2RVQD

Solution structure of the isolated histone h2a-h2b heterodimer
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
GPGMPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein/nuclear protein
molecule keywords Histone H2A type 1-B/E
publication title Solution structure of the isolated histone H2A-H2B heterodimer
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2rvqD00
3KWQB 1ID3D 5JRGB 3WA9B 2RVQC 3MGPA 4NE5A 4H9QB 2FJ7D 4G92C 5AV5A 5B40A 1P3PB 1TZYA 5B0ZD 3X1TC 3AZEB 3O62C 3TU4A 1P3MA 1KX3C 5AY8D 5KDMB 1P3AB 3X1UA 3R45A 3AZKA 3B6FA 3AZFC 2NQBA 4YM6C 1F66D 3X1VA 3MGSA 1P3KA 4G92B 1EQZC 4KGCD 5B2JA 3RELD 5GT3C 4J8WC 3O62B 3UTAC 1KX3B 5B33D 5CPJA 3REID 3LZ0D 5CPKA 2BYKB 5CP6B 4J8VD 3W98D 5AV9D 4J8XD 3AZFB 2AROC 4YM6B 1B67A 4R8PA 2HIOD 3LZ1D 3W97D 5GT0D 2F8NB 1KX5A 3AV1B 1M19A 4UUZB 5GT3B 4CAYB 4J8WB 3W99D 3REKC 1P3BD 3AZLD 4XUJA 1P3GC 3LELA 3REJA 1R4VA 3UTBC 3MGQA 3X1SD 2AROB 1HQ3D 3MGRD 1ID3C 3LJAB 5AV8A 4H9OB 3WKJD 5BNVA 3AN2D 4LD9D 1M18C 1KX4A 3REHD 5B2IA 3REKB 3AZGA 1P3LA 1P34A 3B0CW 1P3GB 2CV5A 3MVDD 1N1JB 2JSSA 3C1BB 5B31D 3AZMA 5AY8C 1KU5A 2F8NH 3C1CA 1B6WA 4Z5TA 2PYOD 1ID3B 4H9RB 1F66C 4CSRA 3MNNA 2FJ7B 3WAAA 3AYWA 5B0ZB 4KGCC 4G91C 1U35A 3AV2D 5F99C 5B33C 3WTPD 5AY8B 5GXQD 2YFVB 3REIC 1AOID 3LZ0C 3AZIA 3X1TA 4J8VC 3W98C 5AV9C 1ZLAA 3VH6T 1F66B 2HIOC 3LZ1C 5B32A 3W97C 1JFIA 4ZUXA 5DNND 5GT0C 1S32A 3AZHD 4H9PB 4JJND 2NZDA 4KGCB 4G91B 3RELB 4YS3D 1P3IA 5B33B 3REIB 3AZLC 3LZ0B 1EQZA 3B6GD 5G49B 4J8VB 2LY8A 3W98B 3X1SC 5AV9B 3UT9D 4J8XB 3UTAA 5DNMA 1TAFA 3W96A 3KXBD 2HIOB 3LZ1B 5GSUA 3MGRC 3W97B 5B1MD 1A7WA 5GT0B 3WKJC 3AZNA 1H3OB 5JA4B 5B32G 4LD9C 3REHC 3W99B 1P3BB 3AZLB 3B0DC 5B1LA 5AV6D 3AFAA 3V9RB 5BO0A 5B31C 4HGAC 3AZEC 3X1SB 1HQ3B 4X23A 2YFWA 3MGRB 3WKJB 3UTBA 4WZSB 3AN2B 4LD9B 4H9NB 3REHB 3B0DB 1BH8B 3A6NA 3MVDB 2BYMB 5CPID 5B31B 1M18A 4HGAB 3WTPC 5FUGA 5GXQC 1AOIC 4E44A 1P3OA 2PYOB 2F8NK 5AVBD 5AVCD 3KUYA 5CP6C 5B0YA 5DNNC 4Z66A 3AZHC 4JJNC 3MGPD 3AZJA 5B24A 3AV2B 5B40D 5AV5D 3AV1C 1TZYD 3WTPB 5GXQB 1AOIB 4QLCA 3B6GC 1WWIA 4XZQA 3TU4D 1P3MD 4J8UA 5F99A 3UT9C 3X1UD 3AZKD 3B6FD 3KXBC 3B0CT 5B1MC 5DNNB 3AZHB 1P3FA 2NQBD 4JJNB 3NQUA 3LJAC 3X1VD 3MGSD 1P3KD 4YS3B 5B2JD 3B6GB 4WU9A 4WNNA 5CPJD 3UT9B 3C1BC 5CPKD 3KXBB 1BH9B 4WU8A 5B1MB 5E5AA 4R8PD 5BS7A 1M1AA 1KX5D 4KUDA 1M19D 5AV6B 2FJ7C 4NE3A 3KWQA 5CPIC 5B0ZC 5JRGA 3WA9A 4XUJD 3LELD 3REJD 3NQJB 4H9QA 5BNXB 3MGQD 1P3PA 3AZEA 3B0BA 4KHAB 5AV8D 5KDMA 3MGPC 1P3AA 1KX4D 5AV5C 5B40C 5CPIB 5B2ID 3AZGD 1TZYC 1P3LD 3RELC 1P34D 2CV5D 3TU4C 3AZMD 1P3MC 5AVBB 5AVCB 1HTAA 3X1UC 3AZKC 3B6FC 4Z2MH 3C1CD 4Z5TD 4WV4B 1Q9CA 5C3IB 3O62A 4J8XC 1KX3A 3VH5A 2NQBC 3MGPB 2BYKA 5CP6A 3MNND 3MGSC 4AWLC 1P3KC 5B40B 5AV5B 3WAAD 1TZYB 3AYWD 3AZFA 5B2JC 1U35D 4YM6A 3TU4B 3W99C 1P3BC 1P3MB 5CPJC 2F8NA 3X1UB 3R45B 3AZID 3AZKB 4UUZA 3X1TD 3AV1A 3B6FB 5GT3A 4CAYA 4J8WA 4E45A 1HQ3C 2NQBB 1ZLAD 3X1VB 5B32D 3MGSB 4AWLB 4ZUXD 1P3KB 1S32D 2IO5B 3VH6A 3AN2C 1KX5C 2NZDD 5B2JB 1M19C 2AROA 4H9SC 1P3ID 3LJAA 4DRAA 5CPJB 4H9OA 1EQZD 4XUJC 3VH5W 3MVDC 5CPKB 3REJC 2F8NG 3MGQC 3UTAD 3REKA 2PYOC 5DNMD 4R8PB 1P3GA 3W96D 5GSUD 3C1BA 1N1JA 5AV8C 1KX5B 3AZND 1M19B 4NE6A 1ID3A 5B2IC 3AZGC 1P3LC 3AV2C 4XUJB 1P34C 5B1LD 4H9RA 3LELB 3AFAD 3REJB 2CV5C 2FJ7A 3MGQB 4Z2MG 5B0ZA 3VH6W 4X23D 3C1CC 4Z5TC 5AV8B 3UTBD 5AY8A 2YFVA 5BNVB 4EO5B 3MNNC 1KX4B 5B2IB 3WAAC 3AZGB 3AYWC 1P3LB 1P34B 1U35C 4YS3C 3A6ND 2CV5B 1F66A 3AZMB 1M18D 4H9PA 3AZIC 4KGCA 1P3OD 3C1CB 3RELA 4Z5TB 1BFMA 5B33A 5BT1D 3KUYD 1ZLAC 5B0YD 3REIA 3LZ0A 4CSRB 5G49A 5B32C 3MNNB 4ZUXC 4Z66D 4J8VA 1S32C 3WAAB 3W98A 3AYWB 2NZDC 5AV9A 3AZJD 5B24D 4J8XA 1U35B 2HIOA 3LZ1A 1P3IC 3W97A 5GT0A 5AV6C 4QLCD 3AZIB 1H3OA 5JA4A 3X1TB 4XZQD 4J8UD 5F99D 3W99A 1P3BA 1ZLAB 5DNMC 3AZLA 3W96C 3V9RA 5GSUC 5B32B 4ZUXB 1JFIB 1S32B 1P3FD 3X1SA 2NZDB 3AZNC 1F1EA 1HQ3A 1WWSA 1P3IB 3MGRA 3WKJA 1EQZB 5B1LC 3AN2A 4WU9D 3AFAC 4LD9A 4H9NA 4H9SA 3REHA 3UTAB 5DNMB 1TAFB 4ZBJC 4X23C 1BH8A 3W96B 5GSUB 5AVBC 5AVCC 2BYMA 4NFTA 3MVDA 5B31A 4WU8D 5E5AD 3AZNB 5C3IC 2PYOA 1M1AD 4KUDD 2L5AA 5B1LB 3AFAB 3A6NC 3KWQD 5BO0B 5JRGD 3WA9D 4ZBJB 4X23B 1P3OC 3AV2A 2YFWB 4DRBA 1P3PD 4M6BA 5BT1C 3KUYC 3WTPA 3UTBB 5GXQA 3AZED 1ULYA 5B0YC 1AOIA 5B31G 3VH5T 4Z66C 1P3AD 3AZJC 3X1VC 5B24C 3A6NB 2IO5C 2CWEA 1M18B 5DNNA 5FUGB 3AZHA 4JJNA 2RVQD 4QLCC 1P3OB 4XZQC 3KSYA 4J8UC 4YS3A 3KUYB 5CPKC 5B0YB 3B6GA 3O62D 1KX3D 4Z66B 4R8PC 1P3FC 3UT9A 3AZJB 5B24B 5CP6D 3KXBA 1BH9A 5B1MA 2HUEC 3AZFD 4YM6D 4QLCB 4WU9C 4XZQB 4J8UB 5F99B 2F8ND 3LELC 3AV1D 5AV6A 5GT3D 4J8WD 4WU8C 1P3FB 5E5AC 3NQUB 3NQJA 5BNXA 5BS7C 2HUEB 1M1AC 4KUDC 4EO5C 2AROD 1KX4C 4WU9B 3KWQC 4KHAA 4WNNB 3LJAD 5JRGC 3WA9C 3AZMC 4WU8B 3WTPE 1P3PC 5CPIA 5CHLB 3REKD 5E5AB 1P3GD 3C1BD 1M1AB 4KUDB 5AVBA 5AVCA 1P3AC
chains in the Genus database with same CATH superfamily
3KWQB 1ID3D 5JRGB 3WA9B 2RVQC 2Y2PA 3MGPA 4NE5A 4H9QB 2FJ7D 4G92C 5AV5A 5B40A 1P3PB 1TZYA 5B0ZD 3X1TC 3AZEB 3O62C 3TU4A 1P3MA 1KX3C 5AY8D 5KDMB 1P3AB 3X1UA 3R45A 3AZKA 2ZM5A 3B6FA 3H0RC 2Y2KA 3AZFC 2NQBA 4YM6C 1F66D 3X1VA 3MGSA 1P3KA 4G92B 1EQZC 4KGCD 5B2JA 3RELD 5GT3C 4J8WC 3O62B 3UTAC 1KX3B 5B33D 2W8SA 5CPJA 3REID 3LZ0D 5CPKA 2BYKB 5CP6B 4WJ3C 4J8VD 4UPKA 3W98D 5AV9D 4J8XD 3AZFB 2AROC 4YM6B 1B67A 4R8PA 2HIOD 3LZ1D 3W97D 5GT0D 2F8NB 1KX5A 3AV1B 1M19A 4UUZB 5GT3B 4CAYB 4J8WB 3W99D 3REKC 1P3BD 3AZLD 4XUJA 1P3GC 3LELA 2DF4C 3REJA 1R4VA 3UTBC 3MGQA 3X1SD 2AROB 1HQ3D 3MGRD 1ID3C 3LJAB 5AV8A 4H9OB 3WKJD 5BNVA 3AN2D 4LD9D 1M18C 1KX4A 3REHD 5B2IA 3REKB 3AZGA 1P3LA 1P34A 3B0CW 1P3GB 2CV5A 3MVDD 1N1JB 2JSSA 3C1BB 5B31D 3AZMA 5AY8C 1KU5A 2F8NH 3C1CA 1B6WA 4Z5TA 2PYOD 1ID3B 3EPJA 4H9RB 1F66C 4CSRA 3MNNA 2FJ7B 3WAAA 3AYWA 5B0ZB 4KGCC 4G91C 1U35A 3AV2D 5F99C 5B33C 3WTPD 5AY8B 5GXQD 2YFVB 3REIC 1AOID 3LZ0C 3AZIA 3X1TA 4J8VC 3W98C 5AV9C 1ZLAA 3VH6T 1F66B 2HIOC 3LZ1C 5B32A 3W97C 1JFIA 4ZUXA 2UWXA 5GT0C 5DNND 1S32A 3AZHD 2Y2OA 4H9PB 4JJND 4KGCB 2NZDA 4G91B 2Y2HA 3RELB 4YS3D 1P3IA 5B33B 3REIB 3AZLC 3LZ0B 1EQZA 3B6GD 5G49B 4J8VB 2LY8A 3W98B 3X1SC 5AV9B 3UT9D 4J8XB 3UTAA 3AL0C 5DNMA 1TAFA 3W96A 3KXBD 2HIOB 3LZ1B 5GSUA 3MGRC 3W97B 5B1MD 1A7WA 5GT0B 3WKJC 3AZNA 1H3OB 5JA4B 5B32G 4LD9C 2XD1A 3REHC 3W99B 1P3BB 3AZLB 3B0DC 5B1LA 5AV6D 3AFAA 2ZY2A 3V9RB 5BO0A 5B31C 2RIQA 4HGAC 3AZEC 3X1SB 1HQ3B 4X23A 2YFWA 3MGRB 3WKJB 3UTBA 4WZSB 3AN2B 4LD9B 4H9NB 3REHB 3H0MC 3B0DB 1BH8B 3EPLA 3A6NA 3MVDB 2BYMB 5CPID 5B31B 1M18A 4HGAB 3WTPC 5FUGA 5GXQC 1AOIC 4E44A 1P3OA 2PYOB 2F8NK 5AVBD 5AVCD 3KUYA 5CP6C 5B0YA 2FFFB 5DNNC 4Z66A 3AZHC 4JJNC 3MGPD 3AZJA 5B24A 3AV2B 2Y2NA 5B40D 5AV5D 3EPHA 3AV1C 1TZYD 3WTPB 5GXQB 1AOIB 4QLCA 3B6GC 1WWIA 4XZQA 3TU4D 1P3MD 4J8UA 5F99A 3UT9C 3X1UD 3AZKD 3B6FD 3KXBC 3B0CT 5B1MC 5DNNB 3AZHB 1P3FA 2NQBD 4JJNB 3NQUA 3LJAC 3X1VD 3MGSD 1P3KD 4YS3B 5B2JD 3B6GB 4WU9A 4WNNA 5CPJD 3UT9B 3C1BC 5CPKD 3KXBB 2XD5A 1BH9B 4WU8A 5B1MB 4DQYB 5E5AA 4R8PD 5BS7A 1M1AA 1KX5D 4KUDA 2DQNC 1M19D 5AV6B 2FJ7C 3FDDA 4NE3A 3KWQA 5CPIC 5B0ZC 5JRGA 3WA9A 4XUJD 3LELD 3REJD 2Y2LA 3NQJB 4H9QA 5BNXB 3MGQD 1P3PA 3AZEA 3B0BA 4KHAB 5AV8D 5KDMA 3MGPC 1P3AA 1KX4D 5AV5C 5B40C 5CPIB 5B2ID 3AZGD 1TZYC 1P3LD 3RELC 1P34D 2CV5D 2J8PA 3TU4C 2ZY5A 3AZMD 1P3MC 5AVBB 5AVCB 1HTAA 3X1UC 3AZKC 3B6FC 4Z2MH 3C1CD 4Z5TD 2G5IC 4WV4B 1Q9CA 5C3IB 3O62A 4J8XC 1KX3A 3VH5A 2NQBC 3MGPB 2BYKA 5CP6A 3MNND 3MGSC 4AWLC 1P3KC 5B40B 5AV5B 3WAAD 1TZYB 3AYWD 3AZFA 5B2JC 1U35D 4YM6A 3H0LC 3P5JB 3TU4B 3W99C 1P3BC 1P3MB 5CPJC 2F8NA 3X1UB 3R45B 3AZID 3AZKB 4UUZA 3X1TD 3AV1A 3B6FB 5GT3A 4CAYA 4J8WA 4E45A 1HQ3C 2NQBB 1ZLAD 3X1VB 3A1KA 5B32D 3MGSB 4ZUXD 4AWLB 1S32D 1P3KB 2IO5B 3VH6A 3AN2C 1KX5C 2NZDD 5B2JB 1M19C 2AROA 4H9SC 3KFUG 1P3ID 3LJAA 2Y2QA 4DRAA 5CPJB 4H9OA 1EQZD 4XUJC 3VH5W 3MVDC 5CPKB 3REJC 2F8NG 3MGQC 3UTAD 3REKA 2G5HC 2PYOC 5DNMD 4R8PB 1P3GA 3W96D 5GSUD 3C1BA 1N1JA 5AV8C 1KX5B 3AZND 1M19B 4NE6A 1ID3A 5B2IC 3AZGC 1P3LC 3AV2C 4XUJB 1P34C 5B1LD 4H9RA 3LELB 3AFAD 3REJB 2Y2GA 2CV5C 2FJ7A 3MGQB 4Z2MG 5B0ZA 3VH6W 4X23D 3C1CC 4Z5TC 5AV8B 3UTBD 5AY8A 2YFVA 5BNVB 2JCHA 4EO5B 3MNNC 1KX4B 5B2IB 3WAAC 3AZGB 3AYWC 1P3LB 1P34B 1U35C 4YS3C 3A6ND 2CV5B 1F66A 3AZMB 1M18D 4H9PA 3AZIC 4KGCA 1P3OD 3C1CB 3RELA 4Z5TB 1BFMA 5B33A 5BT1D 3KUYD 1ZLAC 5B0YD 3REIA 3LZ0A 4CSRB 5G49A 5B32C 3MNNB 4ZUXC 4Z66D 4J8VA 1S32C 3WAAB 3W98A 1Z2CB 3AYWB 5AV9A 3AZJD 5B24D 4J8XA 2NZDC 1U35B 2HIOA 3LZ1A 1P3IC 3W97A 5GT0A 5AV6C 4QLCD 3AZIB 1H3OA 5JA4A 3X1TB 4XZQD 4J8UD 5F99D 3W99A 1P3BA 1ZLAB 5DNMC 3AZLA 3W96C 3V9RA 5GSUC 5B32B 2BG1A 4ZUXB 1S32B 1JFIB 1P3FD 3X1SA 2NZDB 3AZNC 1F1EA 1HQ3A 1WWSA 1P3IB 3MGRA 3WKJA 2ZY4A 1EQZB 5B1LC 3AN2A 4WU9D 3AFAC 4LD9A 4H9NA 4H9SA 3REHA 3UTAB 5DNMB 1TAFB 4ZBJC 4X23C 1BH8A 3W96B 5GSUB 5AVBC 5AVCC 2BYMA 4NFTA 3MVDA 5B31A 4WU8D 5E5AD 1W2EA 3AZNB 1T3UA 5C3IC 2PYOA 1M1AD 4KUDD 2L5AA 2VQRA 5B1LB 3AFAB 3A6NC 3KWQD 5BO0B 5JRGD 3EPKA 2Y2JA 3WA9D 4ZBJB 4X23B 1P3OC 3AV2A 2YFWB 2Y2IA 4DRBA 1P3PD 4M6BA 5BT1C 3KUYC 3WTPA 3UTBB 5GXQA 3AZED 1ULYA 5B0YC 3A1IA 1AOIA 5B31G 2Y2MA 3VH5T 4Z66C 1P3AD 3AZJC 3X1VC 5B24C 3A6NB 1PZRA 2IO5C 2CWEA 1M18B 5DNNA 5FUGB 3AZHA 3IP4C 4JJNA 2RVQD 4QLCC 1P3OB 4XZQC 3KSYA 4J8UC 4YS3A 3KUYB 5CPKC 5B0YB 3B6GA 3O62D 1KX3D 4Z66B 4R8PC 1P3FC 3UT9A 3AZJB 5B24B 5CP6D 3KXBA 1BH9A 5B1MA 2HUEC 3AZFD 4YM6D 2F2AC 4QLCB 4WU9C 4XZQB 4J8UB 5F99B 2F8ND 3LELC 3AV1D 5AV6A 5GT3D 4J8WD 4WU8C 1P3FB 5E5AC 3NQUB 3NQJA 5BNXA 5BS7C 2HUEB 3EG5B 1M1AC 4KUDC 4EO5C 2AROD 1KX4C 4WU9B 3KWQC 4KHAA 4WNNB 3LJAD 5JRGC 2JE5A 3WA9C 3AZMC 4WU8B 3WTPE 1P3PC 5CPIA 5CHLB 3REKD 5E5AB 1P3GD 3F6TA 3C1BD 1M1AB 4KUDB 5AVBA 5AVCA 1P3AC 2ZY3A
chains in the Genus database with same CATH topology
3KWQB 1ID3D 5JRGB 3WA9B 2RVQC 2Y2PA 3MGPA 4NE5A 4H9QB 2FJ7D 4G92C 5AV5A 5B40A 1P3PB 1TZYA 5B0ZD 3X1TC 3AZEB 3O62C 3TU4A 1P3MA 1KX3C 5AY8D 5KDMB 1P3AB 3X1UA 3R45A 3AZKA 2ZM5A 3B6FA 3H0RC 2Y2KA 3AZFC 2NQBA 4YM6C 1F66D 3X1VA 3MGSA 1P3KA 4G92B 1EQZC 4KGCD 5B2JA 3RELD 5GT3C 4J8WC 3O62B 3UTAC 1KX3B 5B33D 2W8SA 5CPJA 3REID 3LZ0D 5CPKA 2BYKB 5CP6B 4WJ3C 4J8VD 4UPKA 3W98D 5AV9D 4J8XD 3AZFB 2AROC 4YM6B 1B67A 4R8PA 2HIOD 3LZ1D 3W97D 5GT0D 2F8NB 1KX5A 3AV1B 1M19A 4UUZB 5GT3B 4CAYB 4J8WB 3W99D 3REKC 1P3BD 3AZLD 4XUJA 1P3GC 3LELA 2DF4C 3REJA 1R4VA 3UTBC 3MGQA 3X1SD 2AROB 1HQ3D 3MGRD 1ID3C 3LJAB 5AV8A 4H9OB 3WKJD 5BNVA 3AN2D 4LD9D 1M18C 1KX4A 3REHD 5B2IA 3REKB 3AZGA 1P3LA 1P34A 3B0CW 1P3GB 2CV5A 3MVDD 1N1JB 2JSSA 3C1BB 5B31D 3AZMA 5AY8C 1KU5A 2F8NH 3C1CA 1B6WA 4Z5TA 2PYOD 1ID3B 3EPJA 4H9RB 1F66C 4CSRA 3MNNA 2FJ7B 3WAAA 3AYWA 5B0ZB 4KGCC 4G91C 1U35A 3AV2D 5F99C 5B33C 3WTPD 5AY8B 5GXQD 2YFVB 3REIC 1AOID 3LZ0C 3AZIA 3X1TA 4J8VC 3W98C 5AV9C 1ZLAA 3VH6T 1F66B 2HIOC 3LZ1C 5B32A 3W97C 1JFIA 4ZUXA 2UWXA 5GT0C 5DNND 1S32A 3AZHD 2Y2OA 4H9PB 4JJND 4KGCB 2NZDA 4G91B 2Y2HA 3RELB 4YS3D 1P3IA 5B33B 3REIB 3AZLC 3LZ0B 1EQZA 3B6GD 5G49B 4J8VB 2LY8A 3W98B 3X1SC 5AV9B 3UT9D 4J8XB 3UTAA 3AL0C 5DNMA 1TAFA 3W96A 3KXBD 2HIOB 3LZ1B 5GSUA 3MGRC 3W97B 5B1MD 1A7WA 5GT0B 3WKJC 3AZNA 1H3OB 5JA4B 5B32G 4LD9C 2XD1A 3REHC 3W99B 1P3BB 3AZLB 3B0DC 5B1LA 5AV6D 3AFAA 2ZY2A 3V9RB 5BO0A 5B31C 2RIQA 4HGAC 3AZEC 3X1SB 1HQ3B 4X23A 2YFWA 3MGRB 3WKJB 3UTBA 4WZSB 3AN2B 4LD9B 4H9NB 3REHB 3H0MC 3B0DB 1BH8B 3EPLA 3A6NA 3MVDB 2BYMB 5CPID 5B31B 1M18A 4HGAB 3WTPC 5FUGA 5GXQC 1AOIC 4E44A 1P3OA 2PYOB 2F8NK 5AVBD 5AVCD 3KUYA 5CP6C 5B0YA 2FFFB 5DNNC 4Z66A 3AZHC 4JJNC 3MGPD 3AZJA 5B24A 3AV2B 2Y2NA 5B40D 5AV5D 3EPHA 3AV1C 1TZYD 3WTPB 5GXQB 1AOIB 4QLCA 3B6GC 1WWIA 4XZQA 3TU4D 1P3MD 4J8UA 5F99A 3UT9C 3X1UD 3AZKD 3B6FD 3KXBC 3B0CT 5B1MC 5DNNB 3AZHB 1P3FA 2NQBD 4JJNB 3NQUA 3LJAC 3X1VD 3MGSD 1P3KD 4YS3B 5B2JD 3B6GB 4WU9A 4WNNA 5CPJD 3UT9B 3C1BC 5CPKD 3KXBB 2XD5A 1BH9B 4WU8A 5B1MB 4DQYB 5E5AA 4R8PD 5BS7A 1M1AA 1KX5D 4KUDA 2DQNC 1M19D 5AV6B 2FJ7C 3FDDA 4NE3A 3KWQA 5CPIC 5B0ZC 5JRGA 3WA9A 4XUJD 3LELD 3REJD 2Y2LA 3NQJB 4H9QA 5BNXB 3MGQD 1P3PA 3AZEA 3B0BA 4KHAB 5AV8D 5KDMA 3MGPC 1P3AA 1KX4D 5AV5C 5B40C 5CPIB 5B2ID 3AZGD 1TZYC 1P3LD 3RELC 1P34D 2CV5D 2J8PA 3TU4C 2ZY5A 3AZMD 1P3MC 5AVBB 5AVCB 1HTAA 3X1UC 3AZKC 3B6FC 4Z2MH 3C1CD 4Z5TD 2G5IC 4WV4B 1Q9CA 5C3IB 3O62A 4J8XC 1KX3A 3VH5A 2NQBC 3MGPB 2BYKA 5CP6A 3MNND 3MGSC 4AWLC 1P3KC 5B40B 5AV5B 3WAAD 1TZYB 3AYWD 3AZFA 5B2JC 1U35D 4YM6A 3H0LC 3P5JB 3TU4B 3W99C 1P3BC 1P3MB 5CPJC 2F8NA 3X1UB 3R45B 3AZID 3AZKB 4UUZA 3X1TD 3AV1A 3B6FB 5GT3A 4CAYA 4J8WA 4E45A 1HQ3C 2NQBB 1ZLAD 3X1VB 3A1KA 5B32D 3MGSB 4ZUXD 4AWLB 1S32D 1P3KB 2IO5B 3VH6A 3AN2C 1KX5C 2NZDD 5B2JB 1M19C 2AROA 4H9SC 3KFUG 1P3ID 3LJAA 2Y2QA 4DRAA 5CPJB 4H9OA 1EQZD 4XUJC 3VH5W 3MVDC 5CPKB 3REJC 2F8NG 3MGQC 3UTAD 3REKA 2G5HC 2PYOC 5DNMD 4R8PB 1P3GA 3W96D 5GSUD 3C1BA 1N1JA 5AV8C 1KX5B 3AZND 1M19B 4NE6A 1ID3A 5B2IC 3AZGC 1P3LC 3AV2C 4XUJB 1P34C 5B1LD 4H9RA 3LELB 3AFAD 3REJB 2Y2GA 2CV5C 2FJ7A 3MGQB 4Z2MG 5B0ZA 3VH6W 4X23D 3C1CC 4Z5TC 5AV8B 3UTBD 5AY8A 2YFVA 5BNVB 2JCHA 4EO5B 3MNNC 1KX4B 5B2IB 3WAAC 3AZGB 3AYWC 1P3LB 1P34B 1U35C 4YS3C 3A6ND 2CV5B 1F66A 3AZMB 1M18D 4H9PA 3AZIC 4KGCA 1P3OD 3C1CB 3RELA 4Z5TB 1BFMA 5B33A 5BT1D 3KUYD 1ZLAC 5B0YD 3REIA 3LZ0A 4CSRB 5G49A 5B32C 3MNNB 4ZUXC 4Z66D 4J8VA 1S32C 3WAAB 3W98A 1Z2CB 3AYWB 5AV9A 3AZJD 5B24D 4J8XA 2NZDC 1U35B 2HIOA 3LZ1A 1P3IC 3W97A 5GT0A 5AV6C 4QLCD 3AZIB 1H3OA 5JA4A 3X1TB 4XZQD 4J8UD 5F99D 3W99A 1P3BA 1ZLAB 5DNMC 3AZLA 3W96C 3V9RA 5GSUC 5B32B 2BG1A 4ZUXB 1S32B 1JFIB 1P3FD 3X1SA 2NZDB 3AZNC 1F1EA 1HQ3A 1WWSA 1P3IB 3MGRA 3WKJA 2ZY4A 1EQZB 5B1LC 3AN2A 4WU9D 3AFAC 4LD9A 4H9NA 4H9SA 3REHA 3UTAB 5DNMB 1TAFB 4ZBJC 4X23C 1BH8A 3W96B 5GSUB 5AVBC 5AVCC 2BYMA 4NFTA 3MVDA 5B31A 4WU8D 5E5AD 1W2EA 3AZNB 1T3UA 5C3IC 2PYOA 1M1AD 4KUDD 2L5AA 2VQRA 5B1LB 3AFAB 3A6NC 3KWQD 5BO0B 5JRGD 3EPKA 2Y2JA 3WA9D 4ZBJB 4X23B 1P3OC 3AV2A 2YFWB 2Y2IA 4DRBA 1P3PD 4M6BA 5BT1C 3KUYC 3WTPA 3UTBB 5GXQA 3AZED 1ULYA 5B0YC 3A1IA 1AOIA 5B31G 2Y2MA 3VH5T 4Z66C 1P3AD 3AZJC 3X1VC 5B24C 3A6NB 1PZRA 2IO5C 2CWEA 1M18B 5DNNA 5FUGB 3AZHA 3IP4C 4JJNA 2RVQD 4QLCC 1P3OB 4XZQC 3KSYA 4J8UC 4YS3A 3KUYB 5CPKC 5B0YB 3B6GA 3O62D 1KX3D 4Z66B 4R8PC 1P3FC 3UT9A 3AZJB 5B24B 5CP6D 3KXBA 1BH9A 5B1MA 2HUEC 3AZFD 4YM6D 2F2AC 4QLCB 4WU9C 4XZQB 4J8UB 5F99B 2F8ND 3LELC 3AV1D 5AV6A 5GT3D 4J8WD 4WU8C 1P3FB 5E5AC 3NQUB 3NQJA 5BNXA 5BS7C 2HUEB 3EG5B 1M1AC 4KUDC 4EO5C 2AROD 1KX4C 4WU9B 3KWQC 4KHAA 4WNNB 3LJAD 5JRGC 2JE5A 3WA9C 3AZMC 4WU8B 3WTPE 1P3PC 5CPIA 5CHLB 3REKD 5E5AB 1P3GD 3F6TA 3C1BD 1M1AB 4KUDB 5AVBA 5AVCA 1P3AC 2ZY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWQ B;  1ID3 D;  5JRG B;  3WA9 B;  2RVQ C;  3MGP A;  4NE5 A;  4H9Q B;  2FJ7 D;  4G92 C;  5AV5 A;  5B40 A;  1P3P B;  1TZY A;  5B0Z D;  3X1T C;  3AZE B;  3O62 C;  3TU4 A;  1P3M A;  1KX3 C;  5AY8 D;  5KDM B;  1P3A B;  3X1U A;  3R45 A;  3AZK A;  3B6F A;  3AZF C;  2NQB A;  4YM6 C;  1F66 D;  3X1V A;  3MGS A;  1P3K A;  4G92 B;  1EQZ C;  4KGC D;  5B2J A;  3REL D;  5GT3 C;  4J8W C;  3O62 B;  3UTA C;  1KX3 B;  5B33 D;  5CPJ A;  3REI D;  3LZ0 D;  5CPK A;  2BYK B;  5CP6 B;  4J8V D;  3W98 D;  5AV9 D;  4J8X D;  3AZF B;  2ARO C;  4YM6 B;  1B67 A;  4R8P A;  2HIO D;  3LZ1 D;  3W97 D;  5GT0 D;  2F8N B;  1KX5 A;  3AV1 B;  1M19 A;  4UUZ B;  5GT3 B;  4CAY B;  4J8W B;  3W99 D;  3REK C;  1P3B D;  3AZL D;  4XUJ A;  1P3G C;  3LEL A;  3REJ A;  1R4V A;  3UTB C;  3MGQ A;  3X1S D;  2ARO B;  1HQ3 D;  3MGR D;  1ID3 C;  3LJA B;  5AV8 A;  4H9O B;  3WKJ D;  5BNV A;  3AN2 D;  4LD9 D;  1M18 C;  1KX4 A;  3REH D;  5B2I A;  3REK B;  3AZG A;  1P3L A;  1P34 A;  3B0C W;  1P3G B;  2CV5 A;  3MVD D;  1N1J B;  2JSS A;  3C1B B;  5B31 D;  3AZM A;  5AY8 C;  1KU5 A;  2F8N H;  3C1C A;  1B6W A;  4Z5T A;  2PYO D;  1ID3 B;  4H9R B;  1F66 C;  4CSR A;  3MNN A;  2FJ7 B;  3WAA A;  3AYW A;  5B0Z B;  4KGC C;  4G91 C;  1U35 A;  3AV2 D;  5F99 C;  5B33 C;  3WTP D;  5AY8 B;  5GXQ D;  2YFV B;  3REI C;  1AOI D;  3LZ0 C;  3AZI A;  3X1T A;  4J8V C;  3W98 C;  5AV9 C;  1ZLA A;  3VH6 T;  1F66 B;  2HIO C;  3LZ1 C;  5B32 A;  3W97 C;  1JFI A;  4ZUX A;  5DNN D;  5GT0 C;  1S32 A;  3AZH D;  4H9P B;  4JJN D;  2NZD A;  4KGC B;  4G91 B;  3REL B;  4YS3 D;  1P3I A;  5B33 B;  3REI B;  3AZL C;  3LZ0 B;  1EQZ A;  3B6G D;  5G49 B;  4J8V B;  2LY8 A;  3W98 B;  3X1S C;  5AV9 B;  3UT9 D;  4J8X B;  3UTA A;  5DNM A;  1TAF A;  3W96 A;  3KXB D;  2HIO B;  3LZ1 B;  5GSU A;  3MGR C;  3W97 B;  5B1M D;  1A7W A;  5GT0 B;  3WKJ C;  3AZN A;  1H3O B;  5JA4 B;  5B32 G;  4LD9 C;  3REH C;  3W99 B;  1P3B B;  3AZL B;  3B0D C;  5B1L A;  5AV6 D;  3AFA A;  3V9R B;  5BO0 A;  5B31 C;  4HGA C;  3AZE C;  3X1S B;  1HQ3 B;  4X23 A;  2YFW A;  3MGR B;  3WKJ B;  3UTB A;  4WZS B;  3AN2 B;  4LD9 B;  4H9N B;  3REH B;  3B0D B;  1BH8 B;  3A6N A;  3MVD B;  2BYM B;  5CPI D;  5B31 B;  1M18 A;  4HGA B;  3WTP C;  5FUG A;  5GXQ C;  1AOI C;  4E44 A;  1P3O A;  2PYO B;  2F8N K;  5AVB D;  5AVC D;  3KUY A;  5CP6 C;  5B0Y A;  5DNN C;  4Z66 A;  3AZH C;  4JJN C;  3MGP D;  3AZJ A;  5B24 A;  3AV2 B;  5B40 D;  5AV5 D;  3AV1 C;  1TZY D;  3WTP B;  5GXQ B;  1AOI B;  4QLC A;  3B6G C;  1WWI A;  4XZQ A;  3TU4 D;  1P3M D;  4J8U A;  5F99 A;  3UT9 C;  3X1U D;  3AZK D;  3B6F D;  3KXB C;  3B0C T;  5B1M C;  5DNN B;  3AZH B;  1P3F A;  2NQB D;  4JJN B;  3NQU A;  3LJA C;  3X1V D;  3MGS D;  1P3K D;  4YS3 B;  5B2J D;  3B6G B;  4WU9 A;  4WNN A;  5CPJ D;  3UT9 B;  3C1B C;  5CPK D;  3KXB B;  1BH9 B;  4WU8 A;  5B1M B;  5E5A A;  4R8P D;  5BS7 A;  1M1A A;  1KX5 D;  4KUD A;  1M19 D;  5AV6 B;  2FJ7 C;  4NE3 A;  3KWQ A;  5CPI C;  5B0Z C;  5JRG A;  3WA9 A;  4XUJ D;  3LEL D;  3REJ D;  3NQJ B;  4H9Q A;  5BNX B;  3MGQ D;  1P3P A;  3AZE A;  3B0B A;  4KHA B;  5AV8 D;  5KDM A;  3MGP C;  1P3A A;  1KX4 D;  5AV5 C;  5B40 C;  5CPI B;  5B2I D;  3AZG D;  1TZY C;  1P3L D;  3REL C;  1P34 D;  2CV5 D;  3TU4 C;  3AZM D;  1P3M C;  5AVB B;  5AVC B;  1HTA A;  3X1U C;  3AZK C;  3B6F C;  4Z2M H;  3C1C D;  4Z5T D;  4WV4 B;  1Q9C A;  5C3I B;  3O62 A;  4J8X C;  1KX3 A;  3VH5 A;  2NQB C;  3MGP B;  2BYK A;  5CP6 A;  3MNN D;  3MGS C;  4AWL C;  1P3K C;  5B40 B;  5AV5 B;  3WAA D;  1TZY B;  3AYW D;  3AZF A;  5B2J C;  1U35 D;  4YM6 A;  3TU4 B;  3W99 C;  1P3B C;  1P3M B;  5CPJ C;  2F8N A;  3X1U B;  3R45 B;  3AZI D;  3AZK B;  4UUZ A;  3X1T D;  3AV1 A;  3B6F B;  5GT3 A;  4CAY A;  4J8W A;  4E45 A;  1HQ3 C;  2NQB B;  1ZLA D;  3X1V B;  5B32 D;  3MGS B;  4AWL B;  4ZUX D;  1P3K B;  1S32 D;  2IO5 B;  3VH6 A;  3AN2 C;  1KX5 C;  2NZD D;  5B2J B;  1M19 C;  2ARO A;  4H9S C;  1P3I D;  3LJA A;  4DRA A;  5CPJ B;  4H9O A;  1EQZ D;  4XUJ C;  3VH5 W;  3MVD C;  5CPK B;  3REJ C;  2F8N G;  3MGQ C;  3UTA D;  3REK A;  2PYO C;  5DNM D;  4R8P B;  1P3G A;  3W96 D;  5GSU D;  3C1B A;  1N1J A;  5AV8 C;  1KX5 B;  3AZN D;  1M19 B;  4NE6 A;  1ID3 A;  5B2I C;  3AZG C;  1P3L C;  3AV2 C;  4XUJ B;  1P34 C;  5B1L D;  4H9R A;  3LEL B;  3AFA D;  3REJ B;  2CV5 C;  2FJ7 A;  3MGQ B;  4Z2M G;  5B0Z A;  3VH6 W;  4X23 D;  3C1C C;  4Z5T C;  5AV8 B;  3UTB D;  5AY8 A;  2YFV A;  5BNV B;  4EO5 B;  3MNN C;  1KX4 B;  5B2I B;  3WAA C;  3AZG B;  3AYW C;  1P3L B;  1P34 B;  1U35 C;  4YS3 C;  3A6N D;  2CV5 B;  1F66 A;  3AZM B;  1M18 D;  4H9P A;  3AZI C;  4KGC A;  1P3O D;  3C1C B;  3REL A;  4Z5T B;  1BFM A;  5B33 A;  5BT1 D;  3KUY D;  1ZLA C;  5B0Y D;  3REI A;  3LZ0 A;  4CSR B;  5G49 A;  5B32 C;  3MNN B;  4ZUX C;  4Z66 D;  4J8V A;  1S32 C;  3WAA B;  3W98 A;  3AYW B;  2NZD C;  5AV9 A;  3AZJ D;  5B24 D;  4J8X A;  1U35 B;  2HIO A;  3LZ1 A;  1P3I C;  3W97 A;  5GT0 A;  5AV6 C;  4QLC D;  3AZI B;  1H3O A;  5JA4 A;  3X1T B;  4XZQ D;  4J8U D;  5F99 D;  3W99 A;  1P3B A;  1ZLA B;  5DNM C;  3AZL A;  3W96 C;  3V9R A;  5GSU C;  5B32 B;  4ZUX B;  1JFI B;  1S32 B;  1P3F D;  3X1S A;  2NZD B;  3AZN C;  1F1E A;  1HQ3 A;  1WWS A;  1P3I B;  3MGR A;  3WKJ A;  1EQZ B;  5B1L C;  3AN2 A;  4WU9 D;  3AFA C;  4LD9 A;  4H9N A;  4H9S A;  3REH A;  3UTA B;  5DNM B;  1TAF B;  4ZBJ C;  4X23 C;  1BH8 A;  3W96 B;  5GSU B;  5AVB C;  5AVC C;  2BYM A;  4NFT A;  3MVD A;  5B31 A;  4WU8 D;  5E5A D;  3AZN B;  5C3I C;  2PYO A;  1M1A D;  4KUD D;  2L5A A;  5B1L B;  3AFA B;  3A6N C;  3KWQ D;  5BO0 B;  5JRG D;  3WA9 D;  4ZBJ B;  4X23 B;  1P3O C;  3AV2 A;  2YFW B;  4DRB A;  1P3P D;  4M6B A;  5BT1 C;  3KUY C;  3WTP A;  3UTB B;  5GXQ A;  3AZE D;  1ULY A;  5B0Y C;  1AOI A;  5B31 G;  3VH5 T;  4Z66 C;  1P3A D;  3AZJ C;  3X1V C;  5B24 C;  3A6N B;  2IO5 C;  2CWE A;  1M18 B;  5DNN A;  5FUG B;  3AZH A;  4JJN A;  2RVQ D;  4QLC C;  1P3O B;  4XZQ C;  3KSY A;  4J8U C;  4YS3 A;  3KUY B;  5CPK C;  5B0Y B;  3B6G A;  3O62 D;  1KX3 D;  4Z66 B;  4R8P C;  1P3F C;  3UT9 A;  3AZJ B;  5B24 B;  5CP6 D;  3KXB A;  1BH9 A;  5B1M A;  2HUE C;  3AZF D;  4YM6 D;  4QLC B;  4WU9 C;  4XZQ B;  4J8U B;  5F99 B;  2F8N D;  3LEL C;  3AV1 D;  5AV6 A;  5GT3 D;  4J8W D;  4WU8 C;  1P3F B;  5E5A C;  3NQU B;  3NQJ A;  5BNX A;  5BS7 C;  2HUE B;  1M1A C;  4KUD C;  4EO5 C;  2ARO D;  1KX4 C;  4WU9 B;  3KWQ C;  4KHA A;  4WNN B;  3LJA D;  5JRG C;  3WA9 C;  3AZM C;  4WU8 B;  3WTP E;  1P3P C;  5CPI A;  5CHL B;  3REK D;  5E5A B;  1P3G D;  3C1B D;  1M1A B;  4KUD B;  5AVB A;  5AVC A;  1P3A C; 
#chains in the Genus database with same CATH topology
 3KWQ B;  1ID3 D;  5JRG B;  3WA9 B;  2RVQ C;  2Y2P A;  3MGP A;  4NE5 A;  4H9Q B;  2FJ7 D;  4G92 C;  5AV5 A;  5B40 A;  1P3P B;  1TZY A;  5B0Z D;  3X1T C;  3AZE B;  3O62 C;  3TU4 A;  1P3M A;  1KX3 C;  5AY8 D;  5KDM B;  1P3A B;  3X1U A;  3R45 A;  3AZK A;  2ZM5 A;  3B6F A;  3H0R C;  2Y2K A;  3AZF C;  2NQB A;  4YM6 C;  1F66 D;  3X1V A;  3MGS A;  1P3K A;  4G92 B;  1EQZ C;  4KGC D;  5B2J A;  3REL D;  5GT3 C;  4J8W C;  3O62 B;  3UTA C;  1KX3 B;  5B33 D;  2W8S A;  5CPJ A;  3REI D;  3LZ0 D;  5CPK A;  2BYK B;  5CP6 B;  4WJ3 C;  4J8V D;  4UPK A;  3W98 D;  5AV9 D;  4J8X D;  3AZF B;  2ARO C;  4YM6 B;  1B67 A;  4R8P A;  2HIO D;  3LZ1 D;  3W97 D;  5GT0 D;  2F8N B;  1KX5 A;  3AV1 B;  1M19 A;  4UUZ B;  5GT3 B;  4CAY B;  4J8W B;  3W99 D;  3REK C;  1P3B D;  3AZL D;  4XUJ A;  1P3G C;  3LEL A;  2DF4 C;  3REJ A;  1R4V A;  3UTB C;  3MGQ A;  3X1S D;  2ARO B;  1HQ3 D;  3MGR D;  1ID3 C;  3LJA B;  5AV8 A;  4H9O B;  3WKJ D;  5BNV A;  3AN2 D;  4LD9 D;  1M18 C;  1KX4 A;  3REH D;  5B2I A;  3REK B;  3AZG A;  1P3L A;  1P34 A;  3B0C W;  1P3G B;  2CV5 A;  3MVD D;  1N1J B;  2JSS A;  3C1B B;  5B31 D;  3AZM A;  5AY8 C;  1KU5 A;  2F8N H;  3C1C A;  1B6W A;  4Z5T A;  2PYO D;  1ID3 B;  3EPJ A;  4H9R B;  1F66 C;  4CSR A;  3MNN A;  2FJ7 B;  3WAA A;  3AYW A;  5B0Z B;  4KGC C;  4G91 C;  1U35 A;  3AV2 D;  5F99 C;  5B33 C;  3WTP D;  5AY8 B;  5GXQ D;  2YFV B;  3REI C;  1AOI D;  3LZ0 C;  3AZI A;  3X1T A;  4J8V C;  3W98 C;  5AV9 C;  1ZLA A;  3VH6 T;  1F66 B;  2HIO C;  3LZ1 C;  5B32 A;  3W97 C;  1JFI A;  4ZUX A;  2UWX A;  5GT0 C;  5DNN D;  1S32 A;  3AZH D;  2Y2O A;  4H9P B;  4JJN D;  4KGC B;  2NZD A;  4G91 B;  2Y2H A;  3REL B;  4YS3 D;  1P3I A;  5B33 B;  3REI B;  3AZL C;  3LZ0 B;  1EQZ A;  3B6G D;  5G49 B;  4J8V B;  2LY8 A;  3W98 B;  3X1S C;  5AV9 B;  3UT9 D;  4J8X B;  3UTA A;  3AL0 C;  5DNM A;  1TAF A;  3W96 A;  3KXB D;  2HIO B;  3LZ1 B;  5GSU A;  3MGR C;  3W97 B;  5B1M D;  1A7W A;  5GT0 B;  3WKJ C;  3AZN A;  1H3O B;  5JA4 B;  5B32 G;  4LD9 C;  2XD1 A;  3REH C;  3W99 B;  1P3B B;  3AZL B;  3B0D C;  5B1L A;  5AV6 D;  3AFA A;  2ZY2 A;  3V9R B;  5BO0 A;  5B31 C;  2RIQ A;  4HGA C;  3AZE C;  3X1S B;  1HQ3 B;  4X23 A;  2YFW A;  3MGR B;  3WKJ B;  3UTB A;  4WZS B;  3AN2 B;  4LD9 B;  4H9N B;  3REH B;  3H0M C;  3B0D B;  1BH8 B;  3EPL A;  3A6N A;  3MVD B;  2BYM B;  5CPI D;  5B31 B;  1M18 A;  4HGA B;  3WTP C;  5FUG A;  5GXQ C;  1AOI C;  4E44 A;  1P3O A;  2PYO B;  2F8N K;  5AVB D;  5AVC D;  3KUY A;  5CP6 C;  5B0Y A;  2FFF B;  5DNN C;  4Z66 A;  3AZH C;  4JJN C;  3MGP D;  3AZJ A;  5B24 A;  3AV2 B;  2Y2N A;  5B40 D;  5AV5 D;  3EPH A;  3AV1 C;  1TZY D;  3WTP B;  5GXQ B;  1AOI B;  4QLC A;  3B6G C;  1WWI A;  4XZQ A;  3TU4 D;  1P3M D;  4J8U A;  5F99 A;  3UT9 C;  3X1U D;  3AZK D;  3B6F D;  3KXB C;  3B0C T;  5B1M C;  5DNN B;  3AZH B;  1P3F A;  2NQB D;  4JJN B;  3NQU A;  3LJA C;  3X1V D;  3MGS D;  1P3K D;  4YS3 B;  5B2J D;  3B6G B;  4WU9 A;  4WNN A;  5CPJ D;  3UT9 B;  3C1B C;  5CPK D;  3KXB B;  2XD5 A;  1BH9 B;  4WU8 A;  5B1M B;  4DQY B;  5E5A A;  4R8P D;  5BS7 A;  1M1A A;  1KX5 D;  4KUD A;  2DQN C;  1M19 D;  5AV6 B;  2FJ7 C;  3FDD A;  4NE3 A;  3KWQ A;  5CPI C;  5B0Z C;  5JRG A;  3WA9 A;  4XUJ D;  3LEL D;  3REJ D;  2Y2L A;  3NQJ B;  4H9Q A;  5BNX B;  3MGQ D;  1P3P A;  3AZE A;  3B0B A;  4KHA B;  5AV8 D;  5KDM A;  3MGP C;  1P3A A;  1KX4 D;  5AV5 C;  5B40 C;  5CPI B;  5B2I D;  3AZG D;  1TZY C;  1P3L D;  3REL C;  1P34 D;  2CV5 D;  2J8P A;  3TU4 C;  2ZY5 A;  3AZM D;  1P3M C;  5AVB B;  5AVC B;  1HTA A;  3X1U C;  3AZK C;  3B6F C;  4Z2M H;  3C1C D;  4Z5T D;  2G5I C;  4WV4 B;  1Q9C A;  5C3I B;  3O62 A;  4J8X C;  1KX3 A;  3VH5 A;  2NQB C;  3MGP B;  2BYK A;  5CP6 A;  3MNN D;  3MGS C;  4AWL C;  1P3K C;  5B40 B;  5AV5 B;  3WAA D;  1TZY B;  3AYW D;  3AZF A;  5B2J C;  1U35 D;  4YM6 A;  3H0L C;  3P5J B;  3TU4 B;  3W99 C;  1P3B C;  1P3M B;  5CPJ C;  2F8N A;  3X1U B;  3R45 B;  3AZI D;  3AZK B;  4UUZ A;  3X1T D;  3AV1 A;  3B6F B;  5GT3 A;  4CAY A;  4J8W A;  4E45 A;  1HQ3 C;  2NQB B;  1ZLA D;  3X1V B;  3A1K A;  5B32 D;  3MGS B;  4ZUX D;  4AWL B;  1S32 D;  1P3K B;  2IO5 B;  3VH6 A;  3AN2 C;  1KX5 C;  2NZD D;  5B2J B;  1M19 C;  2ARO A;  4H9S C;  3KFU G;  1P3I D;  3LJA A;  2Y2Q A;  4DRA A;  5CPJ B;  4H9O A;  1EQZ D;  4XUJ C;  3VH5 W;  3MVD C;  5CPK B;  3REJ C;  2F8N G;  3MGQ C;  3UTA D;  3REK A;  2G5H C;  2PYO C;  5DNM D;  4R8P B;  1P3G A;  3W96 D;  5GSU D;  3C1B A;  1N1J A;  5AV8 C;  1KX5 B;  3AZN D;  1M19 B;  4NE6 A;  1ID3 A;  5B2I C;  3AZG C;  1P3L C;  3AV2 C;  4XUJ B;  1P34 C;  5B1L D;  4H9R A;  3LEL B;  3AFA D;  3REJ B;  2Y2G A;  2CV5 C;  2FJ7 A;  3MGQ B;  4Z2M G;  5B0Z A;  3VH6 W;  4X23 D;  3C1C C;  4Z5T C;  5AV8 B;  3UTB D;  5AY8 A;  2YFV A;  5BNV B;  2JCH A;  4EO5 B;  3MNN C;  1KX4 B;  5B2I B;  3WAA C;  3AZG B;  3AYW C;  1P3L B;  1P34 B;  1U35 C;  4YS3 C;  3A6N D;  2CV5 B;  1F66 A;  3AZM B;  1M18 D;  4H9P A;  3AZI C;  4KGC A;  1P3O D;  3C1C B;  3REL A;  4Z5T B;  1BFM A;  5B33 A;  5BT1 D;  3KUY D;  1ZLA C;  5B0Y D;  3REI A;  3LZ0 A;  4CSR B;  5G49 A;  5B32 C;  3MNN B;  4ZUX C;  4Z66 D;  4J8V A;  1S32 C;  3WAA B;  3W98 A;  1Z2C B;  3AYW B;  5AV9 A;  3AZJ D;  5B24 D;  4J8X A;  2NZD C;  1U35 B;  2HIO A;  3LZ1 A;  1P3I C;  3W97 A;  5GT0 A;  5AV6 C;  4QLC D;  3AZI B;  1H3O A;  5JA4 A;  3X1T B;  4XZQ D;  4J8U D;  5F99 D;  3W99 A;  1P3B A;  1ZLA B;  5DNM C;  3AZL A;  3W96 C;  3V9R A;  5GSU C;  5B32 B;  2BG1 A;  4ZUX B;  1S32 B;  1JFI B;  1P3F D;  3X1S A;  2NZD B;  3AZN C;  1F1E A;  1HQ3 A;  1WWS A;  1P3I B;  3MGR A;  3WKJ A;  2ZY4 A;  1EQZ B;  5B1L C;  3AN2 A;  4WU9 D;  3AFA C;  4LD9 A;  4H9N A;  4H9S A;  3REH A;  3UTA B;  5DNM B;  1TAF B;  4ZBJ C;  4X23 C;  1BH8 A;  3W96 B;  5GSU B;  5AVB C;  5AVC C;  2BYM A;  4NFT A;  3MVD A;  5B31 A;  4WU8 D;  5E5A D;  1W2E A;  3AZN B;  1T3U A;  5C3I C;  2PYO A;  1M1A D;  4KUD D;  2L5A A;  2VQR A;  5B1L B;  3AFA B;  3A6N C;  3KWQ D;  5BO0 B;  5JRG D;  3EPK A;  2Y2J A;  3WA9 D;  4ZBJ B;  4X23 B;  1P3O C;  3AV2 A;  2YFW B;  2Y2I A;  4DRB A;  1P3P D;  4M6B A;  5BT1 C;  3KUY C;  3WTP A;  3UTB B;  5GXQ A;  3AZE D;  1ULY A;  5B0Y C;  3A1I A;  1AOI A;  5B31 G;  2Y2M A;  3VH5 T;  4Z66 C;  1P3A D;  3AZJ C;  3X1V C;  5B24 C;  3A6N B;  1PZR A;  2IO5 C;  2CWE A;  1M18 B;  5DNN A;  5FUG B;  3AZH A;  3IP4 C;  4JJN A;  2RVQ D;  4QLC C;  1P3O B;  4XZQ C;  3KSY A;  4J8U C;  4YS3 A;  3KUY B;  5CPK C;  5B0Y B;  3B6G A;  3O62 D;  1KX3 D;  4Z66 B;  4R8P C;  1P3F C;  3UT9 A;  3AZJ B;  5B24 B;  5CP6 D;  3KXB A;  1BH9 A;  5B1M A;  2HUE C;  3AZF D;  4YM6 D;  2F2A C;  4QLC B;  4WU9 C;  4XZQ B;  4J8U B;  5F99 B;  2F8N D;  3LEL C;  3AV1 D;  5AV6 A;  5GT3 D;  4J8W D;  4WU8 C;  1P3F B;  5E5A C;  3NQU B;  3NQJ A;  5BNX A;  5BS7 C;  2HUE B;  3EG5 B;  1M1A C;  4KUD C;  4EO5 C;  2ARO D;  1KX4 C;  4WU9 B;  3KWQ C;  4KHA A;  4WNN B;  3LJA D;  5JRG C;  2JE5 A;  3WA9 C;  3AZM C;  4WU8 B;  3WTP E;  1P3P C;  5CPI A;  5CHL B;  3REK D;  5E5A B;  1P3G D;  3F6T A;  3C1B D;  1M1A B;  4KUD B;  5AVB A;  5AVC A;  1P3A C;  2ZY3 A; 
#chains in the Genus database with same CATH homology
 3KWQ B;  1ID3 D;  5JRG B;  3WA9 B;  2RVQ C;  2Y2P A;  3MGP A;  4NE5 A;  4H9Q B;  2FJ7 D;  4G92 C;  5AV5 A;  5B40 A;  1P3P B;  1TZY A;  5B0Z D;  3X1T C;  3AZE B;  3O62 C;  3TU4 A;  1P3M A;  1KX3 C;  5AY8 D;  5KDM B;  1P3A B;  3X1U A;  3R45 A;  3AZK A;  2ZM5 A;  3B6F A;  3H0R C;  2Y2K A;  3AZF C;  2NQB A;  4YM6 C;  1F66 D;  3X1V A;  3MGS A;  1P3K A;  4G92 B;  1EQZ C;  4KGC D;  5B2J A;  3REL D;  5GT3 C;  4J8W C;  3O62 B;  3UTA C;  1KX3 B;  5B33 D;  2W8S A;  5CPJ A;  3REI D;  3LZ0 D;  5CPK A;  2BYK B;  5CP6 B;  4WJ3 C;  4J8V D;  4UPK A;  3W98 D;  5AV9 D;  4J8X D;  3AZF B;  2ARO C;  4YM6 B;  1B67 A;  4R8P A;  2HIO D;  3LZ1 D;  3W97 D;  5GT0 D;  2F8N B;  1KX5 A;  3AV1 B;  1M19 A;  4UUZ B;  5GT3 B;  4CAY B;  4J8W B;  3W99 D;  3REK C;  1P3B D;  3AZL D;  4XUJ A;  1P3G C;  3LEL A;  2DF4 C;  3REJ A;  1R4V A;  3UTB C;  3MGQ A;  3X1S D;  2ARO B;  1HQ3 D;  3MGR D;  1ID3 C;  3LJA B;  5AV8 A;  4H9O B;  3WKJ D;  5BNV A;  3AN2 D;  4LD9 D;  1M18 C;  1KX4 A;  3REH D;  5B2I A;  3REK B;  3AZG A;  1P3L A;  1P34 A;  3B0C W;  1P3G B;  2CV5 A;  3MVD D;  1N1J B;  2JSS A;  3C1B B;  5B31 D;  3AZM A;  5AY8 C;  1KU5 A;  2F8N H;  3C1C A;  1B6W A;  4Z5T A;  2PYO D;  1ID3 B;  3EPJ A;  4H9R B;  1F66 C;  4CSR A;  3MNN A;  2FJ7 B;  3WAA A;  3AYW A;  5B0Z B;  4KGC C;  4G91 C;  1U35 A;  3AV2 D;  5F99 C;  5B33 C;  3WTP D;  5AY8 B;  5GXQ D;  2YFV B;  3REI C;  1AOI D;  3LZ0 C;  3AZI A;  3X1T A;  4J8V C;  3W98 C;  5AV9 C;  1ZLA A;  3VH6 T;  1F66 B;  2HIO C;  3LZ1 C;  5B32 A;  3W97 C;  1JFI A;  4ZUX A;  2UWX A;  5GT0 C;  5DNN D;  1S32 A;  3AZH D;  2Y2O A;  4H9P B;  4JJN D;  4KGC B;  2NZD A;  4G91 B;  2Y2H A;  3REL B;  4YS3 D;  1P3I A;  5B33 B;  3REI B;  3AZL C;  3LZ0 B;  1EQZ A;  3B6G D;  5G49 B;  4J8V B;  2LY8 A;  3W98 B;  3X1S C;  5AV9 B;  3UT9 D;  4J8X B;  3UTA A;  3AL0 C;  5DNM A;  1TAF A;  3W96 A;  3KXB D;  2HIO B;  3LZ1 B;  5GSU A;  3MGR C;  3W97 B;  5B1M D;  1A7W A;  5GT0 B;  3WKJ C;  3AZN A;  1H3O B;  5JA4 B;  5B32 G;  4LD9 C;  2XD1 A;  3REH C;  3W99 B;  1P3B B;  3AZL B;  3B0D C;  5B1L A;  5AV6 D;  3AFA A;  2ZY2 A;  3V9R B;  5BO0 A;  5B31 C;  2RIQ A;  4HGA C;  3AZE C;  3X1S B;  1HQ3 B;  4X23 A;  2YFW A;  3MGR B;  3WKJ B;  3UTB A;  4WZS B;  3AN2 B;  4LD9 B;  4H9N B;  3REH B;  3H0M C;  3B0D B;  1BH8 B;  3EPL A;  3A6N A;  3MVD B;  2BYM B;  5CPI D;  5B31 B;  1M18 A;  4HGA B;  3WTP C;  5FUG A;  5GXQ C;  1AOI C;  4E44 A;  1P3O A;  2PYO B;  2F8N K;  5AVB D;  5AVC D;  3KUY A;  5CP6 C;  5B0Y A;  2FFF B;  5DNN C;  4Z66 A;  3AZH C;  4JJN C;  3MGP D;  3AZJ A;  5B24 A;  3AV2 B;  2Y2N A;  5B40 D;  5AV5 D;  3EPH A;  3AV1 C;  1TZY D;  3WTP B;  5GXQ B;  1AOI B;  4QLC A;  3B6G C;  1WWI A;  4XZQ A;  3TU4 D;  1P3M D;  4J8U A;  5F99 A;  3UT9 C;  3X1U D;  3AZK D;  3B6F D;  3KXB C;  3B0C T;  5B1M C;  5DNN B;  3AZH B;  1P3F A;  2NQB D;  4JJN B;  3NQU A;  3LJA C;  3X1V D;  3MGS D;  1P3K D;  4YS3 B;  5B2J D;  3B6G B;  4WU9 A;  4WNN A;  5CPJ D;  3UT9 B;  3C1B C;  5CPK D;  3KXB B;  2XD5 A;  1BH9 B;  4WU8 A;  5B1M B;  4DQY B;  5E5A A;  4R8P D;  5BS7 A;  1M1A A;  1KX5 D;  4KUD A;  2DQN C;  1M19 D;  5AV6 B;  2FJ7 C;  3FDD A;  4NE3 A;  3KWQ A;  5CPI C;  5B0Z C;  5JRG A;  3WA9 A;  4XUJ D;  3LEL D;  3REJ D;  2Y2L A;  3NQJ B;  4H9Q A;  5BNX B;  3MGQ D;  1P3P A;  3AZE A;  3B0B A;  4KHA B;  5AV8 D;  5KDM A;  3MGP C;  1P3A A;  1KX4 D;  5AV5 C;  5B40 C;  5CPI B;  5B2I D;  3AZG D;  1TZY C;  1P3L D;  3REL C;  1P34 D;  2CV5 D;  2J8P A;  3TU4 C;  2ZY5 A;  3AZM D;  1P3M C;  5AVB B;  5AVC B;  1HTA A;  3X1U C;  3AZK C;  3B6F C;  4Z2M H;  3C1C D;  4Z5T D;  2G5I C;  4WV4 B;  1Q9C A;  5C3I B;  3O62 A;  4J8X C;  1KX3 A;  3VH5 A;  2NQB C;  3MGP B;  2BYK A;  5CP6 A;  3MNN D;  3MGS C;  4AWL C;  1P3K C;  5B40 B;  5AV5 B;  3WAA D;  1TZY B;  3AYW D;  3AZF A;  5B2J C;  1U35 D;  4YM6 A;  3H0L C;  3P5J B;  3TU4 B;  3W99 C;  1P3B C;  1P3M B;  5CPJ C;  2F8N A;  3X1U B;  3R45 B;  3AZI D;  3AZK B;  4UUZ A;  3X1T D;  3AV1 A;  3B6F B;  5GT3 A;  4CAY A;  4J8W A;  4E45 A;  1HQ3 C;  2NQB B;  1ZLA D;  3X1V B;  3A1K A;  5B32 D;  3MGS B;  4ZUX D;  4AWL B;  1S32 D;  1P3K B;  2IO5 B;  3VH6 A;  3AN2 C;  1KX5 C;  2NZD D;  5B2J B;  1M19 C;  2ARO A;  4H9S C;  3KFU G;  1P3I D;  3LJA A;  2Y2Q A;  4DRA A;  5CPJ B;  4H9O A;  1EQZ D;  4XUJ C;  3VH5 W;  3MVD C;  5CPK B;  3REJ C;  2F8N G;  3MGQ C;  3UTA D;  3REK A;  2G5H C;  2PYO C;  5DNM D;  4R8P B;  1P3G A;  3W96 D;  5GSU D;  3C1B A;  1N1J A;  5AV8 C;  1KX5 B;  3AZN D;  1M19 B;  4NE6 A;  1ID3 A;  5B2I C;  3AZG C;  1P3L C;  3AV2 C;  4XUJ B;  1P34 C;  5B1L D;  4H9R A;  3LEL B;  3AFA D;  3REJ B;  2Y2G A;  2CV5 C;  2FJ7 A;  3MGQ B;  4Z2M G;  5B0Z A;  3VH6 W;  4X23 D;  3C1C C;  4Z5T C;  5AV8 B;  3UTB D;  5AY8 A;  2YFV A;  5BNV B;  2JCH A;  4EO5 B;  3MNN C;  1KX4 B;  5B2I B;  3WAA C;  3AZG B;  3AYW C;  1P3L B;  1P34 B;  1U35 C;  4YS3 C;  3A6N D;  2CV5 B;  1F66 A;  3AZM B;  1M18 D;  4H9P A;  3AZI C;  4KGC A;  1P3O D;  3C1C B;  3REL A;  4Z5T B;  1BFM A;  5B33 A;  5BT1 D;  3KUY D;  1ZLA C;  5B0Y D;  3REI A;  3LZ0 A;  4CSR B;  5G49 A;  5B32 C;  3MNN B;  4ZUX C;  4Z66 D;  4J8V A;  1S32 C;  3WAA B;  3W98 A;  1Z2C B;  3AYW B;  5AV9 A;  3AZJ D;  5B24 D;  4J8X A;  2NZD C;  1U35 B;  2HIO A;  3LZ1 A;  1P3I C;  3W97 A;  5GT0 A;  5AV6 C;  4QLC D;  3AZI B;  1H3O A;  5JA4 A;  3X1T B;  4XZQ D;  4J8U D;  5F99 D;  3W99 A;  1P3B A;  1ZLA B;  5DNM C;  3AZL A;  3W96 C;  3V9R A;  5GSU C;  5B32 B;  2BG1 A;  4ZUX B;  1S32 B;  1JFI B;  1P3F D;  3X1S A;  2NZD B;  3AZN C;  1F1E A;  1HQ3 A;  1WWS A;  1P3I B;  3MGR A;  3WKJ A;  2ZY4 A;  1EQZ B;  5B1L C;  3AN2 A;  4WU9 D;  3AFA C;  4LD9 A;  4H9N A;  4H9S A;  3REH A;  3UTA B;  5DNM B;  1TAF B;  4ZBJ C;  4X23 C;  1BH8 A;  3W96 B;  5GSU B;  5AVB C;  5AVC C;  2BYM A;  4NFT A;  3MVD A;  5B31 A;  4WU8 D;  5E5A D;  1W2E A;  3AZN B;  1T3U A;  5C3I C;  2PYO A;  1M1A D;  4KUD D;  2L5A A;  2VQR A;  5B1L B;  3AFA B;  3A6N C;  3KWQ D;  5BO0 B;  5JRG D;  3EPK A;  2Y2J A;  3WA9 D;  4ZBJ B;  4X23 B;  1P3O C;  3AV2 A;  2YFW B;  2Y2I A;  4DRB A;  1P3P D;  4M6B A;  5BT1 C;  3KUY C;  3WTP A;  3UTB B;  5GXQ A;  3AZE D;  1ULY A;  5B0Y C;  3A1I A;  1AOI A;  5B31 G;  2Y2M A;  3VH5 T;  4Z66 C;  1P3A D;  3AZJ C;  3X1V C;  5B24 C;  3A6N B;  1PZR A;  2IO5 C;  2CWE A;  1M18 B;  5DNN A;  5FUG B;  3AZH A;  3IP4 C;  4JJN A;  2RVQ D;  4QLC C;  1P3O B;  4XZQ C;  3KSY A;  4J8U C;  4YS3 A;  3KUY B;  5CPK C;  5B0Y B;  3B6G A;  3O62 D;  1KX3 D;  4Z66 B;  4R8P C;  1P3F C;  3UT9 A;  3AZJ B;  5B24 B;  5CP6 D;  3KXB A;  1BH9 A;  5B1M A;  2HUE C;  3AZF D;  4YM6 D;  2F2A C;  4QLC B;  4WU9 C;  4XZQ B;  4J8U B;  5F99 B;  2F8N D;  3LEL C;  3AV1 D;  5AV6 A;  5GT3 D;  4J8W D;  4WU8 C;  1P3F B;  5E5A C;  3NQU B;  3NQJ A;  5BNX A;  5BS7 C;  2HUE B;  3EG5 B;  1M1A C;  4KUD C;  4EO5 C;  2ARO D;  1KX4 C;  4WU9 B;  3KWQ C;  4KHA A;  4WNN B;  3LJA D;  5JRG C;  2JE5 A;  3WA9 C;  3AZM C;  4WU8 B;  3WTP E;  1P3P C;  5CPI A;  5CHL B;  3REK D;  5E5A B;  1P3G D;  3F6T A;  3C1B D;  1M1A B;  4KUD B;  5AVB A;  5AVC A;  1P3A C;  2ZY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...