2RVQD

Solution structure of the isolated histone h2a-h2b heterodimer
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
GPGMPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H2A type 1-B/E
publication title Solution structure of the isolated histone H2A-H2B heterodimer
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein/nuclear protein
total genus 35
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2rvqD00
3R45A 1P34D 5AV8D 1P3IA 5BNXA 2F8ND 1P3AA 5GSUC 4J8XA 2FJ7C 2IO5B 3NQUB 5B33D 4JJND 4EO5B 3KXBA 2NZDD 5AV9D 3C1BC 3UT9D 1KX3C 3MNNC 4WU8C 5B2JD 5B1LB 4J8UA 1P3FA 5B31D 5G49A 4E44A 3LZ1D 4YM6D 5CPJA 3AZGA 1P3KD 3WA9D 3B0CT 5DNMD 4YS3D 5B0ZC 4R8PD 3AN2B 3AZLB 5CPIB 4KUDD 5CPKC 1P3BA 1B67A 4XZQB 3AFAC 4QLCB 3AZHC 2CWEA 5B32D 5AY8B 4Z5TB 3UTBC 5AVBC 2PYOB 3B0CW 3AZFD 1F1EA 3VH6T 5B0YA 4WU9D 3MVDC 3NQUA 5GT0B 3W98B 3LZ0C 4ZUXC 3MGQC 1P3IC 3MGPD 5B1LA 4CAYB 1ID3D 1P3AC 4J8XC 3WTPD 5BO0A 3MGSD 3VH6W 3W97D 2AROD 3REID 3AZLA 5CPIA 4Z2MG 4J8UC 1P3FC 4XZQA 3RELB 4QLCA 5CPJC 5AY8A 3AZGC 4Z5TA 3B6FB 3AZMD 4WNNA 1P3MC 2PYOA 5DNNA 5B24D 5GT0A 3W98A 5B2IA 3AZEB 4CAYA 2IO5C 3AYWB 4EO5C 3C1CB 4J8VB 3W99B 5B1LC 5BT1D 3RELA 2FJ7B 1TAFB 4KHAB 3KSYA 5JRGB 5CP6D 3AV1B 3A6ND 3B6FA 1P3OD 4LD9D 3AV2B 3AN2C 3AZND 3AZLC 5CPIC 2CV5B 5GSUD 3TU4D 4XZQC 4QLCC 4H9SA 5AY8C 4Z5TC 3B0DB 3C1BD 1KX3D 3LJAD 1KX4D 2PYOC 3AZEA 3MNND 3REKD 4WU8D 2F8NK 3REJB 5CPKB 1TZYD 3AZKD 5GT0C 3W98C 3AYWA 3C1CA 1ZLAB 4J8VA 1S32B 3X1SD 1P3PB 1AOIB 5B0ZD 3W99A 4LD9C 3W96D 5B40B 2FJ7A 3AZHD 1TAFA 4KHAA 5JRGA 3AV1A 3UTBD 5AVBD 4G91B 3RELC 1BH8A 3MVDD 3O62B 3B6FC 4H9RB 4ZUXD 5GXQB 3MGQD 1M19B 1P3ID 3AZJB 3REJA 5CPKA 1R4VA 4J8XD 5E5AC 5AV5B 3KXBD 1S32A 1P3PA 1ZLAA 1AOIA 5CHLB 1Q9CA 3AZEC 4CSRB 5B40A 1P3FD 5CPJD 1F66D 3AYWC 3C1CC 4J8VC 3REHB 1P3GB 2NQBB 3W99C 5B31G 3LELB 1P3BD 4H9QB 1WWSA 1M1AB 5JRGC 2L5AA 3AV1C 3AV2C 1H3OB 5B1MB 1KX5B 5F99B 2CV5C 1HTAA 5B0YD 1P34B 5AV5A 2YFVB 3B0DC 1P3MA 1HQ3B 5B1LD 3REJC 2NZDB 4CSRA 2HIOB 1ZLAC 1S32C 1P3PC 1AOIC 3UTAD 5B31B 1P3GA 2NQBA 2JSSA 3B0BA 3AZLD 5CPID 3LELA 3V9RB 4H9QA 4XUJD 3NQJB 5B40C 4QLCD 4R8PB 3X1TB 1M1AA 3VH5T 5AY8D 5B1MA 2RVQC 1ULYA 5F99A 1KX5A 4G91C 1BFMA 5DNND 1P34A 5GT0D 3W98D 3O62C 2YFVA 5GXQC 3VH5W 1M19C 5B2ID 1HQ3A 3AN2A 1JFIB 1N1JB 3AZJC 4Z2MH 2NZDA 2HIOA 5AV5C 3WTPB 5B31A 5C3IC 3KUYB 3V9RA 3NQJA 3RELD 4WV4B 3X1TA 2HUEB 5E5AB 3B6FD 3REHC 1P3GC 2NQBC 4X23C 3LELC 3MGRB 3AZMB 1M1AC 5B24B 5B1MC 1N1JA 1KX5C 5F99C 1U35B 4NFTA 1P34C 3AYWD 3C1CD 4J8VD 3X1VB 4M6BA 3WTPA 1M18B 1HQ3C 3WKJB 3KUYA 3W99D 3B6GB 2NZDC 2HIOC 4J8WB 2FJ7D 5E5AA 1WWIA 3AV1D 5AV6B 5B31C 5AVCB 5GT3B 5CP6B 4WZSB 3MGRA 1P3OB 4R8PC 3X1TC 3AZNB 1P3LB 3TU4B 3WTPE 1U35A 5CPKD 3AFAD 1KX4B 3LJAB 3REKB 3WAAB 2YFWB 1ZLAD 3X1VA 1AOID 1M18A 1TZYB 3AV2A 3WKJA 3AZKB 3X1UB 3B6GA 4NE5A 2CV5A 4ZBJB 3X1SB 5B40D 4J8WA 3AZIB 5AV6A 3LZ0D 3W96B 3WTPC 4HGAB 5AVCA 2RVQD 3KUYC 5GT3A 5CP6A 1P3AD 1P3OA 2HUEC 3AZNA 4KGCB 1P3LA 3TU4A 2F8NG 3VH6A 5C3IB 2LY8A 3MGRC 3KWQB 4J8UD 3AZMC 4DRAA 5AV5D 3REKA 2YFWA 3WAAA 3AZGD 1TZYA 1P3MD 5B24C 4H9OB 3AZKA 3X1UA 1U35C 4X23B 3KXBB 3X1SA 3AZIA 4DRBA 3O62A 3X1VC 4H9RA 1M18C 5GXQA 3WKJC 1M19A 4E45A 2NQBD 1EQZB 4Z66B 3AZJA 1F66B 3B6GC 3LELD 4J8WC 5B32G 1M1AD 4KGCA 5AV8B 5AV6C 1P3BB 2F8NB 5B1MD 5AVCC 5GT3C 4H9PB 5B33B 4JJNB 5CP6C 3KWQA 1P3OC 5AV9B 3UT9B 3AZNC 5B2JB 1P3LC 3REHA 3TU4C 5B0YB 4H9OA 3AN2D 1HQ3D 5BS7A 4X23A 4YM6B 3LZ1B 1A7WA 1P3KB 2HIOD 3WA9B 4XZQD 1B6WA 3LJAC 5DNMB 4YS3B 1KX4C 3REKC 3WAAC 4Z5TD 4KUDB 1TZYC 3AZKC 1H3OA 3X1UC 4G92C 5BO0B 4Z66A 1EQZA 1F66A 2PYOD 5B32B 4ZBJC 3AZIC 3X1SC 3UTAB 3X1TD 5JA4B 5AV8A 3AZFB 3W96C 2F8NA 4XUJB 4HGAC 4WU9B 4H9PA 5B33A 4JJNA 1BH9B 4WNNB 5AV9A 3UT9A 4KGCC 5B2JA 3MGPB 1ID3B 5DNNB 3LZ1A 3MGSB 4YM6A 5BNVB 1P3KA 3KWQC 3W97B 3WA9A 5DNMA 4YS3A 5B2IB 2AROB 4R8PA 3REIB 4KUDA 3KUYD 5BS7C 5B32A 3KXBC 3UTAA 5E5AD 5JA4A 3AZFA 4XUJA 4WU9A 1EQZC 4Z66C 3AZED 1JFIA 1F66C 4UUZB 4AWLB 3MGRD 1BH9A 2BYMB 5AV8C 3MGPA 1P3BC 1ID3A 3MGSA 5B33C 1U35D 5BNVA 4JJNC 3W97A 5AV9C 3UT9C 2AROA 3REIA 5JRGD 5B2JC 3X1VD 5B0YC 1M18D 3AV2D 3WKJD 3LZ1C 4YM6C 3B6GD 2CV5D 1P3KC 3A6NB 3AZMA 4J8WD 3WA9C 5DNMC 4LD9B 4YS3C 5AV6D 4KUDC 2BYKB 5GSUB 5B24A 5AVCD 5GT3D 4UUZA 5B32C 3REJD 3UTAC 4NE6A 2BYMA 3C1BB 1KX3B 3MNNB 4WU8B 3AZFC 1S32D 1P3PD 1P3LD 4XUJC 1BH8B 4WU9C 4G92B 5B0ZB 3WAAD 3MGPC 1ID3C 4H9NB 5DNNC 3X1UD 3AFAB 3MGSC 5KDMB 3AZHB 3A6NA 3UTBB 3AZID 3W97C 5FUGB 4LD9A 5AVBB 5B2IC 2AROC 3REIC 3O62D 2BYKA 5GXQD 5GSUA 4NE3A 1M19D 1KU5A 3MVDB 3AZJD 2F8NH 3LZ0B 4ZUXB 3MGQB 3VH5A 3C1BA 1KX3A 3LJAA 1KX4A 3R45B 4KGCD 3MNNA 4WU8A 1P3IB 5BNXB 1P3AB 4J8XB 4AWLC 3KWQD 5B0ZA 4H9NA 3W96A 4J8UB 3REHD 1P3FB 1P3GD 3AFAA 4H9SC 3AZHA 5G49B 5KDMA 4X23D 5CPJB 3AZGB 3UTBA 5FUGA 5AVBA 1P3MB 5BT1C 1EQZD 3MVDA 4Z66D 1KX5D 5F99D 3A6NC 3LZ0A 4ZUXA 3MGQA
chains in the Genus database with same CATH superfamily
3R45A 1P34D 5AV8D 1P3IA 5BNXA 2F8ND 1P3AA 5GSUC 4J8XA 2FJ7C 2IO5B 3NQUB 5B33D 4JJND 1W2EA 4EO5B 3KXBA 2NZDD 5AV9D 3C1BC 3UT9D 1KX3C 3MNNC 4WU8C 5B2JD 5B1LB 4J8UA 1P3FA 5B31D 5G49A 4E44A 3LZ1D 4YM6D 5CPJA 3AZGA 1P3KD 3WA9D 3B0CT 5DNMD 4YS3D 5B0ZC 4R8PD 3AN2B 3AZLB 5CPIB 4KUDD 5CPKC 1P3BA 3EPKA 1B67A 4XZQB 3AFAC 4QLCB 3AZHC 2CWEA 5B32D 5AY8B 4Z5TB 3UTBC 2Y2KA 5AVBC 2PYOB 3B0CW 3AZFD 1F1EA 3VH6T 5B0YA 4WU9D 3MVDC 3NQUA 5GT0B 3W98B 3LZ0C 4ZUXC 3MGQC 1P3IC 3MGPD 5B1LA 4CAYB 1ID3D 1P3AC 2Y2JA 3WTPD 4J8XC 5BO0A 3MGSD 3VH6W 3W97D 2AROD 3REID 3AZLA 5CPIA 4Z2MG 4J8UC 1P3FC 4XZQA 3RELB 4QLCA 5CPJC 5AY8A 3AZGC 4Z5TA 2W8SA 3B6FB 3AZMD 4WNNA 1P3MC 2PYOA 5DNNA 5B24D 5GT0A 3W98A 5B2IA 3AZEB 4CAYA 2IO5C 3AYWB 4EO5C 3C1CB 4J8VB 3W99B 5B1LC 5BT1D 3RELA 2FJ7B 1TAFB 4KHAB 3KSYA 5JRGB 5CP6D 3AV1B 3A6ND 3B6FA 1P3OD 4LD9D 3AV2B 3AN2C 3AZND 2F2AC 3AZLC 5CPIC 2CV5B 5GSUD 3TU4D 4XZQC 4QLCC 4H9SA 5AY8C 4Z5TC 3B0DB 3C1BD 1KX3D 3LJAD 1KX4D 2PYOC 3AZEA 3MNND 3REKD 4WU8D 2F8NK 3REJB 5CPKB 1TZYD 3AZKD 5GT0C 3W98C 3AYWA 3C1CA 3EPHA 1ZLAB 2Y2HA 4J8VA 2VQRA 2Y2QA 3X1SD 2Y2PA 1S32B 1P3PB 1AOIB 2J8PA 5B0ZD 3F6TA 3W99A 4LD9C 3W96D 5B40B 2FJ7A 3AZHD 1TAFA 4KHAA 5JRGA 2ZY4A 3AV1A 3UTBD 3EPJA 5AVBD 4G91B 3RELC 1BH8A 3MVDD 3O62B 3B6FC 4H9RB 4ZUXD 5GXQB 3MGQD 1M19B 1P3ID 3AZJB 3REJA 5CPKA 1R4VA 4J8XD 5E5AC 5AV5B 3KXBD 1S32A 1P3PA 1ZLAA 1AOIA 5CHLB 1Q9CA 3AZEC 3A1IA 4CSRB 5B40A 1P3FD 2DQNC 5CPJD 1F66D 3EG5B 3C1CC 3AYWC 4J8VC 3REHB 3KFUG 1P3GB 2NQBB 3W99C 5B31G 3LELB 1P3BD 4H9QB 1WWSA 1M1AB 5JRGC 2L5AA 2Y2NA 3AV1C 3AV2C 1H3OB 5B1MB 1KX5B 5F99B 2CV5C 1HTAA 5B0YD 1P34B 5AV5A 2YFVB 3B0DC 2RIQA 1P3MA 1HQ3B 5B1LD 3REJC 2NZDB 4CSRA 2HIOB 1ZLAC 1S32C 1P3PC 1AOIC 3UTAD 5B31B 1P3GA 2NQBA 2JSSA 3B0BA 3AZLD 5CPID 3LELA 3V9RB 4H9QA 4XUJD 3NQJB 1T3UA 5B40C 4QLCD 4R8PB 3X1TB 1M1AA 3VH5T 5AY8D 5B1MA 2RVQC 1ULYA 5F99A 1KX5A 4G91C 1BFMA 5DNND 1P34A 5GT0D 3W98D 3O62C 2YFVA 5GXQC 3VH5W 1M19C 5B2ID 1HQ3A 3AN2A 1JFIB 1N1JB 3AZJC 4Z2MH 2NZDA 2HIOA 5AV5C 3WTPB 5B31A 3P5JB 5C3IC 3KUYB 2DF4C 3V9RA 3NQJA 3RELD 3H0RC 4WV4B 3X1TA 2HUEB 2Y2LA 5E5AB 1P3FB 3B6FD 3REHC 1P3GC 2NQBC 4X23C 3LELC 3MGRB 3AZMB 1M1AC 5B24B 5B1MC 1N1JA 1KX5C 5F99C 1U35B 4NFTA 1P34C 3AYWD 3C1CD 4J8VD 3X1VB 4M6BA 3WTPA 1M18B 1HQ3C 2XD5A 3WKJB 3KUYA 3W99D 3B6GB 2NZDC 2HIOC 4J8WB 2FJ7D 5E5AA 1WWIA 3AV1D 5AV6B 2Y2GA 5B31C 5AVCB 5GT3B 5CP6B 4WZSB 3MGRA 1P3OB 4R8PC 3X1TC 3AZNB 1P3LB 3TU4B 3WTPE 1U35A 5CPKD 2UWXA 3AFAD 1KX4B 3LJAB 3REKB 3WAAB 2YFWB 1ZLAD 3X1VA 1AOID 1M18A 1TZYB 3AV2A 3WKJA 3AZKB 3X1UB 3B6GA 2JE5A 4NE5A 4ZBJB 2CV5A 3X1SB 5B40D 4J8WA 3AZIB 5AV6A 3LZ0D 3W96B 3WTPC 4HGAB 5AVCA 2BG1A 2RVQD 5GT3A 3KUYC 5CP6A 1P3AD 1P3OA 2HUEC 3AZNA 4KGCB 1P3LA 3TU4A 2F8NG 3VH6A 5C3IB 2LY8A 3MGRC 3KWQB 4J8UD 3AZMC 4DRAA 5AV5D 3REKA 2YFWA 3WAAA 3AZGD 1TZYA 1P3MD 5B24C 4H9OB 3AZKA 3X1UA 1U35C 4X23B 4DQYB 3KXBB 3X1SA 3AZIA 4DRBA 3O62A 3X1VC 4H9RA 1M18C 5GXQA 3WKJC 1M19A 4E45A 2NQBD 1EQZB 4Z66B 3AZJA 1F66B 3B6GC 3LELD 4J8WC 5B32G 1M1AD 4KGCA 5AV8B 5AV6C 1P3BB 2F8NB 5B1MD 5AVCC 5GT3C 4H9PB 5B33B 4JJNB 5CP6C 3KWQA 1P3OC 5AV9B 3UT9B 3AZNC 5B2JB 1P3LC 3A1KA 3REHA 5B0YB 3TU4C 4H9OA 3AN2D 1HQ3D 5BS7A 4X23A 4YM6B 3LZ1B 1A7WA 1P3KB 2HIOD 3WA9B 4XZQD 1B6WA 3LJAC 5DNMB 4YS3B 1KX4C 3REKC 3WAAC 4Z5TD 4KUDB 1TZYC 3AZKC 1H3OA 3X1UC 4G92C 5BO0B 4Z66A 1EQZA 1F66A 2PYOD 5B32B 4ZBJC 3AZIC 3X1SC 3UTAB 3X1TD 5JA4B 2FFFB 5AV8A 3AZFB 3W96C 2F8NA 4XUJB 4HGAC 4WU9B 4H9PA 5B33A 4JJNA 1BH9B 4WNNB 5AV9A 3UT9A 4KGCC 5B2JA 3MGPB 1ID3B 2Y2MA 5DNNB 3LZ1A 3MGSB 4YM6A 5BNVB 1P3KA 3KWQC 3W97B 3WA9A 5DNMA 4YS3A 5B2IB 2AROB 4R8PA 3REIB 4KUDA 3KUYD 5BS7C 5B32A 3KXBC 3UTAA 5E5AD 5JA4A 3AZFA 4XUJA 4WU9A 1EQZC 4Z66C 3AZED 1JFIA 1F66C 4UUZB 4AWLB 3MGRD 3EPLA 1BH9A 2BYMB 5AV8C 3AL0C 3MGPA 1P3BC 3H0LC 1ID3A 3MGSA 5B33C 1U35D 5BNVA 4JJNC 3W97A 5AV9C 3UT9C 2AROA 3REIA 5JRGD 5B2JC 3X1VD 5B0YC 1M18D 3AV2D 3WKJD 3LZ1C 4YM6C 3B6GD 2CV5D 1P3KC 3A6NB 3AZMA 4J8WD 3WA9C 5DNMC 4LD9B 4YS3C 2ZY5A 5AV6D 4KUDC 3H0MC 2BYKB 5GSUB 5B24A 5AVCD 3FDDA 5GT3D 4UUZA 5B32C 3REJD 3UTAC 4NE6A 2Y2IA 2BYMA 3C1BB 2ZM5A 1KX3B 3MNNB 4WU8B 3AZFC 1S32D 2ZY3A 1P3PD 1P3LD 2XD1A 4XUJC 1BH8B 4WU9C 4G92B 2ZY2A 5B0ZB 3WAAD 3MGPC 2G5HC 4H9NB 1ID3C 3IP4C 4UPKA 5DNNC 3X1UD 3AFAB 3MGSC 5KDMB 3AZHB 3A6NA 3UTBB 3AZID 3W97C 5FUGB 4LD9A 5AVBB 5B2IC 2AROC 3REIC 3O62D 4WJ3C 2BYKA 5GXQD 5GSUA 4NE3A 1M19D 1KU5A 3MVDB 3AZJD 2F8NH 3LZ0B 4ZUXB 3MGQB 3VH5A 3C1BA 1KX3A 3LJAA 1KX4A 3R45B 4KGCD 3MNNA 4WU8A 2JCHA 1P3IB 1PZRA 5BNXB 1P3AB 4J8XB 4AWLC 3KWQD 1Z2CB 5B0ZA 4H9NA 2Y2OA 3W96A 4J8UB 2G5IC 3REHD 1P3GD 3AFAA 4H9SC 3AZHA 5G49B 5KDMA 4X23D 5CPJB 3AZGB 3UTBA 5FUGA 5AVBA 1P3MB 5BT1C 1EQZD 3MVDA 4Z66D 1KX5D 5F99D 3A6NC 3LZ0A 4ZUXA 3MGQA
chains in the Genus database with same CATH topology
3R45A 1P34D 5AV8D 1P3IA 5BNXA 2F8ND 1P3AA 5GSUC 4J8XA 2FJ7C 2IO5B 3NQUB 5B33D 4JJND 1W2EA 4EO5B 3KXBA 2NZDD 5AV9D 3C1BC 3UT9D 1KX3C 3MNNC 4WU8C 5B2JD 5B1LB 4J8UA 1P3FA 5B31D 5G49A 4E44A 3LZ1D 4YM6D 5CPJA 3AZGA 1P3KD 3WA9D 3B0CT 5DNMD 4YS3D 5B0ZC 4R8PD 3AN2B 3AZLB 5CPIB 4KUDD 5CPKC 1P3BA 3EPKA 1B67A 4XZQB 3AFAC 4QLCB 3AZHC 2CWEA 5B32D 5AY8B 4Z5TB 3UTBC 2Y2KA 5AVBC 2PYOB 3B0CW 3AZFD 1F1EA 3VH6T 5B0YA 4WU9D 3MVDC 3NQUA 5GT0B 3W98B 3LZ0C 4ZUXC 3MGQC 1P3IC 3MGPD 5B1LA 4CAYB 1ID3D 1P3AC 2Y2JA 3WTPD 4J8XC 5BO0A 3MGSD 3VH6W 3W97D 2AROD 3REID 3AZLA 5CPIA 4Z2MG 4J8UC 1P3FC 4XZQA 3RELB 4QLCA 5CPJC 5AY8A 3AZGC 4Z5TA 2W8SA 3B6FB 3AZMD 4WNNA 1P3MC 2PYOA 5DNNA 5B24D 5GT0A 3W98A 5B2IA 3AZEB 4CAYA 2IO5C 3AYWB 4EO5C 3C1CB 4J8VB 3W99B 5B1LC 5BT1D 3RELA 2FJ7B 1TAFB 4KHAB 3KSYA 5JRGB 5CP6D 3AV1B 3A6ND 3B6FA 1P3OD 4LD9D 3AV2B 3AN2C 3AZND 2F2AC 3AZLC 5CPIC 2CV5B 5GSUD 3TU4D 4XZQC 4QLCC 4H9SA 5AY8C 4Z5TC 3B0DB 3C1BD 1KX3D 3LJAD 1KX4D 2PYOC 3AZEA 3MNND 3REKD 4WU8D 2F8NK 3REJB 5CPKB 1TZYD 3AZKD 5GT0C 3W98C 3AYWA 3C1CA 3EPHA 1ZLAB 2Y2HA 4J8VA 2VQRA 2Y2QA 3X1SD 2Y2PA 1S32B 1P3PB 1AOIB 2J8PA 5B0ZD 3F6TA 3W99A 4LD9C 3W96D 5B40B 2FJ7A 3AZHD 1TAFA 4KHAA 5JRGA 2ZY4A 3AV1A 3UTBD 3EPJA 5AVBD 4G91B 3RELC 1BH8A 3MVDD 3O62B 3B6FC 4H9RB 4ZUXD 5GXQB 3MGQD 1M19B 1P3ID 3AZJB 3REJA 5CPKA 1R4VA 4J8XD 5E5AC 5AV5B 3KXBD 1S32A 1P3PA 1ZLAA 1AOIA 5CHLB 1Q9CA 3AZEC 3A1IA 4CSRB 5B40A 1P3FD 2DQNC 5CPJD 1F66D 3EG5B 3C1CC 3AYWC 4J8VC 3REHB 3KFUG 1P3GB 2NQBB 3W99C 5B31G 3LELB 1P3BD 4H9QB 1WWSA 1M1AB 5JRGC 2L5AA 2Y2NA 3AV1C 3AV2C 1H3OB 5B1MB 1KX5B 5F99B 2CV5C 1HTAA 5B0YD 1P34B 5AV5A 2YFVB 3B0DC 2RIQA 1P3MA 1HQ3B 5B1LD 3REJC 2NZDB 4CSRA 2HIOB 1ZLAC 1S32C 1P3PC 1AOIC 3UTAD 5B31B 1P3GA 2NQBA 2JSSA 3B0BA 3AZLD 5CPID 3LELA 3V9RB 4H9QA 4XUJD 3NQJB 1T3UA 5B40C 4QLCD 4R8PB 3X1TB 1M1AA 3VH5T 5AY8D 5B1MA 2RVQC 1ULYA 5F99A 1KX5A 4G91C 1BFMA 5DNND 1P34A 5GT0D 3W98D 3O62C 2YFVA 5GXQC 3VH5W 1M19C 5B2ID 1HQ3A 3AN2A 1JFIB 1N1JB 3AZJC 4Z2MH 2NZDA 2HIOA 5AV5C 3WTPB 5B31A 3P5JB 5C3IC 3KUYB 2DF4C 3V9RA 3NQJA 3RELD 3H0RC 4WV4B 3X1TA 2HUEB 2Y2LA 5E5AB 1P3FB 3B6FD 3REHC 1P3GC 2NQBC 4X23C 3LELC 3MGRB 3AZMB 1M1AC 5B24B 5B1MC 1N1JA 1KX5C 5F99C 1U35B 4NFTA 1P34C 3AYWD 3C1CD 4J8VD 3X1VB 4M6BA 3WTPA 1M18B 1HQ3C 2XD5A 3WKJB 3KUYA 3W99D 3B6GB 2NZDC 2HIOC 4J8WB 2FJ7D 5E5AA 1WWIA 3AV1D 5AV6B 2Y2GA 5B31C 5AVCB 5GT3B 5CP6B 4WZSB 3MGRA 1P3OB 4R8PC 3X1TC 3AZNB 1P3LB 3TU4B 3WTPE 1U35A 5CPKD 2UWXA 3AFAD 1KX4B 3LJAB 3REKB 3WAAB 2YFWB 1ZLAD 3X1VA 1AOID 1M18A 1TZYB 3AV2A 3WKJA 3AZKB 3X1UB 3B6GA 2JE5A 4NE5A 4ZBJB 2CV5A 3X1SB 5B40D 4J8WA 3AZIB 5AV6A 3LZ0D 3W96B 3WTPC 4HGAB 5AVCA 2BG1A 2RVQD 5GT3A 3KUYC 5CP6A 1P3AD 1P3OA 2HUEC 3AZNA 4KGCB 1P3LA 3TU4A 2F8NG 3VH6A 5C3IB 2LY8A 3MGRC 3KWQB 4J8UD 3AZMC 4DRAA 5AV5D 3REKA 2YFWA 3WAAA 3AZGD 1TZYA 1P3MD 5B24C 4H9OB 3AZKA 3X1UA 1U35C 4X23B 4DQYB 3KXBB 3X1SA 3AZIA 4DRBA 3O62A 3X1VC 4H9RA 1M18C 5GXQA 3WKJC 1M19A 4E45A 2NQBD 1EQZB 4Z66B 3AZJA 1F66B 3B6GC 3LELD 4J8WC 5B32G 1M1AD 4KGCA 5AV8B 5AV6C 1P3BB 2F8NB 5B1MD 5AVCC 5GT3C 4H9PB 5B33B 4JJNB 5CP6C 3KWQA 1P3OC 5AV9B 3UT9B 3AZNC 5B2JB 1P3LC 3A1KA 3REHA 5B0YB 3TU4C 4H9OA 3AN2D 1HQ3D 5BS7A 4X23A 4YM6B 3LZ1B 1A7WA 1P3KB 2HIOD 3WA9B 4XZQD 1B6WA 3LJAC 5DNMB 4YS3B 1KX4C 3REKC 3WAAC 4Z5TD 4KUDB 1TZYC 3AZKC 1H3OA 3X1UC 4G92C 5BO0B 4Z66A 1EQZA 1F66A 2PYOD 5B32B 4ZBJC 3AZIC 3X1SC 3UTAB 3X1TD 5JA4B 2FFFB 5AV8A 3AZFB 3W96C 2F8NA 4XUJB 4HGAC 4WU9B 4H9PA 5B33A 4JJNA 1BH9B 4WNNB 5AV9A 3UT9A 4KGCC 5B2JA 3MGPB 1ID3B 2Y2MA 5DNNB 3LZ1A 3MGSB 4YM6A 5BNVB 1P3KA 3KWQC 3W97B 3WA9A 5DNMA 4YS3A 5B2IB 2AROB 4R8PA 3REIB 4KUDA 3KUYD 5BS7C 5B32A 3KXBC 3UTAA 5E5AD 5JA4A 3AZFA 4XUJA 4WU9A 1EQZC 4Z66C 3AZED 1JFIA 1F66C 4UUZB 4AWLB 3MGRD 3EPLA 1BH9A 2BYMB 5AV8C 3AL0C 3MGPA 1P3BC 3H0LC 1ID3A 3MGSA 5B33C 1U35D 5BNVA 4JJNC 3W97A 5AV9C 3UT9C 2AROA 3REIA 5JRGD 5B2JC 3X1VD 5B0YC 1M18D 3AV2D 3WKJD 3LZ1C 4YM6C 3B6GD 2CV5D 1P3KC 3A6NB 3AZMA 4J8WD 3WA9C 5DNMC 4LD9B 4YS3C 2ZY5A 5AV6D 4KUDC 3H0MC 2BYKB 5GSUB 5B24A 5AVCD 3FDDA 5GT3D 4UUZA 5B32C 3REJD 3UTAC 4NE6A 2Y2IA 2BYMA 3C1BB 2ZM5A 1KX3B 3MNNB 4WU8B 3AZFC 1S32D 2ZY3A 1P3PD 1P3LD 2XD1A 4XUJC 1BH8B 4WU9C 4G92B 2ZY2A 5B0ZB 3WAAD 3MGPC 2G5HC 4H9NB 1ID3C 3IP4C 4UPKA 5DNNC 3X1UD 3AFAB 3MGSC 5KDMB 3AZHB 3A6NA 3UTBB 3AZID 3W97C 5FUGB 4LD9A 5AVBB 5B2IC 2AROC 3REIC 3O62D 4WJ3C 2BYKA 5GXQD 5GSUA 4NE3A 1M19D 1KU5A 3MVDB 3AZJD 2F8NH 3LZ0B 4ZUXB 3MGQB 3VH5A 3C1BA 1KX3A 3LJAA 1KX4A 3R45B 4KGCD 3MNNA 4WU8A 2JCHA 1P3IB 1PZRA 5BNXB 1P3AB 4J8XB 4AWLC 3KWQD 1Z2CB 5B0ZA 4H9NA 2Y2OA 3W96A 4J8UB 2G5IC 3REHD 1P3GD 3AFAA 4H9SC 3AZHA 5G49B 5KDMA 4X23D 5CPJB 3AZGB 3UTBA 5FUGA 5AVBA 1P3MB 5BT1C 1EQZD 3MVDA 4Z66D 1KX5D 5F99D 3A6NC 3LZ0A 4ZUXA 3MGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R45 A;  1P34 D;  5AV8 D;  1P3I A;  5BNX A;  2F8N D;  1P3A A;  5GSU C;  4J8X A;  2FJ7 C;  2IO5 B;  3NQU B;  5B33 D;  4JJN D;  4EO5 B;  3KXB A;  2NZD D;  5AV9 D;  3C1B C;  3UT9 D;  1KX3 C;  3MNN C;  4WU8 C;  5B2J D;  5B1L B;  4J8U A;  1P3F A;  5B31 D;  5G49 A;  4E44 A;  3LZ1 D;  4YM6 D;  5CPJ A;  3AZG A;  1P3K D;  3WA9 D;  3B0C T;  5DNM D;  4YS3 D;  5B0Z C;  4R8P D;  3AN2 B;  3AZL B;  5CPI B;  4KUD D;  5CPK C;  1P3B A;  1B67 A;  4XZQ B;  3AFA C;  4QLC B;  3AZH C;  2CWE A;  5B32 D;  5AY8 B;  4Z5T B;  3UTB C;  5AVB C;  2PYO B;  3B0C W;  3AZF D;  1F1E A;  3VH6 T;  5B0Y A;  4WU9 D;  3MVD C;  3NQU A;  5GT0 B;  3W98 B;  3LZ0 C;  4ZUX C;  3MGQ C;  1P3I C;  3MGP D;  5B1L A;  4CAY B;  1ID3 D;  1P3A C;  4J8X C;  3WTP D;  5BO0 A;  3MGS D;  3VH6 W;  3W97 D;  2ARO D;  3REI D;  3AZL A;  5CPI A;  4Z2M G;  4J8U C;  1P3F C;  4XZQ A;  3REL B;  4QLC A;  5CPJ C;  5AY8 A;  3AZG C;  4Z5T A;  3B6F B;  3AZM D;  4WNN A;  1P3M C;  2PYO A;  5DNN A;  5B24 D;  5GT0 A;  3W98 A;  5B2I A;  3AZE B;  4CAY A;  2IO5 C;  3AYW B;  4EO5 C;  3C1C B;  4J8V B;  3W99 B;  5B1L C;  5BT1 D;  3REL A;  2FJ7 B;  1TAF B;  4KHA B;  3KSY A;  5JRG B;  5CP6 D;  3AV1 B;  3A6N D;  3B6F A;  1P3O D;  4LD9 D;  3AV2 B;  3AN2 C;  3AZN D;  3AZL C;  5CPI C;  2CV5 B;  5GSU D;  3TU4 D;  4XZQ C;  4QLC C;  4H9S A;  5AY8 C;  4Z5T C;  3B0D B;  3C1B D;  1KX3 D;  3LJA D;  1KX4 D;  2PYO C;  3AZE A;  3MNN D;  3REK D;  4WU8 D;  2F8N K;  3REJ B;  5CPK B;  1TZY D;  3AZK D;  5GT0 C;  3W98 C;  3AYW A;  3C1C A;  1ZLA B;  4J8V A;  1S32 B;  3X1S D;  1P3P B;  1AOI B;  5B0Z D;  3W99 A;  4LD9 C;  3W96 D;  5B40 B;  2FJ7 A;  3AZH D;  1TAF A;  4KHA A;  5JRG A;  3AV1 A;  3UTB D;  5AVB D;  4G91 B;  3REL C;  1BH8 A;  3MVD D;  3O62 B;  3B6F C;  4H9R B;  4ZUX D;  5GXQ B;  3MGQ D;  1M19 B;  1P3I D;  3AZJ B;  3REJ A;  5CPK A;  1R4V A;  4J8X D;  5E5A C;  5AV5 B;  3KXB D;  1S32 A;  1P3P A;  1ZLA A;  1AOI A;  5CHL B;  1Q9C A;  3AZE C;  4CSR B;  5B40 A;  1P3F D;  5CPJ D;  1F66 D;  3AYW C;  3C1C C;  4J8V C;  3REH B;  1P3G B;  2NQB B;  3W99 C;  5B31 G;  3LEL B;  1P3B D;  4H9Q B;  1WWS A;  1M1A B;  5JRG C;  2L5A A;  3AV1 C;  3AV2 C;  1H3O B;  5B1M B;  1KX5 B;  5F99 B;  2CV5 C;  1HTA A;  5B0Y D;  1P34 B;  5AV5 A;  2YFV B;  3B0D C;  1P3M A;  1HQ3 B;  5B1L D;  3REJ C;  2NZD B;  4CSR A;  2HIO B;  1ZLA C;  1S32 C;  1P3P C;  1AOI C;  3UTA D;  5B31 B;  1P3G A;  2NQB A;  2JSS A;  3B0B A;  3AZL D;  5CPI D;  3LEL A;  3V9R B;  4H9Q A;  4XUJ D;  3NQJ B;  5B40 C;  4QLC D;  4R8P B;  3X1T B;  1M1A A;  3VH5 T;  5AY8 D;  5B1M A;  2RVQ C;  1ULY A;  5F99 A;  1KX5 A;  4G91 C;  1BFM A;  5DNN D;  1P34 A;  5GT0 D;  3W98 D;  3O62 C;  2YFV A;  5GXQ C;  3VH5 W;  1M19 C;  5B2I D;  1HQ3 A;  3AN2 A;  1JFI B;  1N1J B;  3AZJ C;  4Z2M H;  2NZD A;  2HIO A;  5AV5 C;  3WTP B;  5B31 A;  5C3I C;  3KUY B;  3V9R A;  3NQJ A;  3REL D;  4WV4 B;  3X1T A;  2HUE B;  5E5A B;  3B6F D;  3REH C;  1P3G C;  2NQB C;  4X23 C;  3LEL C;  3MGR B;  3AZM B;  1M1A C;  5B24 B;  5B1M C;  1N1J A;  1KX5 C;  5F99 C;  1U35 B;  4NFT A;  1P34 C;  3AYW D;  3C1C D;  4J8V D;  3X1V B;  4M6B A;  3WTP A;  1M18 B;  1HQ3 C;  3WKJ B;  3KUY A;  3W99 D;  3B6G B;  2NZD C;  2HIO C;  4J8W B;  2FJ7 D;  5E5A A;  1WWI A;  3AV1 D;  5AV6 B;  5B31 C;  5AVC B;  5GT3 B;  5CP6 B;  4WZS B;  3MGR A;  1P3O B;  4R8P C;  3X1T C;  3AZN B;  1P3L B;  3TU4 B;  3WTP E;  1U35 A;  5CPK D;  3AFA D;  1KX4 B;  3LJA B;  3REK B;  3WAA B;  2YFW B;  1ZLA D;  3X1V A;  1AOI D;  1M18 A;  1TZY B;  3AV2 A;  3WKJ A;  3AZK B;  3X1U B;  3B6G A;  4NE5 A;  2CV5 A;  4ZBJ B;  3X1S B;  5B40 D;  4J8W A;  3AZI B;  5AV6 A;  3LZ0 D;  3W96 B;  3WTP C;  4HGA B;  5AVC A;  2RVQ D;  3KUY C;  5GT3 A;  5CP6 A;  1P3A D;  1P3O A;  2HUE C;  3AZN A;  4KGC B;  1P3L A;  3TU4 A;  2F8N G;  3VH6 A;  5C3I B;  2LY8 A;  3MGR C;  3KWQ B;  4J8U D;  3AZM C;  4DRA A;  5AV5 D;  3REK A;  2YFW A;  3WAA A;  3AZG D;  1TZY A;  1P3M D;  5B24 C;  4H9O B;  3AZK A;  3X1U A;  1U35 C;  4X23 B;  3KXB B;  3X1S A;  3AZI A;  4DRB A;  3O62 A;  3X1V C;  4H9R A;  1M18 C;  5GXQ A;  3WKJ C;  1M19 A;  4E45 A;  2NQB D;  1EQZ B;  4Z66 B;  3AZJ A;  1F66 B;  3B6G C;  3LEL D;  4J8W C;  5B32 G;  1M1A D;  4KGC A;  5AV8 B;  5AV6 C;  1P3B B;  2F8N B;  5B1M D;  5AVC C;  5GT3 C;  4H9P B;  5B33 B;  4JJN B;  5CP6 C;  3KWQ A;  1P3O C;  5AV9 B;  3UT9 B;  3AZN C;  5B2J B;  1P3L C;  3REH A;  3TU4 C;  5B0Y B;  4H9O A;  3AN2 D;  1HQ3 D;  5BS7 A;  4X23 A;  4YM6 B;  3LZ1 B;  1A7W A;  1P3K B;  2HIO D;  3WA9 B;  4XZQ D;  1B6W A;  3LJA C;  5DNM B;  4YS3 B;  1KX4 C;  3REK C;  3WAA C;  4Z5T D;  4KUD B;  1TZY C;  3AZK C;  1H3O A;  3X1U C;  4G92 C;  5BO0 B;  4Z66 A;  1EQZ A;  1F66 A;  2PYO D;  5B32 B;  4ZBJ C;  3AZI C;  3X1S C;  3UTA B;  3X1T D;  5JA4 B;  5AV8 A;  3AZF B;  3W96 C;  2F8N A;  4XUJ B;  4HGA C;  4WU9 B;  4H9P A;  5B33 A;  4JJN A;  1BH9 B;  4WNN B;  5AV9 A;  3UT9 A;  4KGC C;  5B2J A;  3MGP B;  1ID3 B;  5DNN B;  3LZ1 A;  3MGS B;  4YM6 A;  5BNV B;  1P3K A;  3KWQ C;  3W97 B;  3WA9 A;  5DNM A;  4YS3 A;  5B2I B;  2ARO B;  4R8P A;  3REI B;  4KUD A;  3KUY D;  5BS7 C;  5B32 A;  3KXB C;  3UTA A;  5E5A D;  5JA4 A;  3AZF A;  4XUJ A;  4WU9 A;  1EQZ C;  4Z66 C;  3AZE D;  1JFI A;  1F66 C;  4UUZ B;  4AWL B;  3MGR D;  1BH9 A;  2BYM B;  5AV8 C;  3MGP A;  1P3B C;  1ID3 A;  3MGS A;  5B33 C;  1U35 D;  5BNV A;  4JJN C;  3W97 A;  5AV9 C;  3UT9 C;  2ARO A;  3REI A;  5JRG D;  5B2J C;  3X1V D;  5B0Y C;  1M18 D;  3AV2 D;  3WKJ D;  3LZ1 C;  4YM6 C;  3B6G D;  2CV5 D;  1P3K C;  3A6N B;  3AZM A;  4J8W D;  3WA9 C;  5DNM C;  4LD9 B;  4YS3 C;  5AV6 D;  4KUD C;  2BYK B;  5GSU B;  5B24 A;  5AVC D;  5GT3 D;  4UUZ A;  5B32 C;  3REJ D;  3UTA C;  4NE6 A;  2BYM A;  3C1B B;  1KX3 B;  3MNN B;  4WU8 B;  3AZF C;  1S32 D;  1P3P D;  1P3L D;  4XUJ C;  1BH8 B;  4WU9 C;  4G92 B;  5B0Z B;  3WAA D;  3MGP C;  1ID3 C;  4H9N B;  5DNN C;  3X1U D;  3AFA B;  3MGS C;  5KDM B;  3AZH B;  3A6N A;  3UTB B;  3AZI D;  3W97 C;  5FUG B;  4LD9 A;  5AVB B;  5B2I C;  2ARO C;  3REI C;  3O62 D;  2BYK A;  5GXQ D;  5GSU A;  4NE3 A;  1M19 D;  1KU5 A;  3MVD B;  3AZJ D;  2F8N H;  3LZ0 B;  4ZUX B;  3MGQ B;  3VH5 A;  3C1B A;  1KX3 A;  3LJA A;  1KX4 A;  3R45 B;  4KGC D;  3MNN A;  4WU8 A;  1P3I B;  5BNX B;  1P3A B;  4J8X B;  4AWL C;  3KWQ D;  5B0Z A;  4H9N A;  3W96 A;  4J8U B;  3REH D;  1P3F B;  1P3G D;  3AFA A;  4H9S C;  3AZH A;  5G49 B;  5KDM A;  4X23 D;  5CPJ B;  3AZG B;  3UTB A;  5FUG A;  5AVB A;  1P3M B;  5BT1 C;  1EQZ D;  3MVD A;  4Z66 D;  1KX5 D;  5F99 D;  3A6N C;  3LZ0 A;  4ZUX A;  3MGQ A; 
#chains in the Genus database with same CATH topology
 3R45 A;  1P34 D;  5AV8 D;  1P3I A;  5BNX A;  2F8N D;  1P3A A;  5GSU C;  4J8X A;  2FJ7 C;  2IO5 B;  3NQU B;  5B33 D;  4JJN D;  1W2E A;  4EO5 B;  3KXB A;  2NZD D;  5AV9 D;  3C1B C;  3UT9 D;  1KX3 C;  3MNN C;  4WU8 C;  5B2J D;  5B1L B;  4J8U A;  1P3F A;  5B31 D;  5G49 A;  4E44 A;  3LZ1 D;  4YM6 D;  5CPJ A;  3AZG A;  1P3K D;  3WA9 D;  3B0C T;  5DNM D;  4YS3 D;  5B0Z C;  4R8P D;  3AN2 B;  3AZL B;  5CPI B;  4KUD D;  5CPK C;  1P3B A;  3EPK A;  1B67 A;  4XZQ B;  3AFA C;  4QLC B;  3AZH C;  2CWE A;  5B32 D;  5AY8 B;  4Z5T B;  3UTB C;  2Y2K A;  5AVB C;  2PYO B;  3B0C W;  3AZF D;  1F1E A;  3VH6 T;  5B0Y A;  4WU9 D;  3MVD C;  3NQU A;  5GT0 B;  3W98 B;  3LZ0 C;  4ZUX C;  3MGQ C;  1P3I C;  3MGP D;  5B1L A;  4CAY B;  1ID3 D;  1P3A C;  2Y2J A;  3WTP D;  4J8X C;  5BO0 A;  3MGS D;  3VH6 W;  3W97 D;  2ARO D;  3REI D;  3AZL A;  5CPI A;  4Z2M G;  4J8U C;  1P3F C;  4XZQ A;  3REL B;  4QLC A;  5CPJ C;  5AY8 A;  3AZG C;  4Z5T A;  2W8S A;  3B6F B;  3AZM D;  4WNN A;  1P3M C;  2PYO A;  5DNN A;  5B24 D;  5GT0 A;  3W98 A;  5B2I A;  3AZE B;  4CAY A;  2IO5 C;  3AYW B;  4EO5 C;  3C1C B;  4J8V B;  3W99 B;  5B1L C;  5BT1 D;  3REL A;  2FJ7 B;  1TAF B;  4KHA B;  3KSY A;  5JRG B;  5CP6 D;  3AV1 B;  3A6N D;  3B6F A;  1P3O D;  4LD9 D;  3AV2 B;  3AN2 C;  3AZN D;  2F2A C;  3AZL C;  5CPI C;  2CV5 B;  5GSU D;  3TU4 D;  4XZQ C;  4QLC C;  4H9S A;  5AY8 C;  4Z5T C;  3B0D B;  3C1B D;  1KX3 D;  3LJA D;  1KX4 D;  2PYO C;  3AZE A;  3MNN D;  3REK D;  4WU8 D;  2F8N K;  3REJ B;  5CPK B;  1TZY D;  3AZK D;  5GT0 C;  3W98 C;  3AYW A;  3C1C A;  3EPH A;  1ZLA B;  2Y2H A;  4J8V A;  2VQR A;  2Y2Q A;  3X1S D;  2Y2P A;  1S32 B;  1P3P B;  1AOI B;  2J8P A;  5B0Z D;  3F6T A;  3W99 A;  4LD9 C;  3W96 D;  5B40 B;  2FJ7 A;  3AZH D;  1TAF A;  4KHA A;  5JRG A;  2ZY4 A;  3AV1 A;  3UTB D;  3EPJ A;  5AVB D;  4G91 B;  3REL C;  1BH8 A;  3MVD D;  3O62 B;  3B6F C;  4H9R B;  4ZUX D;  5GXQ B;  3MGQ D;  1M19 B;  1P3I D;  3AZJ B;  3REJ A;  5CPK A;  1R4V A;  4J8X D;  5E5A C;  5AV5 B;  3KXB D;  1S32 A;  1P3P A;  1ZLA A;  1AOI A;  5CHL B;  1Q9C A;  3AZE C;  3A1I A;  4CSR B;  5B40 A;  1P3F D;  2DQN C;  5CPJ D;  1F66 D;  3EG5 B;  3C1C C;  3AYW C;  4J8V C;  3REH B;  3KFU G;  1P3G B;  2NQB B;  3W99 C;  5B31 G;  3LEL B;  1P3B D;  4H9Q B;  1WWS A;  1M1A B;  5JRG C;  2L5A A;  2Y2N A;  3AV1 C;  3AV2 C;  1H3O B;  5B1M B;  1KX5 B;  5F99 B;  2CV5 C;  1HTA A;  5B0Y D;  1P34 B;  5AV5 A;  2YFV B;  3B0D C;  2RIQ A;  1P3M A;  1HQ3 B;  5B1L D;  3REJ C;  2NZD B;  4CSR A;  2HIO B;  1ZLA C;  1S32 C;  1P3P C;  1AOI C;  3UTA D;  5B31 B;  1P3G A;  2NQB A;  2JSS A;  3B0B A;  3AZL D;  5CPI D;  3LEL A;  3V9R B;  4H9Q A;  4XUJ D;  3NQJ B;  1T3U A;  5B40 C;  4QLC D;  4R8P B;  3X1T B;  1M1A A;  3VH5 T;  5AY8 D;  5B1M A;  2RVQ C;  1ULY A;  5F99 A;  1KX5 A;  4G91 C;  1BFM A;  5DNN D;  1P34 A;  5GT0 D;  3W98 D;  3O62 C;  2YFV A;  5GXQ C;  3VH5 W;  1M19 C;  5B2I D;  1HQ3 A;  3AN2 A;  1JFI B;  1N1J B;  3AZJ C;  4Z2M H;  2NZD A;  2HIO A;  5AV5 C;  3WTP B;  5B31 A;  3P5J B;  5C3I C;  3KUY B;  2DF4 C;  3V9R A;  3NQJ A;  3REL D;  3H0R C;  4WV4 B;  3X1T A;  2HUE B;  2Y2L A;  5E5A B;  1P3F B;  3B6F D;  3REH C;  1P3G C;  2NQB C;  4X23 C;  3LEL C;  3MGR B;  3AZM B;  1M1A C;  5B24 B;  5B1M C;  1N1J A;  1KX5 C;  5F99 C;  1U35 B;  4NFT A;  1P34 C;  3AYW D;  3C1C D;  4J8V D;  3X1V B;  4M6B A;  3WTP A;  1M18 B;  1HQ3 C;  2XD5 A;  3WKJ B;  3KUY A;  3W99 D;  3B6G B;  2NZD C;  2HIO C;  4J8W B;  2FJ7 D;  5E5A A;  1WWI A;  3AV1 D;  5AV6 B;  2Y2G A;  5B31 C;  5AVC B;  5GT3 B;  5CP6 B;  4WZS B;  3MGR A;  1P3O B;  4R8P C;  3X1T C;  3AZN B;  1P3L B;  3TU4 B;  3WTP E;  1U35 A;  5CPK D;  2UWX A;  3AFA D;  1KX4 B;  3LJA B;  3REK B;  3WAA B;  2YFW B;  1ZLA D;  3X1V A;  1AOI D;  1M18 A;  1TZY B;  3AV2 A;  3WKJ A;  3AZK B;  3X1U B;  3B6G A;  2JE5 A;  4NE5 A;  4ZBJ B;  2CV5 A;  3X1S B;  5B40 D;  4J8W A;  3AZI B;  5AV6 A;  3LZ0 D;  3W96 B;  3WTP C;  4HGA B;  5AVC A;  2BG1 A;  2RVQ D;  5GT3 A;  3KUY C;  5CP6 A;  1P3A D;  1P3O A;  2HUE C;  3AZN A;  4KGC B;  1P3L A;  3TU4 A;  2F8N G;  3VH6 A;  5C3I B;  2LY8 A;  3MGR C;  3KWQ B;  4J8U D;  3AZM C;  4DRA A;  5AV5 D;  3REK A;  2YFW A;  3WAA A;  3AZG D;  1TZY A;  1P3M D;  5B24 C;  4H9O B;  3AZK A;  3X1U A;  1U35 C;  4X23 B;  4DQY B;  3KXB B;  3X1S A;  3AZI A;  4DRB A;  3O62 A;  3X1V C;  4H9R A;  1M18 C;  5GXQ A;  3WKJ C;  1M19 A;  4E45 A;  2NQB D;  1EQZ B;  4Z66 B;  3AZJ A;  1F66 B;  3B6G C;  3LEL D;  4J8W C;  5B32 G;  1M1A D;  4KGC A;  5AV8 B;  5AV6 C;  1P3B B;  2F8N B;  5B1M D;  5AVC C;  5GT3 C;  4H9P B;  5B33 B;  4JJN B;  5CP6 C;  3KWQ A;  1P3O C;  5AV9 B;  3UT9 B;  3AZN C;  5B2J B;  1P3L C;  3A1K A;  3REH A;  5B0Y B;  3TU4 C;  4H9O A;  3AN2 D;  1HQ3 D;  5BS7 A;  4X23 A;  4YM6 B;  3LZ1 B;  1A7W A;  1P3K B;  2HIO D;  3WA9 B;  4XZQ D;  1B6W A;  3LJA C;  5DNM B;  4YS3 B;  1KX4 C;  3REK C;  3WAA C;  4Z5T D;  4KUD B;  1TZY C;  3AZK C;  1H3O A;  3X1U C;  4G92 C;  5BO0 B;  4Z66 A;  1EQZ A;  1F66 A;  2PYO D;  5B32 B;  4ZBJ C;  3AZI C;  3X1S C;  3UTA B;  3X1T D;  5JA4 B;  2FFF B;  5AV8 A;  3AZF B;  3W96 C;  2F8N A;  4XUJ B;  4HGA C;  4WU9 B;  4H9P A;  5B33 A;  4JJN A;  1BH9 B;  4WNN B;  5AV9 A;  3UT9 A;  4KGC C;  5B2J A;  3MGP B;  1ID3 B;  2Y2M A;  5DNN B;  3LZ1 A;  3MGS B;  4YM6 A;  5BNV B;  1P3K A;  3KWQ C;  3W97 B;  3WA9 A;  5DNM A;  4YS3 A;  5B2I B;  2ARO B;  4R8P A;  3REI B;  4KUD A;  3KUY D;  5BS7 C;  5B32 A;  3KXB C;  3UTA A;  5E5A D;  5JA4 A;  3AZF A;  4XUJ A;  4WU9 A;  1EQZ C;  4Z66 C;  3AZE D;  1JFI A;  1F66 C;  4UUZ B;  4AWL B;  3MGR D;  3EPL A;  1BH9 A;  2BYM B;  5AV8 C;  3AL0 C;  3MGP A;  1P3B C;  3H0L C;  1ID3 A;  3MGS A;  5B33 C;  1U35 D;  5BNV A;  4JJN C;  3W97 A;  5AV9 C;  3UT9 C;  2ARO A;  3REI A;  5JRG D;  5B2J C;  3X1V D;  5B0Y C;  1M18 D;  3AV2 D;  3WKJ D;  3LZ1 C;  4YM6 C;  3B6G D;  2CV5 D;  1P3K C;  3A6N B;  3AZM A;  4J8W D;  3WA9 C;  5DNM C;  4LD9 B;  4YS3 C;  2ZY5 A;  5AV6 D;  4KUD C;  3H0M C;  2BYK B;  5GSU B;  5B24 A;  5AVC D;  3FDD A;  5GT3 D;  4UUZ A;  5B32 C;  3REJ D;  3UTA C;  4NE6 A;  2Y2I A;  2BYM A;  3C1B B;  2ZM5 A;  1KX3 B;  3MNN B;  4WU8 B;  3AZF C;  1S32 D;  2ZY3 A;  1P3P D;  1P3L D;  2XD1 A;  4XUJ C;  1BH8 B;  4WU9 C;  4G92 B;  2ZY2 A;  5B0Z B;  3WAA D;  3MGP C;  2G5H C;  4H9N B;  1ID3 C;  3IP4 C;  4UPK A;  5DNN C;  3X1U D;  3AFA B;  3MGS C;  5KDM B;  3AZH B;  3A6N A;  3UTB B;  3AZI D;  3W97 C;  5FUG B;  4LD9 A;  5AVB B;  5B2I C;  2ARO C;  3REI C;  3O62 D;  4WJ3 C;  2BYK A;  5GXQ D;  5GSU A;  4NE3 A;  1M19 D;  1KU5 A;  3MVD B;  3AZJ D;  2F8N H;  3LZ0 B;  4ZUX B;  3MGQ B;  3VH5 A;  3C1B A;  1KX3 A;  3LJA A;  1KX4 A;  3R45 B;  4KGC D;  3MNN A;  4WU8 A;  2JCH A;  1P3I B;  1PZR A;  5BNX B;  1P3A B;  4J8X B;  4AWL C;  3KWQ D;  1Z2C B;  5B0Z A;  4H9N A;  2Y2O A;  3W96 A;  4J8U B;  2G5I C;  3REH D;  1P3G D;  3AFA A;  4H9S C;  3AZH A;  5G49 B;  5KDM A;  4X23 D;  5CPJ B;  3AZG B;  3UTB A;  5FUG A;  5AVB A;  1P3M B;  5BT1 C;  1EQZ D;  3MVD A;  4Z66 D;  1KX5 D;  5F99 D;  3A6N C;  3LZ0 A;  4ZUX A;  3MGQ A; 
#chains in the Genus database with same CATH homology
 3R45 A;  1P34 D;  5AV8 D;  1P3I A;  5BNX A;  2F8N D;  1P3A A;  5GSU C;  4J8X A;  2FJ7 C;  2IO5 B;  3NQU B;  5B33 D;  4JJN D;  1W2E A;  4EO5 B;  3KXB A;  2NZD D;  5AV9 D;  3C1B C;  3UT9 D;  1KX3 C;  3MNN C;  4WU8 C;  5B2J D;  5B1L B;  4J8U A;  1P3F A;  5B31 D;  5G49 A;  4E44 A;  3LZ1 D;  4YM6 D;  5CPJ A;  3AZG A;  1P3K D;  3WA9 D;  3B0C T;  5DNM D;  4YS3 D;  5B0Z C;  4R8P D;  3AN2 B;  3AZL B;  5CPI B;  4KUD D;  5CPK C;  1P3B A;  3EPK A;  1B67 A;  4XZQ B;  3AFA C;  4QLC B;  3AZH C;  2CWE A;  5B32 D;  5AY8 B;  4Z5T B;  3UTB C;  2Y2K A;  5AVB C;  2PYO B;  3B0C W;  3AZF D;  1F1E A;  3VH6 T;  5B0Y A;  4WU9 D;  3MVD C;  3NQU A;  5GT0 B;  3W98 B;  3LZ0 C;  4ZUX C;  3MGQ C;  1P3I C;  3MGP D;  5B1L A;  4CAY B;  1ID3 D;  1P3A C;  2Y2J A;  3WTP D;  4J8X C;  5BO0 A;  3MGS D;  3VH6 W;  3W97 D;  2ARO D;  3REI D;  3AZL A;  5CPI A;  4Z2M G;  4J8U C;  1P3F C;  4XZQ A;  3REL B;  4QLC A;  5CPJ C;  5AY8 A;  3AZG C;  4Z5T A;  2W8S A;  3B6F B;  3AZM D;  4WNN A;  1P3M C;  2PYO A;  5DNN A;  5B24 D;  5GT0 A;  3W98 A;  5B2I A;  3AZE B;  4CAY A;  2IO5 C;  3AYW B;  4EO5 C;  3C1C B;  4J8V B;  3W99 B;  5B1L C;  5BT1 D;  3REL A;  2FJ7 B;  1TAF B;  4KHA B;  3KSY A;  5JRG B;  5CP6 D;  3AV1 B;  3A6N D;  3B6F A;  1P3O D;  4LD9 D;  3AV2 B;  3AN2 C;  3AZN D;  2F2A C;  3AZL C;  5CPI C;  2CV5 B;  5GSU D;  3TU4 D;  4XZQ C;  4QLC C;  4H9S A;  5AY8 C;  4Z5T C;  3B0D B;  3C1B D;  1KX3 D;  3LJA D;  1KX4 D;  2PYO C;  3AZE A;  3MNN D;  3REK D;  4WU8 D;  2F8N K;  3REJ B;  5CPK B;  1TZY D;  3AZK D;  5GT0 C;  3W98 C;  3AYW A;  3C1C A;  3EPH A;  1ZLA B;  2Y2H A;  4J8V A;  2VQR A;  2Y2Q A;  3X1S D;  2Y2P A;  1S32 B;  1P3P B;  1AOI B;  2J8P A;  5B0Z D;  3F6T A;  3W99 A;  4LD9 C;  3W96 D;  5B40 B;  2FJ7 A;  3AZH D;  1TAF A;  4KHA A;  5JRG A;  2ZY4 A;  3AV1 A;  3UTB D;  3EPJ A;  5AVB D;  4G91 B;  3REL C;  1BH8 A;  3MVD D;  3O62 B;  3B6F C;  4H9R B;  4ZUX D;  5GXQ B;  3MGQ D;  1M19 B;  1P3I D;  3AZJ B;  3REJ A;  5CPK A;  1R4V A;  4J8X D;  5E5A C;  5AV5 B;  3KXB D;  1S32 A;  1P3P A;  1ZLA A;  1AOI A;  5CHL B;  1Q9C A;  3AZE C;  3A1I A;  4CSR B;  5B40 A;  1P3F D;  2DQN C;  5CPJ D;  1F66 D;  3EG5 B;  3C1C C;  3AYW C;  4J8V C;  3REH B;  3KFU G;  1P3G B;  2NQB B;  3W99 C;  5B31 G;  3LEL B;  1P3B D;  4H9Q B;  1WWS A;  1M1A B;  5JRG C;  2L5A A;  2Y2N A;  3AV1 C;  3AV2 C;  1H3O B;  5B1M B;  1KX5 B;  5F99 B;  2CV5 C;  1HTA A;  5B0Y D;  1P34 B;  5AV5 A;  2YFV B;  3B0D C;  2RIQ A;  1P3M A;  1HQ3 B;  5B1L D;  3REJ C;  2NZD B;  4CSR A;  2HIO B;  1ZLA C;  1S32 C;  1P3P C;  1AOI C;  3UTA D;  5B31 B;  1P3G A;  2NQB A;  2JSS A;  3B0B A;  3AZL D;  5CPI D;  3LEL A;  3V9R B;  4H9Q A;  4XUJ D;  3NQJ B;  1T3U A;  5B40 C;  4QLC D;  4R8P B;  3X1T B;  1M1A A;  3VH5 T;  5AY8 D;  5B1M A;  2RVQ C;  1ULY A;  5F99 A;  1KX5 A;  4G91 C;  1BFM A;  5DNN D;  1P34 A;  5GT0 D;  3W98 D;  3O62 C;  2YFV A;  5GXQ C;  3VH5 W;  1M19 C;  5B2I D;  1HQ3 A;  3AN2 A;  1JFI B;  1N1J B;  3AZJ C;  4Z2M H;  2NZD A;  2HIO A;  5AV5 C;  3WTP B;  5B31 A;  3P5J B;  5C3I C;  3KUY B;  2DF4 C;  3V9R A;  3NQJ A;  3REL D;  3H0R C;  4WV4 B;  3X1T A;  2HUE B;  2Y2L A;  5E5A B;  1P3F B;  3B6F D;  3REH C;  1P3G C;  2NQB C;  4X23 C;  3LEL C;  3MGR B;  3AZM B;  1M1A C;  5B24 B;  5B1M C;  1N1J A;  1KX5 C;  5F99 C;  1U35 B;  4NFT A;  1P34 C;  3AYW D;  3C1C D;  4J8V D;  3X1V B;  4M6B A;  3WTP A;  1M18 B;  1HQ3 C;  2XD5 A;  3WKJ B;  3KUY A;  3W99 D;  3B6G B;  2NZD C;  2HIO C;  4J8W B;  2FJ7 D;  5E5A A;  1WWI A;  3AV1 D;  5AV6 B;  2Y2G A;  5B31 C;  5AVC B;  5GT3 B;  5CP6 B;  4WZS B;  3MGR A;  1P3O B;  4R8P C;  3X1T C;  3AZN B;  1P3L B;  3TU4 B;  3WTP E;  1U35 A;  5CPK D;  2UWX A;  3AFA D;  1KX4 B;  3LJA B;  3REK B;  3WAA B;  2YFW B;  1ZLA D;  3X1V A;  1AOI D;  1M18 A;  1TZY B;  3AV2 A;  3WKJ A;  3AZK B;  3X1U B;  3B6G A;  2JE5 A;  4NE5 A;  4ZBJ B;  2CV5 A;  3X1S B;  5B40 D;  4J8W A;  3AZI B;  5AV6 A;  3LZ0 D;  3W96 B;  3WTP C;  4HGA B;  5AVC A;  2BG1 A;  2RVQ D;  5GT3 A;  3KUY C;  5CP6 A;  1P3A D;  1P3O A;  2HUE C;  3AZN A;  4KGC B;  1P3L A;  3TU4 A;  2F8N G;  3VH6 A;  5C3I B;  2LY8 A;  3MGR C;  3KWQ B;  4J8U D;  3AZM C;  4DRA A;  5AV5 D;  3REK A;  2YFW A;  3WAA A;  3AZG D;  1TZY A;  1P3M D;  5B24 C;  4H9O B;  3AZK A;  3X1U A;  1U35 C;  4X23 B;  4DQY B;  3KXB B;  3X1S A;  3AZI A;  4DRB A;  3O62 A;  3X1V C;  4H9R A;  1M18 C;  5GXQ A;  3WKJ C;  1M19 A;  4E45 A;  2NQB D;  1EQZ B;  4Z66 B;  3AZJ A;  1F66 B;  3B6G C;  3LEL D;  4J8W C;  5B32 G;  1M1A D;  4KGC A;  5AV8 B;  5AV6 C;  1P3B B;  2F8N B;  5B1M D;  5AVC C;  5GT3 C;  4H9P B;  5B33 B;  4JJN B;  5CP6 C;  3KWQ A;  1P3O C;  5AV9 B;  3UT9 B;  3AZN C;  5B2J B;  1P3L C;  3A1K A;  3REH A;  5B0Y B;  3TU4 C;  4H9O A;  3AN2 D;  1HQ3 D;  5BS7 A;  4X23 A;  4YM6 B;  3LZ1 B;  1A7W A;  1P3K B;  2HIO D;  3WA9 B;  4XZQ D;  1B6W A;  3LJA C;  5DNM B;  4YS3 B;  1KX4 C;  3REK C;  3WAA C;  4Z5T D;  4KUD B;  1TZY C;  3AZK C;  1H3O A;  3X1U C;  4G92 C;  5BO0 B;  4Z66 A;  1EQZ A;  1F66 A;  2PYO D;  5B32 B;  4ZBJ C;  3AZI C;  3X1S C;  3UTA B;  3X1T D;  5JA4 B;  2FFF B;  5AV8 A;  3AZF B;  3W96 C;  2F8N A;  4XUJ B;  4HGA C;  4WU9 B;  4H9P A;  5B33 A;  4JJN A;  1BH9 B;  4WNN B;  5AV9 A;  3UT9 A;  4KGC C;  5B2J A;  3MGP B;  1ID3 B;  2Y2M A;  5DNN B;  3LZ1 A;  3MGS B;  4YM6 A;  5BNV B;  1P3K A;  3KWQ C;  3W97 B;  3WA9 A;  5DNM A;  4YS3 A;  5B2I B;  2ARO B;  4R8P A;  3REI B;  4KUD A;  3KUY D;  5BS7 C;  5B32 A;  3KXB C;  3UTA A;  5E5A D;  5JA4 A;  3AZF A;  4XUJ A;  4WU9 A;  1EQZ C;  4Z66 C;  3AZE D;  1JFI A;  1F66 C;  4UUZ B;  4AWL B;  3MGR D;  3EPL A;  1BH9 A;  2BYM B;  5AV8 C;  3AL0 C;  3MGP A;  1P3B C;  3H0L C;  1ID3 A;  3MGS A;  5B33 C;  1U35 D;  5BNV A;  4JJN C;  3W97 A;  5AV9 C;  3UT9 C;  2ARO A;  3REI A;  5JRG D;  5B2J C;  3X1V D;  5B0Y C;  1M18 D;  3AV2 D;  3WKJ D;  3LZ1 C;  4YM6 C;  3B6G D;  2CV5 D;  1P3K C;  3A6N B;  3AZM A;  4J8W D;  3WA9 C;  5DNM C;  4LD9 B;  4YS3 C;  2ZY5 A;  5AV6 D;  4KUD C;  3H0M C;  2BYK B;  5GSU B;  5B24 A;  5AVC D;  3FDD A;  5GT3 D;  4UUZ A;  5B32 C;  3REJ D;  3UTA C;  4NE6 A;  2Y2I A;  2BYM A;  3C1B B;  2ZM5 A;  1KX3 B;  3MNN B;  4WU8 B;  3AZF C;  1S32 D;  2ZY3 A;  1P3P D;  1P3L D;  2XD1 A;  4XUJ C;  1BH8 B;  4WU9 C;  4G92 B;  2ZY2 A;  5B0Z B;  3WAA D;  3MGP C;  2G5H C;  4H9N B;  1ID3 C;  3IP4 C;  4UPK A;  5DNN C;  3X1U D;  3AFA B;  3MGS C;  5KDM B;  3AZH B;  3A6N A;  3UTB B;  3AZI D;  3W97 C;  5FUG B;  4LD9 A;  5AVB B;  5B2I C;  2ARO C;  3REI C;  3O62 D;  4WJ3 C;  2BYK A;  5GXQ D;  5GSU A;  4NE3 A;  1M19 D;  1KU5 A;  3MVD B;  3AZJ D;  2F8N H;  3LZ0 B;  4ZUX B;  3MGQ B;  3VH5 A;  3C1B A;  1KX3 A;  3LJA A;  1KX4 A;  3R45 B;  4KGC D;  3MNN A;  4WU8 A;  2JCH A;  1P3I B;  1PZR A;  5BNX B;  1P3A B;  4J8X B;  4AWL C;  3KWQ D;  1Z2C B;  5B0Z A;  4H9N A;  2Y2O A;  3W96 A;  4J8U B;  2G5I C;  3REH D;  1P3G D;  3AFA A;  4H9S C;  3AZH A;  5G49 B;  5KDM A;  4X23 D;  5CPJ B;  3AZG B;  3UTB A;  5FUG A;  5AVB A;  1P3M B;  5BT1 C;  1EQZ D;  3MVD A;  4Z66 D;  1KX5 D;  5F99 D;  3A6N C;  3LZ0 A;  4ZUX A;  3MGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...