3AV1B

The human nucleosome structure containing the histone variant h3.2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Structures of human nucleosomes containing major histone H3 variants
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3av1B00
2PYOA 1BH9A 3B0DB 4ZUXB 3REHD 4QLCC 3MNNA 1P3MC 3VH5T 4G91C 3AV1C 2CV5A 2CV5D 3C1CD 4KUDC 3REKC 1KX5C 5B31A 5E5AB 3AZID 3LZ0B 3W97C 1AOIA 3AN2C 3AZJD 4J8VC 3AFAC 2NQBD 5B1MB 4AWLB 3VH6T 3MGRB 3X1VC 3NQUB 4G92C 4E44A 5GT3A 5AVCC 1U35B 5CPJA 1KX3C 3UTAC 3LJAC 4WU9C 3B6GB 4J8XC 3WAAA 3REIC 3B6FD 3W98A 1P3BB 5AV5B 1S32C 3WTPC 5B1LB 5GT0A 5B40D 4X23C 3UTBB 3R45B 5B2JD 5DNNC 5GSUA 5GXQD 1EQZB 4NE6A 5BNXB 3AZMC 3AZKC 1H3OA 5B33A 1N1JA 5BS7C 3MGPB 5B0ZB 3A6NB 2HIOC 1P3AA 3WA9C 1P3MB 4KUDB 5AV8A 3AV1B 1F66D 5G49B 3REKB 1KX5B 1P3IA 2F8NH 1P3ID 3WKJC 3UT9C 1M18C 3W97B 1WWIA 4R8PD 4J8VB 3AFAB 3MGRA 5CPIC 4H9QB 3AV2D 3AZEC 2F8NB 2CWEA 5AV9D 1U35A 4G92B 5AVCB 1KX3B 3UTAB 4WU9B 1WWSA 2BYKA 4YS3C 1P3LC 4ZBJC 4J8XB 3X1TC 3REIB 3R45A 4UUZB 2IO5C 1ID3C 2FJ7C 1S32B 4LD9C 3WTPB 4X23B 2BYMB 5BNXA 5DNNB 3AZFC 5KDMA 5AV6A 2NZDD 3MGPA 3KUYC 1P3OB 3W99D 5B0ZA 3A6NA 3REHC 4KUDA 3C1CC 3REKA 1P3FA 2HIOB 3C1BD 3AZIC 3WA9B 4Z2MG 1A7WA 3AFAA 2NQBC 4WU8A 3WKJB 3UT9B 3MVDA 1M18B 5DNMA 4DRAA 2F8NA 4XZQD 3REJD 5CPIB 3LELA 3LELD 3AZEB 1ZLAA 2F8NK 4Z66D 5B24A 1TZYC 3AZHD 3WTPE 3B6FC 3MGQD 4XUJD 3AZLD 1S32A 4YS3B 1P3LB 1TAFA 5B40C 4ZBJB 3VH5A 4DRBA 3X1TB 5B2JC 2IO5B 5F99A 4M6BA 1ID3B 2FJ7B 1KU5A 3MGSA 3AZND 3RELD 4J8UA 1P34D 3AZFB 1P3OA 1M19D 3AYWA 5B0YD 3W96D 3AZGD 3KWQA 3KWQD 3VH6A 5B2IB 3KUYB 3LZ1A 3REHB 4H9OA 4CSRA 1P3PD 1F66C 5B32A 3AZIB 4R8PC 1P3GC 2NQBB 5CP6D 3AV2C 2AROB 2PYOD 3AZEA 4J8WA 3MNND 1M1AB 5B31D 4JJNA 1AOID 4KHAB 4KGCC 1TZYB 4YM6B 5FUGA 5JA4A 3B6FB 3TU4A 5B40B 3KXBA 5B2JB 5AY8A 3AZFA 5GT3D 2YFVB 3X1SA 1HQ3A 5CPJD 4H9PA 3W99C 5B2IA 3KUYA 1P3KA 3WAAD 3W98D 3C1BC 5JRGA 4H9SC 3O62A 5CPKA 5GT0D 1F66B 5AVBB 3X1UA 4H9NB 5GSUD 2AROA 1P3GB 4H9RB 3B0CW 4ZUXA 3REJC 3AV2B 5B33D 1M1AA 3B0CT 1P3AD 5E5AA 4NE5A 4QLCB 4Z66C 4Z5TC 4G91B 5AV8D 2JSSA 3LZ0A 3NQJB 1TZYA 4YM6A 3AZHC 3MGQC 4E45A 4NFTA 4XUJC 5B1MA 1KX4C 3AN2B 4KGCB 4WNNB 3MGRD 3NQUA 1ULYA 3AZNC 3RELC 1U35D 3X1VB 1P34C 1M19C 3B6GA 5B0YC 3W96C 3AZGC 3LJAB 3W99B 1P3BA 5AV5A 1P3PC 5B1LA 5AVBA 3UTBA 4CAYB 3V9RB 3C1BB 4EO5C 1P3GA 1EQZA 5AV6D 2PYOC 3MGPD 3AZMB 5B0ZD 3A6ND 3AZKB 3REJB 3MNNC 4QLCA 1P3MA 2CV5C 3AV1A 4KUDD 5G49A 3NQJA 1KX5A 5B31C 1B6WA 3REKD 1P3FD 1KX5D 2RVQD 4Z5TB 4Z66B 3W97A 1AOIC 3AN2A 3AZJC 4KGCA 3AZHB 4J8VA 3AFAD 3MGQB 1JFIB 4WU8D 1BFMA 4XUJB 1KX4B 3MVDD 4H9QA 5B31G 5DNMD 2F8ND 3X1VA 5GT3C 5AVCA 3AZNB 1Q9CA 5CPJC 1KX3A 1ZLAD 3UTAA 1P34B 3LJAA 4WU9A 1M19B 5B24D 5B0YB 3W96B 5BNVB 3AZGB 3WAAC 4J8XA 3REIA 4UUZA 3W98C 1HTAA 1S32D 1P3PB 3WTPA 4X23A 2BYMA 4Z2MH 5GXQC 5F99D 5GSUC 5DNNA 4LD9B 3MGSD 4J8UD 3AZMA 1P3OD 3AZKA 5B33C 3AYWD 2PYOB 5BS7A 1BH9B 1P3AC 2HIOA 3LZ1D 3WA9A 3MNNB 5AV8C 4Z5TA 3C1CB 2CV5B 5B32D 1P3IC 3WKJA 3UT9A 1M18A 1KX4A 1AOIB 3AZJB 3MGRC 5CPIA 5AV9C 3AZED 1U35C 4J8WD 5GT3B 4WV4B 5CPJB 4JJND 1P3LA 4YS3A 3WAAB 3X1TA 3W98B 1ID3A 2FJ7A 3TU4D 4LD9A 5CHLB 3KXBD 5BO0B 5GXQB 5AY8D 5GSUB 3AZFD 1F1EA 4NE3A 5AV6C 3X1SD 2NZDC 1HQ3D 5BT1D 3VH5W 3MGPC 5B0ZC 3A6NC 5B2ID 3KUYD 3REHA 1H3OB 1P3KD 2L5AA 5B33B 1N1JB 3C1CA 2YFWB 1P3FC 1P3AB 2RVQC 5JRGD 3O62D 3AZIA 5AV8B 5CPKD 3X1UD 3AZJA 1P3IB 3VH6W 2NQBA 1R4VA 4WU8C 3MVDC 4R8PB 5DNMC 2AROD 4XZQC 4ZUXD 3LELC 1M1AD 2HUEC 5AV9B 4WZSB 1ZLAC 5E5AD 1BH8B 3LZ0D 2F8NG 5B24C 4KHAA 1TZYD 4YM6D 3B6FA 3AZLC 5B1MD 2BYKB 5B40A 5BO0A 5B2JA 5F99C 5GXQA 3MGSC 2YFVA 5C3IC 4J8UC 1P3OC 5KDMB 3AYWC 3B6GD 5AV6B 2NZDB 2YFWA 3KWQC 3LZ1C 1B67A 1P3BD 5AV5D 1F66A 5B1LD 5B32C 5AVBD 3UTBD 4H9NA 1P3FB 4R8PA 4H9RA 1P3GD 1EQZD 5CP6C 4WU8B 5B32G 3MVDB 3AV2A 5DNMB 3B0BA 4HGAC 5AV9A 4XZQB 4J8WC 4QLCD 1P3MD 1BH8A 3AV1D 3LELB 2HUEB 1ZLAB 4JJNC 3W97D 5B24B 3AN2D 4KGCD 4J8VD 4WNNA 3AZLB 3TU4C 3KSYA 1TAFB 3KXBC 5AY8C 5F99B 3X1VD 3MGSB 5AVCD 3X1SC 1HQ3C 5BT1C 5C3IB 3RELB 2NZDA 4J8UB 1KX3D 3UTAD 5B2IC 3LJAD 4WU9D 3W99A 1P3KC 3AYWB 3KWQB 4J8XD 3REID 4CAYA 3LZ1B 4H9OB 3V9RA 4H9SA 4CSRB 5JRGC 3O62C 3C1BA 5GT0C 5CPKC 3WTPD 3X1UC 5B32B 4X23D 2LY8A 5DNND 2AROC 4EO5B 5CP6B 3B0DC 4XZQA 4ZUXC 3REJA 3AZKD 3AZMD 1M1AC 4HGAB 5E5AC 2HIOD 4J8WB 3LZ0C 3WA9D 4Z66A 4Z5TD 4YM6C 3AZHA 5B31B 3MGQA 1JFIA 5B1MC 4XUJA 4JJNB 4AWLC 3UT9D 3AZLA 1M18D 1KX4D 3WKJD 5FUGB 5JA4B 5CPID 3TU4B 3AZNA 3KXBB 3RELA 5AY8B 1P34A 1M19A 3B6GC 5B0YA 3W96A 3X1SB 1HQ3B 5BNVA 3AZGA 4H9PB 1P3BC 1P3KB 5AV5C 1P3LD 4YS3D 1P3PA 5B1LC 5AVBC 3UTBC 3X1TD 5JRGB 3O62B 1ID3D 2FJ7D 5GT0B 5CPKB 4LD9D 3X1UB 1EQZC 5CP6A
chains in the Genus database with same CATH superfamily
2DF4C 2PYOA 1BH9A 3B0DB 4ZUXB 3REHD 4QLCC 3MNNA 1P3MC 3VH5T 4G91C 3AV1C 2CV5A 2CV5D 3C1CD 4KUDC 3REKC 1KX5C 5B31A 5E5AB 3AZID 3LZ0B 3W97C 1AOIA 3AN2C 2XD1A 3AZJD 3IP4C 4J8VC 3AFAC 2NQBD 5B1MB 4AWLB 3VH6T 3MGRB 2Y2GA 3X1VC 3NQUB 4G92C 4E44A 5GT3A 5AVCC 1U35B 5CPJA 1KX3C 3UTAC 3LJAC 4WU9C 3B6GB 2JCHA 4J8XC 3WAAA 3REIC 3B6FD 3W98A 2G5HC 2FFFB 1P3BB 5AV5B 1S32C 3WTPC 5B1LB 5GT0A 5B40D 4X23C 3UTBB 3R45B 5B2JD 5DNNC 5GSUA 5GXQD 3EPJA 1EQZB 4NE6A 5BNXB 3AZMC 3AZKC 1H3OA 5B33A 1N1JA 4DQYB 5BS7C 3MGPB 5B0ZB 3A6NB 2HIOC 1P3AA 3WA9C 1P3MB 4KUDB 5AV8A 3AV1B 1F66D 5G49B 3REKB 1KX5B 1P3IA 2F8NH 1P3ID 3WKJC 3UT9C 1M18C 3W97B 1WWIA 4R8PD 3EPKA 4J8VB 3AFAB 3MGRA 5CPIC 4H9QB 3AV2D 3AZEC 2F8NB 2CWEA 5AV9D 1U35A 3EPHA 4G92B 3A1IA 5AVCB 1KX3B 3UTAB 4WU9B 1WWSA 2BYKA 2RIQA 4YS3C 1P3LC 4ZBJC 4J8XB 3X1TC 3REIB 3R45A 4UUZB 2IO5C 1ID3C 2FJ7C 1S32B 4LD9C 3WTPB 4X23B 2BYMB 5BNXA 5DNNB 3AZFC 2ZY4A 5KDMA 5AV6A 2NZDD 3MGPA 3KUYC 1P3OB 3W99D 5B0ZA 3A6NA 3REHC 4KUDA 3C1CC 3REKA 1P3FA 3A1KA 2HIOB 3C1BD 3AZIC 3WA9B 4Z2MG 1A7WA 3AFAA 2NQBC 4WU8A 2F2AC 3UT9B 3MVDA 1M18B 3WKJB 5DNMA 4DRAA 2F8NA 4XZQD 3REJD 5CPIB 3LELA 3LELD 4WJ3C 3AZEB 1ZLAA 2UWXA 2F8NK 4Z66D 5B24A 1TZYC 3AZHD 3WTPE 3B6FC 3MGQD 4XUJD 3AZLD 1S32A 4YS3B 1P3LB 1TAFA 1W2EA 3H0MC 4ZBJB 3VH5A 4DRBA 5B40C 3X1TB 5B2JC 2IO5B 5F99A 4M6BA 1ID3B 2FJ7B 1KU5A 3MGSA 3AZND 3RELD 4J8UA 1P34D 3AZFB 1P3OA 1M19D 3AYWA 5B0YD 3W96D 3AZGD 3KWQA 3KWQD 3VH6A 2W8SA 5B2IB 3KUYB 3LZ1A 3REHB 4H9OA 4CSRA 1P3PD 1F66C 5B32A 1Z2CB 3AZIB 4R8PC 1P3GC 2NQBB 5CP6D 3AV2C 2AROB 2PYOD 3AZEA 2Y2JA 4J8WA 3MNND 1M1AB 5B31D 2Y2LA 4JJNA 1AOID 4KHAB 4KGCC 1TZYB 4YM6B 5FUGA 5JA4A 3B6FB 3TU4A 2G5IC 5B40B 2XD5A 3KXBA 5B2JB 5AY8A 3AZFA 5GT3D 2Y2NA 2YFVB 3X1SA 1HQ3A 5CPJD 4H9PA 3W99C 5B2IA 3KUYA 1P3KA 2ZY2A 3EG5B 3WAAD 3W98D 3C1BC 4H9SC 5JRGA 3O62A 5CPKA 5GT0D 1F66B 5AVBB 3X1UA 4H9NB 5GSUD 2AROA 1P3GB 4H9RB 3B0CW 4ZUXA 3REJC 3AV2B 5B33D 1M1AA 3B0CT 1P3AD 5E5AA 2Y2QA 4NE5A 4QLCB 4Z5TC 4G91B 4Z66C 5AV8D 2JSSA 3LZ0A 3NQJB 1TZYA 4YM6A 3AZHC 3MGQC 4E45A 4NFTA 4XUJC 5B1MA 1KX4C 3AN2B 4KGCB 4WNNB 3MGRD 3NQUA 1PZRA 1ULYA 3AZNC 3RELC 1U35D 3X1VB 1P34C 1M19C 3B6GA 5B0YC 2JE5A 3W96C 3AZGC 3LJAB 3W99B 1P3BA 5AV5A 1P3PC 5B1LA 5AVBA 3UTBA 4CAYB 3V9RB 3C1BB 4EO5C 1P3GA 1EQZA 5AV6D 2PYOC 3MGPD 3AZMB 5B0ZD 3A6ND 3AZKB 3REJB 3MNNC 4QLCA 1P3MA 2CV5C 3AV1A 4KUDD 5G49A 3NQJA 1KX5A 5B31C 1B6WA 3REKD 1P3FD 1KX5D 2RVQD 4Z5TB 4Z66B 3W97A 1AOIC 3AN2A 3AZJC 4KGCA 3AZHB 4J8VA 3AFAD 3MGQB 1JFIB 4WU8D 1BFMA 4XUJB 1KX4B 3MVDD 4H9QA 5B31G 2Y2KA 5DNMD 2F8ND 3X1VA 5GT3C 5AVCA 3AZNB 1Q9CA 5CPJC 1KX3A 1ZLAD 3UTAA 3F6TA 3FDDA 3LJAA 4WU9A 1P34B 1M19B 5B24D 5B0YB 3W96B 5BNVB 3AZGB 3WAAC 4J8XA 3REIA 4UUZA 3W98C 1HTAA 1S32D 1P3PB 3WTPA 2Y2OA 4X23A 2BYMA 4Z2MH 5GXQC 5F99D 1T3UA 5GSUC 5DNNA 4LD9B 3MGSD 4J8UD 3AZMA 1P3OD 3AZKA 5B33C 3AYWD 2PYOB 5BS7A 2VQRA 1BH9B 1P3AC 2HIOA 3LZ1D 3WA9A 3MNNB 5AV8C 4Z5TA 3C1CB 2CV5B 2ZY5A 5B32D 1P3IC 2Y2PA 3WKJA 3UT9A 1M18A 1KX4A 1AOIB 3AZJB 3MGRC 5CPIA 5AV9C 3AZED 1U35C 2J8PA 4J8WD 2DQNC 5GT3B 4WV4B 5CPJB 4JJND 1P3LA 4YS3A 3WAAB 3X1TA 3W98B 2BG1A 1ID3A 2FJ7A 3TU4D 4LD9A 5CHLB 3KXBD 5BO0B 2ZM5A 5GXQB 5AY8D 5GSUB 3AZFD 1F1EA 4NE3A 5AV6C 3X1SD 2NZDC 1HQ3D 5BT1D 3VH5W 3MGPC 5B0ZC 3A6NC 5B2ID 3KUYD 3REHA 1H3OB 1P3KD 2L5AA 5B33B 1N1JB 3C1CA 2YFWB 1P3FC 1P3AB 2RVQC 5JRGD 3O62D 3AZIA 5AV8B 5CPKD 3X1UD 3AZJA 1P3IB 3VH6W 2NQBA 1R4VA 4WU8C 3MVDC 4R8PB 5DNMC 2AROD 4XZQC 4ZUXD 3LELC 1M1AD 2HUEC 5AV9B 4WZSB 1ZLAC 5E5AD 4UPKA 1BH8B 3LZ0D 2F8NG 5B24C 4KHAA 1TZYD 4YM6D 3B6FA 3AZLC 5B1MD 2BYKB 5B40A 5BO0A 5B2JA 5F99C 5GXQA 3MGSC 2YFVA 5C3IC 4J8UC 1P3OC 5KDMB 3AYWC 3B6GD 5AV6B 2NZDB 2YFWA 3KWQC 2ZY3A 1B67A 3LZ1C 1P3BD 5AV5D 1F66A 5B1LD 5B32C 5AVBD 3UTBD 4H9NA 1P3FB 2Y2MA 4R8PA 4H9RA 1P3GD 1EQZD 5CP6C 4WU8B 5B32G 3MVDB 3AV2A 5DNMB 3B0BA 4HGAC 5AV9A 4XZQB 4J8WC 4QLCD 1P3MD 1BH8A 3AV1D 3LELB 3KFUG 2HUEB 1ZLAB 4JJNC 3W97D 5B24B 3AN2D 4KGCD 4J8VD 4WNNA 3AZLB 3TU4C 3KSYA 1TAFB 3KXBC 5AY8C 5F99B 3X1VD 3P5JB 3MGSB 5AVCD 3X1SC 1HQ3C 5BT1C 5C3IB 3RELB 2NZDA 4J8UB 1KX3D 3UTAD 5B2IC 3LJAD 4WU9D 3W99A 1P3KC 3AYWB 3KWQB 4J8XD 3REID 4CAYA 3LZ1B 4H9OB 3V9RA 4H9SA 4CSRB 5JRGC 3O62C 3C1BA 5GT0C 5CPKC 3WTPD 3AL0C 3X1UC 5B32B 4X23D 2LY8A 5DNND 2AROC 4EO5B 5CP6B 3B0DC 4XZQA 4ZUXC 3REJA 3AZKD 3H0LC 3AZMD 1M1AC 4HGAB 5E5AC 2HIOD 4J8WB 3LZ0C 3WA9D 4Z66A 4Z5TD 4YM6C 3AZHA 5B31B 3MGQA 1JFIA 5B1MC 4XUJA 4JJNB 4AWLC 3UT9D 3AZLA 1M18D 1KX4D 3WKJD 5FUGB 5JA4B 5CPID 3TU4B 3AZNA 3EPLA 2Y2HA 3KXBB 3RELA 5AY8B 1P34A 1M19A 2Y2IA 3H0RC 3B6GC 5B0YA 3W96A 3X1SB 1HQ3B 5BNVA 3AZGA 4H9PB 1P3BC 1P3KB 5AV5C 1P3LD 4YS3D 1P3PA 5B1LC 5AVBC 3UTBC 3X1TD 5JRGB 3O62B 1ID3D 2FJ7D 5GT0B 5CPKB 4LD9D 3X1UB 1EQZC 5CP6A
chains in the Genus database with same CATH topology
2DF4C 2PYOA 1BH9A 3B0DB 4ZUXB 3REHD 4QLCC 3MNNA 1P3MC 3VH5T 4G91C 3AV1C 2CV5A 2CV5D 3C1CD 4KUDC 3REKC 1KX5C 5B31A 5E5AB 3AZID 3LZ0B 3W97C 1AOIA 3AN2C 2XD1A 3AZJD 3IP4C 4J8VC 3AFAC 2NQBD 5B1MB 4AWLB 3VH6T 3MGRB 2Y2GA 3X1VC 3NQUB 4G92C 4E44A 5GT3A 5AVCC 1U35B 5CPJA 1KX3C 3UTAC 3LJAC 4WU9C 3B6GB 2JCHA 4J8XC 3WAAA 3REIC 3B6FD 3W98A 2G5HC 2FFFB 1P3BB 5AV5B 1S32C 3WTPC 5B1LB 5GT0A 5B40D 4X23C 3UTBB 3R45B 5B2JD 5DNNC 5GSUA 5GXQD 3EPJA 1EQZB 4NE6A 5BNXB 3AZMC 3AZKC 1H3OA 5B33A 1N1JA 4DQYB 5BS7C 3MGPB 5B0ZB 3A6NB 2HIOC 1P3AA 3WA9C 1P3MB 4KUDB 5AV8A 3AV1B 1F66D 5G49B 3REKB 1KX5B 1P3IA 2F8NH 1P3ID 3WKJC 3UT9C 1M18C 3W97B 1WWIA 4R8PD 3EPKA 4J8VB 3AFAB 3MGRA 5CPIC 4H9QB 3AV2D 3AZEC 2F8NB 2CWEA 5AV9D 1U35A 3EPHA 4G92B 3A1IA 5AVCB 1KX3B 3UTAB 4WU9B 1WWSA 2BYKA 2RIQA 4YS3C 1P3LC 4ZBJC 4J8XB 3X1TC 3REIB 3R45A 4UUZB 2IO5C 1ID3C 2FJ7C 1S32B 4LD9C 3WTPB 4X23B 2BYMB 5BNXA 5DNNB 3AZFC 2ZY4A 5KDMA 5AV6A 2NZDD 3MGPA 3KUYC 1P3OB 3W99D 5B0ZA 3A6NA 3REHC 4KUDA 3C1CC 3REKA 1P3FA 3A1KA 2HIOB 3C1BD 3AZIC 3WA9B 4Z2MG 1A7WA 3AFAA 2NQBC 4WU8A 2F2AC 3UT9B 3MVDA 1M18B 3WKJB 5DNMA 4DRAA 2F8NA 4XZQD 3REJD 5CPIB 3LELA 3LELD 4WJ3C 3AZEB 1ZLAA 2UWXA 2F8NK 4Z66D 5B24A 1TZYC 3AZHD 3WTPE 3B6FC 3MGQD 4XUJD 3AZLD 1S32A 4YS3B 1P3LB 1TAFA 1W2EA 3H0MC 4ZBJB 3VH5A 4DRBA 5B40C 3X1TB 5B2JC 2IO5B 5F99A 4M6BA 1ID3B 2FJ7B 1KU5A 3MGSA 3AZND 3RELD 4J8UA 1P34D 3AZFB 1P3OA 1M19D 3AYWA 5B0YD 3W96D 3AZGD 3KWQA 3KWQD 3VH6A 2W8SA 5B2IB 3KUYB 3LZ1A 3REHB 4H9OA 4CSRA 1P3PD 1F66C 5B32A 1Z2CB 3AZIB 4R8PC 1P3GC 2NQBB 5CP6D 3AV2C 2AROB 2PYOD 3AZEA 2Y2JA 4J8WA 3MNND 1M1AB 5B31D 2Y2LA 4JJNA 1AOID 4KHAB 4KGCC 1TZYB 4YM6B 5FUGA 5JA4A 3B6FB 3TU4A 2G5IC 5B40B 2XD5A 3KXBA 5B2JB 5AY8A 3AZFA 5GT3D 2Y2NA 2YFVB 3X1SA 1HQ3A 5CPJD 4H9PA 3W99C 5B2IA 3KUYA 1P3KA 2ZY2A 3EG5B 3WAAD 3W98D 3C1BC 4H9SC 5JRGA 3O62A 5CPKA 5GT0D 1F66B 5AVBB 3X1UA 4H9NB 5GSUD 2AROA 1P3GB 4H9RB 3B0CW 4ZUXA 3REJC 3AV2B 5B33D 1M1AA 3B0CT 1P3AD 5E5AA 2Y2QA 4NE5A 4QLCB 4Z5TC 4G91B 4Z66C 5AV8D 2JSSA 3LZ0A 3NQJB 1TZYA 4YM6A 3AZHC 3MGQC 4E45A 4NFTA 4XUJC 5B1MA 1KX4C 3AN2B 4KGCB 4WNNB 3MGRD 3NQUA 1PZRA 1ULYA 3AZNC 3RELC 1U35D 3X1VB 1P34C 1M19C 3B6GA 5B0YC 2JE5A 3W96C 3AZGC 3LJAB 3W99B 1P3BA 5AV5A 1P3PC 5B1LA 5AVBA 3UTBA 4CAYB 3V9RB 3C1BB 4EO5C 1P3GA 1EQZA 5AV6D 2PYOC 3MGPD 3AZMB 5B0ZD 3A6ND 3AZKB 3REJB 3MNNC 4QLCA 1P3MA 2CV5C 3AV1A 4KUDD 5G49A 3NQJA 1KX5A 5B31C 1B6WA 3REKD 1P3FD 1KX5D 2RVQD 4Z5TB 4Z66B 3W97A 1AOIC 3AN2A 3AZJC 4KGCA 3AZHB 4J8VA 3AFAD 3MGQB 1JFIB 4WU8D 1BFMA 4XUJB 1KX4B 3MVDD 4H9QA 5B31G 2Y2KA 5DNMD 2F8ND 3X1VA 5GT3C 5AVCA 3AZNB 1Q9CA 5CPJC 1KX3A 1ZLAD 3UTAA 3F6TA 3FDDA 3LJAA 4WU9A 1P34B 1M19B 5B24D 5B0YB 3W96B 5BNVB 3AZGB 3WAAC 4J8XA 3REIA 4UUZA 3W98C 1HTAA 1S32D 1P3PB 3WTPA 2Y2OA 4X23A 2BYMA 4Z2MH 5GXQC 5F99D 1T3UA 5GSUC 5DNNA 4LD9B 3MGSD 4J8UD 3AZMA 1P3OD 3AZKA 5B33C 3AYWD 2PYOB 5BS7A 2VQRA 1BH9B 1P3AC 2HIOA 3LZ1D 3WA9A 3MNNB 5AV8C 4Z5TA 3C1CB 2CV5B 2ZY5A 5B32D 1P3IC 2Y2PA 3WKJA 3UT9A 1M18A 1KX4A 1AOIB 3AZJB 3MGRC 5CPIA 5AV9C 3AZED 1U35C 2J8PA 4J8WD 2DQNC 5GT3B 4WV4B 5CPJB 4JJND 1P3LA 4YS3A 3WAAB 3X1TA 3W98B 2BG1A 1ID3A 2FJ7A 3TU4D 4LD9A 5CHLB 3KXBD 5BO0B 2ZM5A 5GXQB 5AY8D 5GSUB 3AZFD 1F1EA 4NE3A 5AV6C 3X1SD 2NZDC 1HQ3D 5BT1D 3VH5W 3MGPC 5B0ZC 3A6NC 5B2ID 3KUYD 3REHA 1H3OB 1P3KD 2L5AA 5B33B 1N1JB 3C1CA 2YFWB 1P3FC 1P3AB 2RVQC 5JRGD 3O62D 3AZIA 5AV8B 5CPKD 3X1UD 3AZJA 1P3IB 3VH6W 2NQBA 1R4VA 4WU8C 3MVDC 4R8PB 5DNMC 2AROD 4XZQC 4ZUXD 3LELC 1M1AD 2HUEC 5AV9B 4WZSB 1ZLAC 5E5AD 4UPKA 1BH8B 3LZ0D 2F8NG 5B24C 4KHAA 1TZYD 4YM6D 3B6FA 3AZLC 5B1MD 2BYKB 5B40A 5BO0A 5B2JA 5F99C 5GXQA 3MGSC 2YFVA 5C3IC 4J8UC 1P3OC 5KDMB 3AYWC 3B6GD 5AV6B 2NZDB 2YFWA 3KWQC 2ZY3A 1B67A 3LZ1C 1P3BD 5AV5D 1F66A 5B1LD 5B32C 5AVBD 3UTBD 4H9NA 1P3FB 2Y2MA 4R8PA 4H9RA 1P3GD 1EQZD 5CP6C 4WU8B 5B32G 3MVDB 3AV2A 5DNMB 3B0BA 4HGAC 5AV9A 4XZQB 4J8WC 4QLCD 1P3MD 1BH8A 3AV1D 3LELB 3KFUG 2HUEB 1ZLAB 4JJNC 3W97D 5B24B 3AN2D 4KGCD 4J8VD 4WNNA 3AZLB 3TU4C 3KSYA 1TAFB 3KXBC 5AY8C 5F99B 3X1VD 3P5JB 3MGSB 5AVCD 3X1SC 1HQ3C 5BT1C 5C3IB 3RELB 2NZDA 4J8UB 1KX3D 3UTAD 5B2IC 3LJAD 4WU9D 3W99A 1P3KC 3AYWB 3KWQB 4J8XD 3REID 4CAYA 3LZ1B 4H9OB 3V9RA 4H9SA 4CSRB 5JRGC 3O62C 3C1BA 5GT0C 5CPKC 3WTPD 3AL0C 3X1UC 5B32B 4X23D 2LY8A 5DNND 2AROC 4EO5B 5CP6B 3B0DC 4XZQA 4ZUXC 3REJA 3AZKD 3H0LC 3AZMD 1M1AC 4HGAB 5E5AC 2HIOD 4J8WB 3LZ0C 3WA9D 4Z66A 4Z5TD 4YM6C 3AZHA 5B31B 3MGQA 1JFIA 5B1MC 4XUJA 4JJNB 4AWLC 3UT9D 3AZLA 1M18D 1KX4D 3WKJD 5FUGB 5JA4B 5CPID 3TU4B 3AZNA 3EPLA 2Y2HA 3KXBB 3RELA 5AY8B 1P34A 1M19A 2Y2IA 3H0RC 3B6GC 5B0YA 3W96A 3X1SB 1HQ3B 5BNVA 3AZGA 4H9PB 1P3BC 1P3KB 5AV5C 1P3LD 4YS3D 1P3PA 5B1LC 5AVBC 3UTBC 3X1TD 5JRGB 3O62B 1ID3D 2FJ7D 5GT0B 5CPKB 4LD9D 3X1UB 1EQZC 5CP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYO A;  1BH9 A;  3B0D B;  4ZUX B;  3REH D;  4QLC C;  3MNN A;  1P3M C;  3VH5 T;  4G91 C;  3AV1 C;  2CV5 A;  2CV5 D;  3C1C D;  4KUD C;  3REK C;  1KX5 C;  5B31 A;  5E5A B;  3AZI D;  3LZ0 B;  3W97 C;  1AOI A;  3AN2 C;  3AZJ D;  4J8V C;  3AFA C;  2NQB D;  5B1M B;  4AWL B;  3VH6 T;  3MGR B;  3X1V C;  3NQU B;  4G92 C;  4E44 A;  5GT3 A;  5AVC C;  1U35 B;  5CPJ A;  1KX3 C;  3UTA C;  3LJA C;  4WU9 C;  3B6G B;  4J8X C;  3WAA A;  3REI C;  3B6F D;  3W98 A;  1P3B B;  5AV5 B;  1S32 C;  3WTP C;  5B1L B;  5GT0 A;  5B40 D;  4X23 C;  3UTB B;  3R45 B;  5B2J D;  5DNN C;  5GSU A;  5GXQ D;  1EQZ B;  4NE6 A;  5BNX B;  3AZM C;  3AZK C;  1H3O A;  5B33 A;  1N1J A;  5BS7 C;  3MGP B;  5B0Z B;  3A6N B;  2HIO C;  1P3A A;  3WA9 C;  1P3M B;  4KUD B;  5AV8 A;  3AV1 B;  1F66 D;  5G49 B;  3REK B;  1KX5 B;  1P3I A;  2F8N H;  1P3I D;  3WKJ C;  3UT9 C;  1M18 C;  3W97 B;  1WWI A;  4R8P D;  4J8V B;  3AFA B;  3MGR A;  5CPI C;  4H9Q B;  3AV2 D;  3AZE C;  2F8N B;  2CWE A;  5AV9 D;  1U35 A;  4G92 B;  5AVC B;  1KX3 B;  3UTA B;  4WU9 B;  1WWS A;  2BYK A;  4YS3 C;  1P3L C;  4ZBJ C;  4J8X B;  3X1T C;  3REI B;  3R45 A;  4UUZ B;  2IO5 C;  1ID3 C;  2FJ7 C;  1S32 B;  4LD9 C;  3WTP B;  4X23 B;  2BYM B;  5BNX A;  5DNN B;  3AZF C;  5KDM A;  5AV6 A;  2NZD D;  3MGP A;  3KUY C;  1P3O B;  3W99 D;  5B0Z A;  3A6N A;  3REH C;  4KUD A;  3C1C C;  3REK A;  1P3F A;  2HIO B;  3C1B D;  3AZI C;  3WA9 B;  4Z2M G;  1A7W A;  3AFA A;  2NQB C;  4WU8 A;  3WKJ B;  3UT9 B;  3MVD A;  1M18 B;  5DNM A;  4DRA A;  2F8N A;  4XZQ D;  3REJ D;  5CPI B;  3LEL A;  3LEL D;  3AZE B;  1ZLA A;  2F8N K;  4Z66 D;  5B24 A;  1TZY C;  3AZH D;  3WTP E;  3B6F C;  3MGQ D;  4XUJ D;  3AZL D;  1S32 A;  4YS3 B;  1P3L B;  1TAF A;  5B40 C;  4ZBJ B;  3VH5 A;  4DRB A;  3X1T B;  5B2J C;  2IO5 B;  5F99 A;  4M6B A;  1ID3 B;  2FJ7 B;  1KU5 A;  3MGS A;  3AZN D;  3REL D;  4J8U A;  1P34 D;  3AZF B;  1P3O A;  1M19 D;  3AYW A;  5B0Y D;  3W96 D;  3AZG D;  3KWQ A;  3KWQ D;  3VH6 A;  5B2I B;  3KUY B;  3LZ1 A;  3REH B;  4H9O A;  4CSR A;  1P3P D;  1F66 C;  5B32 A;  3AZI B;  4R8P C;  1P3G C;  2NQB B;  5CP6 D;  3AV2 C;  2ARO B;  2PYO D;  3AZE A;  4J8W A;  3MNN D;  1M1A B;  5B31 D;  4JJN A;  1AOI D;  4KHA B;  4KGC C;  1TZY B;  4YM6 B;  5FUG A;  5JA4 A;  3B6F B;  3TU4 A;  5B40 B;  3KXB A;  5B2J B;  5AY8 A;  3AZF A;  5GT3 D;  2YFV B;  3X1S A;  1HQ3 A;  5CPJ D;  4H9P A;  3W99 C;  5B2I A;  3KUY A;  1P3K A;  3WAA D;  3W98 D;  3C1B C;  5JRG A;  4H9S C;  3O62 A;  5CPK A;  5GT0 D;  1F66 B;  5AVB B;  3X1U A;  4H9N B;  5GSU D;  2ARO A;  1P3G B;  4H9R B;  3B0C W;  4ZUX A;  3REJ C;  3AV2 B;  5B33 D;  1M1A A;  3B0C T;  1P3A D;  5E5A A;  4NE5 A;  4QLC B;  4Z66 C;  4Z5T C;  4G91 B;  5AV8 D;  2JSS A;  3LZ0 A;  3NQJ B;  1TZY A;  4YM6 A;  3AZH C;  3MGQ C;  4E45 A;  4NFT A;  4XUJ C;  5B1M A;  1KX4 C;  3AN2 B;  4KGC B;  4WNN B;  3MGR D;  3NQU A;  1ULY A;  3AZN C;  3REL C;  1U35 D;  3X1V B;  1P34 C;  1M19 C;  3B6G A;  5B0Y C;  3W96 C;  3AZG C;  3LJA B;  3W99 B;  1P3B A;  5AV5 A;  1P3P C;  5B1L A;  5AVB A;  3UTB A;  4CAY B;  3V9R B;  3C1B B;  4EO5 C;  1P3G A;  1EQZ A;  5AV6 D;  2PYO C;  3MGP D;  3AZM B;  5B0Z D;  3A6N D;  3AZK B;  3REJ B;  3MNN C;  4QLC A;  1P3M A;  2CV5 C;  3AV1 A;  4KUD D;  5G49 A;  3NQJ A;  1KX5 A;  5B31 C;  1B6W A;  3REK D;  1P3F D;  1KX5 D;  2RVQ D;  4Z5T B;  4Z66 B;  3W97 A;  1AOI C;  3AN2 A;  3AZJ C;  4KGC A;  3AZH B;  4J8V A;  3AFA D;  3MGQ B;  1JFI B;  4WU8 D;  1BFM A;  4XUJ B;  1KX4 B;  3MVD D;  4H9Q A;  5B31 G;  5DNM D;  2F8N D;  3X1V A;  5GT3 C;  5AVC A;  3AZN B;  1Q9C A;  5CPJ C;  1KX3 A;  1ZLA D;  3UTA A;  1P34 B;  3LJA A;  4WU9 A;  1M19 B;  5B24 D;  5B0Y B;  3W96 B;  5BNV B;  3AZG B;  3WAA C;  4J8X A;  3REI A;  4UUZ A;  3W98 C;  1HTA A;  1S32 D;  1P3P B;  3WTP A;  4X23 A;  2BYM A;  4Z2M H;  5GXQ C;  5F99 D;  5GSU C;  5DNN A;  4LD9 B;  3MGS D;  4J8U D;  3AZM A;  1P3O D;  3AZK A;  5B33 C;  3AYW D;  2PYO B;  5BS7 A;  1BH9 B;  1P3A C;  2HIO A;  3LZ1 D;  3WA9 A;  3MNN B;  5AV8 C;  4Z5T A;  3C1C B;  2CV5 B;  5B32 D;  1P3I C;  3WKJ A;  3UT9 A;  1M18 A;  1KX4 A;  1AOI B;  3AZJ B;  3MGR C;  5CPI A;  5AV9 C;  3AZE D;  1U35 C;  4J8W D;  5GT3 B;  4WV4 B;  5CPJ B;  4JJN D;  1P3L A;  4YS3 A;  3WAA B;  3X1T A;  3W98 B;  1ID3 A;  2FJ7 A;  3TU4 D;  4LD9 A;  5CHL B;  3KXB D;  5BO0 B;  5GXQ B;  5AY8 D;  5GSU B;  3AZF D;  1F1E A;  4NE3 A;  5AV6 C;  3X1S D;  2NZD C;  1HQ3 D;  5BT1 D;  3VH5 W;  3MGP C;  5B0Z C;  3A6N C;  5B2I D;  3KUY D;  3REH A;  1H3O B;  1P3K D;  2L5A A;  5B33 B;  1N1J B;  3C1C A;  2YFW B;  1P3F C;  1P3A B;  2RVQ C;  5JRG D;  3O62 D;  3AZI A;  5AV8 B;  5CPK D;  3X1U D;  3AZJ A;  1P3I B;  3VH6 W;  2NQB A;  1R4V A;  4WU8 C;  3MVD C;  4R8P B;  5DNM C;  2ARO D;  4XZQ C;  4ZUX D;  3LEL C;  1M1A D;  2HUE C;  5AV9 B;  4WZS B;  1ZLA C;  5E5A D;  1BH8 B;  3LZ0 D;  2F8N G;  5B24 C;  4KHA A;  1TZY D;  4YM6 D;  3B6F A;  3AZL C;  5B1M D;  2BYK B;  5B40 A;  5BO0 A;  5B2J A;  5F99 C;  5GXQ A;  3MGS C;  2YFV A;  5C3I C;  4J8U C;  1P3O C;  5KDM B;  3AYW C;  3B6G D;  5AV6 B;  2NZD B;  2YFW A;  3KWQ C;  3LZ1 C;  1B67 A;  1P3B D;  5AV5 D;  1F66 A;  5B1L D;  5B32 C;  5AVB D;  3UTB D;  4H9N A;  1P3F B;  4R8P A;  4H9R A;  1P3G D;  1EQZ D;  5CP6 C;  4WU8 B;  5B32 G;  3MVD B;  3AV2 A;  5DNM B;  3B0B A;  4HGA C;  5AV9 A;  4XZQ B;  4J8W C;  4QLC D;  1P3M D;  1BH8 A;  3AV1 D;  3LEL B;  2HUE B;  1ZLA B;  4JJN C;  3W97 D;  5B24 B;  3AN2 D;  4KGC D;  4J8V D;  4WNN A;  3AZL B;  3TU4 C;  3KSY A;  1TAF B;  3KXB C;  5AY8 C;  5F99 B;  3X1V D;  3MGS B;  5AVC D;  3X1S C;  1HQ3 C;  5BT1 C;  5C3I B;  3REL B;  2NZD A;  4J8U B;  1KX3 D;  3UTA D;  5B2I C;  3LJA D;  4WU9 D;  3W99 A;  1P3K C;  3AYW B;  3KWQ B;  4J8X D;  3REI D;  4CAY A;  3LZ1 B;  4H9O B;  3V9R A;  4H9S A;  4CSR B;  5JRG C;  3O62 C;  3C1B A;  5GT0 C;  5CPK C;  3WTP D;  3X1U C;  5B32 B;  4X23 D;  2LY8 A;  5DNN D;  2ARO C;  4EO5 B;  5CP6 B;  3B0D C;  4XZQ A;  4ZUX C;  3REJ A;  3AZK D;  3AZM D;  1M1A C;  4HGA B;  5E5A C;  2HIO D;  4J8W B;  3LZ0 C;  3WA9 D;  4Z66 A;  4Z5T D;  4YM6 C;  3AZH A;  5B31 B;  3MGQ A;  1JFI A;  5B1M C;  4XUJ A;  4JJN B;  4AWL C;  3UT9 D;  3AZL A;  1M18 D;  1KX4 D;  3WKJ D;  5FUG B;  5JA4 B;  5CPI D;  3TU4 B;  3AZN A;  3KXB B;  3REL A;  5AY8 B;  1P34 A;  1M19 A;  3B6G C;  5B0Y A;  3W96 A;  3X1S B;  1HQ3 B;  5BNV A;  3AZG A;  4H9P B;  1P3B C;  1P3K B;  5AV5 C;  1P3L D;  4YS3 D;  1P3P A;  5B1L C;  5AVB C;  3UTB C;  3X1T D;  5JRG B;  3O62 B;  1ID3 D;  2FJ7 D;  5GT0 B;  5CPK B;  4LD9 D;  3X1U B;  1EQZ C;  5CP6 A; 
#chains in the Genus database with same CATH topology
 2DF4 C;  2PYO A;  1BH9 A;  3B0D B;  4ZUX B;  3REH D;  4QLC C;  3MNN A;  1P3M C;  3VH5 T;  4G91 C;  3AV1 C;  2CV5 A;  2CV5 D;  3C1C D;  4KUD C;  3REK C;  1KX5 C;  5B31 A;  5E5A B;  3AZI D;  3LZ0 B;  3W97 C;  1AOI A;  3AN2 C;  2XD1 A;  3AZJ D;  3IP4 C;  4J8V C;  3AFA C;  2NQB D;  5B1M B;  4AWL B;  3VH6 T;  3MGR B;  2Y2G A;  3X1V C;  3NQU B;  4G92 C;  4E44 A;  5GT3 A;  5AVC C;  1U35 B;  5CPJ A;  1KX3 C;  3UTA C;  3LJA C;  4WU9 C;  3B6G B;  2JCH A;  4J8X C;  3WAA A;  3REI C;  3B6F D;  3W98 A;  2G5H C;  2FFF B;  1P3B B;  5AV5 B;  1S32 C;  3WTP C;  5B1L B;  5GT0 A;  5B40 D;  4X23 C;  3UTB B;  3R45 B;  5B2J D;  5DNN C;  5GSU A;  5GXQ D;  3EPJ A;  1EQZ B;  4NE6 A;  5BNX B;  3AZM C;  3AZK C;  1H3O A;  5B33 A;  1N1J A;  4DQY B;  5BS7 C;  3MGP B;  5B0Z B;  3A6N B;  2HIO C;  1P3A A;  3WA9 C;  1P3M B;  4KUD B;  5AV8 A;  3AV1 B;  1F66 D;  5G49 B;  3REK B;  1KX5 B;  1P3I A;  2F8N H;  1P3I D;  3WKJ C;  3UT9 C;  1M18 C;  3W97 B;  1WWI A;  4R8P D;  3EPK A;  4J8V B;  3AFA B;  3MGR A;  5CPI C;  4H9Q B;  3AV2 D;  3AZE C;  2F8N B;  2CWE A;  5AV9 D;  1U35 A;  3EPH A;  4G92 B;  3A1I A;  5AVC B;  1KX3 B;  3UTA B;  4WU9 B;  1WWS A;  2BYK A;  2RIQ A;  4YS3 C;  1P3L C;  4ZBJ C;  4J8X B;  3X1T C;  3REI B;  3R45 A;  4UUZ B;  2IO5 C;  1ID3 C;  2FJ7 C;  1S32 B;  4LD9 C;  3WTP B;  4X23 B;  2BYM B;  5BNX A;  5DNN B;  3AZF C;  2ZY4 A;  5KDM A;  5AV6 A;  2NZD D;  3MGP A;  3KUY C;  1P3O B;  3W99 D;  5B0Z A;  3A6N A;  3REH C;  4KUD A;  3C1C C;  3REK A;  1P3F A;  3A1K A;  2HIO B;  3C1B D;  3AZI C;  3WA9 B;  4Z2M G;  1A7W A;  3AFA A;  2NQB C;  4WU8 A;  2F2A C;  3UT9 B;  3MVD A;  1M18 B;  3WKJ B;  5DNM A;  4DRA A;  2F8N A;  4XZQ D;  3REJ D;  5CPI B;  3LEL A;  3LEL D;  4WJ3 C;  3AZE B;  1ZLA A;  2UWX A;  2F8N K;  4Z66 D;  5B24 A;  1TZY C;  3AZH D;  3WTP E;  3B6F C;  3MGQ D;  4XUJ D;  3AZL D;  1S32 A;  4YS3 B;  1P3L B;  1TAF A;  1W2E A;  3H0M C;  4ZBJ B;  3VH5 A;  4DRB A;  5B40 C;  3X1T B;  5B2J C;  2IO5 B;  5F99 A;  4M6B A;  1ID3 B;  2FJ7 B;  1KU5 A;  3MGS A;  3AZN D;  3REL D;  4J8U A;  1P34 D;  3AZF B;  1P3O A;  1M19 D;  3AYW A;  5B0Y D;  3W96 D;  3AZG D;  3KWQ A;  3KWQ D;  3VH6 A;  2W8S A;  5B2I B;  3KUY B;  3LZ1 A;  3REH B;  4H9O A;  4CSR A;  1P3P D;  1F66 C;  5B32 A;  1Z2C B;  3AZI B;  4R8P C;  1P3G C;  2NQB B;  5CP6 D;  3AV2 C;  2ARO B;  2PYO D;  3AZE A;  2Y2J A;  4J8W A;  3MNN D;  1M1A B;  5B31 D;  2Y2L A;  4JJN A;  1AOI D;  4KHA B;  4KGC C;  1TZY B;  4YM6 B;  5FUG A;  5JA4 A;  3B6F B;  3TU4 A;  2G5I C;  5B40 B;  2XD5 A;  3KXB A;  5B2J B;  5AY8 A;  3AZF A;  5GT3 D;  2Y2N A;  2YFV B;  3X1S A;  1HQ3 A;  5CPJ D;  4H9P A;  3W99 C;  5B2I A;  3KUY A;  1P3K A;  2ZY2 A;  3EG5 B;  3WAA D;  3W98 D;  3C1B C;  4H9S C;  5JRG A;  3O62 A;  5CPK A;  5GT0 D;  1F66 B;  5AVB B;  3X1U A;  4H9N B;  5GSU D;  2ARO A;  1P3G B;  4H9R B;  3B0C W;  4ZUX A;  3REJ C;  3AV2 B;  5B33 D;  1M1A A;  3B0C T;  1P3A D;  5E5A A;  2Y2Q A;  4NE5 A;  4QLC B;  4Z5T C;  4G91 B;  4Z66 C;  5AV8 D;  2JSS A;  3LZ0 A;  3NQJ B;  1TZY A;  4YM6 A;  3AZH C;  3MGQ C;  4E45 A;  4NFT A;  4XUJ C;  5B1M A;  1KX4 C;  3AN2 B;  4KGC B;  4WNN B;  3MGR D;  3NQU A;  1PZR A;  1ULY A;  3AZN C;  3REL C;  1U35 D;  3X1V B;  1P34 C;  1M19 C;  3B6G A;  5B0Y C;  2JE5 A;  3W96 C;  3AZG C;  3LJA B;  3W99 B;  1P3B A;  5AV5 A;  1P3P C;  5B1L A;  5AVB A;  3UTB A;  4CAY B;  3V9R B;  3C1B B;  4EO5 C;  1P3G A;  1EQZ A;  5AV6 D;  2PYO C;  3MGP D;  3AZM B;  5B0Z D;  3A6N D;  3AZK B;  3REJ B;  3MNN C;  4QLC A;  1P3M A;  2CV5 C;  3AV1 A;  4KUD D;  5G49 A;  3NQJ A;  1KX5 A;  5B31 C;  1B6W A;  3REK D;  1P3F D;  1KX5 D;  2RVQ D;  4Z5T B;  4Z66 B;  3W97 A;  1AOI C;  3AN2 A;  3AZJ C;  4KGC A;  3AZH B;  4J8V A;  3AFA D;  3MGQ B;  1JFI B;  4WU8 D;  1BFM A;  4XUJ B;  1KX4 B;  3MVD D;  4H9Q A;  5B31 G;  2Y2K A;  5DNM D;  2F8N D;  3X1V A;  5GT3 C;  5AVC A;  3AZN B;  1Q9C A;  5CPJ C;  1KX3 A;  1ZLA D;  3UTA A;  3F6T A;  3FDD A;  3LJA A;  4WU9 A;  1P34 B;  1M19 B;  5B24 D;  5B0Y B;  3W96 B;  5BNV B;  3AZG B;  3WAA C;  4J8X A;  3REI A;  4UUZ A;  3W98 C;  1HTA A;  1S32 D;  1P3P B;  3WTP A;  2Y2O A;  4X23 A;  2BYM A;  4Z2M H;  5GXQ C;  5F99 D;  1T3U A;  5GSU C;  5DNN A;  4LD9 B;  3MGS D;  4J8U D;  3AZM A;  1P3O D;  3AZK A;  5B33 C;  3AYW D;  2PYO B;  5BS7 A;  2VQR A;  1BH9 B;  1P3A C;  2HIO A;  3LZ1 D;  3WA9 A;  3MNN B;  5AV8 C;  4Z5T A;  3C1C B;  2CV5 B;  2ZY5 A;  5B32 D;  1P3I C;  2Y2P A;  3WKJ A;  3UT9 A;  1M18 A;  1KX4 A;  1AOI B;  3AZJ B;  3MGR C;  5CPI A;  5AV9 C;  3AZE D;  1U35 C;  2J8P A;  4J8W D;  2DQN C;  5GT3 B;  4WV4 B;  5CPJ B;  4JJN D;  1P3L A;  4YS3 A;  3WAA B;  3X1T A;  3W98 B;  2BG1 A;  1ID3 A;  2FJ7 A;  3TU4 D;  4LD9 A;  5CHL B;  3KXB D;  5BO0 B;  2ZM5 A;  5GXQ B;  5AY8 D;  5GSU B;  3AZF D;  1F1E A;  4NE3 A;  5AV6 C;  3X1S D;  2NZD C;  1HQ3 D;  5BT1 D;  3VH5 W;  3MGP C;  5B0Z C;  3A6N C;  5B2I D;  3KUY D;  3REH A;  1H3O B;  1P3K D;  2L5A A;  5B33 B;  1N1J B;  3C1C A;  2YFW B;  1P3F C;  1P3A B;  2RVQ C;  5JRG D;  3O62 D;  3AZI A;  5AV8 B;  5CPK D;  3X1U D;  3AZJ A;  1P3I B;  3VH6 W;  2NQB A;  1R4V A;  4WU8 C;  3MVD C;  4R8P B;  5DNM C;  2ARO D;  4XZQ C;  4ZUX D;  3LEL C;  1M1A D;  2HUE C;  5AV9 B;  4WZS B;  1ZLA C;  5E5A D;  4UPK A;  1BH8 B;  3LZ0 D;  2F8N G;  5B24 C;  4KHA A;  1TZY D;  4YM6 D;  3B6F A;  3AZL C;  5B1M D;  2BYK B;  5B40 A;  5BO0 A;  5B2J A;  5F99 C;  5GXQ A;  3MGS C;  2YFV A;  5C3I C;  4J8U C;  1P3O C;  5KDM B;  3AYW C;  3B6G D;  5AV6 B;  2NZD B;  2YFW A;  3KWQ C;  2ZY3 A;  1B67 A;  3LZ1 C;  1P3B D;  5AV5 D;  1F66 A;  5B1L D;  5B32 C;  5AVB D;  3UTB D;  4H9N A;  1P3F B;  2Y2M A;  4R8P A;  4H9R A;  1P3G D;  1EQZ D;  5CP6 C;  4WU8 B;  5B32 G;  3MVD B;  3AV2 A;  5DNM B;  3B0B A;  4HGA C;  5AV9 A;  4XZQ B;  4J8W C;  4QLC D;  1P3M D;  1BH8 A;  3AV1 D;  3LEL B;  3KFU G;  2HUE B;  1ZLA B;  4JJN C;  3W97 D;  5B24 B;  3AN2 D;  4KGC D;  4J8V D;  4WNN A;  3AZL B;  3TU4 C;  3KSY A;  1TAF B;  3KXB C;  5AY8 C;  5F99 B;  3X1V D;  3P5J B;  3MGS B;  5AVC D;  3X1S C;  1HQ3 C;  5BT1 C;  5C3I B;  3REL B;  2NZD A;  4J8U B;  1KX3 D;  3UTA D;  5B2I C;  3LJA D;  4WU9 D;  3W99 A;  1P3K C;  3AYW B;  3KWQ B;  4J8X D;  3REI D;  4CAY A;  3LZ1 B;  4H9O B;  3V9R A;  4H9S A;  4CSR B;  5JRG C;  3O62 C;  3C1B A;  5GT0 C;  5CPK C;  3WTP D;  3AL0 C;  3X1U C;  5B32 B;  4X23 D;  2LY8 A;  5DNN D;  2ARO C;  4EO5 B;  5CP6 B;  3B0D C;  4XZQ A;  4ZUX C;  3REJ A;  3AZK D;  3H0L C;  3AZM D;  1M1A C;  4HGA B;  5E5A C;  2HIO D;  4J8W B;  3LZ0 C;  3WA9 D;  4Z66 A;  4Z5T D;  4YM6 C;  3AZH A;  5B31 B;  3MGQ A;  1JFI A;  5B1M C;  4XUJ A;  4JJN B;  4AWL C;  3UT9 D;  3AZL A;  1M18 D;  1KX4 D;  3WKJ D;  5FUG B;  5JA4 B;  5CPI D;  3TU4 B;  3AZN A;  3EPL A;  2Y2H A;  3KXB B;  3REL A;  5AY8 B;  1P34 A;  1M19 A;  2Y2I A;  3H0R C;  3B6G C;  5B0Y A;  3W96 A;  3X1S B;  1HQ3 B;  5BNV A;  3AZG A;  4H9P B;  1P3B C;  1P3K B;  5AV5 C;  1P3L D;  4YS3 D;  1P3P A;  5B1L C;  5AVB C;  3UTB C;  3X1T D;  5JRG B;  3O62 B;  1ID3 D;  2FJ7 D;  5GT0 B;  5CPK B;  4LD9 D;  3X1U B;  1EQZ C;  5CP6 A; 
#chains in the Genus database with same CATH homology
 2DF4 C;  2PYO A;  1BH9 A;  3B0D B;  4ZUX B;  3REH D;  4QLC C;  3MNN A;  1P3M C;  3VH5 T;  4G91 C;  3AV1 C;  2CV5 A;  2CV5 D;  3C1C D;  4KUD C;  3REK C;  1KX5 C;  5B31 A;  5E5A B;  3AZI D;  3LZ0 B;  3W97 C;  1AOI A;  3AN2 C;  2XD1 A;  3AZJ D;  3IP4 C;  4J8V C;  3AFA C;  2NQB D;  5B1M B;  4AWL B;  3VH6 T;  3MGR B;  2Y2G A;  3X1V C;  3NQU B;  4G92 C;  4E44 A;  5GT3 A;  5AVC C;  1U35 B;  5CPJ A;  1KX3 C;  3UTA C;  3LJA C;  4WU9 C;  3B6G B;  2JCH A;  4J8X C;  3WAA A;  3REI C;  3B6F D;  3W98 A;  2G5H C;  2FFF B;  1P3B B;  5AV5 B;  1S32 C;  3WTP C;  5B1L B;  5GT0 A;  5B40 D;  4X23 C;  3UTB B;  3R45 B;  5B2J D;  5DNN C;  5GSU A;  5GXQ D;  3EPJ A;  1EQZ B;  4NE6 A;  5BNX B;  3AZM C;  3AZK C;  1H3O A;  5B33 A;  1N1J A;  4DQY B;  5BS7 C;  3MGP B;  5B0Z B;  3A6N B;  2HIO C;  1P3A A;  3WA9 C;  1P3M B;  4KUD B;  5AV8 A;  3AV1 B;  1F66 D;  5G49 B;  3REK B;  1KX5 B;  1P3I A;  2F8N H;  1P3I D;  3WKJ C;  3UT9 C;  1M18 C;  3W97 B;  1WWI A;  4R8P D;  3EPK A;  4J8V B;  3AFA B;  3MGR A;  5CPI C;  4H9Q B;  3AV2 D;  3AZE C;  2F8N B;  2CWE A;  5AV9 D;  1U35 A;  3EPH A;  4G92 B;  3A1I A;  5AVC B;  1KX3 B;  3UTA B;  4WU9 B;  1WWS A;  2BYK A;  2RIQ A;  4YS3 C;  1P3L C;  4ZBJ C;  4J8X B;  3X1T C;  3REI B;  3R45 A;  4UUZ B;  2IO5 C;  1ID3 C;  2FJ7 C;  1S32 B;  4LD9 C;  3WTP B;  4X23 B;  2BYM B;  5BNX A;  5DNN B;  3AZF C;  2ZY4 A;  5KDM A;  5AV6 A;  2NZD D;  3MGP A;  3KUY C;  1P3O B;  3W99 D;  5B0Z A;  3A6N A;  3REH C;  4KUD A;  3C1C C;  3REK A;  1P3F A;  3A1K A;  2HIO B;  3C1B D;  3AZI C;  3WA9 B;  4Z2M G;  1A7W A;  3AFA A;  2NQB C;  4WU8 A;  2F2A C;  3UT9 B;  3MVD A;  1M18 B;  3WKJ B;  5DNM A;  4DRA A;  2F8N A;  4XZQ D;  3REJ D;  5CPI B;  3LEL A;  3LEL D;  4WJ3 C;  3AZE B;  1ZLA A;  2UWX A;  2F8N K;  4Z66 D;  5B24 A;  1TZY C;  3AZH D;  3WTP E;  3B6F C;  3MGQ D;  4XUJ D;  3AZL D;  1S32 A;  4YS3 B;  1P3L B;  1TAF A;  1W2E A;  3H0M C;  4ZBJ B;  3VH5 A;  4DRB A;  5B40 C;  3X1T B;  5B2J C;  2IO5 B;  5F99 A;  4M6B A;  1ID3 B;  2FJ7 B;  1KU5 A;  3MGS A;  3AZN D;  3REL D;  4J8U A;  1P34 D;  3AZF B;  1P3O A;  1M19 D;  3AYW A;  5B0Y D;  3W96 D;  3AZG D;  3KWQ A;  3KWQ D;  3VH6 A;  2W8S A;  5B2I B;  3KUY B;  3LZ1 A;  3REH B;  4H9O A;  4CSR A;  1P3P D;  1F66 C;  5B32 A;  1Z2C B;  3AZI B;  4R8P C;  1P3G C;  2NQB B;  5CP6 D;  3AV2 C;  2ARO B;  2PYO D;  3AZE A;  2Y2J A;  4J8W A;  3MNN D;  1M1A B;  5B31 D;  2Y2L A;  4JJN A;  1AOI D;  4KHA B;  4KGC C;  1TZY B;  4YM6 B;  5FUG A;  5JA4 A;  3B6F B;  3TU4 A;  2G5I C;  5B40 B;  2XD5 A;  3KXB A;  5B2J B;  5AY8 A;  3AZF A;  5GT3 D;  2Y2N A;  2YFV B;  3X1S A;  1HQ3 A;  5CPJ D;  4H9P A;  3W99 C;  5B2I A;  3KUY A;  1P3K A;  2ZY2 A;  3EG5 B;  3WAA D;  3W98 D;  3C1B C;  4H9S C;  5JRG A;  3O62 A;  5CPK A;  5GT0 D;  1F66 B;  5AVB B;  3X1U A;  4H9N B;  5GSU D;  2ARO A;  1P3G B;  4H9R B;  3B0C W;  4ZUX A;  3REJ C;  3AV2 B;  5B33 D;  1M1A A;  3B0C T;  1P3A D;  5E5A A;  2Y2Q A;  4NE5 A;  4QLC B;  4Z5T C;  4G91 B;  4Z66 C;  5AV8 D;  2JSS A;  3LZ0 A;  3NQJ B;  1TZY A;  4YM6 A;  3AZH C;  3MGQ C;  4E45 A;  4NFT A;  4XUJ C;  5B1M A;  1KX4 C;  3AN2 B;  4KGC B;  4WNN B;  3MGR D;  3NQU A;  1PZR A;  1ULY A;  3AZN C;  3REL C;  1U35 D;  3X1V B;  1P34 C;  1M19 C;  3B6G A;  5B0Y C;  2JE5 A;  3W96 C;  3AZG C;  3LJA B;  3W99 B;  1P3B A;  5AV5 A;  1P3P C;  5B1L A;  5AVB A;  3UTB A;  4CAY B;  3V9R B;  3C1B B;  4EO5 C;  1P3G A;  1EQZ A;  5AV6 D;  2PYO C;  3MGP D;  3AZM B;  5B0Z D;  3A6N D;  3AZK B;  3REJ B;  3MNN C;  4QLC A;  1P3M A;  2CV5 C;  3AV1 A;  4KUD D;  5G49 A;  3NQJ A;  1KX5 A;  5B31 C;  1B6W A;  3REK D;  1P3F D;  1KX5 D;  2RVQ D;  4Z5T B;  4Z66 B;  3W97 A;  1AOI C;  3AN2 A;  3AZJ C;  4KGC A;  3AZH B;  4J8V A;  3AFA D;  3MGQ B;  1JFI B;  4WU8 D;  1BFM A;  4XUJ B;  1KX4 B;  3MVD D;  4H9Q A;  5B31 G;  2Y2K A;  5DNM D;  2F8N D;  3X1V A;  5GT3 C;  5AVC A;  3AZN B;  1Q9C A;  5CPJ C;  1KX3 A;  1ZLA D;  3UTA A;  3F6T A;  3FDD A;  3LJA A;  4WU9 A;  1P34 B;  1M19 B;  5B24 D;  5B0Y B;  3W96 B;  5BNV B;  3AZG B;  3WAA C;  4J8X A;  3REI A;  4UUZ A;  3W98 C;  1HTA A;  1S32 D;  1P3P B;  3WTP A;  2Y2O A;  4X23 A;  2BYM A;  4Z2M H;  5GXQ C;  5F99 D;  1T3U A;  5GSU C;  5DNN A;  4LD9 B;  3MGS D;  4J8U D;  3AZM A;  1P3O D;  3AZK A;  5B33 C;  3AYW D;  2PYO B;  5BS7 A;  2VQR A;  1BH9 B;  1P3A C;  2HIO A;  3LZ1 D;  3WA9 A;  3MNN B;  5AV8 C;  4Z5T A;  3C1C B;  2CV5 B;  2ZY5 A;  5B32 D;  1P3I C;  2Y2P A;  3WKJ A;  3UT9 A;  1M18 A;  1KX4 A;  1AOI B;  3AZJ B;  3MGR C;  5CPI A;  5AV9 C;  3AZE D;  1U35 C;  2J8P A;  4J8W D;  2DQN C;  5GT3 B;  4WV4 B;  5CPJ B;  4JJN D;  1P3L A;  4YS3 A;  3WAA B;  3X1T A;  3W98 B;  2BG1 A;  1ID3 A;  2FJ7 A;  3TU4 D;  4LD9 A;  5CHL B;  3KXB D;  5BO0 B;  2ZM5 A;  5GXQ B;  5AY8 D;  5GSU B;  3AZF D;  1F1E A;  4NE3 A;  5AV6 C;  3X1S D;  2NZD C;  1HQ3 D;  5BT1 D;  3VH5 W;  3MGP C;  5B0Z C;  3A6N C;  5B2I D;  3KUY D;  3REH A;  1H3O B;  1P3K D;  2L5A A;  5B33 B;  1N1J B;  3C1C A;  2YFW B;  1P3F C;  1P3A B;  2RVQ C;  5JRG D;  3O62 D;  3AZI A;  5AV8 B;  5CPK D;  3X1U D;  3AZJ A;  1P3I B;  3VH6 W;  2NQB A;  1R4V A;  4WU8 C;  3MVD C;  4R8P B;  5DNM C;  2ARO D;  4XZQ C;  4ZUX D;  3LEL C;  1M1A D;  2HUE C;  5AV9 B;  4WZS B;  1ZLA C;  5E5A D;  4UPK A;  1BH8 B;  3LZ0 D;  2F8N G;  5B24 C;  4KHA A;  1TZY D;  4YM6 D;  3B6F A;  3AZL C;  5B1M D;  2BYK B;  5B40 A;  5BO0 A;  5B2J A;  5F99 C;  5GXQ A;  3MGS C;  2YFV A;  5C3I C;  4J8U C;  1P3O C;  5KDM B;  3AYW C;  3B6G D;  5AV6 B;  2NZD B;  2YFW A;  3KWQ C;  2ZY3 A;  1B67 A;  3LZ1 C;  1P3B D;  5AV5 D;  1F66 A;  5B1L D;  5B32 C;  5AVB D;  3UTB D;  4H9N A;  1P3F B;  2Y2M A;  4R8P A;  4H9R A;  1P3G D;  1EQZ D;  5CP6 C;  4WU8 B;  5B32 G;  3MVD B;  3AV2 A;  5DNM B;  3B0B A;  4HGA C;  5AV9 A;  4XZQ B;  4J8W C;  4QLC D;  1P3M D;  1BH8 A;  3AV1 D;  3LEL B;  3KFU G;  2HUE B;  1ZLA B;  4JJN C;  3W97 D;  5B24 B;  3AN2 D;  4KGC D;  4J8V D;  4WNN A;  3AZL B;  3TU4 C;  3KSY A;  1TAF B;  3KXB C;  5AY8 C;  5F99 B;  3X1V D;  3P5J B;  3MGS B;  5AVC D;  3X1S C;  1HQ3 C;  5BT1 C;  5C3I B;  3REL B;  2NZD A;  4J8U B;  1KX3 D;  3UTA D;  5B2I C;  3LJA D;  4WU9 D;  3W99 A;  1P3K C;  3AYW B;  3KWQ B;  4J8X D;  3REI D;  4CAY A;  3LZ1 B;  4H9O B;  3V9R A;  4H9S A;  4CSR B;  5JRG C;  3O62 C;  3C1B A;  5GT0 C;  5CPK C;  3WTP D;  3AL0 C;  3X1U C;  5B32 B;  4X23 D;  2LY8 A;  5DNN D;  2ARO C;  4EO5 B;  5CP6 B;  3B0D C;  4XZQ A;  4ZUX C;  3REJ A;  3AZK D;  3H0L C;  3AZM D;  1M1A C;  4HGA B;  5E5A C;  2HIO D;  4J8W B;  3LZ0 C;  3WA9 D;  4Z66 A;  4Z5T D;  4YM6 C;  3AZH A;  5B31 B;  3MGQ A;  1JFI A;  5B1M C;  4XUJ A;  4JJN B;  4AWL C;  3UT9 D;  3AZL A;  1M18 D;  1KX4 D;  3WKJ D;  5FUG B;  5JA4 B;  5CPI D;  3TU4 B;  3AZN A;  3EPL A;  2Y2H A;  3KXB B;  3REL A;  5AY8 B;  1P34 A;  1M19 A;  2Y2I A;  3H0R C;  3B6G C;  5B0Y A;  3W96 A;  3X1S B;  1HQ3 B;  5BNV A;  3AZG A;  4H9P B;  1P3B C;  1P3K B;  5AV5 C;  1P3L D;  4YS3 D;  1P3P A;  5B1L C;  5AVB C;  3UTB C;  3X1T D;  5JRG B;  3O62 B;  1ID3 D;  2FJ7 D;  5GT0 B;  5CPK B;  4LD9 D;  3X1U B;  1EQZ C;  5CP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...