA A;  3EPK A;  1AOI A;  2LY8 A;  4Z5T C;  3WA9 D;  2CWE A;  5B40 D;  1P3G C;  4J8V A;  3WKJ A;  2JCH A;  5AY8 D;  3MVD D;  3AN2 D;  3KWQ D;  3LZ0 D;  4J8X A;  5BS7 A;  5B31 C;  3KUY B;  1M18 B;  1TAF A;  2Y2O A;  5GT0 D;  3AV1 A;  3AZG B;  3B0C T;  3X1S C;  4R8P C;  5B0Z B;  3AZE C;  2ARO A;  3X1U D;  4YS3 B;  1EQZ D;  4KHA B;  3W96 A;  3AZM A;  3AYW B;  2Y2J A;  3AV2 A;  3VH5 T;  2Y2M A;  5E5A B;  4J8U A;  5GT3 C;  1P3O B;  2F8N G;  4XZQ D;  5AV9 C;  5B24 C;  4CSR A;  4Z66 A;  5B1M A;  1P3G D;  3UTA B;  2HUE C;  1F66 B;  3MNN D;  4H9N A;  1KX5 A;  4CAY B;  4QLC B;  4XUJ D;  5GSU A;  5AV5 D;  3AZJ A;  3B6G A;  2NQB C;  5B31 D;  1U35 C;  1BH9 A;  5AVC B;  4DRB A;  4ZUX A;  1P34 B;  3WTP D;  1P3L B;  3X1S D;  4R8P D;  1P3M B;  1P3I C;  3O62 C;  3KXB D;  5CPJ A;  2G5I C;  5DNN B;  3WA9 A;  3H0L C;  5B40 A;  4G92 C;  5BO0 B;  2NZD B;  3B6F D;  2Y2L A;  5AY8 A;  4WZS B;  3MVD A;  5B32 G;  4J8V C;  3AN2 A;  2F8N B;  3KWQ A;  3WKJ C;  1KU5 A;  3LZ0 A;  2F2A C;  5KDM A;  3A6N B;  5GT0 A;  5GT3 D;  4NE6 A;  4Z5T B;  3X1T C;  5B33 B;  1KX3 D;  5F99 B;  3AZN B;  3AZI C;  5AV9 D;  5B24 D;  2UWX A;  3X1U A;  4X23 D;  3REK A;  1EQZ A;  5AVB C;  4EO5 C;  1ULY A;  3UTB B;  2NQB D;  2ZY4 A;  1U35 D;  5C3I C;  4XZQ A;  3AZE B;  5B32 B;  3AZK C;  4JJN C;  4Z5T A;  1P3I D;  3O62 D;  3AZL C;  2DQN C;  5CPI B;  1P3G A;  1HQ3 D;  5B1L C;  1WWI A;  3A1K A;  5CPK C;  3MGP B;  2ZY5 A;  3REJ C;  5AV5 A;  5JRG B;  1KX4 B;  3AZF C;  5B31 A;  1JFI A;  3MGS D;  3AZJ C;  5GXQ D;  3X1S A;  3X1T D;  4R8P A;  3KXB A;  3UT9 C;  4G91 C;  3AZI D;  2Y2P A;  1S32 D;  4H9O B;  4WJ3 C;  3B6F A;  4WU8 C;  3B0D C;  4HGA C;  2IO5 C;  5AVB D;  5AY8 C;  3MVD C;  3AN2 C;  2RIQ A;  5BNX A;  1P3F C;  3B0B A;  5GT3 A;  3LJA B;  1AOI B;  1KX3 A;  2G5H C;  3NQJ A;  5CP6 C;  5AV9 A;  4JJN D;  5B24 A;  1P3K D;  3FDD A;  3AZL D;  4J8V B;  3WKJ B;  4X23 A;  3TU4 C;  3MGQ D;  3KFU G;  4YM6 C;  5B1L D;  4WU9 D;  4H9Q A;  3A1I A;  5CPK D;  2J8P A;  3W98 D;  5AV8 C;  3REI C;  3REJ D;  1P3P D;  3AZF D;  1TAF B;  2NQB A;  3C1B C;  1U35 A;  3AV1 B;  3NQU A;  3REL D;  5JA4 A;  3C1C C;  1P3I A;  3O62 A;  3B0C W;  3UT9 D;  2ARO B;  5B2J C;  1BH8 A;  1P3B C;  4KUD C;  3AZM B;  4WU8 D;  3W96 B;  2JSS A;  3MNN C;  3AV2 B;  5C3I B;  4J8U B;  3V9R A;  4XUJ C;  1P3F D;  5AV5 C;  4ZBJ B;  3VH5 W;  5GXQ A;  4H9S C;  3X1T A;  4DRA A;  3WTP C;  3AZI A;  5CP6 D;  4CSR B;  4Z66 B;  5B1M B;  3KXB C;  1S32 A;  3WTP E;  3LZ1 C;  3TU4 D;  4H9N B;  4YM6 D;  1KX5 B;  3R45 A;  2FJ7 C;  3W99 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...