2RVQD

Solution structure of the isolated histone h2a-h2b heterodimer
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'GPGMPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H2A type 1-B/E
publication title Solution structure of the isolated histone H2A-H2B heterodimer
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein/nuclear protein
total genus 35
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2rvqD00
3AZFC 5AV5A 3LZ0C 1P3IC 4X23C 1P3AD 3VH6W 3MGSC 3RELC 3AZND 3AFAD 1ID3C 3AV1C 3R45B 3WA9B 4UUZA 5B1LA 5E5AA 3AZED 1P3FD 3MGQC 4YS3D 1M19C 4LD9A 1EQZD 4WV4B 3W98C 3AZJC 3B0DB 3W99B 3REJC 3UTAA 5KDMA 3LZ0B 1P3IB 4X23B 3MGSB 5BNVA 1BH8A 3RELB 1HQ3C 4YM6C 4XZQC 5JRGA 4DRBA 1P3OC 1ID3B 3WKJA 2L5AA 3AV1B 3WA9D 3O62C 3REHA 5B24C 1M19B 4NE5A 3MGQB 4Z66C 4EO5C 4XUJC 4NFTA 4KUDA 3AZIC 3W99D 1P3BC 3AYWD 3LZ0D 3KWQC 1P3ID 3KUYA 5GT3A 4X23D 3WAAC 3B0BA 3MGSD 3RELD 1HQ3B 4XZQB 3AV2B 1P3OB 1ID3D 2CV5C 3AZKC 4KGCC 3O62B 5B24B 1M19D 5B0YC 3MGQD 4Z66B 4EO5B 3B6FA 3AZIB 4WNNA 5B32A 4J8XA 5BO0B 1P3BB 2AROA 1H3OB 3LJAA 4HGAC 5AVBA 3KWQB 4JJNC 2HIOA 5AY8A 4KHAB 5DNNA 1M1AC 1ULYA 3MVDA 3WAAB 5B1MA 1P3GA 4R8PA 1M18A 5AV6D 4XZQD 3MNNC 3AV2D 4H9RA 3AZKB 1P3OD 4KGCB 1F66C 4AWLB 5B40C 3REKA 4QLCA 3O62D 1HTAA 5CP6C 5B24D 3LELC 4CAYA 3KXBB 3X1TA 4J8UA 5B0YB 4Z66D 3NQUB 3AZHC 4CSRA 3AZID 5BS7C 1P34A 1WWIA 4HGAB 1AOIC 4JJNB 3KWQD 2LY8A 3X1UA 3W96C 5BT1D 4Z5TC 1M1AB 3X1VC 4WU9C 4H9QA 3UTBC 3WAAD 1S32A 4J8WC 3MNNB 3AZKD 4KGCD 1P3PC 5GXQA 5B40B 3LELB 1U35A 4G91C 5DNMA 3KXBD 3MGRA 5B0YD 1P3LA 3AZHB 1TZYA 5JA4B 3TU4A 5CPIC 3LZ1C 5AV8B 3VH6T 4JJND 1ZLAB 3W96B 3AZLC 4Z5TB 5BNXA 3C1CA 4WU9B 2NQBB 3A6NC 5F99C 5CPJC 3MGPC 3UTBB 4ZUXA 3W97D 5B33C 4J8WB 5CPKC 1P3PB 5B40D 3LELD 4G91B 1KX3C 1JFIA 4H9NB 5GT0C 3AZHD 1BH9B 2PYOC 2BYKA 1P3AA 1KX4C 5CPIB 3AZGC 3LZ1B 5AV9A 5GSUB 5AV8D 5B2IC 1ZLAD 3W96D 4Z5TD 1P3KA 2NQBD 3A6NB 5F99B 3AZEA 5CPJB 1F1EA 3MGPB 3UTBD 4YS3A 1P3FA 5B33B 1EQZA 4J8WD 4J8VC 5CPKB 1P3PD 3B0CT 1KX5C 3AN2D 3REID 2FJ7B 5GT0B 2PYOB 1KX4B 1KU5A 3AZGB 5CPID 3VH6A 5GSUD 3R45A 5B2IB 5B1LC 2F8NA 1Q9CA 5F99D 5CPJD 3A6ND 3MGPD 4LD9C 4J8VB 5CPKD 3W99A 4M6BA 3AZFB 5AVCC 1KX5B 3AYWA 2F8NG 3WTPC 1P3IA 4X23A 2FJ7D 5GT0D 2PYOD 2F8NK 1KX4D 3AZGD 3MGSA 5B2ID 5B1LB 2NZDA 3REHC 3KSYA 3MGQA 4LD9B 3W98B 4KUDC 3B0CW 5B2JC 3AZJB 4J8VD 3REJB 3AZFD 5AVCB 1KX5D 3WTPB 3KUYC 5GT3C 4YM6B 2YFWB 5AV6A 1BFMA 3AV2A 1P3OA 3AV1D 2CWEA 4Z2MG 4XUJB 4LD9D 3B6FC 3W98D 5B2JB 1TAFB 3AZJD 5B32C 5BO0A 2HUEC 3REJD 3UT9A 1H3OA 5AVCD 3LJAC 5AVBC 3WTPD 3V9RB 5DNNC 4KHAA 5AY8C 3KUYB 5B32G 3AZMA 3X1SC 3MVDC 1HQ3D 4YM6D 4R8PC 2CV5B 4E44A 1M18C 3AZKA 3REKC 5FUGA 3X1TC 3KXBA 1P3MC 5B0YA 2JSSA 4XUJD 3B6FB 5B2JD 4WNNB 1N1JB 1P3BD 2HUEB 1P34C 4H9PB 4H9SC 5AVBB 3NQJA 5B31A 4JJNA 5DNNB 3KUYD 3X1UC 5B0ZC 2IO5C 3X1SB 3VH5W 3W97A 1S32C 4R8PB 1M18B 2CV5D 1F66B 5B31G 5CP6B 3LELA 3X1TB 1U35C 4WU8C 4CAYB 5DNMC 3MGRC 1P3MB 3C1BC 3B6FD 3B6GA 4CSRB 2YFVA 1TZYC 5BS7A 5JA4A 3TU4C 5C3IC 1P34B 1AOIB 4NE6A 5AV8A 5DNND 1ZLAA 3W96A 3X1UB 4Z5TA 5B0ZB 2IO5B 3C1CC 3X1VB 1M1AD 3X1SD 2NQBA 4H9QB 3UTBA 1S32B 4J8WA 3MNND 1F66D 1P3PA 5CP6D 1U35B 4WU8B 3X1TD 5DNMB 3MGRB 1P3MD 3AN2A 4H9OA 3REIA 3C1BB 1BH9A 1TZYB 3TU4B 5C3IB 3AZNA 3AFAA 5AV9C 1AOID 5GSUA 3AZLB 3X1UD 4WU9D 5BNXB 5B0ZD 3C1CB 3X1VD 1P3KC 3A6NA 5CPJA 3AZEC 3MGPA 4YS3C 1S32D 2BYMB 1KX3B 5AV5C 1U35D 4WU8D 5DNMD 3C1BD 2FJ7A 2PYOA 1TZYD 3TU4D 1KX4A 3LZ1D 5G49B 5AV9B 3WA9A 3AZLD 5E5AC 1P3KB 3C1CD 5B33D 4G92C 3UTAC 3AZFA 1KX3D 5AV5B 1KX5A 3LZ0A 3AYWC 1A7WA 4E45A 4NE3A 3RELA 1ID3A 5AV9D 5JRGC 3AV1A 3WKJC 4UUZB 2F8NH 5E5AB 2NZDC 2RVQC 1P3KD 1M19A 2F8NB 4G92B 3W98A 3AZJA 3REJA 3UTAB 5AVCA 5AV5D 5KDMB 3AYWB 3WTPA 5BNVB 1BH8B 1B6WA 1HQ3A 4YM6A 2YFWA 4XZQA 5JRGB 5AV6C 3VH5T 3WKJB 3AV2C 5B1LD 3O62A 5B24A 5E5AD 3REHB 2NZDB 2F8ND 4Z66A 4XUJA 4KUDB 4DRAA 3AZIA 5B2JA 4J8XC 1TAFA 1P3BA 2AROC 3UTAD 3UT9C 1R4VA 3KWQA 2HIOC 3V9RA 5GT3B 5BT1C 4Z2MH 3AZMC 3WAAA 1WWSA 5B1MC 1P3GC 5JRGD 5AV6B 2CV5A 4KGCA 3WKJD 4AWLC 4QLCC 3REHD 4WZSB 2NZDD 2RVQD 4J8UC 3KXBC 3NQUA 4KUDD 5B32B 4J8XB 1N1JA 2AROB 3LJAB 3UT9B 4H9PA 2HIOB 5AY8B 5B31C 5GT3D 1M1AA 3X1SA 3MVDB 3AZMB 5B1MB 3W97C 1P3GB 3VH5A 3MNNA 4H9RB 1F66A 5GXQC 5B40A 3REKB 4QLCB 5CP6A 5FUGB 4J8UB 1P3MA 1P3LC 3AZHA 5B32D 4J8XD 3B6GC 2AROD 3LJAD 1AOIA 3UT9D 5AVBD 4H9SA 5AV8C 2HIOD 3NQJB 5AY8D 5B31B 3WTPE 3X1VA 4WU9A 1ZLAC 5B0ZA 2NQBC 3MVDD 3AZMD 5B1MD 4ZUXC 3W97B 4ZBJC 1P3GD 4R8PD 1M18D 5GXQB 3REKD 4QLCD 4WU8A 4H9NA 4J8UD 1P3LB 3AN2C 3C1BA 3REIC 3B6GB 2YFVB 1P3AC 5CPIA 1P34D 3LZ1A 3AZNC 3AFAC 5GSUC 5B31D 3AZLA 5CHLB 5F99A 1P3FC 4ZUXB 5B33A 1EQZC 4ZBJB 5CPKA 2BYMA 5GXQD 1KX3A 1JFIB 3MGRD 3AN2B 4H9OB 3REIB 1P3LD 5GT0A 2FJ7C 3B6GD 2BYKB 1P3AB 3AZGA 3AZNB 5G49A 3AFAB 1B67A 5B2IA 3WA9C 3AZEB 1P3FB 4YS3B 1EQZB 4ZUXD 4J8VA 3B0DC 3W99C
chains in the Genus database with same CATH superfamily
3AZFC 5AV5A 3LZ0C 1P3IC 4X23C 1P3AD 3VH6W 3MGSC 3RELC 3AZND 3AFAD 1PZRA 1ID3C 3AV1C 3R45B 3WA9B 4UUZA 5B1LA 5E5AA 3AZED 1P3FD 3MGQC 4YS3D 1M19C 4LD9A 1EQZD 4WV4B 3W98C 3AZJC 3B0DB 3W99B 2DQNC 3REJC 3UTAA 3F6TA 5KDMA 3LZ0B 1P3IB 4X23B 2Y2LA 3MGSB 5BNVA 1BH8A 3RELB 1HQ3C 4YM6C 4XZQC 5JRGA 4DRBA 1P3OC 1ID3B 3WKJA 2L5AA 3AV1B 2Y2QA 1Z2CB 3WA9D 3O62C 3REHA 5B24C 2XD1A 1M19B 4NE5A 3MGQB 4Z66C 4EO5C 4XUJC 4NFTA 4KUDA 3AZIC 3W99D 1P3BC 3AYWD 3LZ0D 3KWQC 1P3ID 3KUYA 5GT3A 4X23D 3WAAC 3B0BA 3MGSD 3RELD 1HQ3B 4XZQB 3AV2B 1P3OB 1ID3D 2CV5C 3AZKC 4KGCC 3O62B 5B24B 1M19D 5B0YC 3MGQD 4Z66B 4EO5B 3B6FA 3AZIB 4WNNA 5B32A 4J8XA 5BO0B 1P3BB 2AROA 1H3OB 3LJAA 4HGAC 5AVBA 3KWQB 4JJNC 2HIOA 5AY8A 4KHAB 5DNNA 1M1AC 1ULYA 3MVDA 3WAAB 5B1MA 1P3GA 4R8PA 1M18A 5AV6D 4XZQD 3MNNC 3AV2D 4H9RA 3AZKB 1P3OD 4KGCB 1F66C 4AWLB 5B40C 3REKA 4QLCA 3O62D 1HTAA 5CP6C 5B24D 1T3UA 4CAYA 3KXBB 3LELC 4J8UA 5B0YB 4Z66D 3NQUB 3AZHC 4CSRA 3AZID 5BS7C 1P34A 1WWIA 4HGAB 1AOIC 4JJNB 2JE5A 2LY8A 3KWQD 3X1UA 3W96C 5BT1D 4Z5TC 1M1AB 3X1VC 4WU9C 4H9QA 3UTBC 3WAAD 3P5JB 1S32A 4J8WC 2J8PA 3MNNB 3AZKD 4KGCD 1P3PC 5GXQA 5B40B 3LELB 1U35A 4G91C 5DNMA 3KXBD 3MGRA 5B0YD 1P3LA 3AZHB 1TZYA 5JA4B 3TU4A 5CPIC 3LZ1C 2Y2GA 5AV8B 3VH6T 4JJND 1ZLAB 3W96B 3AZLC 4Z5TB 5BNXA 3C1CA 4WU9B 2NQBB 3EPJA 3A6NC 5F99C 5CPJC 3MGPC 3UTBB 4ZUXA 3W97D 5B33C 4J8WB 3X1TA 5CPKC 1P3PB 5B40D 3LELD 4G91B 1KX3C 1JFIA 4H9NB 5GT0C 3AZHD 1BH9B 2PYOC 2BYKA 1P3AA 1KX4C 5CPIB 3AZGC 3LZ1B 5AV9A 3FDDA 5GSUB 5AV8D 2UWXA 5B2IC 1ZLAD 3W96D 4Z5TD 1P3KA 2RIQA 3A6NB 5F99B 3AZEA 5CPJB 1F1EA 3MGPB 3UTBD 4YS3A 1P3FA 5B33B 1EQZA 2Y2OA 4J8WD 4J8VC 5CPKB 2FFFB 1P3PD 3B0CT 1KX5C 3AN2D 3REID 2Y2NA 2FJ7B 5GT0B 2PYOB 1KX4B 1KU5A 3AZGB 5CPID 2NQBD 3VH6A 5GSUD 3R45A 5B2IB 5B1LC 4WJ3C 2F8NA 1Q9CA 5F99D 5CPJD 3A6ND 3MGPD 4LD9C 4J8VB 5CPKD 3EG5B 3W99A 4M6BA 3AZFB 5AVCC 1KX5B 3AYWA 2F8NG 3WTPC 1P3IA 4X23A 2FJ7D 5GT0D 2PYOD 2F8NK 1KX4D 3AZGD 3MGSA 1W2EA 2G5HC 5B2ID 5B1LB 2NZDA 3REHC 3KSYA 3MGQA 4LD9B 3W98B 4KUDC 3B0CW 5B2JC 3AZJB 3EPLA 4J8VD 3REJB 3AZFD 5AVCB 2BG1A 1KX5D 3WTPB 3KUYC 5GT3C 3EPHA 2DF4C 4YM6B 2YFWB 5AV6A 1BFMA 3AV2A 1P3OA 3AV1D 2CWEA 4Z2MG 4XUJB 4LD9D 3B6FC 3W98D 5B2JB 1TAFB 3AZJD 5B32C 5BO0A 2HUEC 3REJD 3UT9A 1H3OA 5AVCD 3LJAC 5AVBC 3WTPD 3V9RB 5DNNC 4KHAA 5AY8C 3KUYB 5B32G 3AZMA 3X1SC 3MVDC 1HQ3D 4YM6D 4R8PC 2CV5B 4E44A 1M18C 2Y2MA 3AZKA 2JCHA 3REKC 5FUGA 3X1TC 3KXBA 1P3MC 2JSSA 5B0YA 4XUJD 3B6FB 5B2JD 4WNNB 1N1JB 1P3BD 2F2AC 2HUEB 1P34C 4H9PB 4H9SC 5AVBB 3NQJA 5B31A 4JJNA 5DNNB 3KUYD 3X1UC 5B0ZC 2IO5C 2ZY3A 3X1SB 3VH5W 3W97A 1S32C 4R8PB 1M18B 2CV5D 1F66B 5B31G 5CP6B 3LELA 3X1TB 1U35C 4WU8C 4CAYB 5DNMC 3MGRC 1P3MB 3C1BC 3B6FD 3B6GA 4CSRB 2YFVA 1TZYC 5BS7A 5JA4A 3TU4C 5C3IC 1P34B 4UPKA 1AOIB 4NE6A 5AV8A 3H0RC 5DNND 1ZLAA 3W96A 3X1UB 4Z5TA 5B0ZB 2IO5B 3C1CC 3X1VB 1M1AD 3X1SD 2NQBA 4H9QB 3UTBA 1S32B 4J8WA 3MNND 1F66D 1P3PA 2W8SA 5CP6D 1U35B 4WU8B 3X1TD 5DNMB 3MGRB 1P3MD 3AN2A 4H9OA 3REIA 3C1BB 1BH9A 1TZYB 3TU4B 5C3IB 3AZNA 3AFAA 5AV9C 1AOID 5GSUA 3AZLB 3X1UD 4WU9D 5BNXB 5B0ZD 3C1CB 3X1VD 1P3KC 2VQRA 2Y2JA 3A6NA 3AZEC 3MGPA 5CPJA 4YS3C 1S32D 3EPKA 2BYMB 1KX3B 5AV5C 1U35D 2G5IC 4WU8D 5DNMD 3C1BD 2FJ7A 2PYOA 1TZYD 3TU4D 1KX4A 3LZ1D 5G49B 5AV9B 3WA9A 3AZLD 5E5AC 1P3KB 3C1CD 5B33D 4G92C 2Y2PA 3UTAC 3AZFA 1KX3D 5AV5B 1KX5A 3LZ0A 3AYWC 1A7WA 4E45A 4NE3A 3RELA 1ID3A 5AV9D 5JRGC 3AV1A 3WKJC 4UUZB 2F8NH 5E5AB 2NZDC 2RVQC 1P3KD 2ZY4A 1M19A 2F8NB 2XD5A 4G92B 3W98A 3AZJA 3REJA 3UTAB 5AVCA 5AV5D 5KDMB 3AYWB 3WTPA 5BNVB 1BH8B 1B6WA 1HQ3A 4YM6A 2YFWA 4XZQA 5JRGB 2ZY2A 3VH5T 5AV6C 3AV2C 3WKJB 3H0LC 5B1LD 3O62A 5B24A 5E5AD 3REHB 2NZDB 2F8ND 4Z66A 4XUJA 4KUDB 4DRAA 3AZIA 5B2JA 4J8XC 1TAFA 1P3BA 2AROC 3UTAD 3UT9C 1R4VA 3KWQA 3H0MC 2HIOC 3V9RA 5GT3B 5BT1C 4Z2MH 2Y2KA 3AZMC 3WAAA 1WWSA 5B1MC 1P3GC 5JRGD 5AV6B 2CV5A 4KGCA 3WKJD 4AWLC 4QLCC 3REHD 4WZSB 2NZDD 2RVQD 4J8UC 3A1KA 3KXBC 3NQUA 4KUDD 5B32B 4J8XB 1N1JA 2AROB 3LJAB 3UT9B 4H9PA 2HIOB 5AY8B 5B31C 5GT3D 1M1AA 3X1SA 3MVDB 4DQYB 5B1MB 3AZMB 3W97C 1P3GB 3VH5A 3MNNA 4H9RB 1F66A 5GXQC 5B40A 3REKB 4QLCB 5CP6A 5FUGB 4J8UB 2ZY5A 2Y2HA 1P3MA 1P3LC 3AZHA 5B32D 4J8XD 3B6GC 2AROD 3LJAD 1AOIA 3UT9D 5AVBD 4H9SA 5AV8C 2HIOD 3NQJB 5AY8D 5B31B 3WTPE 3X1VA 4WU9A 1ZLAC 5B0ZA 3AL0C 2NQBC 3MVDD 3AZMD 5B1MD 4ZUXC 3W97B 4ZBJC 2Y2IA 1P3GD 4R8PD 1M18D 5GXQB 3REKD 4QLCD 4WU8A 4H9NA 4J8UD 1P3LB 3AN2C 3C1BA 3REIC 3IP4C 3B6GB 2YFVB 1P3AC 5CPIA 1P34D 3LZ1A 3AZNC 3AFAC 5GSUC 5B31D 3AZLA 2ZM5A 5CHLB 5F99A 1P3FC 4ZUXB 5B33A 1EQZC 4ZBJB 5CPKA 2BYMA 5GXQD 3A1IA 1KX3A 1JFIB 3MGRD 3AN2B 4H9OB 3REIB 1P3LD 5GT0A 2FJ7C 3B6GD 2BYKB 1P3AB 3AZGA 3AZNB 5G49A 3AFAB 1B67A 5B2IA 3WA9C 3AZEB 1P3FB 4YS3B 1EQZB 4ZUXD 4J8VA 3KFUG 3B0DC 3W99C
chains in the Genus database with same CATH topology
3AZFC 5AV5A 3LZ0C 1P3IC 4X23C 1P3AD 3VH6W 3MGSC 3RELC 3AZND 3AFAD 1PZRA 1ID3C 3AV1C 3R45B 3WA9B 4UUZA 5B1LA 5E5AA 3AZED 1P3FD 3MGQC 4YS3D 1M19C 4LD9A 1EQZD 4WV4B 3W98C 3AZJC 3B0DB 3W99B 2DQNC 3REJC 3UTAA 3F6TA 5KDMA 3LZ0B 1P3IB 4X23B 2Y2LA 3MGSB 5BNVA 1BH8A 3RELB 1HQ3C 4YM6C 4XZQC 5JRGA 4DRBA 1P3OC 1ID3B 3WKJA 2L5AA 3AV1B 2Y2QA 1Z2CB 3WA9D 3O62C 3REHA 5B24C 2XD1A 1M19B 4NE5A 3MGQB 4Z66C 4EO5C 4XUJC 4NFTA 4KUDA 3AZIC 3W99D 1P3BC 3AYWD 3LZ0D 3KWQC 1P3ID 3KUYA 5GT3A 4X23D 3WAAC 3B0BA 3MGSD 3RELD 1HQ3B 4XZQB 3AV2B 1P3OB 1ID3D 2CV5C 3AZKC 4KGCC 3O62B 5B24B 1M19D 5B0YC 3MGQD 4Z66B 4EO5B 3B6FA 3AZIB 4WNNA 5B32A 4J8XA 5BO0B 1P3BB 2AROA 1H3OB 3LJAA 4HGAC 5AVBA 3KWQB 4JJNC 2HIOA 5AY8A 4KHAB 5DNNA 1M1AC 1ULYA 3MVDA 3WAAB 5B1MA 1P3GA 4R8PA 1M18A 5AV6D 4XZQD 3MNNC 3AV2D 4H9RA 3AZKB 1P3OD 4KGCB 1F66C 4AWLB 5B40C 3REKA 4QLCA 3O62D 1HTAA 5CP6C 5B24D 1T3UA 4CAYA 3KXBB 3LELC 4J8UA 5B0YB 4Z66D 3NQUB 3AZHC 4CSRA 3AZID 5BS7C 1P34A 1WWIA 4HGAB 1AOIC 4JJNB 2JE5A 2LY8A 3KWQD 3X1UA 3W96C 5BT1D 4Z5TC 1M1AB 3X1VC 4WU9C 4H9QA 3UTBC 3WAAD 3P5JB 1S32A 4J8WC 2J8PA 3MNNB 3AZKD 4KGCD 1P3PC 5GXQA 5B40B 3LELB 1U35A 4G91C 5DNMA 3KXBD 3MGRA 5B0YD 1P3LA 3AZHB 1TZYA 5JA4B 3TU4A 5CPIC 3LZ1C 2Y2GA 5AV8B 3VH6T 4JJND 1ZLAB 3W96B 3AZLC 4Z5TB 5BNXA 3C1CA 4WU9B 2NQBB 3EPJA 3A6NC 5F99C 5CPJC 3MGPC 3UTBB 4ZUXA 3W97D 5B33C 4J8WB 3X1TA 5CPKC 1P3PB 5B40D 3LELD 4G91B 1KX3C 1JFIA 4H9NB 5GT0C 3AZHD 1BH9B 2PYOC 2BYKA 1P3AA 1KX4C 5CPIB 3AZGC 3LZ1B 5AV9A 3FDDA 5GSUB 5AV8D 2UWXA 5B2IC 1ZLAD 3W96D 4Z5TD 1P3KA 2RIQA 3A6NB 5F99B 3AZEA 5CPJB 1F1EA 3MGPB 3UTBD 4YS3A 1P3FA 5B33B 1EQZA 2Y2OA 4J8WD 4J8VC 5CPKB 2FFFB 1P3PD 3B0CT 1KX5C 3AN2D 3REID 2Y2NA 2FJ7B 5GT0B 2PYOB 1KX4B 1KU5A 3AZGB 5CPID 2NQBD 3VH6A 5GSUD 3R45A 5B2IB 5B1LC 4WJ3C 2F8NA 1Q9CA 5F99D 5CPJD 3A6ND 3MGPD 4LD9C 4J8VB 5CPKD 3EG5B 3W99A 4M6BA 3AZFB 5AVCC 1KX5B 3AYWA 2F8NG 3WTPC 1P3IA 4X23A 2FJ7D 5GT0D 2PYOD 2F8NK 1KX4D 3AZGD 3MGSA 1W2EA 2G5HC 5B2ID 5B1LB 2NZDA 3REHC 3KSYA 3MGQA 4LD9B 3W98B 4KUDC 3B0CW 5B2JC 3AZJB 3EPLA 4J8VD 3REJB 3AZFD 5AVCB 2BG1A 1KX5D 3WTPB 3KUYC 5GT3C 3EPHA 2DF4C 4YM6B 2YFWB 5AV6A 1BFMA 3AV2A 1P3OA 3AV1D 2CWEA 4Z2MG 4XUJB 4LD9D 3B6FC 3W98D 5B2JB 1TAFB 3AZJD 5B32C 5BO0A 2HUEC 3REJD 3UT9A 1H3OA 5AVCD 3LJAC 5AVBC 3WTPD 3V9RB 5DNNC 4KHAA 5AY8C 3KUYB 5B32G 3AZMA 3X1SC 3MVDC 1HQ3D 4YM6D 4R8PC 2CV5B 4E44A 1M18C 2Y2MA 3AZKA 2JCHA 3REKC 5FUGA 3X1TC 3KXBA 1P3MC 2JSSA 5B0YA 4XUJD 3B6FB 5B2JD 4WNNB 1N1JB 1P3BD 2F2AC 2HUEB 1P34C 4H9PB 4H9SC 5AVBB 3NQJA 5B31A 4JJNA 5DNNB 3KUYD 3X1UC 5B0ZC 2IO5C 2ZY3A 3X1SB 3VH5W 3W97A 1S32C 4R8PB 1M18B 2CV5D 1F66B 5B31G 5CP6B 3LELA 3X1TB 1U35C 4WU8C 4CAYB 5DNMC 3MGRC 1P3MB 3C1BC 3B6FD 3B6GA 4CSRB 2YFVA 1TZYC 5BS7A 5JA4A 3TU4C 5C3IC 1P34B 4UPKA 1AOIB 4NE6A 5AV8A 3H0RC 5DNND 1ZLAA 3W96A 3X1UB 4Z5TA 5B0ZB 2IO5B 3C1CC 3X1VB 1M1AD 3X1SD 2NQBA 4H9QB 3UTBA 1S32B 4J8WA 3MNND 1F66D 1P3PA 2W8SA 5CP6D 1U35B 4WU8B 3X1TD 5DNMB 3MGRB 1P3MD 3AN2A 4H9OA 3REIA 3C1BB 1BH9A 1TZYB 3TU4B 5C3IB 3AZNA 3AFAA 5AV9C 1AOID 5GSUA 3AZLB 3X1UD 4WU9D 5BNXB 5B0ZD 3C1CB 3X1VD 1P3KC 2VQRA 2Y2JA 3A6NA 3AZEC 3MGPA 5CPJA 4YS3C 1S32D 3EPKA 2BYMB 1KX3B 5AV5C 1U35D 2G5IC 4WU8D 5DNMD 3C1BD 2FJ7A 2PYOA 1TZYD 3TU4D 1KX4A 3LZ1D 5G49B 5AV9B 3WA9A 3AZLD 5E5AC 1P3KB 3C1CD 5B33D 4G92C 2Y2PA 3UTAC 3AZFA 1KX3D 5AV5B 1KX5A 3LZ0A 3AYWC 1A7WA 4E45A 4NE3A 3RELA 1ID3A 5AV9D 5JRGC 3AV1A 3WKJC 4UUZB 2F8NH 5E5AB 2NZDC 2RVQC 1P3KD 2ZY4A 1M19A 2F8NB 2XD5A 4G92B 3W98A 3AZJA 3REJA 3UTAB 5AVCA 5AV5D 5KDMB 3AYWB 3WTPA 5BNVB 1BH8B 1B6WA 1HQ3A 4YM6A 2YFWA 4XZQA 5JRGB 2ZY2A 3VH5T 5AV6C 3AV2C 3WKJB 3H0LC 5B1LD 3O62A 5B24A 5E5AD 3REHB 2NZDB 2F8ND 4Z66A 4XUJA 4KUDB 4DRAA 3AZIA 5B2JA 4J8XC 1TAFA 1P3BA 2AROC 3UTAD 3UT9C 1R4VA 3KWQA 3H0MC 2HIOC 3V9RA 5GT3B 5BT1C 4Z2MH 2Y2KA 3AZMC 3WAAA 1WWSA 5B1MC 1P3GC 5JRGD 5AV6B 2CV5A 4KGCA 3WKJD 4AWLC 4QLCC 3REHD 4WZSB 2NZDD 2RVQD 4J8UC 3A1KA 3KXBC 3NQUA 4KUDD 5B32B 4J8XB 1N1JA 2AROB 3LJAB 3UT9B 4H9PA 2HIOB 5AY8B 5B31C 5GT3D 1M1AA 3X1SA 3MVDB 4DQYB 5B1MB 3AZMB 3W97C 1P3GB 3VH5A 3MNNA 4H9RB 1F66A 5GXQC 5B40A 3REKB 4QLCB 5CP6A 5FUGB 4J8UB 2ZY5A 2Y2HA 1P3MA 1P3LC 3AZHA 5B32D 4J8XD 3B6GC 2AROD 3LJAD 1AOIA 3UT9D 5AVBD 4H9SA 5AV8C 2HIOD 3NQJB 5AY8D 5B31B 3WTPE 3X1VA 4WU9A 1ZLAC 5B0ZA 3AL0C 2NQBC 3MVDD 3AZMD 5B1MD 4ZUXC 3W97B 4ZBJC 2Y2IA 1P3GD 4R8PD 1M18D 5GXQB 3REKD 4QLCD 4WU8A 4H9NA 4J8UD 1P3LB 3AN2C 3C1BA 3REIC 3IP4C 3B6GB 2YFVB 1P3AC 5CPIA 1P34D 3LZ1A 3AZNC 3AFAC 5GSUC 5B31D 3AZLA 2ZM5A 5CHLB 5F99A 1P3FC 4ZUXB 5B33A 1EQZC 4ZBJB 5CPKA 2BYMA 5GXQD 3A1IA 1KX3A 1JFIB 3MGRD 3AN2B 4H9OB 3REIB 1P3LD 5GT0A 2FJ7C 3B6GD 2BYKB 1P3AB 3AZGA 3AZNB 5G49A 3AFAB 1B67A 5B2IA 3WA9C 3AZEB 1P3FB 4YS3B 1EQZB 4ZUXD 4J8VA 3KFUG 3B0DC 3W99C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZF C;  5AV5 A;  3LZ0 C;  1P3I C;  4X23 C;  1P3A D;  3VH6 W;  3MGS C;  3REL C;  3AZN D;  3AFA D;  1ID3 C;  3AV1 C;  3R45 B;  3WA9 B;  4UUZ A;  5B1L A;  5E5A A;  3AZE D;  1P3F D;  3MGQ C;  4YS3 D;  1M19 C;  4LD9 A;  1EQZ D;  4WV4 B;  3W98 C;  3AZJ C;  3B0D B;  3W99 B;  3REJ C;  3UTA A;  5KDM A;  3LZ0 B;  1P3I B;  4X23 B;  3MGS B;  5BNV A;  1BH8 A;  3REL B;  1HQ3 C;  4YM6 C;  4XZQ C;  5JRG A;  4DRB A;  1P3O C;  1ID3 B;  3WKJ A;  2L5A A;  3AV1 B;  3WA9 D;  3O62 C;  3REH A;  5B24 C;  1M19 B;  4NE5 A;  3MGQ B;  4Z66 C;  4EO5 C;  4XUJ C;  4NFT A;  4KUD A;  3AZI C;  3W99 D;  1P3B C;  3AYW D;  3LZ0 D;  3KWQ C;  1P3I D;  3KUY A;  5GT3 A;  4X23 D;  3WAA C;  3B0B A;  3MGS D;  3REL D;  1HQ3 B;  4XZQ B;  3AV2 B;  1P3O B;  1ID3 D;  2CV5 C;  3AZK C;  4KGC C;  3O62 B;  5B24 B;  1M19 D;  5B0Y C;  3MGQ D;  4Z66 B;  4EO5 B;  3B6F A;  3AZI B;  4WNN A;  5B32 A;  4J8X A;  5BO0 B;  1P3B B;  2ARO A;  1H3O B;  3LJA A;  4HGA C;  5AVB A;  3KWQ B;  4JJN C;  2HIO A;  5AY8 A;  4KHA B;  5DNN A;  1M1A C;  1ULY A;  3MVD A;  3WAA B;  5B1M A;  1P3G A;  4R8P A;  1M18 A;  5AV6 D;  4XZQ D;  3MNN C;  3AV2 D;  4H9R A;  3AZK B;  1P3O D;  4KGC B;  1F66 C;  4AWL B;  5B40 C;  3REK A;  4QLC A;  3O62 D;  1HTA A;  5CP6 C;  5B24 D;  3LEL C;  4CAY A;  3KXB B;  3X1T A;  4J8U A;  5B0Y B;  4Z66 D;  3NQU B;  3AZH C;  4CSR A;  3AZI D;  5BS7 C;  1P34 A;  1WWI A;  4HGA B;  1AOI C;  4JJN B;  3KWQ D;  2LY8 A;  3X1U A;  3W96 C;  5BT1 D;  4Z5T C;  1M1A B;  3X1V C;  4WU9 C;  4H9Q A;  3UTB C;  3WAA D;  1S32 A;  4J8W C;  3MNN B;  3AZK D;  4KGC D;  1P3P C;  5GXQ A;  5B40 B;  3LEL B;  1U35 A;  4G91 C;  5DNM A;  3KXB D;  3MGR A;  5B0Y D;  1P3L A;  3AZH B;  1TZY A;  5JA4 B;  3TU4 A;  5CPI C;  3LZ1 C;  5AV8 B;  3VH6 T;  4JJN D;  1ZLA B;  3W96 B;  3AZL C;  4Z5T B;  5BNX A;  3C1C A;  4WU9 B;  2NQB B;  3A6N C;  5F99 C;  5CPJ C;  3MGP C;  3UTB B;  4ZUX A;  3W97 D;  5B33 C;  4J8W B;  5CPK C;  1P3P B;  5B40 D;  3LEL D;  4G91 B;  1KX3 C;  1JFI A;  4H9N B;  5GT0 C;  3AZH D;  1BH9 B;  2PYO C;  2BYK A;  1P3A A;  1KX4 C;  5CPI B;  3AZG C;  3LZ1 B;  5AV9 A;  5GSU B;  5AV8 D;  5B2I C;  1ZLA D;  3W96 D;  4Z5T D;  1P3K A;  2NQB D;  3A6N B;  5F99 B;  3AZE A;  5CPJ B;  1F1E A;  3MGP B;  3UTB D;  4YS3 A;  1P3F A;  5B33 B;  1EQZ A;  4J8W D;  4J8V C;  5CPK B;  1P3P D;  3B0C T;  1KX5 C;  3AN2 D;  3REI D;  2FJ7 B;  5GT0 B;  2PYO B;  1KX4 B;  1KU5 A;  3AZG B;  5CPI D;  3VH6 A;  5GSU D;  3R45 A;  5B2I B;  5B1L C;  2F8N A;  1Q9C A;  5F99 D;  5CPJ D;  3A6N D;  3MGP D;  4LD9 C;  4J8V B;  5CPK D;  3W99 A;  4M6B A;  3AZF B;  5AVC C;  1KX5 B;  3AYW A;  2F8N G;  3WTP C;  1P3I A;  4X23 A;  2FJ7 D;  5GT0 D;  2PYO D;  2F8N K;  1KX4 D;  3AZG D;  3MGS A;  5B2I D;  5B1L B;  2NZD A;  3REH C;  3KSY A;  3MGQ A;  4LD9 B;  3W98 B;  4KUD C;  3B0C W;  5B2J C;  3AZJ B;  4J8V D;  3REJ B;  3AZF D;  5AVC B;  1KX5 D;  3WTP B;  3KUY C;  5GT3 C;  4YM6 B;  2YFW B;  5AV6 A;  1BFM A;  3AV2 A;  1P3O A;  3AV1 D;  2CWE A;  4Z2M G;  4XUJ B;  4LD9 D;  3B6F C;  3W98 D;  5B2J B;  1TAF B;  3AZJ D;  5B32 C;  5BO0 A;  2HUE C;  3REJ D;  3UT9 A;  1H3O A;  5AVC D;  3LJA C;  5AVB C;  3WTP D;  3V9R B;  5DNN C;  4KHA A;  5AY8 C;  3KUY B;  5B32 G;  3AZM A;  3X1S C;  3MVD C;  1HQ3 D;  4YM6 D;  4R8P C;  2CV5 B;  4E44 A;  1M18 C;  3AZK A;  3REK C;  5FUG A;  3X1T C;  3KXB A;  1P3M C;  5B0Y A;  2JSS A;  4XUJ D;  3B6F B;  5B2J D;  4WNN B;  1N1J B;  1P3B D;  2HUE B;  1P34 C;  4H9P B;  4H9S C;  5AVB B;  3NQJ A;  5B31 A;  4JJN A;  5DNN B;  3KUY D;  3X1U C;  5B0Z C;  2IO5 C;  3X1S B;  3VH5 W;  3W97 A;  1S32 C;  4R8P B;  1M18 B;  2CV5 D;  1F66 B;  5B31 G;  5CP6 B;  3LEL A;  3X1T B;  1U35 C;  4WU8 C;  4CAY B;  5DNM C;  3MGR C;  1P3M B;  3C1B C;  3B6F D;  3B6G A;  4CSR B;  2YFV A;  1TZY C;  5BS7 A;  5JA4 A;  3TU4 C;  5C3I C;  1P34 B;  1AOI B;  4NE6 A;  5AV8 A;  5DNN D;  1ZLA A;  3W96 A;  3X1U B;  4Z5T A;  5B0Z B;  2IO5 B;  3C1C C;  3X1V B;  1M1A D;  3X1S D;  2NQB A;  4H9Q B;  3UTB A;  1S32 B;  4J8W A;  3MNN D;  1F66 D;  1P3P A;  5CP6 D;  1U35 B;  4WU8 B;  3X1T D;  5DNM B;  3MGR B;  1P3M D;  3AN2 A;  4H9O A;  3REI A;  3C1B B;  1BH9 A;  1TZY B;  3TU4 B;  5C3I B;  3AZN A;  3AFA A;  5AV9 C;  1AOI D;  5GSU A;  3AZL B;  3X1U D;  4WU9 D;  5BNX B;  5B0Z D;  3C1C B;  3X1V D;  1P3K C;  3A6N A;  5CPJ A;  3AZE C;  3MGP A;  4YS3 C;  1S32 D;  2BYM B;  1KX3 B;  5AV5 C;  1U35 D;  4WU8 D;  5DNM D;  3C1B D;  2FJ7 A;  2PYO A;  1TZY D;  3TU4 D;  1KX4 A;  3LZ1 D;  5G49 B;  5AV9 B;  3WA9 A;  3AZL D;  5E5A C;  1P3K B;  3C1C D;  5B33 D;  4G92 C;  3UTA C;  3AZF A;  1KX3 D;  5AV5 B;  1KX5 A;  3LZ0 A;  3AYW C;  1A7W A;  4E45 A;  4NE3 A;  3REL A;  1ID3 A;  5AV9 D;  5JRG C;  3AV1 A;  3WKJ C;  4UUZ B;  2F8N H;  5E5A B;  2NZD C;  2RVQ C;  1P3K D;  1M19 A;  2F8N B;  4G92 B;  3W98 A;  3AZJ A;  3REJ A;  3UTA B;  5AVC A;  5AV5 D;  5KDM B;  3AYW B;  3WTP A;  5BNV B;  1BH8 B;  1B6W A;  1HQ3 A;  4YM6 A;  2YFW A;  4XZQ A;  5JRG B;  5AV6 C;  3VH5 T;  3WKJ B;  3AV2 C;  5B1L D;  3O62 A;  5B24 A;  5E5A D;  3REH B;  2NZD B;  2F8N D;  4Z66 A;  4XUJ A;  4KUD B;  4DRA A;  3AZI A;  5B2J A;  4J8X C;  1TAF A;  1P3B A;  2ARO C;  3UTA D;  3UT9 C;  1R4V A;  3KWQ A;  2HIO C;  3V9R A;  5GT3 B;  5BT1 C;  4Z2M H;  3AZM C;  3WAA A;  1WWS A;  5B1M C;  1P3G C;  5JRG D;  5AV6 B;  2CV5 A;  4KGC A;  3WKJ D;  4AWL C;  4QLC C;  3REH D;  4WZS B;  2NZD D;  2RVQ D;  4J8U C;  3KXB C;  3NQU A;  4KUD D;  5B32 B;  4J8X B;  1N1J A;  2ARO B;  3LJA B;  3UT9 B;  4H9P A;  2HIO B;  5AY8 B;  5B31 C;  5GT3 D;  1M1A A;  3X1S A;  3MVD B;  3AZM B;  5B1M B;  3W97 C;  1P3G B;  3VH5 A;  3MNN A;  4H9R B;  1F66 A;  5GXQ C;  5B40 A;  3REK B;  4QLC B;  5CP6 A;  5FUG B;  4J8U B;  1P3M A;  1P3L C;  3AZH A;  5B32 D;  4J8X D;  3B6G C;  2ARO D;  3LJA D;  1AOI A;  3UT9 D;  5AVB D;  4H9S A;  5AV8 C;  2HIO D;  3NQJ B;  5AY8 D;  5B31 B;  3WTP E;  3X1V A;  4WU9 A;  1ZLA C;  5B0Z A;  2NQB C;  3MVD D;  3AZM D;  5B1M D;  4ZUX C;  3W97 B;  4ZBJ C;  1P3G D;  4R8P D;  1M18 D;  5GXQ B;  3REK D;  4QLC D;  4WU8 A;  4H9N A;  4J8U D;  1P3L B;  3AN2 C;  3C1B A;  3REI C;  3B6G B;  2YFV B;  1P3A C;  5CPI A;  1P34 D;  3LZ1 A;  3AZN C;  3AFA C;  5GSU C;  5B31 D;  3AZL A;  5CHL B;  5F99 A;  1P3F C;  4ZUX B;  5B33 A;  1EQZ C;  4ZBJ B;  5CPK A;  2BYM A;  5GXQ D;  1KX3 A;  1JFI B;  3MGR D;  3AN2 B;  4H9O B;  3REI B;  1P3L D;  5GT0 A;  2FJ7 C;  3B6G D;  2BYK B;  1P3A B;  3AZG A;  3AZN B;  5G49 A;  3AFA B;  1B67 A;  5B2I A;  3WA9 C;  3AZE B;  1P3F B;  4YS3 B;  1EQZ B;  4ZUX D;  4J8V A;  3B0D C;  3W99 C; 
#chains in the Genus database with same CATH topology
 3AZF C;  5AV5 A;  3LZ0 C;  1P3I C;  4X23 C;  1P3A D;  3VH6 W;  3MGS C;  3REL C;  3AZN D;  3AFA D;  1PZR A;  1ID3 C;  3AV1 C;  3R45 B;  3WA9 B;  4UUZ A;  5B1L A;  5E5A A;  3AZE D;  1P3F D;  3MGQ C;  4YS3 D;  1M19 C;  4LD9 A;  1EQZ D;  4WV4 B;  3W98 C;  3AZJ C;  3B0D B;  3W99 B;  2DQN C;  3REJ C;  3UTA A;  3F6T A;  5KDM A;  3LZ0 B;  1P3I B;  4X23 B;  2Y2L A;  3MGS B;  5BNV A;  1BH8 A;  3REL B;  1HQ3 C;  4YM6 C;  4XZQ C;  5JRG A;  4DRB A;  1P3O C;  1ID3 B;  3WKJ A;  2L5A A;  3AV1 B;  2Y2Q A;  1Z2C B;  3WA9 D;  3O62 C;  3REH A;  5B24 C;  2XD1 A;  1M19 B;  4NE5 A;  3MGQ B;  4Z66 C;  4EO5 C;  4XUJ C;  4NFT A;  4KUD A;  3AZI C;  3W99 D;  1P3B C;  3AYW D;  3LZ0 D;  3KWQ C;  1P3I D;  3KUY A;  5GT3 A;  4X23 D;  3WAA C;  3B0B A;  3MGS D;  3REL D;  1HQ3 B;  4XZQ B;  3AV2 B;  1P3O B;  1ID3 D;  2CV5 C;  3AZK C;  4KGC C;  3O62 B;  5B24 B;  1M19 D;  5B0Y C;  3MGQ D;  4Z66 B;  4EO5 B;  3B6F A;  3AZI B;  4WNN A;  5B32 A;  4J8X A;  5BO0 B;  1P3B B;  2ARO A;  1H3O B;  3LJA A;  4HGA C;  5AVB A;  3KWQ B;  4JJN C;  2HIO A;  5AY8 A;  4KHA B;  5DNN A;  1M1A C;  1ULY A;  3MVD A;  3WAA B;  5B1M A;  1P3G A;  4R8P A;  1M18 A;  5AV6 D;  4XZQ D;  3MNN C;  3AV2 D;  4H9R A;  3AZK B;  1P3O D;  4KGC B;  1F66 C;  4AWL B;  5B40 C;  3REK A;  4QLC A;  3O62 D;  1HTA A;  5CP6 C;  5B24 D;  1T3U A;  4CAY A;  3KXB B;  3LEL C;  4J8U A;  5B0Y B;  4Z66 D;  3NQU B;  3AZH C;  4CSR A;  3AZI D;  5BS7 C;  1P34 A;  1WWI A;  4HGA B;  1AOI C;  4JJN B;  2JE5 A;  2LY8 A;  3KWQ D;  3X1U A;  3W96 C;  5BT1 D;  4Z5T C;  1M1A B;  3X1V C;  4WU9 C;  4H9Q A;  3UTB C;  3WAA D;  3P5J B;  1S32 A;  4J8W C;  2J8P A;  3MNN B;  3AZK D;  4KGC D;  1P3P C;  5GXQ A;  5B40 B;  3LEL B;  1U35 A;  4G91 C;  5DNM A;  3KXB D;  3MGR A;  5B0Y D;  1P3L A;  3AZH B;  1TZY A;  5JA4 B;  3TU4 A;  5CPI C;  3LZ1 C;  2Y2G A;  5AV8 B;  3VH6 T;  4JJN D;  1ZLA B;  3W96 B;  3AZL C;  4Z5T B;  5BNX A;  3C1C A;  4WU9 B;  2NQB B;  3EPJ A;  3A6N C;  5F99 C;  5CPJ C;  3MGP C;  3UTB B;  4ZUX A;  3W97 D;  5B33 C;  4J8W B;  3X1T A;  5CPK C;  1P3P B;  5B40 D;  3LEL D;  4G91 B;  1KX3 C;  1JFI A;  4H9N B;  5GT0 C;  3AZH D;  1BH9 B;  2PYO C;  2BYK A;  1P3A A;  1KX4 C;  5CPI B;  3AZG C;  3LZ1 B;  5AV9 A;  3FDD A;  5GSU B;  5AV8 D;  2UWX A;  5B2I C;  1ZLA D;  3W96 D;  4Z5T D;  1P3K A;  2RIQ A;  3A6N B;  5F99 B;  3AZE A;  5CPJ B;  1F1E A;  3MGP B;  3UTB D;  4YS3 A;  1P3F A;  5B33 B;  1EQZ A;  2Y2O A;  4J8W D;  4J8V C;  5CPK B;  2FFF B;  1P3P D;  3B0C T;  1KX5 C;  3AN2 D;  3REI D;  2Y2N A;  2FJ7 B;  5GT0 B;  2PYO B;  1KX4 B;  1KU5 A;  3AZG B;  5CPI D;  2NQB D;  3VH6 A;  5GSU D;  3R45 A;  5B2I B;  5B1L C;  4WJ3 C;  2F8N A;  1Q9C A;  5F99 D;  5CPJ D;  3A6N D;  3MGP D;  4LD9 C;  4J8V B;  5CPK D;  3EG5 B;  3W99 A;  4M6B A;  3AZF B;  5AVC C;  1KX5 B;  3AYW A;  2F8N G;  3WTP C;  1P3I A;  4X23 A;  2FJ7 D;  5GT0 D;  2PYO D;  2F8N K;  1KX4 D;  3AZG D;  3MGS A;  1W2E A;  2G5H C;  5B2I D;  5B1L B;  2NZD A;  3REH C;  3KSY A;  3MGQ A;  4LD9 B;  3W98 B;  4KUD C;  3B0C W;  5B2J C;  3AZJ B;  3EPL A;  4J8V D;  3REJ B;  3AZF D;  5AVC B;  2BG1 A;  1KX5 D;  3WTP B;  3KUY C;  5GT3 C;  3EPH A;  2DF4 C;  4YM6 B;  2YFW B;  5AV6 A;  1BFM A;  3AV2 A;  1P3O A;  3AV1 D;  2CWE A;  4Z2M G;  4XUJ B;  4LD9 D;  3B6F C;  3W98 D;  5B2J B;  1TAF B;  3AZJ D;  5B32 C;  5BO0 A;  2HUE C;  3REJ D;  3UT9 A;  1H3O A;  5AVC D;  3LJA C;  5AVB C;  3WTP D;  3V9R B;  5DNN C;  4KHA A;  5AY8 C;  3KUY B;  5B32 G;  3AZM A;  3X1S C;  3MVD C;  1HQ3 D;  4YM6 D;  4R8P C;  2CV5 B;  4E44 A;  1M18 C;  2Y2M A;  3AZK A;  2JCH A;  3REK C;  5FUG A;  3X1T C;  3KXB A;  1P3M C;  2JSS A;  5B0Y A;  4XUJ D;  3B6F B;  5B2J D;  4WNN B;  1N1J B;  1P3B D;  2F2A C;  2HUE B;  1P34 C;  4H9P B;  4H9S C;  5AVB B;  3NQJ A;  5B31 A;  4JJN A;  5DNN B;  3KUY D;  3X1U C;  5B0Z C;  2IO5 C;  2ZY3 A;  3X1S B;  3VH5 W;  3W97 A;  1S32 C;  4R8P B;  1M18 B;  2CV5 D;  1F66 B;  5B31 G;  5CP6 B;  3LEL A;  3X1T B;  1U35 C;  4WU8 C;  4CAY B;  5DNM C;  3MGR C;  1P3M B;  3C1B C;  3B6F D;  3B6G A;  4CSR B;  2YFV A;  1TZY C;  5BS7 A;  5JA4 A;  3TU4 C;  5C3I C;  1P34 B;  4UPK A;  1AOI B;  4NE6 A;  5AV8 A;  3H0R C;  5DNN D;  1ZLA A;  3W96 A;  3X1U B;  4Z5T A;  5B0Z B;  2IO5 B;  3C1C C;  3X1V B;  1M1A D;  3X1S D;  2NQB A;  4H9Q B;  3UTB A;  1S32 B;  4J8W A;  3MNN D;  1F66 D;  1P3P A;  2W8S A;  5CP6 D;  1U35 B;  4WU8 B;  3X1T D;  5DNM B;  3MGR B;  1P3M D;  3AN2 A;  4H9O A;  3REI A;  3C1B B;  1BH9 A;  1TZY B;  3TU4 B;  5C3I B;  3AZN A;  3AFA A;  5AV9 C;  1AOI D;  5GSU A;  3AZL B;  3X1U D;  4WU9 D;  5BNX B;  5B0Z D;  3C1C B;  3X1V D;  1P3K C;  2VQR A;  2Y2J A;  3A6N A;  3AZE C;  3MGP A;  5CPJ A;  4YS3 C;  1S32 D;  3EPK A;  2BYM B;  1KX3 B;  5AV5 C;  1U35 D;  2G5I C;  4WU8 D;  5DNM D;  3C1B D;  2FJ7 A;  2PYO A;  1TZY D;  3TU4 D;  1KX4 A;  3LZ1 D;  5G49 B;  5AV9 B;  3WA9 A;  3AZL D;  5E5A C;  1P3K B;  3C1C D;  5B33 D;  4G92 C;  2Y2P A;  3UTA C;  3AZF A;  1KX3 D;  5AV5 B;  1KX5 A;  3LZ0 A;  3AYW C;  1A7W A;  4E45 A;  4NE3 A;  3REL A;  1ID3 A;  5AV9 D;  5JRG C;  3AV1 A;  3WKJ C;  4UUZ B;  2F8N H;  5E5A B;  2NZD C;  2RVQ C;  1P3K D;  2ZY4 A;  1M19 A;  2F8N B;  2XD5 A;  4G92 B;  3W98 A;  3AZJ A;  3REJ A;  3UTA B;  5AVC A;  5AV5 D;  5KDM B;  3AYW B;  3WTP A;  5BNV B;  1BH8 B;  1B6W A;  1HQ3 A;  4YM6 A;  2YFW A;  4XZQ A;  5JRG B;  2ZY2 A;  3VH5 T;  5AV6 C;  3AV2 C;  3WKJ B;  3H0L C;  5B1L D;  3O62 A;  5B24 A;  5E5A D;  3REH B;  2NZD B;  2F8N D;  4Z66 A;  4XUJ A;  4KUD B;  4DRA A;  3AZI A;  5B2J A;  4J8X C;  1TAF A;  1P3B A;  2ARO C;  3UTA D;  3UT9 C;  1R4V A;  3KWQ A;  3H0M C;  2HIO C;  3V9R A;  5GT3 B;  5BT1 C;  4Z2M H;  2Y2K A;  3AZM C;  3WAA A;  1WWS A;  5B1M C;  1P3G C;  5JRG D;  5AV6 B;  2CV5 A;  4KGC A;  3WKJ D;  4AWL C;  4QLC C;  3REH D;  4WZS B;  2NZD D;  2RVQ D;  4J8U C;  3A1K A;  3KXB C;  3NQU A;  4KUD D;  5B32 B;  4J8X B;  1N1J A;  2ARO B;  3LJA B;  3UT9 B;  4H9P A;  2HIO B;  5AY8 B;  5B31 C;  5GT3 D;  1M1A A;  3X1S A;  3MVD B;  4DQY B;  5B1M B;  3AZM B;  3W97 C;  1P3G B;  3VH5 A;  3MNN A;  4H9R B;  1F66 A;  5GXQ C;  5B40 A;  3REK B;  4QLC B;  5CP6 A;  5FUG B;  4J8U B;  2ZY5 A;  2Y2H A;  1P3M A;  1P3L C;  3AZH A;  5B32 D;  4J8X D;  3B6G C;  2ARO D;  3LJA D;  1AOI A;  3UT9 D;  5AVB D;  4H9S A;  5AV8 C;  2HIO D;  3NQJ B;  5AY8 D;  5B31 B;  3WTP E;  3X1V A;  4WU9 A;  1ZLA C;  5B0Z A;  3AL0 C;  2NQB C;  3MVD D;  3AZM D;  5B1M D;  4ZUX C;  3W97 B;  4ZBJ C;  2Y2I A;  1P3G D;  4R8P D;  1M18 D;  5GXQ B;  3REK D;  4QLC D;  4WU8 A;  4H9N A;  4J8U D;  1P3L B;  3AN2 C;  3C1B A;  3REI C;  3IP4 C;  3B6G B;  2YFV B;  1P3A C;  5CPI A;  1P34 D;  3LZ1 A;  3AZN C;  3AFA C;  5GSU C;  5B31 D;  3AZL A;  2ZM5 A;  5CHL B;  5F99 A;  1P3F C;  4ZUX B;  5B33 A;  1EQZ C;  4ZBJ B;  5CPK A;  2BYM A;  5GXQ D;  3A1I A;  1KX3 A;  1JFI B;  3MGR D;  3AN2 B;  4H9O B;  3REI B;  1P3L D;  5GT0 A;  2FJ7 C;  3B6G D;  2BYK B;  1P3A B;  3AZG A;  3AZN B;  5G49 A;  3AFA B;  1B67 A;  5B2I A;  3WA9 C;  3AZE B;  1P3F B;  4YS3 B;  1EQZ B;  4ZUX D;  4J8V A;  3KFU G;  3B0D C;  3W99 C; 
#chains in the Genus database with same CATH homology
 3AZF C;  5AV5 A;  3LZ0 C;  1P3I C;  4X23 C;  1P3A D;  3VH6 W;  3MGS C;  3REL C;  3AZN D;  3AFA D;  1PZR A;  1ID3 C;  3AV1 C;  3R45 B;  3WA9 B;  4UUZ A;  5B1L A;  5E5A A;  3AZE D;  1P3F D;  3MGQ C;  4YS3 D;  1M19 C;  4LD9 A;  1EQZ D;  4WV4 B;  3W98 C;  3AZJ C;  3B0D B;  3W99 B;  2DQN C;  3REJ C;  3UTA A;  3F6T A;  5KDM A;  3LZ0 B;  1P3I B;  4X23 B;  2Y2L A;  3MGS B;  5BNV A;  1BH8 A;  3REL B;  1HQ3 C;  4YM6 C;  4XZQ C;  5JRG A;  4DRB A;  1P3O C;  1ID3 B;  3WKJ A;  2L5A A;  3AV1 B;  2Y2Q A;  1Z2C B;  3WA9 D;  3O62 C;  3REH A;  5B24 C;  2XD1 A;  1M19 B;  4NE5 A;  3MGQ B;  4Z66 C;  4EO5 C;  4XUJ C;  4NFT A;  4KUD A;  3AZI C;  3W99 D;  1P3B C;  3AYW D;  3LZ0 D;  3KWQ C;  1P3I D;  3KUY A;  5GT3 A;  4X23 D;  3WAA C;  3B0B A;  3MGS D;  3REL D;  1HQ3 B;  4XZQ B;  3AV2 B;  1P3O B;  1ID3 D;  2CV5 C;  3AZK C;  4KGC C;  3O62 B;  5B24 B;  1M19 D;  5B0Y C;  3MGQ D;  4Z66 B;  4EO5 B;  3B6F A;  3AZI B;  4WNN A;  5B32 A;  4J8X A;  5BO0 B;  1P3B B;  2ARO A;  1H3O B;  3LJA A;  4HGA C;  5AVB A;  3KWQ B;  4JJN C;  2HIO A;  5AY8 A;  4KHA B;  5DNN A;  1M1A C;  1ULY A;  3MVD A;  3WAA B;  5B1M A;  1P3G A;  4R8P A;  1M18 A;  5AV6 D;  4XZQ D;  3MNN C;  3AV2 D;  4H9R A;  3AZK B;  1P3O D;  4KGC B;  1F66 C;  4AWL B;  5B40 C;  3REK A;  4QLC A;  3O62 D;  1HTA A;  5CP6 C;  5B24 D;  1T3U A;  4CAY A;  3KXB B;  3LEL C;  4J8U A;  5B0Y B;  4Z66 D;  3NQU B;  3AZH C;  4CSR A;  3AZI D;  5BS7 C;  1P34 A;  1WWI A;  4HGA B;  1AOI C;  4JJN B;  2JE5 A;  2LY8 A;  3KWQ D;  3X1U A;  3W96 C;  5BT1 D;  4Z5T C;  1M1A B;  3X1V C;  4WU9 C;  4H9Q A;  3UTB C;  3WAA D;  3P5J B;  1S32 A;  4J8W C;  2J8P A;  3MNN B;  3AZK D;  4KGC D;  1P3P C;  5GXQ A;  5B40 B;  3LEL B;  1U35 A;  4G91 C;  5DNM A;  3KXB D;  3MGR A;  5B0Y D;  1P3L A;  3AZH B;  1TZY A;  5JA4 B;  3TU4 A;  5CPI C;  3LZ1 C;  2Y2G A;  5AV8 B;  3VH6 T;  4JJN D;  1ZLA B;  3W96 B;  3AZL C;  4Z5T B;  5BNX A;  3C1C A;  4WU9 B;  2NQB B;  3EPJ A;  3A6N C;  5F99 C;  5CPJ C;  3MGP C;  3UTB B;  4ZUX A;  3W97 D;  5B33 C;  4J8W B;  3X1T A;  5CPK C;  1P3P B;  5B40 D;  3LEL D;  4G91 B;  1KX3 C;  1JFI A;  4H9N B;  5GT0 C;  3AZH D;  1BH9 B;  2PYO C;  2BYK A;  1P3A A;  1KX4 C;  5CPI B;  3AZG C;  3LZ1 B;  5AV9 A;  3FDD A;  5GSU B;  5AV8 D;  2UWX A;  5B2I C;  1ZLA D;  3W96 D;  4Z5T D;  1P3K A;  2RIQ A;  3A6N B;  5F99 B;  3AZE A;  5CPJ B;  1F1E A;  3MGP B;  3UTB D;  4YS3 A;  1P3F A;  5B33 B;  1EQZ A;  2Y2O A;  4J8W D;  4J8V C;  5CPK B;  2FFF B;  1P3P D;  3B0C T;  1KX5 C;  3AN2 D;  3REI D;  2Y2N A;  2FJ7 B;  5GT0 B;  2PYO B;  1KX4 B;  1KU5 A;  3AZG B;  5CPI D;  2NQB D;  3VH6 A;  5GSU D;  3R45 A;  5B2I B;  5B1L C;  4WJ3 C;  2F8N A;  1Q9C A;  5F99 D;  5CPJ D;  3A6N D;  3MGP D;  4LD9 C;  4J8V B;  5CPK D;  3EG5 B;  3W99 A;  4M6B A;  3AZF B;  5AVC C;  1KX5 B;  3AYW A;  2F8N G;  3WTP C;  1P3I A;  4X23 A;  2FJ7 D;  5GT0 D;  2PYO D;  2F8N K;  1KX4 D;  3AZG D;  3MGS A;  1W2E A;  2G5H C;  5B2I D;  5B1L B;  2NZD A;  3REH C;  3KSY A;  3MGQ A;  4LD9 B;  3W98 B;  4KUD C;  3B0C W;  5B2J C;  3AZJ B;  3EPL A;  4J8V D;  3REJ B;  3AZF D;  5AVC B;  2BG1 A;  1KX5 D;  3WTP B;  3KUY C;  5GT3 C;  3EPH A;  2DF4 C;  4YM6 B;  2YFW B;  5AV6 A;  1BFM A;  3AV2 A;  1P3O A;  3AV1 D;  2CWE A;  4Z2M G;  4XUJ B;  4LD9 D;  3B6F C;  3W98 D;  5B2J B;  1TAF B;  3AZJ D;  5B32 C;  5BO0 A;  2HUE C;  3REJ D;  3UT9 A;  1H3O A;  5AVC D;  3LJA C;  5AVB C;  3WTP D;  3V9R B;  5DNN C;  4KHA A;  5AY8 C;  3KUY B;  5B32 G;  3AZM A;  3X1S C;  3MVD C;  1HQ3 D;  4YM6 D;  4R8P C;  2CV5 B;  4E44 A;  1M18 C;  2Y2M A;  3AZK A;  2JCH A;  3REK C;  5FUG A;  3X1T C;  3KXB A;  1P3M C;  2JSS A;  5B0Y A;  4XUJ D;  3B6F B;  5B2J D;  4WNN B;  1N1J B;  1P3B D;  2F2A C;  2HUE B;  1P34 C;  4H9P B;  4H9S C;  5AVB B;  3NQJ A;  5B31 A;  4JJN A;  5DNN B;  3KUY D;  3X1U C;  5B0Z C;  2IO5 C;  2ZY3 A;  3X1S B;  3VH5 W;  3W97 A;  1S32 C;  4R8P B;  1M18 B;  2CV5 D;  1F66 B;  5B31 G;  5CP6 B;  3LEL A;  3X1T B;  1U35 C;  4WU8 C;  4CAY B;  5DNM C;  3MGR C;  1P3M B;  3C1B C;  3B6F D;  3B6G A;  4CSR B;  2YFV A;  1TZY C;  5BS7 A;  5JA4 A;  3TU4 C;  5C3I C;  1P34 B;  4UPK A;  1AOI B;  4NE6 A;  5AV8 A;  3H0R C;  5DNN D;  1ZLA A;  3W96 A;  3X1U B;  4Z5T A;  5B0Z B;  2IO5 B;  3C1C C;  3X1V B;  1M1A D;  3X1S D;  2NQB A;  4H9Q B;  3UTB A;  1S32 B;  4J8W A;  3MNN D;  1F66 D;  1P3P A;  2W8S A;  5CP6 D;  1U35 B;  4WU8 B;  3X1T D;  5DNM B;  3MGR B;  1P3M D;  3AN2 A;  4H9O A;  3REI A;  3C1B B;  1BH9 A;  1TZY B;  3TU4 B;  5C3I B;  3AZN A;  3AFA A;  5AV9 C;  1AOI D;  5GSU A;  3AZL B;  3X1U D;  4WU9 D;  5BNX B;  5B0Z D;  3C1C B;  3X1V D;  1P3K C;  2VQR A;  2Y2J A;  3A6N A;  3AZE C;  3MGP A;  5CPJ A;  4YS3 C;  1S32 D;  3EPK A;  2BYM B;  1KX3 B;  5AV5 C;  1U35 D;  2G5I C;  4WU8 D;  5DNM D;  3C1B D;  2FJ7 A;  2PYO A;  1TZY D;  3TU4 D;  1KX4 A;  3LZ1 D;  5G49 B;  5AV9 B;  3WA9 A;  3AZL D;  5E5A C;  1P3K B;  3C1C D;  5B33 D;  4G92 C;  2Y2P A;  3UTA C;  3AZF A;  1KX3 D;  5AV5 B;  1KX5 A;  3LZ0 A;  3AYW C;  1A7W A;  4E45 A;  4NE3 A;  3REL A;  1ID3 A;  5AV9 D;  5JRG C;  3AV1 A;  3WKJ C;  4UUZ B;  2F8N H;  5E5A B;  2NZD C;  2RVQ C;  1P3K D;  2ZY4 A;  1M19 A;  2F8N B;  2XD5 A;  4G92 B;  3W98 A;  3AZJ A;  3REJ A;  3UTA B;  5AVC A;  5AV5 D;  5KDM B;  3AYW B;  3WTP A;  5BNV B;  1BH8 B;  1B6W A;  1HQ3 A;  4YM6 A;  2YFW A;  4XZQ A;  5JRG B;  2ZY2 A;  3VH5 T;  5AV6 C;  3AV2 C;  3WKJ B;  3H0L C;  5B1L D;  3O62 A;  5B24 A;  5E5A D;  3REH B;  2NZD B;  2F8N D;  4Z66 A;  4XUJ A;  4KUD B;  4DRA A;  3AZI A;  5B2J A;  4J8X C;  1TAF A;  1P3B A;  2ARO C;  3UTA D;  3UT9 C;  1R4V A;  3KWQ A;  3H0M C;  2HIO C;  3V9R A;  5GT3 B;  5BT1 C;  4Z2M H;  2Y2K A;  3AZM C;  3WAA A;  1WWS A;  5B1M C;  1P3G C;  5JRG D;  5AV6 B;  2CV5 A;  4KGC A;  3WKJ D;  4AWL C;  4QLC C;  3REH D;  4WZS B;  2NZD D;  2RVQ D;  4J8U C;  3A1K A;  3KXB C;  3NQU A;  4KUD D;  5B32 B;  4J8X B;  1N1J A;  2ARO B;  3LJA B;  3UT9 B;  4H9P A;  2HIO B;  5AY8 B;  5B31 C;  5GT3 D;  1M1A A;  3X1S A;  3MVD B;  4DQY B;  5B1M B;  3AZM B;  3W97 C;  1P3G B;  3VH5 A;  3MNN A;  4H9R B;  1F66 A;  5GXQ C;  5B40 A;  3REK B;  4QLC B;  5CP6 A;  5FUG B;  4J8U B;  2ZY5 A;  2Y2H A;  1P3M A;  1P3L C;  3AZH A;  5B32 D;  4J8X D;  3B6G C;  2ARO D;  3LJA D;  1AOI A;  3UT9 D;  5AVB D;  4H9S A;  5AV8 C;  2HIO D;  3NQJ B;  5AY8 D;  5B31 B;  3WTP E;  3X1V A;  4WU9 A;  1ZLA C;  5B0Z A;  3AL0 C;  2NQB C;  3MVD D;  3AZM D;  5B1M D;  4ZUX C;  3W97 B;  4ZBJ C;  2Y2I A;  1P3G D;  4R8P D;  1M18 D;  5GXQ B;  3REK D;  4QLC D;  4WU8 A;  4H9N A;  4J8U D;  1P3L B;  3AN2 C;  3C1B A;  3REI C;  3IP4 C;  3B6G B;  2YFV B;  1P3A C;  5CPI A;  1P34 D;  3LZ1 A;  3AZN C;  3AFA C;  5GSU C;  5B31 D;  3AZL A;  2ZM5 A;  5CHL B;  5F99 A;  1P3F C;  4ZUX B;  5B33 A;  1EQZ C;  4ZBJ B;  5CPK A;  2BYM A;  5GXQ D;  3A1I A;  1KX3 A;  1JFI B;  3MGR D;  3AN2 B;  4H9O B;  3REI B;  1P3L D;  5GT0 A;  2FJ7 C;  3B6G D;  2BYK B;  1P3A B;  3AZG A;  3AZN B;  5G49 A;  3AFA B;  1B67 A;  5B2I A;  3WA9 C;  3AZE B;  1P3F B;  4YS3 B;  1EQZ B;  4ZUX D;  4J8V A;  3KFU G;  3B0D C;  3W99 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...