3AV1B

The human nucleosome structure containing the histone variant h3.2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structures of human nucleosomes containing major histone H3 variants
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 27
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3av1B00
2PYOB 5AV5C 3AFAC 2FJ7B 3AV2A 3UTBC 2YFVB 4X23C 3MGSD 4WU8C 5GT3D 5CP6C 1P3LB 5GSUA 3WTPA 1HQ3B 4YS3A 5AV9D 4Z2MH 3W96C 1F66D 3KUYD 5KDMA 4JJNB 3VH6W 2NZDA 3X1UC 3X1VC 3WKJB 3WKJA 5AV8A 2HIOD 2F8NB 1M1AB 1EQZA 5F99A 4XUJA 1S32B 2YFVA 3REKB 3C1BB 3RELB 1P3KD 4H9OB 5B1MC 5AV5B 1HQ3A 3MGPD 4H9RB 3UTBB 1ZLAD 3B6GC 4X23B 4J8VB 3V9RA 3VH6A 4QLCD 3MGRB 3W96B 3AZKA 3X1SC 5CPIA 3W99A 5BNXB 4YM6A 3LELA 2CWEA 3X1VB 1P3BA 1P3MD 1P3PB 4R8PA 2NQBC 4H9OA 5AV6C 2CV5A 3UTAC 1BH9B 4H9RA 1BFMA 3AZLA 4J8VA 5B1MB 1P3AA 2HUEC 2F8NG 3B6GB 3MGRA 4Z5TA 3AZJC 3WA9B 3B0CT 5BNXA 5B31A 3X1VA 1P3PA 4UUZB 3AZND 3B6FC 2BYKB 3AFAD 5CPKA 5DNND 4ZUXD 3REJA 1KX5D 5B40B 3REHC 3AV1B 4WU8D 5CP6D 5GT0C 1P34A 1M19D 2NQBB 5AV6B 3REID 2F8NK 5B33C 3AZGC 3LZ1A 5G49B 3WA9A 2L5AA 3MGQC 1KX4B 3WAAA 2HUEB 4Z66A 1TAFA 5E5AA 5BT1D 3B0CW 3X1UD 5CPJC 1P3OC 3TU4D 1M18A 1HTAA 4KUDA 1P3IC 5B40A 5AY8C 3AV1A 5JA4B 5B1MD 3B6FB 4KHAB 3W97A 3REHB 3AV2C 5FUGB 5GT0B 5GSUC 3AZGB 1KX4A 3WTPC 2AROD 4YS3C 5GXQA 4J8XA 3X1SD 3VH5A 5CHLB 3MGQB 1H3OA 5B0YA 3LZ0B 1P3OB 5CPJB 5JRGA 2NZDC 4CAYA 3WKJC 5AV8C 4KHAA 1P3IB 3UTAD 3R45B 1EQZC 5F99C 5B1LD 4XUJC 4J8UA 5DNMD 5B2IA 1R4VA 3AZFD 1HQ3C 3AZHD 4KGCB 3AV2B 3AZJD 1P3FD 5GSUB 3LZ0A 1P3GB 3WTPB 4YS3B 3O62D 3AZIB 3AZKC 3A6ND 3W99C 1WWSA 5CPIC 3KWQD 4YM6C 3LELC 1BH8A 5KDMB 3W98B 3MNNA 2NZDB 4XZQA 1P3BC 4R8PC 5B33D 2LY8A 5F99B 1EQZB 4XUJB 2CV5C 4KGCA 1ID3A 3AZLC 4J8VC 3UT9B 5B32G 1P3AC 1P3GA 5AVCB 3MGSA 3AZIA 3MGRC 1N1JA 4Z5TC 5B32D 5AV9A 3KXBD 3V9RB 3W98A 5B31C 1KX3D 4M6BA 1F66A 5AY8D 3AZKB 5CPIB 3W99B 4YM6B 3LELB 1U35D 1P3PC 4LD9D 5CPKC 3REJC 2HIOA 4WNNA 1P3BB 4R8PB 3X1TB 1P34C 3UT9A 5AVCA 2CV5B 1P3KA 3AZLB 5B2JB 3LZ1C 3MGPA 1P3AB 3WA9C 1ZLAA 3WAAC 3AYWB 4Z66C 1JFIA 5E5AC 4J8WB 4Z5TB 1M18C 1TZYD 3MVDD 4QLCA 5AV8D 3WKJD 2JSSA 5B31B 2PYOD 1AOIB 4KUDC 2FJ7D 3C1CB 5B40C 3AZMC 3AV1C 1P3LD 2F8NH 3X1TA 5CPKB 1HQ3D 3REJB 3W97C 1P3MA 5B2JA 1P34B 1KX4C 3AYWA 4J8XC 2YFWA 4H9NA 5GXQC 4JJND 4G92C 3LZ1B 4J8WA 5B24B 5B0YC 5B0ZB 3WAAB 4Z66B 1TAFB 3VH5T 5E5AB 1M1AD 1AOIA 2F8ND 1S32D 5JRGC 1M18B 3C1CA 3REKD 3C1BD 3RELD 5AV5D 3AZEB 1F1EA 4KUDB 3UTBD 3B0DB 5BO0A 4J8UC 4X23D 4J8VD 3AZNA 3AZMB 5DNNA 4ZUXA 1KX5A 1WWIA 3W97B 5B2IC 3W96D 3MGRD 1M19A 3REIA 4WU9A 4NE6A 5B24A 3LZ0C 5B0ZA 4J8XB 5GXQB 4G92B 2RVQC 3X1VD 1Q9CA 5BS7A 1H3OB 4H9SA 3VH5W 5B0YB 1P3PD 3TU4A 3AZEA 1KU5A 3MNNC 5JRGB 5AVBB 3AZMA 2BYMA 4XZQC 4AWLB 4CAYB 4J8UB 3B6GD 4H9PA 4KGCC 1ID3C 3WA9D 1P3GC 5B2IB 3MGSC 3AZIC 2AROA 2IO5C 5AV9C 3W98C 5B40D 1F66C 3AV1D 5AVBA 2NQBD 1B67A 5AV6D 1BH8B 3MNNB 4H9QB 2HIOC 4XZQB 3AN2B 5B1LA 3LJAB 3UT9C 1KX4D 5AVCC 3NQJA 5DNMA 1ID3B 1P3KC 3AZHA 3AZFA 3MGPC 1ZLAC 3MGSB 1P3FA 5GT3B 1N1JB 2IO5B 5AV9B 3O62A 4NFTA 4QLCC 3B6FD 4NE5A 3A6NA 3REHD 1F66B 4H9QA 3KUYB 5GT0D 3AN2A 3X1TC 3AZGD 3LJAA 2HIOB 4WNNB 1P3MC 5B2JC 3MGQD 3LZ0D 1P3OD 3AYWC 5CPJD 5GT3A 1P3KB 4J8WC 3MGPB 1ZLAB 1P3ID 1JFIB 5B32A 1AOIC 3KUYA 3KXBA 3C1CC 4CSRB 4EO5B 4QLCB 1KX3A 4KGCD 3AV2D 4WV4B 1U35A 3NQUA 3AZNC 4LD9A 5DNNC 5GSUD 4ZUXC 1P3GD 1KX5C 3WTPD 4YS3D 1P3MB 3AZID 1M19C 1B6WA 3REIC 4WU9C 5B24C 4WZSB 5B0ZC 3W98D 2YFWB 4H9NB 4ZBJC 5BNVB 2NZDD 5BS7C 4CSRA 4H9SC 5BT1C 3TU4C 1EQZD 5F99D 1TZYA 4XUJD 3MVDA 3AZEC 4Z2MG 3B0DC 2PYOA 3UT9D 2FJ7A 5AVCD 1P3LA 5BO0B 3AZNB 3AFAB 3B0BA 5DNNB 4ZUXB 1KX5B 4WU8B 5CP6B 1M19B 5BNVA 3REIB 3AZKD 4WU9B 3W99D 5CPID 2AROC 4YM6D 3LELD 4JJNA 4ZBJB 1P3BD 5AVBC 2F8NA 4R8PD 1M1AA 3X1UB 5C3IC 3X1TD 4AWLC 3TU4B 1S32A 2CV5D 3REKA 3C1BA 3RELA 3AZLD 2BYMB 5B2JD 5AV5A 3AFAA 1P3AD 3UTBA 5B1LC 4X23A 4WU8A 3AYWD 5CP6A 5B31G 4J8WD 4H9PB 4Z5TD 5DNMC 3AZHC 3W96A 4DRBA 3AZFC 4G91C 4E44A 5B31D 1AOID 3KSYA 1P3FC 3C1CD 2AROB 3O62C 3X1UA 3X1SB 5CPKD 3REJD 3A6NC 3KWQC 5C3IB 1P34D 1BH9A 3AN2C 3LJAC 5B1MA 3LZ1D 4HGAC 3UTAB 4WU9D 5B24D 5B1LB 3B6GA 5B0ZD 3WAAD 3NQJB 4Z66D 5E5AD 5DNMB 5GT3C 1M18D 3AZHB 3AZFB 4G91B 4E45A 1A7WA 3AZJB 3X1SA 4KUDD 3AZED 1P3FB 5B32C 3AZMD 4UUZA 2BYKA 3KUYC 3KXBC 3O62B 1KX3C 3W97D 3A6NB 3KWQB 2NQBA 5AV6A 1U35C 4LD9C 4DRAA 3UTAA 4J8XD 5GXQD 5G49A 4HGAB 5B33B 5B0YD 3AZJA 1ULYA 5JRGD 4NE3A 5AVBD 4EO5C 5JA4A 5B32B 1TZYC 4J8UD 3MVDC 3KWQA 3B6FA 3KXBB 1KX3B 2PYOC 3REHA 5AY8B 2FJ7C 5B2ID 5FUGA 5GT0A 1P3LC 1U35B 3NQUB 4LD9B 5B33A 3AZGA 2RVQD 3MGQA 1P3OA 5CPJA 4JJNC 3MNND 3VH6T 4XZQD 3WTPE 1P3IA 3AN2D 3R45A 1M1AC 5AY8A 3LJAD 1S32C 1TZYB 3MVDB 5AV8B 3REKC 3C1BC 1ID3D 3RELC
chains in the Genus database with same CATH superfamily
2PYOB 5AV5C 3AFAC 2FJ7B 2Y2MA 3AV2A 3UTBC 2YFVB 3P5JB 4X23C 3MGSD 5GT3D 5CP6C 4WU8C 1P3LB 5GSUA 3WTPA 1HQ3B 4YS3A 5AV9D 4Z2MH 3W96C 1F66D 3KUYD 5KDMA 4JJNB 3VH6W 2F2AC 3X1UC 2NZDA 3X1VC 3WKJB 3WKJA 5AV8A 2HIOD 2VQRA 2F8NB 1M1AB 1EQZA 5F99A 4XUJA 1S32B 2XD1A 2YFVA 3REKB 3C1BB 3RELB 1P3KD 4H9OB 5B1MC 5AV5B 1HQ3A 3MGPD 4H9RB 3UTBB 1ZLAD 3B6GC 4X23B 4J8VB 3V9RA 3VH6A 4QLCD 3MGRB 3W96B 3AZKA 3X1SC 5CPIA 3W99A 5BNXB 2ZY4A 4YM6A 3LELA 2CWEA 4DQYB 3X1VB 1P3BA 1P3MD 1P3PB 4R8PA 3FDDA 2NQBC 4H9OA 5AV6C 2CV5A 3UTAC 1BH9B 4H9RA 1BFMA 3AZLA 4J8VA 5B1MB 3H0RC 1P3AA 2HUEC 2ZM5A 2F8NG 3B6GB 3MGRA 4Z5TA 3AZJC 3WA9B 3B0CT 5BNXA 3H0LC 5B31A 3F6TA 3X1VA 1P3PA 4UUZB 3AZND 3B6FC 2BYKB 4WJ3C 3AFAD 5CPKA 5DNND 4ZUXD 3REJA 1KX5D 5B40B 3REHC 3AV1B 4WU8D 5CP6D 5GT0C 1P34A 1M19D 2NQBB 5AV6B 3REID 2F8NK 5B33C 3AZGC 3H0MC 3LZ1A 5G49B 3WA9A 2L5AA 3MGQC 1KX4B 3WAAA 2HUEB 4Z66A 1TAFA 5E5AA 5BT1D 3B0CW 3X1UD 5CPJC 1P3OC 3TU4D 2ZY2A 1M18A 1HTAA 2RIQA 4KUDA 1P3IC 5B40A 5AY8C 3AV1A 5JA4B 5B1MD 3B6FB 4KHAB 3W97A 3REHB 3AV2C 3EPKA 5FUGB 5GT0B 5GSUC 3AZGB 1KX4A 3WTPC 2AROD 1T3UA 4YS3C 5GXQA 4J8XA 3X1SD 3VH5A 5CHLB 3MGQB 1H3OA 5B0YA 3LZ0B 1P3OB 5CPJB 5JRGA 2DQNC 2NZDC 4CAYA 2Y2LA 5AV8C 3WKJC 4KHAA 1P3IB 3UTAD 3R45B 1EQZC 5F99C 5B1LD 4XUJC 4J8UA 3KFUG 5DNMD 5B2IA 1R4VA 3AZFD 1HQ3C 3AZHD 4KGCB 3AV2B 3AZJD 1P3FD 5GSUB 3LZ0A 1P3GB 3WTPB 4YS3B 3O62D 3AZIB 3AZKC 3A6ND 3W99C 1WWSA 5CPIC 3KWQD 4YM6C 3LELC 1BH8A 5KDMB 3W98B 3MNNA 2NZDB 4XZQA 1P3BC 4R8PC 5B33D 2LY8A 5F99B 1EQZB 4XUJB 2CV5C 4KGCA 1ID3A 3AZLC 4J8VC 3UT9B 5B32G 1P3AC 1P3GA 5AVCB 3MGSA 3AZIA 3MGRC 1N1JA 4Z5TC 5B32D 5AV9A 3KXBD 1Z2CB 3V9RB 5B31C 1KX3D 3W98A 4M6BA 1F66A 5AY8D 2Y2OA 3AZKB 5CPIB 3W99B 4YM6B 3LELB 1U35D 1P3PC 4LD9D 5CPKC 3REJC 2HIOA 4WNNA 1P3BB 2Y2QA 4R8PB 3X1TB 1P34C 3UT9A 5AVCA 2CV5B 1P3KA 3AZLB 5B2JB 3LZ1C 3MGPA 1P3AB 3WA9C 1ZLAA 3EG5B 3WAAC 3AYWB 4Z66C 1JFIA 5E5AC 2G5HC 4J8WB 4Z5TB 1M18C 1TZYD 1W2EA 4QLCA 5AV8D 3MVDD 2JSSA 3WKJD 5B31B 2PYOD 1AOIB 4KUDC 2FJ7D 3C1CB 5B40C 3AZMC 3AV1C 1P3LD 2F8NH 3X1TA 5CPKB 1HQ3D 3REJB 3W97C 1P3MA 5B2JA 2JCHA 1P34B 1KX4C 3AYWA 4J8XC 2YFWA 4H9NA 5GXQC 4JJND 4G92C 3LZ1B 4J8WA 2Y2GA 2Y2KA 5B24B 5B0YC 5B0ZB 3WAAB 4Z66B 1TAFB 3VH5T 5E5AB 1M1AD 1AOIA 2F8ND 1S32D 5JRGC 1M18B 3C1CA 3REKD 3C1BD 3RELD 5AV5D 3AZEB 1F1EA 4KUDB 3UTBD 3B0DB 5BO0A 4J8UC 4X23D 4J8VD 3AZNA 3AZMB 5DNNA 4ZUXA 1KX5A 1WWIA 3W97B 5B2IC 3W96D 3MGRD 1M19A 2Y2JA 3REIA 4WU9A 3A1KA 4NE6A 5B24A 3LZ0C 5B0ZA 4J8XB 5GXQB 4G92B 4UPKA 2RVQC 3X1VD 1Q9CA 5BS7A 1H3OB 4H9SA 3VH5W 5B0YB 1P3PD 2FFFB 3TU4A 3AZEA 1KU5A 3MNNC 5JRGB 5AVBB 3AZMA 2BYMA 4XZQC 4AWLB 4CAYB 2W8SA 4J8UB 3B6GD 4H9PA 4KGCC 1ID3C 3WA9D 2DF4C 1P3GC 5B2IB 3MGSC 3AZIC 2AROA 2IO5C 5AV9C 3W98C 5B40D 1F66C 3AV1D 3IP4C 5AVBA 2NQBD 1B67A 5AV6D 1BH8B 3MNNB 4H9QB 2HIOC 4XZQB 3AN2B 5B1LA 3LJAB 2Y2NA 3UT9C 2Y2PA 5AVCC 1KX4D 3NQJA 5DNMA 1ID3B 1P3KC 3AZHA 3AZFA 3MGPC 1ZLAC 3MGSB 1P3FA 5GT3B 1N1JB 2IO5B 5AV9B 3O62A 4NFTA 4QLCC 3B6FD 4NE5A 3A6NA 3REHD 1F66B 4H9QA 3KUYB 5GT0D 2ZY3A 3AN2A 3X1TC 3AZGD 3LJAA 2HIOB 4WNNB 1P3MC 5B2JC 3MGQD 3LZ0D 1P3OD 3AYWC 5CPJD 5GT3A 1P3KB 4J8WC 3MGPB 1ZLAB 1P3ID 1JFIB 5B32A 2JE5A 1AOIC 3KUYA 3KXBA 3C1CC 4CSRB 4EO5B 4QLCB 1KX3A 3A1IA 4KGCD 3AV2D 4WV4B 1U35A 3NQUA 3AZNC 4LD9A 5DNNC 5GSUD 4ZUXC 1P3GD 1KX5C 3WTPD 4YS3D 1P3MB 3AZID 1M19C 1B6WA 3REIC 4WU9C 5B24C 3EPLA 4WZSB 5B0ZC 3W98D 2YFWB 4H9NB 4ZBJC 5BNVB 2NZDD 5BS7C 4CSRA 4H9SC 5BT1C 3TU4C 1EQZD 5F99D 1TZYA 4XUJD 3MVDA 3AZEC 2ZY5A 4Z2MG 3B0DC 2PYOA 3UT9D 2FJ7A 5AVCD 1P3LA 2Y2IA 5BO0B 3AZNB 3AFAB 3B0BA 5DNNB 4ZUXB 1KX5B 4WU8B 5CP6B 1PZRA 1M19B 5BNVA 3REIB 3AZKD 4WU9B 3W99D 5CPID 2AROC 4YM6D 3LELD 4JJNA 4ZBJB 1P3BD 5AVBC 2F8NA 4R8PD 1M1AA 3X1UB 5C3IC 3X1TD 4AWLC 3TU4B 1S32A 2CV5D 3REKA 3C1BA 3RELA 3AZLD 2BYMB 5B2JD 5AV5A 3AFAA 1P3AD 3UTBA 5B1LC 4X23A 4WU8A 3AYWD 5CP6A 5B31G 4J8WD 4H9PB 4Z5TD 5DNMC 3AZHC 2Y2HA 3W96A 4DRBA 4G91C 4E44A 3AZFC 5B31D 1AOID 3KSYA 1P3FC 3AL0C 3C1CD 2AROB 3O62C 3X1UA 3X1SB 5CPKD 3REJD 3A6NC 3KWQC 5C3IB 1P34D 1BH9A 3AN2C 3LJAC 5B1MA 3LZ1D 4HGAC 3UTAB 4WU9D 5B24D 5B1LB 3B6GA 5B0ZD 3WAAD 3NQJB 4Z66D 5E5AD 5DNMB 5GT3C 1M18D 3AZHB 3AZFB 4G91B 4E45A 1A7WA 3AZJB 3X1SA 4KUDD 3AZED 1P3FB 3EPHA 5B32C 3AZMD 4UUZA 2BYKA 3KUYC 3KXBC 3O62B 3EPJA 1KX3C 3W97D 2XD5A 3A6NB 3KWQB 2UWXA 2NQBA 5AV6A 1U35C 4LD9C 4DRAA 3UTAA 4J8XD 5GXQD 5G49A 4HGAB 5B33B 5B0YD 2BG1A 3AZJA 1ULYA 5JRGD 4NE3A 5AVBD 4EO5C 5JA4A 5B32B 1TZYC 4J8UD 3MVDC 2G5IC 3KWQA 3B6FA 3KXBB 1KX3B 2PYOC 3REHA 5AY8B 2FJ7C 5B2ID 5FUGA 5GT0A 1P3LC 1U35B 2J8PA 3NQUB 4LD9B 5B33A 3AZGA 2RVQD 3MGQA 1P3OA 5CPJA 4JJNC 3MNND 3VH6T 4XZQD 3WTPE 1P3IA 3AN2D 3R45A 1M1AC 5AY8A 3LJAD 1S32C 1TZYB 3MVDB 5AV8B 3REKC 3C1BC 1ID3D 3RELC
chains in the Genus database with same CATH topology
2PYOB 5AV5C 3AFAC 2FJ7B 2Y2MA 3AV2A 3UTBC 2YFVB 3P5JB 4X23C 3MGSD 5GT3D 5CP6C 4WU8C 1P3LB 5GSUA 3WTPA 1HQ3B 4YS3A 5AV9D 4Z2MH 3W96C 1F66D 3KUYD 5KDMA 4JJNB 3VH6W 2F2AC 3X1UC 2NZDA 3X1VC 3WKJB 3WKJA 5AV8A 2HIOD 2VQRA 2F8NB 1M1AB 1EQZA 5F99A 4XUJA 1S32B 2XD1A 2YFVA 3REKB 3C1BB 3RELB 1P3KD 4H9OB 5B1MC 5AV5B 1HQ3A 3MGPD 4H9RB 3UTBB 1ZLAD 3B6GC 4X23B 4J8VB 3V9RA 3VH6A 4QLCD 3MGRB 3W96B 3AZKA 3X1SC 5CPIA 3W99A 5BNXB 2ZY4A 4YM6A 3LELA 2CWEA 4DQYB 3X1VB 1P3BA 1P3MD 1P3PB 4R8PA 3FDDA 2NQBC 4H9OA 5AV6C 2CV5A 3UTAC 1BH9B 4H9RA 1BFMA 3AZLA 4J8VA 5B1MB 3H0RC 1P3AA 2HUEC 2ZM5A 2F8NG 3B6GB 3MGRA 4Z5TA 3AZJC 3WA9B 3B0CT 5BNXA 3H0LC 5B31A 3F6TA 3X1VA 1P3PA 4UUZB 3AZND 3B6FC 2BYKB 4WJ3C 3AFAD 5CPKA 5DNND 4ZUXD 3REJA 1KX5D 5B40B 3REHC 3AV1B 4WU8D 5CP6D 5GT0C 1P34A 1M19D 2NQBB 5AV6B 3REID 2F8NK 5B33C 3AZGC 3H0MC 3LZ1A 5G49B 3WA9A 2L5AA 3MGQC 1KX4B 3WAAA 2HUEB 4Z66A 1TAFA 5E5AA 5BT1D 3B0CW 3X1UD 5CPJC 1P3OC 3TU4D 2ZY2A 1M18A 1HTAA 2RIQA 4KUDA 1P3IC 5B40A 5AY8C 3AV1A 5JA4B 5B1MD 3B6FB 4KHAB 3W97A 3REHB 3AV2C 3EPKA 5FUGB 5GT0B 5GSUC 3AZGB 1KX4A 3WTPC 2AROD 1T3UA 4YS3C 5GXQA 4J8XA 3X1SD 3VH5A 5CHLB 3MGQB 1H3OA 5B0YA 3LZ0B 1P3OB 5CPJB 5JRGA 2DQNC 2NZDC 4CAYA 2Y2LA 5AV8C 3WKJC 4KHAA 1P3IB 3UTAD 3R45B 1EQZC 5F99C 5B1LD 4XUJC 4J8UA 3KFUG 5DNMD 5B2IA 1R4VA 3AZFD 1HQ3C 3AZHD 4KGCB 3AV2B 3AZJD 1P3FD 5GSUB 3LZ0A 1P3GB 3WTPB 4YS3B 3O62D 3AZIB 3AZKC 3A6ND 3W99C 1WWSA 5CPIC 3KWQD 4YM6C 3LELC 1BH8A 5KDMB 3W98B 3MNNA 2NZDB 4XZQA 1P3BC 4R8PC 5B33D 2LY8A 5F99B 1EQZB 4XUJB 2CV5C 4KGCA 1ID3A 3AZLC 4J8VC 3UT9B 5B32G 1P3AC 1P3GA 5AVCB 3MGSA 3AZIA 3MGRC 1N1JA 4Z5TC 5B32D 5AV9A 3KXBD 1Z2CB 3V9RB 5B31C 1KX3D 3W98A 4M6BA 1F66A 5AY8D 2Y2OA 3AZKB 5CPIB 3W99B 4YM6B 3LELB 1U35D 1P3PC 4LD9D 5CPKC 3REJC 2HIOA 4WNNA 1P3BB 2Y2QA 4R8PB 3X1TB 1P34C 3UT9A 5AVCA 2CV5B 1P3KA 3AZLB 5B2JB 3LZ1C 3MGPA 1P3AB 3WA9C 1ZLAA 3EG5B 3WAAC 3AYWB 4Z66C 1JFIA 5E5AC 2G5HC 4J8WB 4Z5TB 1M18C 1TZYD 1W2EA 4QLCA 5AV8D 3MVDD 2JSSA 3WKJD 5B31B 2PYOD 1AOIB 4KUDC 2FJ7D 3C1CB 5B40C 3AZMC 3AV1C 1P3LD 2F8NH 3X1TA 5CPKB 1HQ3D 3REJB 3W97C 1P3MA 5B2JA 2JCHA 1P34B 1KX4C 3AYWA 4J8XC 2YFWA 4H9NA 5GXQC 4JJND 4G92C 3LZ1B 4J8WA 2Y2GA 2Y2KA 5B24B 5B0YC 5B0ZB 3WAAB 4Z66B 1TAFB 3VH5T 5E5AB 1M1AD 1AOIA 2F8ND 1S32D 5JRGC 1M18B 3C1CA 3REKD 3C1BD 3RELD 5AV5D 3AZEB 1F1EA 4KUDB 3UTBD 3B0DB 5BO0A 4J8UC 4X23D 4J8VD 3AZNA 3AZMB 5DNNA 4ZUXA 1KX5A 1WWIA 3W97B 5B2IC 3W96D 3MGRD 1M19A 2Y2JA 3REIA 4WU9A 3A1KA 4NE6A 5B24A 3LZ0C 5B0ZA 4J8XB 5GXQB 4G92B 4UPKA 2RVQC 3X1VD 1Q9CA 5BS7A 1H3OB 4H9SA 3VH5W 5B0YB 1P3PD 2FFFB 3TU4A 3AZEA 1KU5A 3MNNC 5JRGB 5AVBB 3AZMA 2BYMA 4XZQC 4AWLB 4CAYB 2W8SA 4J8UB 3B6GD 4H9PA 4KGCC 1ID3C 3WA9D 2DF4C 1P3GC 5B2IB 3MGSC 3AZIC 2AROA 2IO5C 5AV9C 3W98C 5B40D 1F66C 3AV1D 3IP4C 5AVBA 2NQBD 1B67A 5AV6D 1BH8B 3MNNB 4H9QB 2HIOC 4XZQB 3AN2B 5B1LA 3LJAB 2Y2NA 3UT9C 2Y2PA 5AVCC 1KX4D 3NQJA 5DNMA 1ID3B 1P3KC 3AZHA 3AZFA 3MGPC 1ZLAC 3MGSB 1P3FA 5GT3B 1N1JB 2IO5B 5AV9B 3O62A 4NFTA 4QLCC 3B6FD 4NE5A 3A6NA 3REHD 1F66B 4H9QA 3KUYB 5GT0D 2ZY3A 3AN2A 3X1TC 3AZGD 3LJAA 2HIOB 4WNNB 1P3MC 5B2JC 3MGQD 3LZ0D 1P3OD 3AYWC 5CPJD 5GT3A 1P3KB 4J8WC 3MGPB 1ZLAB 1P3ID 1JFIB 5B32A 2JE5A 1AOIC 3KUYA 3KXBA 3C1CC 4CSRB 4EO5B 4QLCB 1KX3A 3A1IA 4KGCD 3AV2D 4WV4B 1U35A 3NQUA 3AZNC 4LD9A 5DNNC 5GSUD 4ZUXC 1P3GD 1KX5C 3WTPD 4YS3D 1P3MB 3AZID 1M19C 1B6WA 3REIC 4WU9C 5B24C 3EPLA 4WZSB 5B0ZC 3W98D 2YFWB 4H9NB 4ZBJC 5BNVB 2NZDD 5BS7C 4CSRA 4H9SC 5BT1C 3TU4C 1EQZD 5F99D 1TZYA 4XUJD 3MVDA 3AZEC 2ZY5A 4Z2MG 3B0DC 2PYOA 3UT9D 2FJ7A 5AVCD 1P3LA 2Y2IA 5BO0B 3AZNB 3AFAB 3B0BA 5DNNB 4ZUXB 1KX5B 4WU8B 5CP6B 1PZRA 1M19B 5BNVA 3REIB 3AZKD 4WU9B 3W99D 5CPID 2AROC 4YM6D 3LELD 4JJNA 4ZBJB 1P3BD 5AVBC 2F8NA 4R8PD 1M1AA 3X1UB 5C3IC 3X1TD 4AWLC 3TU4B 1S32A 2CV5D 3REKA 3C1BA 3RELA 3AZLD 2BYMB 5B2JD 5AV5A 3AFAA 1P3AD 3UTBA 5B1LC 4X23A 4WU8A 3AYWD 5CP6A 5B31G 4J8WD 4H9PB 4Z5TD 5DNMC 3AZHC 2Y2HA 3W96A 4DRBA 4G91C 4E44A 3AZFC 5B31D 1AOID 3KSYA 1P3FC 3AL0C 3C1CD 2AROB 3O62C 3X1UA 3X1SB 5CPKD 3REJD 3A6NC 3KWQC 5C3IB 1P34D 1BH9A 3AN2C 3LJAC 5B1MA 3LZ1D 4HGAC 3UTAB 4WU9D 5B24D 5B1LB 3B6GA 5B0ZD 3WAAD 3NQJB 4Z66D 5E5AD 5DNMB 5GT3C 1M18D 3AZHB 3AZFB 4G91B 4E45A 1A7WA 3AZJB 3X1SA 4KUDD 3AZED 1P3FB 3EPHA 5B32C 3AZMD 4UUZA 2BYKA 3KUYC 3KXBC 3O62B 3EPJA 1KX3C 3W97D 2XD5A 3A6NB 3KWQB 2UWXA 2NQBA 5AV6A 1U35C 4LD9C 4DRAA 3UTAA 4J8XD 5GXQD 5G49A 4HGAB 5B33B 5B0YD 2BG1A 3AZJA 1ULYA 5JRGD 4NE3A 5AVBD 4EO5C 5JA4A 5B32B 1TZYC 4J8UD 3MVDC 2G5IC 3KWQA 3B6FA 3KXBB 1KX3B 2PYOC 3REHA 5AY8B 2FJ7C 5B2ID 5FUGA 5GT0A 1P3LC 1U35B 2J8PA 3NQUB 4LD9B 5B33A 3AZGA 2RVQD 3MGQA 1P3OA 5CPJA 4JJNC 3MNND 3VH6T 4XZQD 3WTPE 1P3IA 3AN2D 3R45A 1M1AC 5AY8A 3LJAD 1S32C 1TZYB 3MVDB 5AV8B 3REKC 3C1BC 1ID3D 3RELC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYO B;  5AV5 C;  3AFA C;  2FJ7 B;  3AV2 A;  3UTB C;  2YFV B;  4X23 C;  3MGS D;  4WU8 C;  5GT3 D;  5CP6 C;  1P3L B;  5GSU A;  3WTP A;  1HQ3 B;  4YS3 A;  5AV9 D;  4Z2M H;  3W96 C;  1F66 D;  3KUY D;  5KDM A;  4JJN B;  3VH6 W;  2NZD A;  3X1U C;  3X1V C;  3WKJ B;  3WKJ A;  5AV8 A;  2HIO D;  2F8N B;  1M1A B;  1EQZ A;  5F99 A;  4XUJ A;  1S32 B;  2YFV A;  3REK B;  3C1B B;  3REL B;  1P3K D;  4H9O B;  5B1M C;  5AV5 B;  1HQ3 A;  3MGP D;  4H9R B;  3UTB B;  1ZLA D;  3B6G C;  4X23 B;  4J8V B;  3V9R A;  3VH6 A;  4QLC D;  3MGR B;  3W96 B;  3AZK A;  3X1S C;  5CPI A;  3W99 A;  5BNX B;  4YM6 A;  3LEL A;  2CWE A;  3X1V B;  1P3B A;  1P3M D;  1P3P B;  4R8P A;  2NQB C;  4H9O A;  5AV6 C;  2CV5 A;  3UTA C;  1BH9 B;  4H9R A;  1BFM A;  3AZL A;  4J8V A;  5B1M B;  1P3A A;  2HUE C;  2F8N G;  3B6G B;  3MGR A;  4Z5T A;  3AZJ C;  3WA9 B;  3B0C T;  5BNX A;  5B31 A;  3X1V A;  1P3P A;  4UUZ B;  3AZN D;  3B6F C;  2BYK B;  3AFA D;  5CPK A;  5DNN D;  4ZUX D;  3REJ A;  1KX5 D;  5B40 B;  3REH C;  3AV1 B;  4WU8 D;  5CP6 D;  5GT0 C;  1P34 A;  1M19 D;  2NQB B;  5AV6 B;  3REI D;  2F8N K;  5B33 C;  3AZG C;  3LZ1 A;  5G49 B;  3WA9 A;  2L5A A;  3MGQ C;  1KX4 B;  3WAA A;  2HUE B;  4Z66 A;  1TAF A;  5E5A A;  5BT1 D;  3B0C W;  3X1U D;  5CPJ C;  1P3O C;  3TU4 D;  1M18 A;  1HTA A;  4KUD A;  1P3I C;  5B40 A;  5AY8 C;  3AV1 A;  5JA4 B;  5B1M D;  3B6F B;  4KHA B;  3W97 A;  3REH B;  3AV2 C;  5FUG B;  5GT0 B;  5GSU C;  3AZG B;  1KX4 A;  3WTP C;  2ARO D;  4YS3 C;  5GXQ A;  4J8X A;  3X1S D;  3VH5 A;  5CHL B;  3MGQ B;  1H3O A;  5B0Y A;  3LZ0 B;  1P3O B;  5CPJ B;  5JRG A;  2NZD C;  4CAY A;  3WKJ C;  5AV8 C;  4KHA A;  1P3I B;  3UTA D;  3R45 B;  1EQZ C;  5F99 C;  5B1L D;  4XUJ C;  4J8U A;  5DNM D;  5B2I A;  1R4V A;  3AZF D;  1HQ3 C;  3AZH D;  4KGC B;  3AV2 B;  3AZJ D;  1P3F D;  5GSU B;  3LZ0 A;  1P3G B;  3WTP B;  4YS3 B;  3O62 D;  3AZI B;  3AZK C;  3A6N D;  3W99 C;  1WWS A;  5CPI C;  3KWQ D;  4YM6 C;  3LEL C;  1BH8 A;  5KDM B;  3W98 B;  3MNN A;  2NZD B;  4XZQ A;  1P3B C;  4R8P C;  5B33 D;  2LY8 A;  5F99 B;  1EQZ B;  4XUJ B;  2CV5 C;  4KGC A;  1ID3 A;  3AZL C;  4J8V C;  3UT9 B;  5B32 G;  1P3A C;  1P3G A;  5AVC B;  3MGS A;  3AZI A;  3MGR C;  1N1J A;  4Z5T C;  5B32 D;  5AV9 A;  3KXB D;  3V9R B;  3W98 A;  5B31 C;  1KX3 D;  4M6B A;  1F66 A;  5AY8 D;  3AZK B;  5CPI B;  3W99 B;  4YM6 B;  3LEL B;  1U35 D;  1P3P C;  4LD9 D;  5CPK C;  3REJ C;  2HIO A;  4WNN A;  1P3B B;  4R8P B;  3X1T B;  1P34 C;  3UT9 A;  5AVC A;  2CV5 B;  1P3K A;  3AZL B;  5B2J B;  3LZ1 C;  3MGP A;  1P3A B;  3WA9 C;  1ZLA A;  3WAA C;  3AYW B;  4Z66 C;  1JFI A;  5E5A C;  4J8W B;  4Z5T B;  1M18 C;  1TZY D;  3MVD D;  4QLC A;  5AV8 D;  3WKJ D;  2JSS A;  5B31 B;  2PYO D;  1AOI B;  4KUD C;  2FJ7 D;  3C1C B;  5B40 C;  3AZM C;  3AV1 C;  1P3L D;  2F8N H;  3X1T A;  5CPK B;  1HQ3 D;  3REJ B;  3W97 C;  1P3M A;  5B2J A;  1P34 B;  1KX4 C;  3AYW A;  4J8X C;  2YFW A;  4H9N A;  5GXQ C;  4JJN D;  4G92 C;  3LZ1 B;  4J8W A;  5B24 B;  5B0Y C;  5B0Z B;  3WAA B;  4Z66 B;  1TAF B;  3VH5 T;  5E5A B;  1M1A D;  1AOI A;  2F8N D;  1S32 D;  5JRG C;  1M18 B;  3C1C A;  3REK D;  3C1B D;  3REL D;  5AV5 D;  3AZE B;  1F1E A;  4KUD B;  3UTB D;  3B0D B;  5BO0 A;  4J8U C;  4X23 D;  4J8V D;  3AZN A;  3AZM B;  5DNN A;  4ZUX A;  1KX5 A;  1WWI A;  3W97 B;  5B2I C;  3W96 D;  3MGR D;  1M19 A;  3REI A;  4WU9 A;  4NE6 A;  5B24 A;  3LZ0 C;  5B0Z A;  4J8X B;  5GXQ B;  4G92 B;  2RVQ C;  3X1V D;  1Q9C A;  5BS7 A;  1H3O B;  4H9S A;  3VH5 W;  5B0Y B;  1P3P D;  3TU4 A;  3AZE A;  1KU5 A;  3MNN C;  5JRG B;  5AVB B;  3AZM A;  2BYM A;  4XZQ C;  4AWL B;  4CAY B;  4J8U B;  3B6G D;  4H9P A;  4KGC C;  1ID3 C;  3WA9 D;  1P3G C;  5B2I B;  3MGS C;  3AZI C;  2ARO A;  2IO5 C;  5AV9 C;  3W98 C;  5B40 D;  1F66 C;  3AV1 D;  5AVB A;  2NQB D;  1B67 A;  5AV6 D;  1BH8 B;  3MNN B;  4H9Q B;  2HIO C;  4XZQ B;  3AN2 B;  5B1L A;  3LJA B;  3UT9 C;  1KX4 D;  5AVC C;  3NQJ A;  5DNM A;  1ID3 B;  1P3K C;  3AZH A;  3AZF A;  3MGP C;  1ZLA C;  3MGS B;  1P3F A;  5GT3 B;  1N1J B;  2IO5 B;  5AV9 B;  3O62 A;  4NFT A;  4QLC C;  3B6F D;  4NE5 A;  3A6N A;  3REH D;  1F66 B;  4H9Q A;  3KUY B;  5GT0 D;  3AN2 A;  3X1T C;  3AZG D;  3LJA A;  2HIO B;  4WNN B;  1P3M C;  5B2J C;  3MGQ D;  3LZ0 D;  1P3O D;  3AYW C;  5CPJ D;  5GT3 A;  1P3K B;  4J8W C;  3MGP B;  1ZLA B;  1P3I D;  1JFI B;  5B32 A;  1AOI C;  3KUY A;  3KXB A;  3C1C C;  4CSR B;  4EO5 B;  4QLC B;  1KX3 A;  4KGC D;  3AV2 D;  4WV4 B;  1U35 A;  3NQU A;  3AZN C;  4LD9 A;  5DNN C;  5GSU D;  4ZUX C;  1P3G D;  1KX5 C;  3WTP D;  4YS3 D;  1P3M B;  3AZI D;  1M19 C;  1B6W A;  3REI C;  4WU9 C;  5B24 C;  4WZS B;  5B0Z C;  3W98 D;  2YFW B;  4H9N B;  4ZBJ C;  5BNV B;  2NZD D;  5BS7 C;  4CSR A;  4H9S C;  5BT1 C;  3TU4 C;  1EQZ D;  5F99 D;  1TZY A;  4XUJ D;  3MVD A;  3AZE C;  4Z2M G;  3B0D C;  2PYO A;  3UT9 D;  2FJ7 A;  5AVC D;  1P3L A;  5BO0 B;  3AZN B;  3AFA B;  3B0B A;  5DNN B;  4ZUX B;  1KX5 B;  4WU8 B;  5CP6 B;  1M19 B;  5BNV A;  3REI B;  3AZK D;  4WU9 B;  3W99 D;  5CPI D;  2ARO C;  4YM6 D;  3LEL D;  4JJN A;  4ZBJ B;  1P3B D;  5AVB C;  2F8N A;  4R8P D;  1M1A A;  3X1U B;  5C3I C;  3X1T D;  4AWL C;  3TU4 B;  1S32 A;  2CV5 D;  3REK A;  3C1B A;  3REL A;  3AZL D;  2BYM B;  5B2J D;  5AV5 A;  3AFA A;  1P3A D;  3UTB A;  5B1L C;  4X23 A;  4WU8 A;  3AYW D;  5CP6 A;  5B31 G;  4J8W D;  4H9P B;  4Z5T D;  5DNM C;  3AZH C;  3W96 A;  4DRB A;  3AZF C;  4G91 C;  4E44 A;  5B31 D;  1AOI D;  3KSY A;  1P3F C;  3C1C D;  2ARO B;  3O62 C;  3X1U A;  3X1S B;  5CPK D;  3REJ D;  3A6N C;  3KWQ C;  5C3I B;  1P34 D;  1BH9 A;  3AN2 C;  3LJA C;  5B1M A;  3LZ1 D;  4HGA C;  3UTA B;  4WU9 D;  5B24 D;  5B1L B;  3B6G A;  5B0Z D;  3WAA D;  3NQJ B;  4Z66 D;  5E5A D;  5DNM B;  5GT3 C;  1M18 D;  3AZH B;  3AZF B;  4G91 B;  4E45 A;  1A7W A;  3AZJ B;  3X1S A;  4KUD D;  3AZE D;  1P3F B;  5B32 C;  3AZM D;  4UUZ A;  2BYK A;  3KUY C;  3KXB C;  3O62 B;  1KX3 C;  3W97 D;  3A6N B;  3KWQ B;  2NQB A;  5AV6 A;  1U35 C;  4LD9 C;  4DRA A;  3UTA A;  4J8X D;  5GXQ D;  5G49 A;  4HGA B;  5B33 B;  5B0Y D;  3AZJ A;  1ULY A;  5JRG D;  4NE3 A;  5AVB D;  4EO5 C;  5JA4 A;  5B32 B;  1TZY C;  4J8U D;  3MVD C;  3KWQ A;  3B6F A;  3KXB B;  1KX3 B;  2PYO C;  3REH A;  5AY8 B;  2FJ7 C;  5B2I D;  5FUG A;  5GT0 A;  1P3L C;  1U35 B;  3NQU B;  4LD9 B;  5B33 A;  3AZG A;  2RVQ D;  3MGQ A;  1P3O A;  5CPJ A;  4JJN C;  3MNN D;  3VH6 T;  4XZQ D;  3WTP E;  1P3I A;  3AN2 D;  3R45 A;  1M1A C;  5AY8 A;  3LJA D;  1S32 C;  1TZY B;  3MVD B;  5AV8 B;  3REK C;  3C1B C;  1ID3 D;  3REL C; 
#chains in the Genus database with same CATH topology
 2PYO B;  5AV5 C;  3AFA C;  2FJ7 B;  2Y2M A;  3AV2 A;  3UTB C;  2YFV B;  3P5J B;  4X23 C;  3MGS D;  5GT3 D;  5CP6 C;  4WU8 C;  1P3L B;  5GSU A;  3WTP A;  1HQ3 B;  4YS3 A;  5AV9 D;  4Z2M H;  3W96 C;  1F66 D;  3KUY D;  5KDM A;  4JJN B;  3VH6 W;  2F2A C;  3X1U C;  2NZD A;  3X1V C;  3WKJ B;  3WKJ A;  5AV8 A;  2HIO D;  2VQR A;  2F8N B;  1M1A B;  1EQZ A;  5F99 A;  4XUJ A;  1S32 B;  2XD1 A;  2YFV A;  3REK B;  3C1B B;  3REL B;  1P3K D;  4H9O B;  5B1M C;  5AV5 B;  1HQ3 A;  3MGP D;  4H9R B;  3UTB B;  1ZLA D;  3B6G C;  4X23 B;  4J8V B;  3V9R A;  3VH6 A;  4QLC D;  3MGR B;  3W96 B;  3AZK A;  3X1S C;  5CPI A;  3W99 A;  5BNX B;  2ZY4 A;  4YM6 A;  3LEL A;  2CWE A;  4DQY B;  3X1V B;  1P3B A;  1P3M D;  1P3P B;  4R8P A;  3FDD A;  2NQB C;  4H9O A;  5AV6 C;  2CV5 A;  3UTA C;  1BH9 B;  4H9R A;  1BFM A;  3AZL A;  4J8V A;  5B1M B;  3H0R C;  1P3A A;  2HUE C;  2ZM5 A;  2F8N G;  3B6G B;  3MGR A;  4Z5T A;  3AZJ C;  3WA9 B;  3B0C T;  5BNX A;  3H0L C;  5B31 A;  3F6T A;  3X1V A;  1P3P A;  4UUZ B;  3AZN D;  3B6F C;  2BYK B;  4WJ3 C;  3AFA D;  5CPK A;  5DNN D;  4ZUX D;  3REJ A;  1KX5 D;  5B40 B;  3REH C;  3AV1 B;  4WU8 D;  5CP6 D;  5GT0 C;  1P34 A;  1M19 D;  2NQB B;  5AV6 B;  3REI D;  2F8N K;  5B33 C;  3AZG C;  3H0M C;  3LZ1 A;  5G49 B;  3WA9 A;  2L5A A;  3MGQ C;  1KX4 B;  3WAA A;  2HUE B;  4Z66 A;  1TAF A;  5E5A A;  5BT1 D;  3B0C W;  3X1U D;  5CPJ C;  1P3O C;  3TU4 D;  2ZY2 A;  1M18 A;  1HTA A;  2RIQ A;  4KUD A;  1P3I C;  5B40 A;  5AY8 C;  3AV1 A;  5JA4 B;  5B1M D;  3B6F B;  4KHA B;  3W97 A;  3REH B;  3AV2 C;  3EPK A;  5FUG B;  5GT0 B;  5GSU C;  3AZG B;  1KX4 A;  3WTP C;  2ARO D;  1T3U A;  4YS3 C;  5GXQ A;  4J8X A;  3X1S D;  3VH5 A;  5CHL B;  3MGQ B;  1H3O A;  5B0Y A;  3LZ0 B;  1P3O B;  5CPJ B;  5JRG A;  2DQN C;  2NZD C;  4CAY A;  2Y2L A;  5AV8 C;  3WKJ C;  4KHA A;  1P3I B;  3UTA D;  3R45 B;  1EQZ C;  5F99 C;  5B1L D;  4XUJ C;  4J8U A;  3KFU G;  5DNM D;  5B2I A;  1R4V A;  3AZF D;  1HQ3 C;  3AZH D;  4KGC B;  3AV2 B;  3AZJ D;  1P3F D;  5GSU B;  3LZ0 A;  1P3G B;  3WTP B;  4YS3 B;  3O62 D;  3AZI B;  3AZK C;  3A6N D;  3W99 C;  1WWS A;  5CPI C;  3KWQ D;  4YM6 C;  3LEL C;  1BH8 A;  5KDM B;  3W98 B;  3MNN A;  2NZD B;  4XZQ A;  1P3B C;  4R8P C;  5B33 D;  2LY8 A;  5F99 B;  1EQZ B;  4XUJ B;  2CV5 C;  4KGC A;  1ID3 A;  3AZL C;  4J8V C;  3UT9 B;  5B32 G;  1P3A C;  1P3G A;  5AVC B;  3MGS A;  3AZI A;  3MGR C;  1N1J A;  4Z5T C;  5B32 D;  5AV9 A;  3KXB D;  1Z2C B;  3V9R B;  5B31 C;  1KX3 D;  3W98 A;  4M6B A;  1F66 A;  5AY8 D;  2Y2O A;  3AZK B;  5CPI B;  3W99 B;  4YM6 B;  3LEL B;  1U35 D;  1P3P C;  4LD9 D;  5CPK C;  3REJ C;  2HIO A;  4WNN A;  1P3B B;  2Y2Q A;  4R8P B;  3X1T B;  1P34 C;  3UT9 A;  5AVC A;  2CV5 B;  1P3K A;  3AZL B;  5B2J B;  3LZ1 C;  3MGP A;  1P3A B;  3WA9 C;  1ZLA A;  3EG5 B;  3WAA C;  3AYW B;  4Z66 C;  1JFI A;  5E5A C;  2G5H C;  4J8W B;  4Z5T B;  1M18 C;  1TZY D;  1W2E A;  4QLC A;  5AV8 D;  3MVD D;  2JSS A;  3WKJ D;  5B31 B;  2PYO D;  1AOI B;  4KUD C;  2FJ7 D;  3C1C B;  5B40 C;  3AZM C;  3AV1 C;  1P3L D;  2F8N H;  3X1T A;  5CPK B;  1HQ3 D;  3REJ B;  3W97 C;  1P3M A;  5B2J A;  2JCH A;  1P34 B;  1KX4 C;  3AYW A;  4J8X C;  2YFW A;  4H9N A;  5GXQ C;  4JJN D;  4G92 C;  3LZ1 B;  4J8W A;  2Y2G A;  2Y2K A;  5B24 B;  5B0Y C;  5B0Z B;  3WAA B;  4Z66 B;  1TAF B;  3VH5 T;  5E5A B;  1M1A D;  1AOI A;  2F8N D;  1S32 D;  5JRG C;  1M18 B;  3C1C A;  3REK D;  3C1B D;  3REL D;  5AV5 D;  3AZE B;  1F1E A;  4KUD B;  3UTB D;  3B0D B;  5BO0 A;  4J8U C;  4X23 D;  4J8V D;  3AZN A;  3AZM B;  5DNN A;  4ZUX A;  1KX5 A;  1WWI A;  3W97 B;  5B2I C;  3W96 D;  3MGR D;  1M19 A;  2Y2J A;  3REI A;  4WU9 A;  3A1K A;  4NE6 A;  5B24 A;  3LZ0 C;  5B0Z A;  4J8X B;  5GXQ B;  4G92 B;  4UPK A;  2RVQ C;  3X1V D;  1Q9C A;  5BS7 A;  1H3O B;  4H9S A;  3VH5 W;  5B0Y B;  1P3P D;  2FFF B;  3TU4 A;  3AZE A;  1KU5 A;  3MNN C;  5JRG B;  5AVB B;  3AZM A;  2BYM A;  4XZQ C;  4AWL B;  4CAY B;  2W8S A;  4J8U B;  3B6G D;  4H9P A;  4KGC C;  1ID3 C;  3WA9 D;  2DF4 C;  1P3G C;  5B2I B;  3MGS C;  3AZI C;  2ARO A;  2IO5 C;  5AV9 C;  3W98 C;  5B40 D;  1F66 C;  3AV1 D;  3IP4 C;  5AVB A;  2NQB D;  1B67 A;  5AV6 D;  1BH8 B;  3MNN B;  4H9Q B;  2HIO C;  4XZQ B;  3AN2 B;  5B1L A;  3LJA B;  2Y2N A;  3UT9 C;  2Y2P A;  5AVC C;  1KX4 D;  3NQJ A;  5DNM A;  1ID3 B;  1P3K C;  3AZH A;  3AZF A;  3MGP C;  1ZLA C;  3MGS B;  1P3F A;  5GT3 B;  1N1J B;  2IO5 B;  5AV9 B;  3O62 A;  4NFT A;  4QLC C;  3B6F D;  4NE5 A;  3A6N A;  3REH D;  1F66 B;  4H9Q A;  3KUY B;  5GT0 D;  2ZY3 A;  3AN2 A;  3X1T C;  3AZG D;  3LJA A;  2HIO B;  4WNN B;  1P3M C;  5B2J C;  3MGQ D;  3LZ0 D;  1P3O D;  3AYW C;  5CPJ D;  5GT3 A;  1P3K B;  4J8W C;  3MGP B;  1ZLA B;  1P3I D;  1JFI B;  5B32 A;  2JE5 A;  1AOI C;  3KUY A;  3KXB A;  3C1C C;  4CSR B;  4EO5 B;  4QLC B;  1KX3 A;  3A1I A;  4KGC D;  3AV2 D;  4WV4 B;  1U35 A;  3NQU A;  3AZN C;  4LD9 A;  5DNN C;  5GSU D;  4ZUX C;  1P3G D;  1KX5 C;  3WTP D;  4YS3 D;  1P3M B;  3AZI D;  1M19 C;  1B6W A;  3REI C;  4WU9 C;  5B24 C;  3EPL A;  4WZS B;  5B0Z C;  3W98 D;  2YFW B;  4H9N B;  4ZBJ C;  5BNV B;  2NZD D;  5BS7 C;  4CSR A;  4H9S C;  5BT1 C;  3TU4 C;  1EQZ D;  5F99 D;  1TZY A;  4XUJ D;  3MVD A;  3AZE C;  2ZY5 A;  4Z2M G;  3B0D C;  2PYO A;  3UT9 D;  2FJ7 A;  5AVC D;  1P3L A;  2Y2I A;  5BO0 B;  3AZN B;  3AFA B;  3B0B A;  5DNN B;  4ZUX B;  1KX5 B;  4WU8 B;  5CP6 B;  1PZR A;  1M19 B;  5BNV A;  3REI B;  3AZK D;  4WU9 B;  3W99 D;  5CPI D;  2ARO C;  4YM6 D;  3LEL D;  4JJN A;  4ZBJ B;  1P3B D;  5AVB C;  2F8N A;  4R8P D;  1M1A A;  3X1U B;  5C3I C;  3X1T D;  4AWL C;  3TU4 B;  1S32 A;  2CV5 D;  3REK A;  3C1B A;  3REL A;  3AZL D;  2BYM B;  5B2J D;  5AV5 A;  3AFA A;  1P3A D;  3UTB A;  5B1L C;  4X23 A;  4WU8 A;  3AYW D;  5CP6 A;  5B31 G;  4J8W D;  4H9P B;  4Z5T D;  5DNM C;  3AZH C;  2Y2H A;  3W96 A;  4DRB A;  4G91 C;  4E44 A;  3AZF C;  5B31 D;  1AOI D;  3KSY A;  1P3F C;  3AL0 C;  3C1C D;  2ARO B;  3O62 C;  3X1U A;  3X1S B;  5CPK D;  3REJ D;  3A6N C;  3KWQ C;  5C3I B;  1P34 D;  1BH9 A;  3AN2 C;  3LJA C;  5B1M A;  3LZ1 D;  4HGA C;  3UTA B;  4WU9 D;  5B24 D;  5B1L B;  3B6G A;  5B0Z D;  3WAA D;  3NQJ B;  4Z66 D;  5E5A D;  5DNM B;  5GT3 C;  1M18 D;  3AZH B;  3AZF B;  4G91 B;  4E45 A;  1A7W A;  3AZJ B;  3X1S A;  4KUD D;  3AZE D;  1P3F B;  3EPH A;  5B32 C;  3AZM D;  4UUZ A;  2BYK A;  3KUY C;  3KXB C;  3O62 B;  3EPJ A;  1KX3 C;  3W97 D;  2XD5 A;  3A6N B;  3KWQ B;  2UWX A;  2NQB A;  5AV6 A;  1U35 C;  4LD9 C;  4DRA A;  3UTA A;  4J8X D;  5GXQ D;  5G49 A;  4HGA B;  5B33 B;  5B0Y D;  2BG1 A;  3AZJ A;  1ULY A;  5JRG D;  4NE3 A;  5AVB D;  4EO5 C;  5JA4 A;  5B32 B;  1TZY C;  4J8U D;  3MVD C;  2G5I C;  3KWQ A;  3B6F A;  3KXB B;  1KX3 B;  2PYO C;  3REH A;  5AY8 B;  2FJ7 C;  5B2I D;  5FUG A;  5GT0 A;  1P3L C;  1U35 B;  2J8P A;  3NQU B;  4LD9 B;  5B33 A;  3AZG A;  2RVQ D;  3MGQ A;  1P3O A;  5CPJ A;  4JJN C;  3MNN D;  3VH6 T;  4XZQ D;  3WTP E;  1P3I A;  3AN2 D;  3R45 A;  1M1A C;  5AY8 A;  3LJA D;  1S32 C;  1TZY B;  3MVD B;  5AV8 B;  3REK C;  3C1B C;  1ID3 D;  3REL C; 
#chains in the Genus database with same CATH homology
 2PYO B;  5AV5 C;  3AFA C;  2FJ7 B;  2Y2M A;  3AV2 A;  3UTB C;  2YFV B;  3P5J B;  4X23 C;  3MGS D;  5GT3 D;  5CP6 C;  4WU8 C;  1P3L B;  5GSU A;  3WTP A;  1HQ3 B;  4YS3 A;  5AV9 D;  4Z2M H;  3W96 C;  1F66 D;  3KUY D;  5KDM A;  4JJN B;  3VH6 W;  2F2A C;  3X1U C;  2NZD A;  3X1V C;  3WKJ B;  3WKJ A;  5AV8 A;  2HIO D;  2VQR A;  2F8N B;  1M1A B;  1EQZ A;  5F99 A;  4XUJ A;  1S32 B;  2XD1 A;  2YFV A;  3REK B;  3C1B B;  3REL B;  1P3K D;  4H9O B;  5B1M C;  5AV5 B;  1HQ3 A;  3MGP D;  4H9R B;  3UTB B;  1ZLA D;  3B6G C;  4X23 B;  4J8V B;  3V9R A;  3VH6 A;  4QLC D;  3MGR B;  3W96 B;  3AZK A;  3X1S C;  5CPI A;  3W99 A;  5BNX B;  2ZY4 A;  4YM6 A;  3LEL A;  2CWE A;  4DQY B;  3X1V B;  1P3B A;  1P3M D;  1P3P B;  4R8P A;  3FDD A;  2NQB C;  4H9O A;  5AV6 C;  2CV5 A;  3UTA C;  1BH9 B;  4H9R A;  1BFM A;  3AZL A;  4J8V A;  5B1M B;  3H0R C;  1P3A A;  2HUE C;  2ZM5 A;  2F8N G;  3B6G B;  3MGR A;  4Z5T A;  3AZJ C;  3WA9 B;  3B0C T;  5BNX A;  3H0L C;  5B31 A;  3F6T A;  3X1V A;  1P3P A;  4UUZ B;  3AZN D;  3B6F C;  2BYK B;  4WJ3 C;  3AFA D;  5CPK A;  5DNN D;  4ZUX D;  3REJ A;  1KX5 D;  5B40 B;  3REH C;  3AV1 B;  4WU8 D;  5CP6 D;  5GT0 C;  1P34 A;  1M19 D;  2NQB B;  5AV6 B;  3REI D;  2F8N K;  5B33 C;  3AZG C;  3H0M C;  3LZ1 A;  5G49 B;  3WA9 A;  2L5A A;  3MGQ C;  1KX4 B;  3WAA A;  2HUE B;  4Z66 A;  1TAF A;  5E5A A;  5BT1 D;  3B0C W;  3X1U D;  5CPJ C;  1P3O C;  3TU4 D;  2ZY2 A;  1M18 A;  1HTA A;  2RIQ A;  4KUD A;  1P3I C;  5B40 A;  5AY8 C;  3AV1 A;  5JA4 B;  5B1M D;  3B6F B;  4KHA B;  3W97 A;  3REH B;  3AV2 C;  3EPK A;  5FUG B;  5GT0 B;  5GSU C;  3AZG B;  1KX4 A;  3WTP C;  2ARO D;  1T3U A;  4YS3 C;  5GXQ A;  4J8X A;  3X1S D;  3VH5 A;  5CHL B;  3MGQ B;  1H3O A;  5B0Y A;  3LZ0 B;  1P3O B;  5CPJ B;  5JRG A;  2DQN C;  2NZD C;  4CAY A;  2Y2L A;  5AV8 C;  3WKJ C;  4KHA A;  1P3I B;  3UTA D;  3R45 B;  1EQZ C;  5F99 C;  5B1L D;  4XUJ C;  4J8U A;  3KFU G;  5DNM D;  5B2I A;  1R4V A;  3AZF D;  1HQ3 C;  3AZH D;  4KGC B;  3AV2 B;  3AZJ D;  1P3F D;  5GSU B;  3LZ0 A;  1P3G B;  3WTP B;  4YS3 B;  3O62 D;  3AZI B;  3AZK C;  3A6N D;  3W99 C;  1WWS A;  5CPI C;  3KWQ D;  4YM6 C;  3LEL C;  1BH8 A;  5KDM B;  3W98 B;  3MNN A;  2NZD B;  4XZQ A;  1P3B C;  4R8P C;  5B33 D;  2LY8 A;  5F99 B;  1EQZ B;  4XUJ B;  2CV5 C;  4KGC A;  1ID3 A;  3AZL C;  4J8V C;  3UT9 B;  5B32 G;  1P3A C;  1P3G A;  5AVC B;  3MGS A;  3AZI A;  3MGR C;  1N1J A;  4Z5T C;  5B32 D;  5AV9 A;  3KXB D;  1Z2C B;  3V9R B;  5B31 C;  1KX3 D;  3W98 A;  4M6B A;  1F66 A;  5AY8 D;  2Y2O A;  3AZK B;  5CPI B;  3W99 B;  4YM6 B;  3LEL B;  1U35 D;  1P3P C;  4LD9 D;  5CPK C;  3REJ C;  2HIO A;  4WNN A;  1P3B B;  2Y2Q A;  4R8P B;  3X1T B;  1P34 C;  3UT9 A;  5AVC A;  2CV5 B;  1P3K A;  3AZL B;  5B2J B;  3LZ1 C;  3MGP A;  1P3A B;  3WA9 C;  1ZLA A;  3EG5 B;  3WAA C;  3AYW B;  4Z66 C;  1JFI A;  5E5A C;  2G5H C;  4J8W B;  4Z5T B;  1M18 C;  1TZY D;  1W2E A;  4QLC A;  5AV8 D;  3MVD D;  2JSS A;  3WKJ D;  5B31 B;  2PYO D;  1AOI B;  4KUD C;  2FJ7 D;  3C1C B;  5B40 C;  3AZM C;  3AV1 C;  1P3L D;  2F8N H;  3X1T A;  5CPK B;  1HQ3 D;  3REJ B;  3W97 C;  1P3M A;  5B2J A;  2JCH A;  1P34 B;  1KX4 C;  3AYW A;  4J8X C;  2YFW A;  4H9N A;  5GXQ C;  4JJN D;  4G92 C;  3LZ1 B;  4J8W A;  2Y2G A;  2Y2K A;  5B24 B;  5B0Y C;  5B0Z B;  3WAA B;  4Z66 B;  1TAF B;  3VH5 T;  5E5A B;  1M1A D;  1AOI A;  2F8N D;  1S32 D;  5JRG C;  1M18 B;  3C1C A;  3REK D;  3C1B D;  3REL D;  5AV5 D;  3AZE B;  1F1E A;  4KUD B;  3UTB D;  3B0D B;  5BO0 A;  4J8U C;  4X23 D;  4J8V D;  3AZN A;  3AZM B;  5DNN A;  4ZUX A;  1KX5 A;  1WWI A;  3W97 B;  5B2I C;  3W96 D;  3MGR D;  1M19 A;  2Y2J A;  3REI A;  4WU9 A;  3A1K A;  4NE6 A;  5B24 A;  3LZ0 C;  5B0Z A;  4J8X B;  5GXQ B;  4G92 B;  4UPK A;  2RVQ C;  3X1V D;  1Q9C A;  5BS7 A;  1H3O B;  4H9S A;  3VH5 W;  5B0Y B;  1P3P D;  2FFF B;  3TU4 A;  3AZE A;  1KU5 A;  3MNN C;  5JRG B;  5AVB B;  3AZM A;  2BYM A;  4XZQ C;  4AWL B;  4CAY B;  2W8S A;  4J8U B;  3B6G D;  4H9P A;  4KGC C;  1ID3 C;  3WA9 D;  2DF4 C;  1P3G C;  5B2I B;  3MGS C;  3AZI C;  2ARO A;  2IO5 C;  5AV9 C;  3W98 C;  5B40 D;  1F66 C;  3AV1 D;  3IP4 C;  5AVB A;  2NQB D;  1B67 A;  5AV6 D;  1BH8 B;  3MNN B;  4H9Q B;  2HIO C;  4XZQ B;  3AN2 B;  5B1L A;  3LJA B;  2Y2N A;  3UT9 C;  2Y2P A;  5AVC C;  1KX4 D;  3NQJ A;  5DNM A;  1ID3 B;  1P3K C;  3AZH A;  3AZF A;  3MGP C;  1ZLA C;  3MGS B;  1P3F A;  5GT3 B;  1N1J B;  2IO5 B;  5AV9 B;  3O62 A;  4NFT A;  4QLC C;  3B6F D;  4NE5 A;  3A6N A;  3REH D;  1F66 B;  4H9Q A;  3KUY B;  5GT0 D;  2ZY3 A;  3AN2 A;  3X1T C;  3AZG D;  3LJA A;  2HIO B;  4WNN B;  1P3M C;  5B2J C;  3MGQ D;  3LZ0 D;  1P3O D;  3AYW C;  5CPJ D;  5GT3 A;  1P3K B;  4J8W C;  3MGP B;  1ZLA B;  1P3I D;  1JFI B;  5B32 A;  2JE5 A;  1AOI C;  3KUY A;  3KXB A;  3C1C C;  4CSR B;  4EO5 B;  4QLC B;  1KX3 A;  3A1I A;  4KGC D;  3AV2 D;  4WV4 B;  1U35 A;  3NQU A;  3AZN C;  4LD9 A;  5DNN C;  5GSU D;  4ZUX C;  1P3G D;  1KX5 C;  3WTP D;  4YS3 D;  1P3M B;  3AZI D;  1M19 C;  1B6W A;  3REI C;  4WU9 C;  5B24 C;  3EPL A;  4WZS B;  5B0Z C;  3W98 D;  2YFW B;  4H9N B;  4ZBJ C;  5BNV B;  2NZD D;  5BS7 C;  4CSR A;  4H9S C;  5BT1 C;  3TU4 C;  1EQZ D;  5F99 D;  1TZY A;  4XUJ D;  3MVD A;  3AZE C;  2ZY5 A;  4Z2M G;  3B0D C;  2PYO A;  3UT9 D;  2FJ7 A;  5AVC D;  1P3L A;  2Y2I A;  5BO0 B;  3AZN B;  3AFA B;  3B0B A;  5DNN B;  4ZUX B;  1KX5 B;  4WU8 B;  5CP6 B;  1PZR A;  1M19 B;  5BNV A;  3REI B;  3AZK D;  4WU9 B;  3W99 D;  5CPI D;  2ARO C;  4YM6 D;  3LEL D;  4JJN A;  4ZBJ B;  1P3B D;  5AVB C;  2F8N A;  4R8P D;  1M1A A;  3X1U B;  5C3I C;  3X1T D;  4AWL C;  3TU4 B;  1S32 A;  2CV5 D;  3REK A;  3C1B A;  3REL A;  3AZL D;  2BYM B;  5B2J D;  5AV5 A;  3AFA A;  1P3A D;  3UTB A;  5B1L C;  4X23 A;  4WU8 A;  3AYW D;  5CP6 A;  5B31 G;  4J8W D;  4H9P B;  4Z5T D;  5DNM C;  3AZH C;  2Y2H A;  3W96 A;  4DRB A;  4G91 C;  4E44 A;  3AZF C;  5B31 D;  1AOI D;  3KSY A;  1P3F C;  3AL0 C;  3C1C D;  2ARO B;  3O62 C;  3X1U A;  3X1S B;  5CPK D;  3REJ D;  3A6N C;  3KWQ C;  5C3I B;  1P34 D;  1BH9 A;  3AN2 C;  3LJA C;  5B1M A;  3LZ1 D;  4HGA C;  3UTA B;  4WU9 D;  5B24 D;  5B1L B;  3B6G A;  5B0Z D;  3WAA D;  3NQJ B;  4Z66 D;  5E5A D;  5DNM B;  5GT3 C;  1M18 D;  3AZH B;  3AZF B;  4G91 B;  4E45 A;  1A7W A;  3AZJ B;  3X1S A;  4KUD D;  3AZE D;  1P3F B;  3EPH A;  5B32 C;  3AZM D;  4UUZ A;  2BYK A;  3KUY C;  3KXB C;  3O62 B;  3EPJ A;  1KX3 C;  3W97 D;  2XD5 A;  3A6N B;  3KWQ B;  2UWX A;  2NQB A;  5AV6 A;  1U35 C;  4LD9 C;  4DRA A;  3UTA A;  4J8X D;  5GXQ D;  5G49 A;  4HGA B;  5B33 B;  5B0Y D;  2BG1 A;  3AZJ A;  1ULY A;  5JRG D;  4NE3 A;  5AVB D;  4EO5 C;  5JA4 A;  5B32 B;  1TZY C;  4J8U D;  3MVD C;  2G5I C;  3KWQ A;  3B6F A;  3KXB B;  1KX3 B;  2PYO C;  3REH A;  5AY8 B;  2FJ7 C;  5B2I D;  5FUG A;  5GT0 A;  1P3L C;  1U35 B;  2J8P A;  3NQU B;  4LD9 B;  5B33 A;  3AZG A;  2RVQ D;  3MGQ A;  1P3O A;  5CPJ A;  4JJN C;  3MNN D;  3VH6 T;  4XZQ D;  3WTP E;  1P3I A;  3AN2 D;  3R45 A;  1M1A C;  5AY8 A;  3LJA D;  1S32 C;  1TZY B;  3MVD B;  5AV8 B;  3REK C;  3C1B C;  1ID3 D;  3REL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...