2RVQD

Solution structure of the isolated histone h2a-h2b heterodimer
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
GPGMPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H2A type 1-B/E
publication title Solution structure of the isolated histone H2A-H2B heterodimer
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein/nuclear protein
total genus 35
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2rvqD00
5B31B 5B24A 3VH5W 3KXBB 2NZDB 3VH5A 5E5AB 3AZHD 3NQJB 5F99A 3WTPE 4YS3D 3AZIA 4ZBJC 1P3MD 5BNVA 5B2JA 3UTBB 4J8XD 1P3LB 5B0YA 3B6FC 3WKJA 3O62B 3B6FA 3C1CA 3TU4A 3VH6W 1KX4A 5BO0B 4KGCB 2L5AA 3B0CW 5B1LB 5GT0B 3AZEA 2FJ7D 1HTAA 1TZYB 3AZND 5B32C 1ID3C 1P3FB 3AN2D 4Z2MG 3AZHA 4YS3C 4H9RB 1Q9CA 1P3MA 5B1MC 4X23B 4J8XA 1KX5D 3X1UD 1P34D 2CWEA 5AV5D 1U35B 3AV2B 2FJ7A 3UTAD 4HGAB 4XZQB 3AZNA 5GXQD 5AV6D 3AZFB 1M19D 1P3AB 3AN2A 4J8VD 3LZ0C 4H9OB 4NE3A 1JFIB 3AYWB 3X1UC 1KX5A 3AZGD 3LELD 1P34A 4G92B 5AV9D 3W98C 5B24B 1N1JA 5AV5A 4G91B 5B31G 1P3IC 2YFVA 3AZIB 3KXBD 3UTAA 2NZDD 4ZBJB 5AV6C 5AVCC 5B0YB 3WKJB 3W96D 5GXQA 3REHD 3B6FB 3REKD 5AV8C 1M19A 1R4VA 3UT9C 4J8VA 3MNNA 3O62D 3LJAC 3LELC 1AOID 3AZGA 4WNNA 5AV9A 5B1LD 5B32B 1H3OB 4UUZA 5BT1D 5AVBD 4YS3B 4H9NB 3KXBA 2NZDA 3WA9C 1P3FD 4Z66C 5B1MB 3W96A 3REKC 4R8PD 3REHA 3REKA 3AZMD 3B6GD 4X23D 4H9PB 1KX3D 3O62A 2YFWA 3AZLC 2AROC 1AOIA 2FJ7B 1HQ3D 5BO0A 5B1LA 3AV2D 2JSSA 3AN2B 5AVBA 3LZ0B 3AZFD 3WTPC 1P3AD 1P3FA 4QLCD 3MGPD 3X1UB 4R8PA 3AZMA 4WU9D 5AV5B 3B6GA 3W98B 4X23A 3B0BA 4M6BA 2YFVB 2RVQD 3R45B 4JJNC 3X1TC 1P3IB 1KX3A 4E45A 3UTAB 1HQ3A 5GXQB 5AVCB 5AV6B 3AV2A 5CPKC 1M19B 5AV8B 4XZQA 4J8UC 2F8NH 5GT3C 3AZKC 1P3KC 3AZFA 1P3AA 4DRAA 3KUYC 4QLCA 3RELC 3LJAB 2BYKB 3LELB 3MGPA 4H9OA 4WNNB 5JRGC 4WU9A 1JFIA 3AYWA 2RVQC 5B32D 5B0ZC 3WA9B 1ID3D 3W96B 3REHB 1P3OC 3REKB 3MGRC 3REJC 1BH9A 5B1MD 2YFWB 2IO5B 3AZLB 4ZUXC 4CSRB 1AOIB 3B0DC 4Z2MH 3W99C 5AVBB 3VH6T 2F8ND 4Z5TC 4AWLB 1M1AD 5B32A 1H3OA 3B0CT 2BYMB 1ID3A 4EO5C 4WU8C 4YS3A 4R8PB 3LZ0D 4H9NA 3AZMB 5CP6D 1S32C 3B6GB 1F1EA 5B1MA 1KX3B 3W98D 1HQ3B 4H9PA 4J8WD 1P3PC 3AFAC 1P3ID 5CPIC 4H9QA 5CPKB 2F8NA 1M1AC 5AVCD 2HIOC 5GT3B 3X1VC 3AZKB 5AV8D 4QLCB 3MGPB 3KUYB 3RELB 3UT9D 2CV5C 5CP6C 3LZ0A 3C1BC 4WU9B 1P3GC 3KWQC 3LJAD 3X1UA 1M18C 4J8WC 3W98A 5B0ZB 3R45A 1P3IA 1P3BC 3MGSD 1BH9B 3REJB 3WA9D 2F8NK 1BFMA 4Z66D 5AV6A 5AVCA 3MGQC 5AV8A 4NFTA 2PYOC 3NQUB 4ZUXB 3UT9A 3AZLD 3AV1C 3LELA 2AROD 2BYKA 3LJAA 3W99B 1ULYA 4WV4B 4KUDD 2LY8A 1WWIA 5CHLB 4Z5TB 1ID3B 5C3IC 3X1SC 4EO5B 3MGSC 4WU8B 3MGSA 5GSUC 3WA9A 1S32B 3WTPD 5B40C 1B67A 4H9SC 4Z66A 3AZJC 1P3PB 3X1TD 4JJND 3AZLA 3REIC 4CSRA 4H9QB 5CPIB 2AROA 5AY8C 4KUDC 2F8NB 5CPJC 1M1AB 2HIOB 3X1VB 5CPKD 2HUEC 5B31C 4J8UD 3W97C 5B2ID 2CV5B 5GT3D 5CP6B 3C1BB 3AZKD 1P3KD 5E5AC 2BYMA 1P3GB 3WTPA 3KWQB 3KUYD 3RELD 4E44A 5JRGD 1M18B 3UTBC 4J8WB 1P3LC 3X1TA 4JJNA 4KGCC 5BS7C 5B0ZD 5GT0C 2NQBC 5CPKA 1P3OD 1ZLAC 3MGRD 3REJD 1KU5A 5B2IC 3UT9B 4J8UA 2PYOB 5B2IA 5B33C 5GT3A 3AZKA 1P3KA 4CAYA 4ZUXD 3KUYA 3RELA 3LZ1C 5JRGA 1EQZD 3V9RB 5B32G 3W99D 5C3IB 3MGSB 4Z5TD 5DNNC 5B0ZA 4Z66B 5DNMC 4WU8D 4HGAC 1P3OA 3MGRA 3VH5T 3REJA 3AZJB 1S32D 5JA4A 4XUJC 3TU4D 2AROB 3NQUA 4ZUXA 3REIB 1P3PD 4LD9C 5AY8B 3A6NC 4KUDB 1EQZC 3WAAC 3AFAD 1BH8B 5CPJB 2F8NG 5CPID 3AZED 3MVDD 4G92C 3W99A 5B24C 2HUEB 4G91C 3W97B 1F66D 4Z5TA 2HIOD 3X1VD 3WTPB 5F99C 3AZIC 2CV5D 4WU8A 3C1BD 5BNXA 5B2JC 1P3GD 1S32A 5B0YC 3KWQD 3WKJC 3X1TB 3C1CC 4JJNB 4YM6D 3TU4C 1M18D 1KX4C 1P3PA 3VH6A 4KHAB 3AFAA 3AZEC 3MVDC 5CPIA 1P3BD 3MVDA 1ZLAB 2NQBB 1B6WA 4J8UB 1F66C 5B2IB 1M1AA 1F66A 1P3KB 5B33B 2HIOA 3X1VA 3AZHC 3MGQD 4CAYB 1TAFA 2PYOD 2CV5A 5G49A 5JRGB 5CP6A 3LZ1B 3C1BA 1P3MC 1P3GA 4J8XC 3KWQA 3AV1D 4YM6C 4YM6A 1M18A 4NE6A 4J8WA 5DNNB 3X1SD 2FJ7C 5DNMB 1P3OB 1P3BA 3MGRB 3AZNC 5JA4B 5GSUD 5KDMB 5B40D 4XUJB 3AN2C 3MGQA 3AZJD 1WWSA 2PYOA 3B0DB 4LD9B 3MNND 3A6NB 1EQZB 3WAAB 1KX5C 3REID 1P34C 3AV1A 5AY8D 5AV5C 3V9RA 5CPJD 5F99B 3X1SA 5B31D 3UTAC 3W97D 1A7WA 5BNXB 4DRBA 5BNVB 5GSUA 5E5AD 5B2JB 4WZSB 5GXQC 5B40A 4H9SA 1M19C 3C1CB 4J8VC 3TU4B 3AZJA 3UTBD 1P3LD 3MNNC 1KX4B 3AFAB 3AZGC 5FUGA 3REIA 3AZEB 3MVDB 5AV9C 5AY8A 4KUDA 4KGCD 1BH8A 5CPJA 1F66B 5GT0D 2NQBD 1ZLAD 1TAFB 3AZHB 1TZYD 5B31A 3W97A 5G49B 3KXBC 2NZDC 5B33D 1P3MB 5E5AA 4J8XB 3W96C 3NQJA 3REHC 4YM6B 3LZ1D 3UTBA 1P3LA 3O62C 2IO5C 1AOIC 1P3BB 5DNND 4KHAA 5BS7A 3AZNB 1U35D 5B1LC 4KGCA 5DNMD 5BT1C 5GT0A 5AVBC 2NQBA 3MGQB 1TZYC 1ZLAA 4XZQD 1TZYA 4AWLC 4XUJD 5B33A 1P3FC 1KX5B 4R8PC 3AV1B 1P34B 4LD9D 3AZMC 4H9RA 3LZ1A 3A6ND 3B6GC 4X23C 1N1JB 3WAAD 3AYWD 1KX3C 4NE5A 3X1SB 5B24D 1HQ3C 3KSYA 5DNNA 5GSUB 1U35C 5F99D 1U35A 5B40B 3AV2C 3AZID 5DNMA 4XZQC 5B2JD 4J8VB 5KDMA 5B0YD 3WKJD 3AZFC 3MNNB 4XUJA 1P3AC 3B6FD 3C1CD 4QLCC 3MGPC 5FUGB 3AZGB 1KX4D 4LD9A 4WU9C 5AV9B 3A6NA 3AYWC 1EQZA 3WAAA 4UUZB
chains in the Genus database with same CATH superfamily
5B31B 5B24A 3VH5W 3KXBB 2NZDB 3VH5A 1W2EA 5E5AB 3AZHD 3NQJB 5F99A 3WTPE 2Y2OA 4YS3D 3AZIA 4ZBJC 1P3MD 5BNVA 5B2JA 2G5IC 3UTBB 4J8XD 1P3LB 5B0YA 3B6FC 3WKJA 3O62B 3B6FA 3C1CA 3TU4A 3VH6W 1KX4A 5BO0B 4KGCB 2L5AA 3B0CW 5B1LB 5GT0B 3AZEA 2FJ7D 1HTAA 1TZYB 3AZND 5B32C 1ID3C 1P3FB 3AN2D 4Z2MG 3AZHA 4YS3C 4H9RB 1Q9CA 1P3MA 5B1MC 4X23B 4J8XA 1KX5D 2J8PA 3X1UD 1P34D 2CWEA 5AV5D 1U35B 3AV2B 2FJ7A 3UTAD 4HGAB 4XZQB 3AZNA 5GXQD 5AV6D 3AZFB 1M19D 1P3AB 3AN2A 4J8VD 3LZ0C 4DQYB 4H9OB 4NE3A 1JFIB 3AYWB 3FDDA 3X1UC 1KX5A 3AZGD 3LELD 1P34A 4G92B 5AV9D 3W98C 5B24B 1N1JA 5AV5A 5B31G 4G91B 1P3IC 2YFVA 3F6TA 3AZIB 3KXBD 2Y2MA 3UTAA 2NZDD 2ZY2A 4ZBJB 5AV6C 5AVCC 5B0YB 3WKJB 3W96D 5GXQA 3REHD 3B6FB 3REKD 5AV8C 1M19A 1R4VA 2Y2IA 3UT9C 4J8VA 3MNNA 3O62D 3LJAC 3LELC 1AOID 3AZGA 4WNNA 5AV9A 5B1LD 5B32B 2Y2KA 1H3OB 4UUZA 5BT1D 5AVBD 2Y2PA 4YS3B 4H9NB 3KXBA 2NZDA 3WA9C 1P3FD 2ZY3A 4Z66C 5B1MB 3W96A 3REKC 4R8PD 3REHA 3REKA 3AZMD 3B6GD 4X23D 4H9PB 3EPHA 3A1IA 1KX3D 3O62A 2YFWA 3AZLC 2AROC 1AOIA 2FJ7B 1HQ3D 5BO0A 2RIQA 5B1LA 3AV2D 2JSSA 3AN2B 5AVBA 2JCHA 3LZ0B 3AZFD 3WTPC 1P3AD 1P3FA 4QLCD 3MGPD 3X1UB 1PZRA 4R8PA 3AZMA 4WU9D 5AV5B 3B6GA 3W98B 4X23A 3B0BA 4M6BA 2YFVB 2RVQD 3R45B 4JJNC 3X1TC 1P3IB 1KX3A 4E45A 3UTAB 1HQ3A 2Y2GA 5GXQB 5AVCB 5AV6B 3AV2A 5CPKC 1M19B 5AV8B 4XZQA 4J8UC 2F8NH 5GT3C 3AZKC 1P3KC 3AZFA 1P3AA 4DRAA 3KUYC 4QLCA 3RELC 3LJAB 2BYKB 3LELB 3MGPA 4H9OA 4WNNB 5JRGC 4WU9A 1JFIA 3AYWA 2RVQC 4WJ3C 5B32D 5B0ZC 3WA9B 1ID3D 3W96B 2G5HC 3REHB 1P3OC 3REKB 3MGRC 3REJC 1BH9A 2Y2LA 5B1MD 2Y2NA 2YFWB 2IO5B 3AZLB 4ZUXC 4CSRB 1AOIB 3B0DC 4Z2MH 3W99C 5AVBB 3VH6T 2F8ND 4Z5TC 4AWLB 1M1AD 5B32A 1H3OA 3B0CT 2BYMB 1ID3A 4EO5C 4WU8C 4YS3A 4R8PB 3LZ0D 4H9NA 2F2AC 3AZMB 5CP6D 1S32C 3B6GB 1F1EA 3H0RC 5B1MA 1KX3B 3W98D 1HQ3B 4H9PA 4J8WD 1P3PC 3AFAC 1P3ID 5CPIC 4H9QA 5CPKB 2F8NA 1M1AC 5AVCD 2HIOC 5GT3B 3X1VC 3AZKB 5AV8D 4QLCB 3MGPB 3KUYB 3RELB 3UT9D 2CV5C 5CP6C 3LZ0A 3C1BC 4WU9B 1P3GC 3KWQC 3LJAD 3X1UA 1M18C 4J8WC 3W98A 2ZY5A 3H0LC 5B0ZB 3R45A 1P3IA 1P3BC 3MGSD 1BH9B 3REJB 3WA9D 2F8NK 1BFMA 4Z66D 5AV6A 5AVCA 1Z2CB 3MGQC 5AV8A 4NFTA 2PYOC 2Y2QA 3NQUB 4ZUXB 3UT9A 3AZLD 3AV1C 3LELA 2AROD 2BYKA 3LJAA 3W99B 1ULYA 4WV4B 4KUDD 2LY8A 1WWIA 5CHLB 4Z5TB 1ID3B 1T3UA 5C3IC 3X1SC 4EO5B 3MGSC 4WU8B 3MGSA 5GSUC 3WA9A 1S32B 3WTPD 5B40C 1B67A 4H9SC 4Z66A 3EPJA 3AZJC 1P3PB 3X1TD 4JJND 3AZLA 3REIC 4CSRA 4H9QB 5CPIB 2AROA 5AY8C 4KUDC 2F8NB 5CPJC 1M1AB 3P5JB 2HIOB 3X1VB 5CPKD 2HUEC 5B31C 4J8UD 3W97C 5B2ID 2CV5B 5GT3D 5CP6B 3C1BB 3AZKD 1P3KD 2Y2HA 5E5AC 2BYMA 4UPKA 3WTPA 1P3GB 3KWQB 3KUYD 3RELD 4E44A 5JRGD 1M18B 3UTBC 4J8WB 1P3LC 3X1TA 4JJNA 4KGCC 5BS7C 5B0ZD 5GT0C 2NQBC 5CPKA 1P3OD 1ZLAC 3MGRD 3REJD 1KU5A 5B2IC 3UT9B 4J8UA 2PYOB 5B2IA 5B33C 2ZY4A 5GT3A 3AZKA 1P3KA 4CAYA 4ZUXD 3KUYA 3RELA 3LZ1C 5JRGA 1EQZD 2JE5A 3V9RB 5B32G 3W99D 5C3IB 3MGSB 4Z5TD 5DNNC 5B0ZA 4Z66B 5DNMC 4WU8D 4HGAC 1P3OA 3MGRA 3VH5T 3REJA 3AZJB 1S32D 5JA4A 2BG1A 4XUJC 3TU4D 2AROB 3NQUA 4ZUXA 3REIB 1P3PD 4LD9C 5AY8B 3A6NC 4KUDB 1EQZC 3WAAC 3AFAD 1BH8B 2ZM5A 5CPJB 2F8NG 5CPID 3AZED 3MVDD 4G92C 3W99A 5B24C 2HUEB 4G91C 3W97B 1F66D 4Z5TA 2HIOD 2XD1A 3X1VD 3WTPB 5F99C 3AZIC 2CV5D 4WU8A 3C1BD 3AL0C 5BNXA 5B2JC 1P3GD 1S32A 5B0YC 3KWQD 3WKJC 3X1TB 3C1CC 4JJNB 4YM6D 3TU4C 1M18D 1KX4C 1P3PA 3VH6A 4KHAB 3AFAA 3AZEC 3MVDC 5CPIA 1P3BD 3MVDA 1ZLAB 2NQBB 3H0MC 1B6WA 4J8UB 3EPLA 1F66C 5B2IB 1M1AA 1F66A 2UWXA 5B33B 2HIOA 3X1VA 1P3KB 2FFFB 3A1KA 3AZHC 3MGQD 4CAYB 1TAFA 2PYOD 2CV5A 5G49A 5JRGB 5CP6A 3LZ1B 3C1BA 1P3MC 1P3GA 4J8XC 3KWQA 3AV1D 4YM6C 4YM6A 1M18A 4NE6A 4J8WA 5DNNB 3X1SD 2FJ7C 5DNMB 1P3OB 1P3BA 3MGRB 3AZNC 5JA4B 5GSUD 5KDMB 5B40D 4XUJB 2XD5A 3AN2C 3MGQA 3AZJD 1WWSA 2PYOA 3B0DB 4LD9B 3MNND 3A6NB 1EQZB 3WAAB 1KX5C 3REID 1P34C 3AV1A 5AY8D 5AV5C 3V9RA 5CPJD 5F99B 3IP4C 3X1SA 5B31D 3UTAC 3W97D 1A7WA 5BNXB 4DRBA 5BNVB 5GSUA 5E5AD 5B2JB 4WZSB 3KFUG 5GXQC 5B40A 4H9SA 1M19C 3C1CB 4J8VC 3TU4B 3AZJA 3EPKA 3UTBD 1P3LD 3MNNC 1KX4B 3AFAB 3AZGC 5FUGA 3REIA 3AZEB 3MVDB 5AV9C 5AY8A 4KUDA 4KGCD 1BH8A 5CPJA 1F66B 5GT0D 2NQBD 1ZLAD 1TAFB 3AZHB 1TZYD 5B31A 3W97A 5G49B 3KXBC 2NZDC 5B33D 1P3MB 5E5AA 4J8XB 3W96C 3NQJA 3EG5B 3REHC 4YM6B 3LZ1D 3UTBA 1P3LA 2Y2JA 3O62C 2IO5C 1AOIC 1P3BB 5DNND 4KHAA 5BS7A 3AZNB 1U35D 5B1LC 4KGCA 5DNMD 5BT1C 5GT0A 5AVBC 2NQBA 3MGQB 1TZYC 1ZLAA 4XZQD 1TZYA 4AWLC 4XUJD 5B33A 1P3FC 1KX5B 4R8PC 3AV1B 2W8SA 1P34B 4LD9D 3AZMC 4H9RA 3LZ1A 3A6ND 3B6GC 4X23C 1N1JB 2VQRA 3WAAD 3AYWD 2DF4C 1KX3C 4NE5A 3X1SB 5B24D 1HQ3C 3KSYA 5DNNA 5GSUB 1U35C 5F99D 1U35A 5B40B 3AV2C 3AZID 5DNMA 4XZQC 5B2JD 4J8VB 5KDMA 5B0YD 3WKJD 3AZFC 3MNNB 4XUJA 1P3AC 3B6FD 2DQNC 3C1CD 4QLCC 3MGPC 5FUGB 3AZGB 1KX4D 4LD9A 4WU9C 5AV9B 3A6NA 3AYWC 1EQZA 3WAAA 4UUZB
chains in the Genus database with same CATH topology
5B31B 5B24A 3VH5W 3KXBB 2NZDB 3VH5A 1W2EA 5E5AB 3AZHD 3NQJB 5F99A 3WTPE 2Y2OA 4YS3D 3AZIA 4ZBJC 1P3MD 5BNVA 5B2JA 2G5IC 3UTBB 4J8XD 1P3LB 5B0YA 3B6FC 3WKJA 3O62B 3B6FA 3C1CA 3TU4A 3VH6W 1KX4A 5BO0B 4KGCB 2L5AA 3B0CW 5B1LB 5GT0B 3AZEA 2FJ7D 1HTAA 1TZYB 3AZND 5B32C 1ID3C 1P3FB 3AN2D 4Z2MG 3AZHA 4YS3C 4H9RB 1Q9CA 1P3MA 5B1MC 4X23B 4J8XA 1KX5D 2J8PA 3X1UD 1P34D 2CWEA 5AV5D 1U35B 3AV2B 2FJ7A 3UTAD 4HGAB 4XZQB 3AZNA 5GXQD 5AV6D 3AZFB 1M19D 1P3AB 3AN2A 4J8VD 3LZ0C 4DQYB 4H9OB 4NE3A 1JFIB 3AYWB 3FDDA 3X1UC 1KX5A 3AZGD 3LELD 1P34A 4G92B 5AV9D 3W98C 5B24B 1N1JA 5AV5A 5B31G 4G91B 1P3IC 2YFVA 3F6TA 3AZIB 3KXBD 2Y2MA 3UTAA 2NZDD 2ZY2A 4ZBJB 5AV6C 5AVCC 5B0YB 3WKJB 3W96D 5GXQA 3REHD 3B6FB 3REKD 5AV8C 1M19A 1R4VA 2Y2IA 3UT9C 4J8VA 3MNNA 3O62D 3LJAC 3LELC 1AOID 3AZGA 4WNNA 5AV9A 5B1LD 5B32B 2Y2KA 1H3OB 4UUZA 5BT1D 5AVBD 2Y2PA 4YS3B 4H9NB 3KXBA 2NZDA 3WA9C 1P3FD 2ZY3A 4Z66C 5B1MB 3W96A 3REKC 4R8PD 3REHA 3REKA 3AZMD 3B6GD 4X23D 4H9PB 3EPHA 3A1IA 1KX3D 3O62A 2YFWA 3AZLC 2AROC 1AOIA 2FJ7B 1HQ3D 5BO0A 2RIQA 5B1LA 3AV2D 2JSSA 3AN2B 5AVBA 2JCHA 3LZ0B 3AZFD 3WTPC 1P3AD 1P3FA 4QLCD 3MGPD 3X1UB 1PZRA 4R8PA 3AZMA 4WU9D 5AV5B 3B6GA 3W98B 4X23A 3B0BA 4M6BA 2YFVB 2RVQD 3R45B 4JJNC 3X1TC 1P3IB 1KX3A 4E45A 3UTAB 1HQ3A 2Y2GA 5GXQB 5AVCB 5AV6B 3AV2A 5CPKC 1M19B 5AV8B 4XZQA 4J8UC 2F8NH 5GT3C 3AZKC 1P3KC 3AZFA 1P3AA 4DRAA 3KUYC 4QLCA 3RELC 3LJAB 2BYKB 3LELB 3MGPA 4H9OA 4WNNB 5JRGC 4WU9A 1JFIA 3AYWA 2RVQC 4WJ3C 5B32D 5B0ZC 3WA9B 1ID3D 3W96B 2G5HC 3REHB 1P3OC 3REKB 3MGRC 3REJC 1BH9A 2Y2LA 5B1MD 2Y2NA 2YFWB 2IO5B 3AZLB 4ZUXC 4CSRB 1AOIB 3B0DC 4Z2MH 3W99C 5AVBB 3VH6T 2F8ND 4Z5TC 4AWLB 1M1AD 5B32A 1H3OA 3B0CT 2BYMB 1ID3A 4EO5C 4WU8C 4YS3A 4R8PB 3LZ0D 4H9NA 2F2AC 3AZMB 5CP6D 1S32C 3B6GB 1F1EA 3H0RC 5B1MA 1KX3B 3W98D 1HQ3B 4H9PA 4J8WD 1P3PC 3AFAC 1P3ID 5CPIC 4H9QA 5CPKB 2F8NA 1M1AC 5AVCD 2HIOC 5GT3B 3X1VC 3AZKB 5AV8D 4QLCB 3MGPB 3KUYB 3RELB 3UT9D 2CV5C 5CP6C 3LZ0A 3C1BC 4WU9B 1P3GC 3KWQC 3LJAD 3X1UA 1M18C 4J8WC 3W98A 2ZY5A 3H0LC 5B0ZB 3R45A 1P3IA 1P3BC 3MGSD 1BH9B 3REJB 3WA9D 2F8NK 1BFMA 4Z66D 5AV6A 5AVCA 1Z2CB 3MGQC 5AV8A 4NFTA 2PYOC 2Y2QA 3NQUB 4ZUXB 3UT9A 3AZLD 3AV1C 3LELA 2AROD 2BYKA 3LJAA 3W99B 1ULYA 4WV4B 4KUDD 2LY8A 1WWIA 5CHLB 4Z5TB 1ID3B 1T3UA 5C3IC 3X1SC 4EO5B 3MGSC 4WU8B 3MGSA 5GSUC 3WA9A 1S32B 3WTPD 5B40C 1B67A 4H9SC 4Z66A 3EPJA 3AZJC 1P3PB 3X1TD 4JJND 3AZLA 3REIC 4CSRA 4H9QB 5CPIB 2AROA 5AY8C 4KUDC 2F8NB 5CPJC 1M1AB 3P5JB 2HIOB 3X1VB 5CPKD 2HUEC 5B31C 4J8UD 3W97C 5B2ID 2CV5B 5GT3D 5CP6B 3C1BB 3AZKD 1P3KD 2Y2HA 5E5AC 2BYMA 4UPKA 3WTPA 1P3GB 3KWQB 3KUYD 3RELD 4E44A 5JRGD 1M18B 3UTBC 4J8WB 1P3LC 3X1TA 4JJNA 4KGCC 5BS7C 5B0ZD 5GT0C 2NQBC 5CPKA 1P3OD 1ZLAC 3MGRD 3REJD 1KU5A 5B2IC 3UT9B 4J8UA 2PYOB 5B2IA 5B33C 2ZY4A 5GT3A 3AZKA 1P3KA 4CAYA 4ZUXD 3KUYA 3RELA 3LZ1C 5JRGA 1EQZD 2JE5A 3V9RB 5B32G 3W99D 5C3IB 3MGSB 4Z5TD 5DNNC 5B0ZA 4Z66B 5DNMC 4WU8D 4HGAC 1P3OA 3MGRA 3VH5T 3REJA 3AZJB 1S32D 5JA4A 2BG1A 4XUJC 3TU4D 2AROB 3NQUA 4ZUXA 3REIB 1P3PD 4LD9C 5AY8B 3A6NC 4KUDB 1EQZC 3WAAC 3AFAD 1BH8B 2ZM5A 5CPJB 2F8NG 5CPID 3AZED 3MVDD 4G92C 3W99A 5B24C 2HUEB 4G91C 3W97B 1F66D 4Z5TA 2HIOD 2XD1A 3X1VD 3WTPB 5F99C 3AZIC 2CV5D 4WU8A 3C1BD 3AL0C 5BNXA 5B2JC 1P3GD 1S32A 5B0YC 3KWQD 3WKJC 3X1TB 3C1CC 4JJNB 4YM6D 3TU4C 1M18D 1KX4C 1P3PA 3VH6A 4KHAB 3AFAA 3AZEC 3MVDC 5CPIA 1P3BD 3MVDA 1ZLAB 2NQBB 3H0MC 1B6WA 4J8UB 3EPLA 1F66C 5B2IB 1M1AA 1F66A 2UWXA 5B33B 2HIOA 3X1VA 1P3KB 2FFFB 3A1KA 3AZHC 3MGQD 4CAYB 1TAFA 2PYOD 2CV5A 5G49A 5JRGB 5CP6A 3LZ1B 3C1BA 1P3MC 1P3GA 4J8XC 3KWQA 3AV1D 4YM6C 4YM6A 1M18A 4NE6A 4J8WA 5DNNB 3X1SD 2FJ7C 5DNMB 1P3OB 1P3BA 3MGRB 3AZNC 5JA4B 5GSUD 5KDMB 5B40D 4XUJB 2XD5A 3AN2C 3MGQA 3AZJD 1WWSA 2PYOA 3B0DB 4LD9B 3MNND 3A6NB 1EQZB 3WAAB 1KX5C 3REID 1P34C 3AV1A 5AY8D 5AV5C 3V9RA 5CPJD 5F99B 3IP4C 3X1SA 5B31D 3UTAC 3W97D 1A7WA 5BNXB 4DRBA 5BNVB 5GSUA 5E5AD 5B2JB 4WZSB 3KFUG 5GXQC 5B40A 4H9SA 1M19C 3C1CB 4J8VC 3TU4B 3AZJA 3EPKA 3UTBD 1P3LD 3MNNC 1KX4B 3AFAB 3AZGC 5FUGA 3REIA 3AZEB 3MVDB 5AV9C 5AY8A 4KUDA 4KGCD 1BH8A 5CPJA 1F66B 5GT0D 2NQBD 1ZLAD 1TAFB 3AZHB 1TZYD 5B31A 3W97A 5G49B 3KXBC 2NZDC 5B33D 1P3MB 5E5AA 4J8XB 3W96C 3NQJA 3EG5B 3REHC 4YM6B 3LZ1D 3UTBA 1P3LA 2Y2JA 3O62C 2IO5C 1AOIC 1P3BB 5DNND 4KHAA 5BS7A 3AZNB 1U35D 5B1LC 4KGCA 5DNMD 5BT1C 5GT0A 5AVBC 2NQBA 3MGQB 1TZYC 1ZLAA 4XZQD 1TZYA 4AWLC 4XUJD 5B33A 1P3FC 1KX5B 4R8PC 3AV1B 2W8SA 1P34B 4LD9D 3AZMC 4H9RA 3LZ1A 3A6ND 3B6GC 4X23C 1N1JB 2VQRA 3WAAD 3AYWD 2DF4C 1KX3C 4NE5A 3X1SB 5B24D 1HQ3C 3KSYA 5DNNA 5GSUB 1U35C 5F99D 1U35A 5B40B 3AV2C 3AZID 5DNMA 4XZQC 5B2JD 4J8VB 5KDMA 5B0YD 3WKJD 3AZFC 3MNNB 4XUJA 1P3AC 3B6FD 2DQNC 3C1CD 4QLCC 3MGPC 5FUGB 3AZGB 1KX4D 4LD9A 4WU9C 5AV9B 3A6NA 3AYWC 1EQZA 3WAAA 4UUZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B31 B;  5B24 A;  3VH5 W;  3KXB B;  2NZD B;  3VH5 A;  5E5A B;  3AZH D;  3NQJ B;  5F99 A;  3WTP E;  4YS3 D;  3AZI A;  4ZBJ C;  1P3M D;  5BNV A;  5B2J A;  3UTB B;  4J8X D;  1P3L B;  5B0Y A;  3B6F C;  3WKJ A;  3O62 B;  3B6F A;  3C1C A;  3TU4 A;  3VH6 W;  1KX4 A;  5BO0 B;  4KGC B;  2L5A A;  3B0C W;  5B1L B;  5GT0 B;  3AZE A;  2FJ7 D;  1HTA A;  1TZY B;  3AZN D;  5B32 C;  1ID3 C;  1P3F B;  3AN2 D;  4Z2M G;  3AZH A;  4YS3 C;  4H9R B;  1Q9C A;  1P3M A;  5B1M C;  4X23 B;  4J8X A;  1KX5 D;  3X1U D;  1P34 D;  2CWE A;  5AV5 D;  1U35 B;  3AV2 B;  2FJ7 A;  3UTA D;  4HGA B;  4XZQ B;  3AZN A;  5GXQ D;  5AV6 D;  3AZF B;  1M19 D;  1P3A B;  3AN2 A;  4J8V D;  3LZ0 C;  4H9O B;  4NE3 A;  1JFI B;  3AYW B;  3X1U C;  1KX5 A;  3AZG D;  3LEL D;  1P34 A;  4G92 B;  5AV9 D;  3W98 C;  5B24 B;  1N1J A;  5AV5 A;  4G91 B;  5B31 G;  1P3I C;  2YFV A;  3AZI B;  3KXB D;  3UTA A;  2NZD D;  4ZBJ B;  5AV6 C;  5AVC C;  5B0Y B;  3WKJ B;  3W96 D;  5GXQ A;  3REH D;  3B6F B;  3REK D;  5AV8 C;  1M19 A;  1R4V A;  3UT9 C;  4J8V A;  3MNN A;  3O62 D;  3LJA C;  3LEL C;  1AOI D;  3AZG A;  4WNN A;  5AV9 A;  5B1L D;  5B32 B;  1H3O B;  4UUZ A;  5BT1 D;  5AVB D;  4YS3 B;  4H9N B;  3KXB A;  2NZD A;  3WA9 C;  1P3F D;  4Z66 C;  5B1M B;  3W96 A;  3REK C;  4R8P D;  3REH A;  3REK A;  3AZM D;  3B6G D;  4X23 D;  4H9P B;  1KX3 D;  3O62 A;  2YFW A;  3AZL C;  2ARO C;  1AOI A;  2FJ7 B;  1HQ3 D;  5BO0 A;  5B1L A;  3AV2 D;  2JSS A;  3AN2 B;  5AVB A;  3LZ0 B;  3AZF D;  3WTP C;  1P3A D;  1P3F A;  4QLC D;  3MGP D;  3X1U B;  4R8P A;  3AZM A;  4WU9 D;  5AV5 B;  3B6G A;  3W98 B;  4X23 A;  3B0B A;  4M6B A;  2YFV B;  2RVQ D;  3R45 B;  4JJN C;  3X1T C;  1P3I B;  1KX3 A;  4E45 A;  3UTA B;  1HQ3 A;  5GXQ B;  5AVC B;  5AV6 B;  3AV2 A;  5CPK C;  1M19 B;  5AV8 B;  4XZQ A;  4J8U C;  2F8N H;  5GT3 C;  3AZK C;  1P3K C;  3AZF A;  1P3A A;  4DRA A;  3KUY C;  4QLC A;  3REL C;  3LJA B;  2BYK B;  3LEL B;  3MGP A;  4H9O A;  4WNN B;  5JRG C;  4WU9 A;  1JFI A;  3AYW A;  2RVQ C;  5B32 D;  5B0Z C;  3WA9 B;  1ID3 D;  3W96 B;  3REH B;  1P3O C;  3REK B;  3MGR C;  3REJ C;  1BH9 A;  5B1M D;  2YFW B;  2IO5 B;  3AZL B;  4ZUX C;  4CSR B;  1AOI B;  3B0D C;  4Z2M H;  3W99 C;  5AVB B;  3VH6 T;  2F8N D;  4Z5T C;  4AWL B;  1M1A D;  5B32 A;  1H3O A;  3B0C T;  2BYM B;  1ID3 A;  4EO5 C;  4WU8 C;  4YS3 A;  4R8P B;  3LZ0 D;  4H9N A;  3AZM B;  5CP6 D;  1S32 C;  3B6G B;  1F1E A;  5B1M A;  1KX3 B;  3W98 D;  1HQ3 B;  4H9P A;  4J8W D;  1P3P C;  3AFA C;  1P3I D;  5CPI C;  4H9Q A;  5CPK B;  2F8N A;  1M1A C;  5AVC D;  2HIO C;  5GT3 B;  3X1V C;  3AZK B;  5AV8 D;  4QLC B;  3MGP B;  3KUY B;  3REL B;  3UT9 D;  2CV5 C;  5CP6 C;  3LZ0 A;  3C1B C;  4WU9 B;  1P3G C;  3KWQ C;  3LJA D;  3X1U A;  1M18 C;  4J8W C;  3W98 A;  5B0Z B;  3R45 A;  1P3I A;  1P3B C;  3MGS D;  1BH9 B;  3REJ B;  3WA9 D;  2F8N K;  1BFM A;  4Z66 D;  5AV6 A;  5AVC A;  3MGQ C;  5AV8 A;  4NFT A;  2PYO C;  3NQU B;  4ZUX B;  3UT9 A;  3AZL D;  3AV1 C;  3LEL A;  2ARO D;  2BYK A;  3LJA A;  3W99 B;  1ULY A;  4WV4 B;  4KUD D;  2LY8 A;  1WWI A;  5CHL B;  4Z5T B;  1ID3 B;  5C3I C;  3X1S C;  4EO5 B;  3MGS C;  4WU8 B;  3MGS A;  5GSU C;  3WA9 A;  1S32 B;  3WTP D;  5B40 C;  1B67 A;  4H9S C;  4Z66 A;  3AZJ C;  1P3P B;  3X1T D;  4JJN D;  3AZL A;  3REI C;  4CSR A;  4H9Q B;  5CPI B;  2ARO A;  5AY8 C;  4KUD C;  2F8N B;  5CPJ C;  1M1A B;  2HIO B;  3X1V B;  5CPK D;  2HUE C;  5B31 C;  4J8U D;  3W97 C;  5B2I D;  2CV5 B;  5GT3 D;  5CP6 B;  3C1B B;  3AZK D;  1P3K D;  5E5A C;  2BYM A;  1P3G B;  3WTP A;  3KWQ B;  3KUY D;  3REL D;  4E44 A;  5JRG D;  1M18 B;  3UTB C;  4J8W B;  1P3L C;  3X1T A;  4JJN A;  4KGC C;  5BS7 C;  5B0Z D;  5GT0 C;  2NQB C;  5CPK A;  1P3O D;  1ZLA C;  3MGR D;  3REJ D;  1KU5 A;  5B2I C;  3UT9 B;  4J8U A;  2PYO B;  5B2I A;  5B33 C;  5GT3 A;  3AZK A;  1P3K A;  4CAY A;  4ZUX D;  3KUY A;  3REL A;  3LZ1 C;  5JRG A;  1EQZ D;  3V9R B;  5B32 G;  3W99 D;  5C3I B;  3MGS B;  4Z5T D;  5DNN C;  5B0Z A;  4Z66 B;  5DNM C;  4WU8 D;  4HGA C;  1P3O A;  3MGR A;  3VH5 T;  3REJ A;  3AZJ B;  1S32 D;  5JA4 A;  4XUJ C;  3TU4 D;  2ARO B;  3NQU A;  4ZUX A;  3REI B;  1P3P D;  4LD9 C;  5AY8 B;  3A6N C;  4KUD B;  1EQZ C;  3WAA C;  3AFA D;  1BH8 B;  5CPJ B;  2F8N G;  5CPI D;  3AZE D;  3MVD D;  4G92 C;  3W99 A;  5B24 C;  2HUE B;  4G91 C;  3W97 B;  1F66 D;  4Z5T A;  2HIO D;  3X1V D;  3WTP B;  5F99 C;  3AZI C;  2CV5 D;  4WU8 A;  3C1B D;  5BNX A;  5B2J C;  1P3G D;  1S32 A;  5B0Y C;  3KWQ D;  3WKJ C;  3X1T B;  3C1C C;  4JJN B;  4YM6 D;  3TU4 C;  1M18 D;  1KX4 C;  1P3P A;  3VH6 A;  4KHA B;  3AFA A;  3AZE C;  3MVD C;  5CPI A;  1P3B D;  3MVD A;  1ZLA B;  2NQB B;  1B6W A;  4J8U B;  1F66 C;  5B2I B;  1M1A A;  1F66 A;  1P3K B;  5B33 B;  2HIO A;  3X1V A;  3AZH C;  3MGQ D;  4CAY B;  1TAF A;  2PYO D;  2CV5 A;  5G49 A;  5JRG B;  5CP6 A;  3LZ1 B;  3C1B A;  1P3M C;  1P3G A;  4J8X C;  3KWQ A;  3AV1 D;  4YM6 C;  4YM6 A;  1M18 A;  4NE6 A;  4J8W A;  5DNN B;  3X1S D;  2FJ7 C;  5DNM B;  1P3O B;  1P3B A;  3MGR B;  3AZN C;  5JA4 B;  5GSU D;  5KDM B;  5B40 D;  4XUJ B;  3AN2 C;  3MGQ A;  3AZJ D;  1WWS A;  2PYO A;  3B0D B;  4LD9 B;  3MNN D;  3A6N B;  1EQZ B;  3WAA B;  1KX5 C;  3REI D;  1P34 C;  3AV1 A;  5AY8 D;  5AV5 C;  3V9R A;  5CPJ D;  5F99 B;  3X1S A;  5B31 D;  3UTA C;  3W97 D;  1A7W A;  5BNX B;  4DRB A;  5BNV B;  5GSU A;  5E5A D;  5B2J B;  4WZS B;  5GXQ C;  5B40 A;  4H9S A;  1M19 C;  3C1C B;  4J8V C;  3TU4 B;  3AZJ A;  3UTB D;  1P3L D;  3MNN C;  1KX4 B;  3AFA B;  3AZG C;  5FUG A;  3REI A;  3AZE B;  3MVD B;  5AV9 C;  5AY8 A;  4KUD A;  4KGC D;  1BH8 A;  5CPJ A;  1F66 B;  5GT0 D;  2NQB D;  1ZLA D;  1TAF B;  3AZH B;  1TZY D;  5B31 A;  3W97 A;  5G49 B;  3KXB C;  2NZD C;  5B33 D;  1P3M B;  5E5A A;  4J8X B;  3W96 C;  3NQJ A;  3REH C;  4YM6 B;  3LZ1 D;  3UTB A;  1P3L A;  3O62 C;  2IO5 C;  1AOI C;  1P3B B;  5DNN D;  4KHA A;  5BS7 A;  3AZN B;  1U35 D;  5B1L C;  4KGC A;  5DNM D;  5BT1 C;  5GT0 A;  5AVB C;  2NQB A;  3MGQ B;  1TZY C;  1ZLA A;  4XZQ D;  1TZY A;  4AWL C;  4XUJ D;  5B33 A;  1P3F C;  1KX5 B;  4R8P C;  3AV1 B;  1P34 B;  4LD9 D;  3AZM C;  4H9R A;  3LZ1 A;  3A6N D;  3B6G C;  4X23 C;  1N1J B;  3WAA D;  3AYW D;  1KX3 C;  4NE5 A;  3X1S B;  5B24 D;  1HQ3 C;  3KSY A;  5DNN A;  5GSU B;  1U35 C;  5F99 D;  1U35 A;  5B40 B;  3AV2 C;  3AZI D;  5DNM A;  4XZQ C;  5B2J D;  4J8V B;  5KDM A;  5B0Y D;  3WKJ D;  3AZF C;  3MNN B;  4XUJ A;  1P3A C;  3B6F D;  3C1C D;  4QLC C;  3MGP C;  5FUG B;  3AZG B;  1KX4 D;  4LD9 A;  4WU9 C;  5AV9 B;  3A6N A;  3AYW C;  1EQZ A;  3WAA A;  4UUZ B; 
#chains in the Genus database with same CATH topology
 5B31 B;  5B24 A;  3VH5 W;  3KXB B;  2NZD B;  3VH5 A;  1W2E A;  5E5A B;  3AZH D;  3NQJ B;  5F99 A;  3WTP E;  2Y2O A;  4YS3 D;  3AZI A;  4ZBJ C;  1P3M D;  5BNV A;  5B2J A;  2G5I C;  3UTB B;  4J8X D;  1P3L B;  5B0Y A;  3B6F C;  3WKJ A;  3O62 B;  3B6F A;  3C1C A;  3TU4 A;  3VH6 W;  1KX4 A;  5BO0 B;  4KGC B;  2L5A A;  3B0C W;  5B1L B;  5GT0 B;  3AZE A;  2FJ7 D;  1HTA A;  1TZY B;  3AZN D;  5B32 C;  1ID3 C;  1P3F B;  3AN2 D;  4Z2M G;  3AZH A;  4YS3 C;  4H9R B;  1Q9C A;  1P3M A;  5B1M C;  4X23 B;  4J8X A;  1KX5 D;  2J8P A;  3X1U D;  1P34 D;  2CWE A;  5AV5 D;  1U35 B;  3AV2 B;  2FJ7 A;  3UTA D;  4HGA B;  4XZQ B;  3AZN A;  5GXQ D;  5AV6 D;  3AZF B;  1M19 D;  1P3A B;  3AN2 A;  4J8V D;  3LZ0 C;  4DQY B;  4H9O B;  4NE3 A;  1JFI B;  3AYW B;  3FDD A;  3X1U C;  1KX5 A;  3AZG D;  3LEL D;  1P34 A;  4G92 B;  5AV9 D;  3W98 C;  5B24 B;  1N1J A;  5AV5 A;  5B31 G;  4G91 B;  1P3I C;  2YFV A;  3F6T A;  3AZI B;  3KXB D;  2Y2M A;  3UTA A;  2NZD D;  2ZY2 A;  4ZBJ B;  5AV6 C;  5AVC C;  5B0Y B;  3WKJ B;  3W96 D;  5GXQ A;  3REH D;  3B6F B;  3REK D;  5AV8 C;  1M19 A;  1R4V A;  2Y2I A;  3UT9 C;  4J8V A;  3MNN A;  3O62 D;  3LJA C;  3LEL C;  1AOI D;  3AZG A;  4WNN A;  5AV9 A;  5B1L D;  5B32 B;  2Y2K A;  1H3O B;  4UUZ A;  5BT1 D;  5AVB D;  2Y2P A;  4YS3 B;  4H9N B;  3KXB A;  2NZD A;  3WA9 C;  1P3F D;  2ZY3 A;  4Z66 C;  5B1M B;  3W96 A;  3REK C;  4R8P D;  3REH A;  3REK A;  3AZM D;  3B6G D;  4X23 D;  4H9P B;  3EPH A;  3A1I A;  1KX3 D;  3O62 A;  2YFW A;  3AZL C;  2ARO C;  1AOI A;  2FJ7 B;  1HQ3 D;  5BO0 A;  2RIQ A;  5B1L A;  3AV2 D;  2JSS A;  3AN2 B;  5AVB A;  2JCH A;  3LZ0 B;  3AZF D;  3WTP C;  1P3A D;  1P3F A;  4QLC D;  3MGP D;  3X1U B;  1PZR A;  4R8P A;  3AZM A;  4WU9 D;  5AV5 B;  3B6G A;  3W98 B;  4X23 A;  3B0B A;  4M6B A;  2YFV B;  2RVQ D;  3R45 B;  4JJN C;  3X1T C;  1P3I B;  1KX3 A;  4E45 A;  3UTA B;  1HQ3 A;  2Y2G A;  5GXQ B;  5AVC B;  5AV6 B;  3AV2 A;  5CPK C;  1M19 B;  5AV8 B;  4XZQ A;  4J8U C;  2F8N H;  5GT3 C;  3AZK C;  1P3K C;  3AZF A;  1P3A A;  4DRA A;  3KUY C;  4QLC A;  3REL C;  3LJA B;  2BYK B;  3LEL B;  3MGP A;  4H9O A;  4WNN B;  5JRG C;  4WU9 A;  1JFI A;  3AYW A;  2RVQ C;  4WJ3 C;  5B32 D;  5B0Z C;  3WA9 B;  1ID3 D;  3W96 B;  2G5H C;  3REH B;  1P3O C;  3REK B;  3MGR C;  3REJ C;  1BH9 A;  2Y2L A;  5B1M D;  2Y2N A;  2YFW B;  2IO5 B;  3AZL B;  4ZUX C;  4CSR B;  1AOI B;  3B0D C;  4Z2M H;  3W99 C;  5AVB B;  3VH6 T;  2F8N D;  4Z5T C;  4AWL B;  1M1A D;  5B32 A;  1H3O A;  3B0C T;  2BYM B;  1ID3 A;  4EO5 C;  4WU8 C;  4YS3 A;  4R8P B;  3LZ0 D;  4H9N A;  2F2A C;  3AZM B;  5CP6 D;  1S32 C;  3B6G B;  1F1E A;  3H0R C;  5B1M A;  1KX3 B;  3W98 D;  1HQ3 B;  4H9P A;  4J8W D;  1P3P C;  3AFA C;  1P3I D;  5CPI C;  4H9Q A;  5CPK B;  2F8N A;  1M1A C;  5AVC D;  2HIO C;  5GT3 B;  3X1V C;  3AZK B;  5AV8 D;  4QLC B;  3MGP B;  3KUY B;  3REL B;  3UT9 D;  2CV5 C;  5CP6 C;  3LZ0 A;  3C1B C;  4WU9 B;  1P3G C;  3KWQ C;  3LJA D;  3X1U A;  1M18 C;  4J8W C;  3W98 A;  2ZY5 A;  3H0L C;  5B0Z B;  3R45 A;  1P3I A;  1P3B C;  3MGS D;  1BH9 B;  3REJ B;  3WA9 D;  2F8N K;  1BFM A;  4Z66 D;  5AV6 A;  5AVC A;  1Z2C B;  3MGQ C;  5AV8 A;  4NFT A;  2PYO C;  2Y2Q A;  3NQU B;  4ZUX B;  3UT9 A;  3AZL D;  3AV1 C;  3LEL A;  2ARO D;  2BYK A;  3LJA A;  3W99 B;  1ULY A;  4WV4 B;  4KUD D;  2LY8 A;  1WWI A;  5CHL B;  4Z5T B;  1ID3 B;  1T3U A;  5C3I C;  3X1S C;  4EO5 B;  3MGS C;  4WU8 B;  3MGS A;  5GSU C;  3WA9 A;  1S32 B;  3WTP D;  5B40 C;  1B67 A;  4H9S C;  4Z66 A;  3EPJ A;  3AZJ C;  1P3P B;  3X1T D;  4JJN D;  3AZL A;  3REI C;  4CSR A;  4H9Q B;  5CPI B;  2ARO A;  5AY8 C;  4KUD C;  2F8N B;  5CPJ C;  1M1A B;  3P5J B;  2HIO B;  3X1V B;  5CPK D;  2HUE C;  5B31 C;  4J8U D;  3W97 C;  5B2I D;  2CV5 B;  5GT3 D;  5CP6 B;  3C1B B;  3AZK D;  1P3K D;  2Y2H A;  5E5A C;  2BYM A;  4UPK A;  3WTP A;  1P3G B;  3KWQ B;  3KUY D;  3REL D;  4E44 A;  5JRG D;  1M18 B;  3UTB C;  4J8W B;  1P3L C;  3X1T A;  4JJN A;  4KGC C;  5BS7 C;  5B0Z D;  5GT0 C;  2NQB C;  5CPK A;  1P3O D;  1ZLA C;  3MGR D;  3REJ D;  1KU5 A;  5B2I C;  3UT9 B;  4J8U A;  2PYO B;  5B2I A;  5B33 C;  2ZY4 A;  5GT3 A;  3AZK A;  1P3K A;  4CAY A;  4ZUX D;  3KUY A;  3REL A;  3LZ1 C;  5JRG A;  1EQZ D;  2JE5 A;  3V9R B;  5B32 G;  3W99 D;  5C3I B;  3MGS B;  4Z5T D;  5DNN C;  5B0Z A;  4Z66 B;  5DNM C;  4WU8 D;  4HGA C;  1P3O A;  3MGR A;  3VH5 T;  3REJ A;  3AZJ B;  1S32 D;  5JA4 A;  2BG1 A;  4XUJ C;  3TU4 D;  2ARO B;  3NQU A;  4ZUX A;  3REI B;  1P3P D;  4LD9 C;  5AY8 B;  3A6N C;  4KUD B;  1EQZ C;  3WAA C;  3AFA D;  1BH8 B;  2ZM5 A;  5CPJ B;  2F8N G;  5CPI D;  3AZE D;  3MVD D;  4G92 C;  3W99 A;  5B24 C;  2HUE B;  4G91 C;  3W97 B;  1F66 D;  4Z5T A;  2HIO D;  2XD1 A;  3X1V D;  3WTP B;  5F99 C;  3AZI C;  2CV5 D;  4WU8 A;  3C1B D;  3AL0 C;  5BNX A;  5B2J C;  1P3G D;  1S32 A;  5B0Y C;  3KWQ D;  3WKJ C;  3X1T B;  3C1C C;  4JJN B;  4YM6 D;  3TU4 C;  1M18 D;  1KX4 C;  1P3P A;  3VH6 A;  4KHA B;  3AFA A;  3AZE C;  3MVD C;  5CPI A;  1P3B D;  3MVD A;  1ZLA B;  2NQB B;  3H0M C;  1B6W A;  4J8U B;  3EPL A;  1F66 C;  5B2I B;  1M1A A;  1F66 A;  2UWX A;  5B33 B;  2HIO A;  3X1V A;  1P3K B;  2FFF B;  3A1K A;  3AZH C;  3MGQ D;  4CAY B;  1TAF A;  2PYO D;  2CV5 A;  5G49 A;  5JRG B;  5CP6 A;  3LZ1 B;  3C1B A;  1P3M C;  1P3G A;  4J8X C;  3KWQ A;  3AV1 D;  4YM6 C;  4YM6 A;  1M18 A;  4NE6 A;  4J8W A;  5DNN B;  3X1S D;  2FJ7 C;  5DNM B;  1P3O B;  1P3B A;  3MGR B;  3AZN C;  5JA4 B;  5GSU D;  5KDM B;  5B40 D;  4XUJ B;  2XD5 A;  3AN2 C;  3MGQ A;  3AZJ D;  1WWS A;  2PYO A;  3B0D B;  4LD9 B;  3MNN D;  3A6N B;  1EQZ B;  3WAA B;  1KX5 C;  3REI D;  1P34 C;  3AV1 A;  5AY8 D;  5AV5 C;  3V9R A;  5CPJ D;  5F99 B;  3IP4 C;  3X1S A;  5B31 D;  3UTA C;  3W97 D;  1A7W A;  5BNX B;  4DRB A;  5BNV B;  5GSU A;  5E5A D;  5B2J B;  4WZS B;  3KFU G;  5GXQ C;  5B40 A;  4H9S A;  1M19 C;  3C1C B;  4J8V C;  3TU4 B;  3AZJ A;  3EPK A;  3UTB D;  1P3L D;  3MNN C;  1KX4 B;  3AFA B;  3AZG C;  5FUG A;  3REI A;  3AZE B;  3MVD B;  5AV9 C;  5AY8 A;  4KUD A;  4KGC D;  1BH8 A;  5CPJ A;  1F66 B;  5GT0 D;  2NQB D;  1ZLA D;  1TAF B;  3AZH B;  1TZY D;  5B31 A;  3W97 A;  5G49 B;  3KXB C;  2NZD C;  5B33 D;  1P3M B;  5E5A A;  4J8X B;  3W96 C;  3NQJ A;  3EG5 B;  3REH C;  4YM6 B;  3LZ1 D;  3UTB A;  1P3L A;  2Y2J A;  3O62 C;  2IO5 C;  1AOI C;  1P3B B;  5DNN D;  4KHA A;  5BS7 A;  3AZN B;  1U35 D;  5B1L C;  4KGC A;  5DNM D;  5BT1 C;  5GT0 A;  5AVB C;  2NQB A;  3MGQ B;  1TZY C;  1ZLA A;  4XZQ D;  1TZY A;  4AWL C;  4XUJ D;  5B33 A;  1P3F C;  1KX5 B;  4R8P C;  3AV1 B;  2W8S A;  1P34 B;  4LD9 D;  3AZM C;  4H9R A;  3LZ1 A;  3A6N D;  3B6G C;  4X23 C;  1N1J B;  2VQR A;  3WAA D;  3AYW D;  2DF4 C;  1KX3 C;  4NE5 A;  3X1S B;  5B24 D;  1HQ3 C;  3KSY A;  5DNN A;  5GSU B;  1U35 C;  5F99 D;  1U35 A;  5B40 B;  3AV2 C;  3AZI D;  5DNM A;  4XZQ C;  5B2J D;  4J8V B;  5KDM A;  5B0Y D;  3WKJ D;  3AZF C;  3MNN B;  4XUJ A;  1P3A C;  3B6F D;  2DQN C;  3C1C D;  4QLC C;  3MGP C;  5FUG B;  3AZG B;  1KX4 D;  4LD9 A;  4WU9 C;  5AV9 B;  3A6N A;  3AYW C;  1EQZ A;  3WAA A;  4UUZ B; 
#chains in the Genus database with same CATH homology
 5B31 B;  5B24 A;  3VH5 W;  3KXB B;  2NZD B;  3VH5 A;  1W2E A;  5E5A B;  3AZH D;  3NQJ B;  5F99 A;  3WTP E;  2Y2O A;  4YS3 D;  3AZI A;  4ZBJ C;  1P3M D;  5BNV A;  5B2J A;  2G5I C;  3UTB B;  4J8X D;  1P3L B;  5B0Y A;  3B6F C;  3WKJ A;  3O62 B;  3B6F A;  3C1C A;  3TU4 A;  3VH6 W;  1KX4 A;  5BO0 B;  4KGC B;  2L5A A;  3B0C W;  5B1L B;  5GT0 B;  3AZE A;  2FJ7 D;  1HTA A;  1TZY B;  3AZN D;  5B32 C;  1ID3 C;  1P3F B;  3AN2 D;  4Z2M G;  3AZH A;  4YS3 C;  4H9R B;  1Q9C A;  1P3M A;  5B1M C;  4X23 B;  4J8X A;  1KX5 D;  2J8P A;  3X1U D;  1P34 D;  2CWE A;  5AV5 D;  1U35 B;  3AV2 B;  2FJ7 A;  3UTA D;  4HGA B;  4XZQ B;  3AZN A;  5GXQ D;  5AV6 D;  3AZF B;  1M19 D;  1P3A B;  3AN2 A;  4J8V D;  3LZ0 C;  4DQY B;  4H9O B;  4NE3 A;  1JFI B;  3AYW B;  3FDD A;  3X1U C;  1KX5 A;  3AZG D;  3LEL D;  1P34 A;  4G92 B;  5AV9 D;  3W98 C;  5B24 B;  1N1J A;  5AV5 A;  5B31 G;  4G91 B;  1P3I C;  2YFV A;  3F6T A;  3AZI B;  3KXB D;  2Y2M A;  3UTA A;  2NZD D;  2ZY2 A;  4ZBJ B;  5AV6 C;  5AVC C;  5B0Y B;  3WKJ B;  3W96 D;  5GXQ A;  3REH D;  3B6F B;  3REK D;  5AV8 C;  1M19 A;  1R4V A;  2Y2I A;  3UT9 C;  4J8V A;  3MNN A;  3O62 D;  3LJA C;  3LEL C;  1AOI D;  3AZG A;  4WNN A;  5AV9 A;  5B1L D;  5B32 B;  2Y2K A;  1H3O B;  4UUZ A;  5BT1 D;  5AVB D;  2Y2P A;  4YS3 B;  4H9N B;  3KXB A;  2NZD A;  3WA9 C;  1P3F D;  2ZY3 A;  4Z66 C;  5B1M B;  3W96 A;  3REK C;  4R8P D;  3REH A;  3REK A;  3AZM D;  3B6G D;  4X23 D;  4H9P B;  3EPH A;  3A1I A;  1KX3 D;  3O62 A;  2YFW A;  3AZL C;  2ARO C;  1AOI A;  2FJ7 B;  1HQ3 D;  5BO0 A;  2RIQ A;  5B1L A;  3AV2 D;  2JSS A;  3AN2 B;  5AVB A;  2JCH A;  3LZ0 B;  3AZF D;  3WTP C;  1P3A D;  1P3F A;  4QLC D;  3MGP D;  3X1U B;  1PZR A;  4R8P A;  3AZM A;  4WU9 D;  5AV5 B;  3B6G A;  3W98 B;  4X23 A;  3B0B A;  4M6B A;  2YFV B;  2RVQ D;  3R45 B;  4JJN C;  3X1T C;  1P3I B;  1KX3 A;  4E45 A;  3UTA B;  1HQ3 A;  2Y2G A;  5GXQ B;  5AVC B;  5AV6 B;  3AV2 A;  5CPK C;  1M19 B;  5AV8 B;  4XZQ A;  4J8U C;  2F8N H;  5GT3 C;  3AZK C;  1P3K C;  3AZF A;  1P3A A;  4DRA A;  3KUY C;  4QLC A;  3REL C;  3LJA B;  2BYK B;  3LEL B;  3MGP A;  4H9O A;  4WNN B;  5JRG C;  4WU9 A;  1JFI A;  3AYW A;  2RVQ C;  4WJ3 C;  5B32 D;  5B0Z C;  3WA9 B;  1ID3 D;  3W96 B;  2G5H C;  3REH B;  1P3O C;  3REK B;  3MGR C;  3REJ C;  1BH9 A;  2Y2L A;  5B1M D;  2Y2N A;  2YFW B;  2IO5 B;  3AZL B;  4ZUX C;  4CSR B;  1AOI B;  3B0D C;  4Z2M H;  3W99 C;  5AVB B;  3VH6 T;  2F8N D;  4Z5T C;  4AWL B;  1M1A D;  5B32 A;  1H3O A;  3B0C T;  2BYM B;  1ID3 A;  4EO5 C;  4WU8 C;  4YS3 A;  4R8P B;  3LZ0 D;  4H9N A;  2F2A C;  3AZM B;  5CP6 D;  1S32 C;  3B6G B;  1F1E A;  3H0R C;  5B1M A;  1KX3 B;  3W98 D;  1HQ3 B;  4H9P A;  4J8W D;  1P3P C;  3AFA C;  1P3I D;  5CPI C;  4H9Q A;  5CPK B;  2F8N A;  1M1A C;  5AVC D;  2HIO C;  5GT3 B;  3X1V C;  3AZK B;  5AV8 D;  4QLC B;  3MGP B;  3KUY B;  3REL B;  3UT9 D;  2CV5 C;  5CP6 C;  3LZ0 A;  3C1B C;  4WU9 B;  1P3G C;  3KWQ C;  3LJA D;  3X1U A;  1M18 C;  4J8W C;  3W98 A;  2ZY5 A;  3H0L C;  5B0Z B;  3R45 A;  1P3I A;  1P3B C;  3MGS D;  1BH9 B;  3REJ B;  3WA9 D;  2F8N K;  1BFM A;  4Z66 D;  5AV6 A;  5AVC A;  1Z2C B;  3MGQ C;  5AV8 A;  4NFT A;  2PYO C;  2Y2Q A;  3NQU B;  4ZUX B;  3UT9 A;  3AZL D;  3AV1 C;  3LEL A;  2ARO D;  2BYK A;  3LJA A;  3W99 B;  1ULY A;  4WV4 B;  4KUD D;  2LY8 A;  1WWI A;  5CHL B;  4Z5T B;  1ID3 B;  1T3U A;  5C3I C;  3X1S C;  4EO5 B;  3MGS C;  4WU8 B;  3MGS A;  5GSU C;  3WA9 A;  1S32 B;  3WTP D;  5B40 C;  1B67 A;  4H9S C;  4Z66 A;  3EPJ A;  3AZJ C;  1P3P B;  3X1T D;  4JJN D;  3AZL A;  3REI C;  4CSR A;  4H9Q B;  5CPI B;  2ARO A;  5AY8 C;  4KUD C;  2F8N B;  5CPJ C;  1M1A B;  3P5J B;  2HIO B;  3X1V B;  5CPK D;  2HUE C;  5B31 C;  4J8U D;  3W97 C;  5B2I D;  2CV5 B;  5GT3 D;  5CP6 B;  3C1B B;  3AZK D;  1P3K D;  2Y2H A;  5E5A C;  2BYM A;  4UPK A;  3WTP A;  1P3G B;  3KWQ B;  3KUY D;  3REL D;  4E44 A;  5JRG D;  1M18 B;  3UTB C;  4J8W B;  1P3L C;  3X1T A;  4JJN A;  4KGC C;  5BS7 C;  5B0Z D;  5GT0 C;  2NQB C;  5CPK A;  1P3O D;  1ZLA C;  3MGR D;  3REJ D;  1KU5 A;  5B2I C;  3UT9 B;  4J8U A;  2PYO B;  5B2I A;  5B33 C;  2ZY4 A;  5GT3 A;  3AZK A;  1P3K A;  4CAY A;  4ZUX D;  3KUY A;  3REL A;  3LZ1 C;  5JRG A;  1EQZ D;  2JE5 A;  3V9R B;  5B32 G;  3W99 D;  5C3I B;  3MGS B;  4Z5T D;  5DNN C;  5B0Z A;  4Z66 B;  5DNM C;  4WU8 D;  4HGA C;  1P3O A;  3MGR A;  3VH5 T;  3REJ A;  3AZJ B;  1S32 D;  5JA4 A;  2BG1 A;  4XUJ C;  3TU4 D;  2ARO B;  3NQU A;  4ZUX A;  3REI B;  1P3P D;  4LD9 C;  5AY8 B;  3A6N C;  4KUD B;  1EQZ C;  3WAA C;  3AFA D;  1BH8 B;  2ZM5 A;  5CPJ B;  2F8N G;  5CPI D;  3AZE D;  3MVD D;  4G92 C;  3W99 A;  5B24 C;  2HUE B;  4G91 C;  3W97 B;  1F66 D;  4Z5T A;  2HIO D;  2XD1 A;  3X1V D;  3WTP B;  5F99 C;  3AZI C;  2CV5 D;  4WU8 A;  3C1B D;  3AL0 C;  5BNX A;  5B2J C;  1P3G D;  1S32 A;  5B0Y C;  3KWQ D;  3WKJ C;  3X1T B;  3C1C C;  4JJN B;  4YM6 D;  3TU4 C;  1M18 D;  1KX4 C;  1P3P A;  3VH6 A;  4KHA B;  3AFA A;  3AZE C;  3MVD C;  5CPI A;  1P3B D;  3MVD A;  1ZLA B;  2NQB B;  3H0M C;  1B6W A;  4J8U B;  3EPL A;  1F66 C;  5B2I B;  1M1A A;  1F66 A;  2UWX A;  5B33 B;  2HIO A;  3X1V A;  1P3K B;  2FFF B;  3A1K A;  3AZH C;  3MGQ D;  4CAY B;  1TAF A;  2PYO D;  2CV5 A;  5G49 A;  5JRG B;  5CP6 A;  3LZ1 B;  3C1B A;  1P3M C;  1P3G A;  4J8X C;  3KWQ A;  3AV1 D;  4YM6 C;  4YM6 A;  1M18 A;  4NE6 A;  4J8W A;  5DNN B;  3X1S D;  2FJ7 C;  5DNM B;  1P3O B;  1P3B A;  3MGR B;  3AZN C;  5JA4 B;  5GSU D;  5KDM B;  5B40 D;  4XUJ B;  2XD5 A;  3AN2 C;  3MGQ A;  3AZJ D;  1WWS A;  2PYO A;  3B0D B;  4LD9 B;  3MNN D;  3A6N B;  1EQZ B;  3WAA B;  1KX5 C;  3REI D;  1P34 C;  3AV1 A;  5AY8 D;  5AV5 C;  3V9R A;  5CPJ D;  5F99 B;  3IP4 C;  3X1S A;  5B31 D;  3UTA C;  3W97 D;  1A7W A;  5BNX B;  4DRB A;  5BNV B;  5GSU A;  5E5A D;  5B2J B;  4WZS B;  3KFU G;  5GXQ C;  5B40 A;  4H9S A;  1M19 C;  3C1C B;  4J8V C;  3TU4 B;  3AZJ A;  3EPK A;  3UTB D;  1P3L D;  3MNN C;  1KX4 B;  3AFA B;  3AZG C;  5FUG A;  3REI A;  3AZE B;  3MVD B;  5AV9 C;  5AY8 A;  4KUD A;  4KGC D;  1BH8 A;  5CPJ A;  1F66 B;  5GT0 D;  2NQB D;  1ZLA D;  1TAF B;  3AZH B;  1TZY D;  5B31 A;  3W97 A;  5G49 B;  3KXB C;  2NZD C;  5B33 D;  1P3M B;  5E5A A;  4J8X B;  3W96 C;  3NQJ A;  3EG5 B;  3REH C;  4YM6 B;  3LZ1 D;  3UTB A;  1P3L A;  2Y2J A;  3O62 C;  2IO5 C;  1AOI C;  1P3B B;  5DNN D;  4KHA A;  5BS7 A;  3AZN B;  1U35 D;  5B1L C;  4KGC A;  5DNM D;  5BT1 C;  5GT0 A;  5AVB C;  2NQB A;  3MGQ B;  1TZY C;  1ZLA A;  4XZQ D;  1TZY A;  4AWL C;  4XUJ D;  5B33 A;  1P3F C;  1KX5 B;  4R8P C;  3AV1 B;  2W8S A;  1P34 B;  4LD9 D;  3AZM C;  4H9R A;  3LZ1 A;  3A6N D;  3B6G C;  4X23 C;  1N1J B;  2VQR A;  3WAA D;  3AYW D;  2DF4 C;  1KX3 C;  4NE5 A;  3X1S B;  5B24 D;  1HQ3 C;  3KSY A;  5DNN A;  5GSU B;  1U35 C;  5F99 D;  1U35 A;  5B40 B;  3AV2 C;  3AZI D;  5DNM A;  4XZQ C;  5B2J D;  4J8V B;  5KDM A;  5B0Y D;  3WKJ D;  3AZF C;  3MNN B;  4XUJ A;  1P3A C;  3B6F D;  2DQN C;  3C1C D;  4QLC C;  3MGP C;  5FUG B;  3AZG B;  1KX4 D;  4LD9 A;  4WU9 C;  5AV9 B;  3A6N A;  3AYW C;  1EQZ A;  3WAA A;  4UUZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...