3REKC

2.6 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b) derivatized with oxaliplatin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
103
structure length
103
Chain Sequence
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 31
structure length 103
sequence length 103
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rekC00
1EQZA 1P3OB 1H3OA 3AZMC 5B33B 1EQZC 1KX4D 4J8WD 5B0ZC 4KHAA 3B6FC 5B32C 3C1BC 3RELC 1KU5A 4KGCD 3AV1A 4EO5C 5DNMD 3B0CT 4EO5B 5AV6A 5F99B 1KX4A 1P3IA 1ID3A 3AZGB 3AZGC 5DNNB 5DNMA 3AZHC 5BO0B 1TAFB 3C1CA 4Z66B 3UTBD 3A6NA 3AZHB 3W99C 5B31G 1P3GB 1KX5D 3C1CC 5G49B 3W97B 5B24D 2F8NK 3X1UB 1ZLAB 4WU8B 4H9OA 1KX3B 4E45A 4X23B 3LELC 2BYKA 5AY8B 3VH6A 4J8XA 5B0YC 2NZDD 4J8UD 5CPIC 1U35C 3REJC 5AVCD 1F66D 3WA9A 3B0BA 3WA9C 5F99A 5BNVA 1P3IB 3B0DC 1S32B 3LZ0C 3NQUB 3KUYD 4QLCB 3LJAB 1EQZD 3AZKB 3B6GB 3AZEC 1BH8A 4R8PB 1TAFA 3REHA 4J8WA 1P3MA 3W97A 1P3GA 5CP6D 3KWQB 4WU8C 2HIOB 3W98C 3KWQC 3AV1D 3MGSA 3KUYA 3UTAB 4E44A 1WWIA 3W96D 4H9QB 4LD9D 1N1JB 5AV6D 5CPKB 3REHD 2NQBB 4UUZA 1P3KB 3TU4D 2BYMB 3MGSD 2F8NG 3MNNB 3X1TB 5B40D 3C1CD 3UTBA 4CSRB 5B1LC 2CV5C 1KX5A 3VH6T 3AZMD 1P3PA 3AZKA 5B24A 1P3OD 3B6GA 5AVBC 2PYOB 1BH8B 4R8PA 1U35D 4WNNA 1P3FC 3NQJA 4J8XD 5KDMB 2NZDA 5GXQD 5B40A 5B32G 4KGCB 5DNNA 4J8UA 1AOIB 1P3PD 2RVQC 3WA9D 5B2JC 5F99D 1JFIA 4Z5TB 1U35A 3MGRD 4ZBJC 5CPJB 3AZIA 5GXQA 5GT0C 3VH5W 5B31B 5E5AC 5AY8A 4WU9B 5DNND 3VH5A 1S32C 5CP6C 4CSRA 1P3MD 1M18D 3B6FB 1P3GD 3W97D 5CP6A 3C1BB 3MGRA 5B24B 2AROB 1M1AC 5JRGC 3X1UD 5BS7A 5B2IA 4WU8D 3REIA 5AY8D 3W96A 1M19B 4LD9A 1P34B 1AOIC 1M19C 4J8VC 3W98B 4J8UB 3KXBC 4Z5TC 5B40C 3TU4A 5GSUB 4H9PA 3AFAB 3AZJC 3X1UA 5B2ID 4WU8A 4H9RA 5B1MB 4JJNA 4WU9C 5B1MC 3RELA 3X1VD 1P3OC 4CAYB 3AZMA 3AZKD 1P3OA 3B6GD 1B67A 1HQ3A 4R8PD 5AV5A 5BT1C 3MVDB 4X23C 3LELB 4G92C 5FUGA 4YM6A 5BNVB 3AZFC 2CV5B 3KWQD 4JJND 1P3AB 1ID3B 4KUDC 3KSYA 5F99C 3MNNA 3UTAD 3AN2D 5CPIB 1BFMA 1M19A 3W96B 5B0ZD 4LD9B 4DRAA 1P3IC 3V9RB 5E5AD 5GSUC 4YM6D 5BS7C 4H9NB 3B0CW 3KWQA 4Z66C 3AZID 3MGRC 3AZLB 1P3GC 3W97C 3MNND 3UTAA 3AN2A 3X1TD 3AZLC 3WAAD 1ZLAA 4XZQB 4Z2MH 5AV9C 5B0ZA 1KX3C 1M18A 2YFVA 2FJ7B 5AY8C 5E5AA 5G49A 5B33A 4XUJB 3UT9A 3REID 1U35B 3AZNB 2YFWB 3X1TA 3WTPC 3AYWB 3AV2B 3MGQC 5B32B 5CPIA 1TZYC 1AOID 3WA9B 4NFTA 5B33D 4G91B 2AROA 4J8WB 3KXBB 4R8PC 5GT0D 5GT3B 5B2IC 4NE5A 3RELD 3X1VA 4WZSB 3AZKC 3B6GC 2HIOA 4XZQC 1P3BC 2L5AA 1HQ3D 5DNMB 1M18C 3UTAC 5AV5D 1P3MB 3W99A 1M18B 5AV8B 4Z66A 2FJ7A 3MGPB 1P3LB 1ULYA 1Q9CA 3C1BD 1H3OB 2AROD 3AN2C 5GSUA 3AZGD 5GT0A 4H9SA 2HUEC 3AYWC 3LZ1B 1M19D 5JA4B 1ID3C 3MNNC 3W99D 4Z66D 3C1BA 5GSUD 3WTPA 4YM6C 3AFAD 5GT3C 5B2IB 3WAAA 3REHC 1P3FA 1ZLAD 1P3AA 1KX3D 3B0DB 3X1VB 1A7WA 5B24C 1M1AB 5AV8C 5B1LA 5BO0A 3UT9D 3LELD 3WTPD 3O62B 4H9PB 3AFAA 3AZEB 4JJNC 4KUDD 4Z5TA 1F1EA 4J8VB 4JJNB 1P3AD 5CPID 1AOIA 3LZ1A 4H9SC 4ZBJB 2F8NB 3AZJB 4J8XC 5B1LD 1N1JA 1P3BD 3LELA 5CPKA 1TZYB 4KUDA 2NQBC 5CP6B 2IO5C 4XUJA 5JRGA 2HIOD 3AV1B 4KHAB 3WAAB 5AV5C 4QLCC 4XZQD 4J8WC 3X1SD 2FJ7D 3AZFB 2AROC 1P3BA 5CPKD 3LJAA 4H9NA 3AZGA 1P3KD 1KX4B 4XUJD 2LY8A 1KX4C 3REKB 3R45A 5AV6C 3VH5T 4AWLC 3AFAC 5B33C 5AV8A 1P3FD 5AV9B 1KX3A 3KXBD 3WKJB 3RELB 2CV5A 1KX5C 4H9OB 4CAYA 1ZLAC 5CPJC 5GXQB 1HTAA 3MVDC 1P3PC 1HQ3B 4G92B 1P3PB 3UTBB 5AVBB 3AZHD 5AV8D 1BH9B 2PYOC 3MGPD 1P3LD 4Z5TD 1R4VA 3KXBA 3REKC 4ZUXB 4X23D 3LZ1D 3VH6W 3REKA 5B2JA 4WU9D 2NZDB 5BNXB 3W99B 3W98A 1M1AA 3MGPA 1P3LA 3B6FD 4NE3A 5C3IB 3O62A 5JRGD 4X23A 2HIOC 4XZQA 3X1SC 3WKJA 5B1MA 1P3MC 4WU9A 5CPJA 3X1SA 4QLCD 3AZIC 3LJAD 1EQZB 3W98D 1M1AD 3AZJA 3WAAC 1WWSA 3AV2C 1P3KA 3WTPB 3O62D 4UUZB 4ZUXC 1TZYA 5CHLB 4J8VD 2BYMA 5B1MD 4ZUXA 4G91C 3X1TC 2NZDC 4YS3B 3REIC 4YS3C 1P34A 3AZJD 5AV6B 3W96C 5B1LB 4LD9C 5BT1D 1P3BB 3REHB 2NQBD 5C3IC 3MVDD 2PYOA 1TZYD 3A6NB 4WNNB 2CV5D 3A6NC 4HGAB 3AZLA 4H9RB 3AN2B 3REJD 3MGPC 3C1CB 3MGQD 1P3LC 5CPKC 5B0ZB 3AZHA 3AZFD 2NQBA 5GXQC 2HUEB 2PYOD 3LZ0D 3LZ1C 4DRBA 2RVQD 5B0YB 3REKD 3AZLD 5B2JD 4J8XB 3REJA 3MGQA 3AV2A 3AZFA 5B32A 3B6FA 4Z2MG 1B6WA 5AVBA 3AV1C 3LJAC 3MGRB 1P3FB 3AZEA 5AV9D 3WKJD 5CPJD 3WTPE 3O62C 2JSSA 4QLCA 5GT3A 4NE6A 5B31D 3AYWD 3AV2D 5B32D 3X1UC 3TU4C 5DNMC 5AVBD 2F8NA 1JFIB 4J8VA 3AZNC 4ZUXD 2YFWA 5GT0B 2F8NH 5GT3D 3AYWA 5B0YA 3AZNA 1P34D 5AV5B 3MVDA 1BH9A 2IO5B 1KX5B 5JRGB 1HQ3C 3NQUA 5BNXA 4YS3A 3X1VC 4M6BA 4HGAC 4KGCC 3LZ0A 5AVCB 1F66B 3R45B 5DNNC 5KDMA 1P3ID 1ID3D 2BYKB 1S32D 1P3KC 3KUYB 2CWEA 5JA4A 4YS3D 4WV4B 3UT9C 5E5AB 3WKJC 5FUGB 4YM6B 3UT9B 3AZED 5AV9A 3A6ND 5B31C 1P3AC 3UTBC 4KUDB 3AZIB 4XUJC 5B31A 1S32A 3REJB 3MGQB 2F8ND 3V9RA 5AVCC 1F66C 1P34C 3LZ0B 5AVCA 1F66A 3REIB 3TU4B 5B0YD 3AZND 3MGSB 5B2JB 3KUYC 3NQJB 3MGSC 4J8UC 5B40B 2FJ7C 4KGCA 4H9QA 2YFVB 4AWLB 3X1SB 3AZMB
chains in the Genus database with same CATH superfamily
1EQZA 1P3OB 1H3OA 3F6TA 5B33B 3AZMC 1EQZC 1KX4D 4J8WD 5B0ZC 4KHAA 3B6FC 5B32C 3C1BC 3RELC 1KU5A 4KGCD 3AV1A 2Y2IA 4EO5C 5DNMD 3B0CT 3H0MC 4EO5B 5AV6A 5F99B 1KX4A 1P3IA 1ID3A 3AZGB 3AZGC 5DNNB 5DNMA 2BG1A 3AZHC 5BO0B 1TAFB 3C1CA 4Z66B 3UTBD 2Y2PA 3A6NA 3AZHB 3W99C 5B31G 1P3GB 1KX5D 3C1CC 5G49B 3W97B 5B24D 2Y2OA 2F8NK 3X1UB 1ZLAB 4WU8B 4H9OA 1KX3B 4E45A 4X23B 3LELC 2BYKA 5AY8B 3VH6A 4J8XA 5B0YC 2NZDD 3EPKA 4J8UD 5CPIC 1U35C 3REJC 5AVCD 1F66D 3WA9A 3B0BA 3WA9C 5F99A 5BNVA 1P3IB 3B0DC 1S32B 3LZ0C 3NQUB 3KUYD 4QLCB 3LJAB 1EQZD 3AZKB 3B6GB 3AZEC 1BH8A 4R8PB 1TAFA 3REHA 4J8WA 1P3MA 3W97A 1P3GA 2FFFB 5CP6D 3KWQB 4WJ3C 4WU8C 2HIOB 3W98C 3KWQC 3AV1D 3MGSA 3KUYA 3UTAB 2DF4C 4E44A 1WWIA 3W96D 4H9QB 4LD9D 1N1JB 5AV6D 5CPKB 3REHD 2NQBB 4UUZA 1P3KB 3TU4D 2BYMB 3MGSD 2F8NG 3MNNB 2J8PA 3X1TB 5B40D 3C1CD 3UTBA 4CSRB 5B1LC 2CV5C 1KX5A 3VH6T 3AZMD 1P3PA 3AZKA 5B24A 1P3OD 3B6GA 5AVBC 2PYOB 1BH8B 4R8PA 1U35D 4WNNA 1P3FC 3NQJA 4J8XD 5KDMB 2NZDA 5GXQD 5B40A 5B32G 4KGCB 5DNNA 4J8UA 1AOIB 1P3PD 2RVQC 3WA9D 5B2JC 5F99D 1JFIA 4Z5TB 3EPLA 1U35A 3MGRD 2W8SA 4ZBJC 5CPJB 3AZIA 5GXQA 5GT0C 3VH5W 5B31B 5E5AC 5AY8A 4WU9B 5DNND 3VH5A 3AL0C 2Y2LA 3EPHA 1S32C 5CP6C 4CSRA 1P3MD 1M18D 3B6FB 1P3GD 3W97D 5CP6A 2RIQA 3C1BB 3MGRA 5B24B 2AROB 4UPKA 1M1AC 2G5IC 5JRGC 3X1UD 5BS7A 2VQRA 1T3UA 5B2IA 4WU8D 3REIA 5AY8D 3W96A 1M19B 4LD9A 1P34B 1AOIC 1M19C 2Y2HA 4J8VC 3W98B 4J8UB 3KXBC 4Z5TC 5B40C 3TU4A 5GSUB 4H9PA 3AFAB 3AZJC 1W2EA 3X1UA 5B2ID 4WU8A 4H9RA 5B1MB 4JJNA 4WU9C 5B1MC 3RELA 3X1VD 1P3OC 4CAYB 3AZMA 3AZKD 1P3OA 3B6GD 1B67A 1HQ3A 4R8PD 5AV5A 5BT1C 4X23C 3MVDB 3LELB 4G92C 5FUGA 4YM6A 5BNVB 3AZFC 2CV5B 3KWQD 4JJND 1P3AB 1ID3B 4KUDC 3KSYA 5F99C 3MNNA 3UTAD 3AN2D 5CPIB 1BFMA 1M19A 3W96B 5B0ZD 4LD9B 4DRAA 1P3IC 3V9RB 5E5AD 5GSUC 4YM6D 5BS7C 4H9NB 3B0CW 3KWQA 4Z66C 3AZID 3MGRC 3AZLB 1P3GC 3W97C 3MNND 3UTAA 3AN2A 3X1TD 3AZLC 3WAAD 1ZLAA 4XZQB 4Z2MH 5AV9C 5B0ZA 1KX3C 1M18A 2YFVA 2FJ7B 2XD1A 5AY8C 5G49A 5E5AA 5B33A 4XUJB 3UT9A 3REID 1U35B 3AZNB 2YFWB 3X1TA 3WTPC 3AYWB 3AV2B 3MGQC 5B32B 5CPIA 1TZYC 1AOID 3WA9B 4NFTA 5B33D 4G91B 2AROA 4J8WB 3KXBB 4R8PC 5GT0D 5GT3B 5B2IC 4NE5A 3RELD 3X1VA 4WZSB 3AZKC 3B6GC 2HIOA 4XZQC 1P3BC 2L5AA 1HQ3D 5DNMB 1M18C 3UTAC 5AV5D 1P3MB 3W99A 1M18B 5AV8B 4Z66A 2FJ7A 3MGPB 1P3LB 1ULYA 1Q9CA 3C1BD 1H3OB 2AROD 3AN2C 5GSUA 3AZGD 5GT0A 4H9SA 2HUEC 3AYWC 3LZ1B 1M19D 5JA4B 1ID3C 3MNNC 3W99D 4Z66D 3C1BA 3KFUG 5GSUD 4YM6C 3WTPA 3AFAD 5GT3C 5B2IB 3WAAA 3REHC 1P3FA 1ZLAD 1P3AA 1KX3D 3H0RC 3B0DB 3X1VB 1A7WA 5B24C 1M1AB 2ZY3A 5AV8C 5B1LA 5BO0A 3UT9D 3LELD 3WTPD 3O62B 4H9PB 3AFAA 3AZEB 4JJNC 4KUDD 4Z5TA 1F1EA 4J8VB 4JJNB 1P3AD 5CPID 1AOIA 3LZ1A 4H9SC 4ZBJB 2F8NB 3AZJB 4J8XC 5B1LD 1N1JA 1P3BD 3LELA 5CPKA 2XD5A 1TZYB 4KUDA 2NQBC 5CP6B 2IO5C 4XUJA 5JRGA 2HIOD 3AV1B 4KHAB 3WAAB 5AV5C 4QLCC 4XZQD 4J8WC 3X1SD 2FJ7D 3AZFB 2AROC 1P3BA 5CPKD 3LJAA 4H9NA 3P5JB 3AZGA 1P3KD 1KX4B 4XUJD 2LY8A 1KX4C 3REKB 3R45A 1PZRA 3VH5T 5AV6C 4AWLC 3EG5B 3AFAC 5B33C 2G5HC 5AV8A 1P3FD 2Y2JA 5AV9B 1KX3A 3KXBD 3WKJB 3RELB 2CV5A 1KX5C 4H9OB 4CAYA 1ZLAC 5CPJC 5GXQB 1HTAA 2ZY4A 3MVDC 1P3PC 1HQ3B 4G92B 1P3PB 3UTBB 5AVBB 3AZHD 5AV8D 1BH9B 2PYOC 3MGPD 1P3LD 4Z5TD 1R4VA 3KXBA 3REKC 2ZY2A 4ZUXB 3A1KA 2F2AC 4X23D 3LZ1D 3VH6W 3REKA 2JCHA 5B2JA 4WU9D 2NZDB 5BNXB 3W99B 3W98A 1M1AA 2JE5A 3MGPA 1P3LA 3B6FD 4NE3A 5C3IB 3O62A 5JRGD 4X23A 2HIOC 4XZQA 3X1SC 3WKJA 5B1MA 1P3MC 4WU9A 5CPJA 3X1SA 4QLCD 3AZIC 3LJAD 1EQZB 3W98D 1M1AD 3AZJA 3WAAC 1WWSA 3AV2C 1P3KA 3WTPB 2ZY5A 3O62D 4UUZB 4ZUXC 1TZYA 5CHLB 4J8VD 2BYMA 5B1MD 4ZUXA 2Y2KA 4G91C 3X1TC 2NZDC 4YS3B 3REIC 4YS3C 1P34A 3AZJD 5AV6B 3W96C 5B1LB 4LD9C 5BT1D 1P3BB 3REHB 4DQYB 2NQBD 5C3IC 3MVDD 2PYOA 1TZYD 3A6NB 4WNNB 2CV5D 3A6NC 4HGAB 3AZLA 4H9RB 3AN2B 3REJD 3MGPC 3C1CB 3MGQD 1P3LC 5CPKC 5B0ZB 3AZHA 3AZFD 2NQBA 5GXQC 2HUEB 2PYOD 3LZ0D 3LZ1C 4DRBA 2RVQD 5B0YB 3REKD 3AZLD 5B2JD 4J8XB 3REJA 3MGQA 3AV2A 3AZFA 5B32A 2UWXA 3B6FA 4Z2MG 1B6WA 3A1IA 5AVBA 3AV1C 3LJAC 3MGRB 1P3FB 3AZEA 5AV9D 3WKJD 5CPJD 3WTPE 3O62C 2JSSA 4QLCA 5GT3A 4NE6A 5B31D 3AYWD 3AV2D 5B32D 3X1UC 2Y2QA 3TU4C 5DNMC 5AVBD 2F8NA 1JFIB 2ZM5A 4J8VA 3AZNC 4ZUXD 2YFWA 5GT0B 2F8NH 5GT3D 3AYWA 5B0YA 3AZNA 1P34D 1Z2CB 5AV5B 3MVDA 1BH9A 2IO5B 2Y2MA 1KX5B 5JRGB 1HQ3C 3IP4C 3NQUA 5BNXA 4YS3A 3X1VC 2Y2GA 4M6BA 4HGAC 3EPJA 4KGCC 3LZ0A 5AVCB 1F66B 3R45B 5DNNC 5KDMA 1P3ID 1ID3D 2BYKB 1S32D 1P3KC 3KUYB 2CWEA 5JA4A 4YS3D 4WV4B 3UT9C 5E5AB 3WKJC 5FUGB 4YM6B 3UT9B 3AZED 5AV9A 3A6ND 5B31C 1P3AC 3UTBC 4KUDB 3AZIB 4XUJC 5B31A 1S32A 3H0LC 3FDDA 3REJB 2Y2NA 3MGQB 2F8ND 3V9RA 5AVCC 1F66C 1P34C 3LZ0B 5AVCA 1F66A 3REIB 3TU4B 5B0YD 3AZND 3MGSB 5B2JB 3KUYC 3NQJB 3MGSC 4J8UC 5B40B 2FJ7C 4KGCA 4H9QA 2YFVB 4AWLB 3X1SB 3AZMB 2DQNC
chains in the Genus database with same CATH topology
1EQZA 1P3OB 1H3OA 3F6TA 5B33B 3AZMC 1EQZC 1KX4D 4J8WD 5B0ZC 4KHAA 3B6FC 5B32C 3C1BC 3RELC 1KU5A 4KGCD 3AV1A 2Y2IA 4EO5C 5DNMD 3B0CT 3H0MC 4EO5B 5AV6A 5F99B 1KX4A 1P3IA 1ID3A 3AZGB 3AZGC 5DNNB 5DNMA 2BG1A 3AZHC 5BO0B 1TAFB 3C1CA 4Z66B 3UTBD 2Y2PA 3A6NA 3AZHB 3W99C 5B31G 1P3GB 1KX5D 3C1CC 5G49B 3W97B 5B24D 2Y2OA 2F8NK 3X1UB 1ZLAB 4WU8B 4H9OA 1KX3B 4E45A 4X23B 3LELC 2BYKA 5AY8B 3VH6A 4J8XA 5B0YC 2NZDD 3EPKA 4J8UD 5CPIC 1U35C 3REJC 5AVCD 1F66D 3WA9A 3B0BA 3WA9C 5F99A 5BNVA 1P3IB 3B0DC 1S32B 3LZ0C 3NQUB 3KUYD 4QLCB 3LJAB 1EQZD 3AZKB 3B6GB 3AZEC 1BH8A 4R8PB 1TAFA 3REHA 4J8WA 1P3MA 3W97A 1P3GA 2FFFB 5CP6D 3KWQB 4WJ3C 4WU8C 2HIOB 3W98C 3KWQC 3AV1D 3MGSA 3KUYA 3UTAB 2DF4C 4E44A 1WWIA 3W96D 4H9QB 4LD9D 1N1JB 5AV6D 5CPKB 3REHD 2NQBB 4UUZA 1P3KB 3TU4D 2BYMB 3MGSD 2F8NG 3MNNB 2J8PA 3X1TB 5B40D 3C1CD 3UTBA 4CSRB 5B1LC 2CV5C 1KX5A 3VH6T 3AZMD 1P3PA 3AZKA 5B24A 1P3OD 3B6GA 5AVBC 2PYOB 1BH8B 4R8PA 1U35D 4WNNA 1P3FC 3NQJA 4J8XD 5KDMB 2NZDA 5GXQD 5B40A 5B32G 4KGCB 5DNNA 4J8UA 1AOIB 1P3PD 2RVQC 3WA9D 5B2JC 5F99D 1JFIA 4Z5TB 3EPLA 1U35A 3MGRD 2W8SA 4ZBJC 5CPJB 3AZIA 5GXQA 5GT0C 3VH5W 5B31B 5E5AC 5AY8A 4WU9B 5DNND 3VH5A 3AL0C 2Y2LA 3EPHA 1S32C 5CP6C 4CSRA 1P3MD 1M18D 3B6FB 1P3GD 3W97D 5CP6A 2RIQA 3C1BB 3MGRA 5B24B 2AROB 4UPKA 1M1AC 2G5IC 5JRGC 3X1UD 5BS7A 2VQRA 1T3UA 5B2IA 4WU8D 3REIA 5AY8D 3W96A 1M19B 4LD9A 1P34B 1AOIC 1M19C 2Y2HA 4J8VC 3W98B 4J8UB 3KXBC 4Z5TC 5B40C 3TU4A 5GSUB 4H9PA 3AFAB 3AZJC 1W2EA 3X1UA 5B2ID 4WU8A 4H9RA 5B1MB 4JJNA 4WU9C 5B1MC 3RELA 3X1VD 1P3OC 4CAYB 3AZMA 3AZKD 1P3OA 3B6GD 1B67A 1HQ3A 4R8PD 5AV5A 5BT1C 4X23C 3MVDB 3LELB 4G92C 5FUGA 4YM6A 5BNVB 3AZFC 2CV5B 3KWQD 4JJND 1P3AB 1ID3B 4KUDC 3KSYA 5F99C 3MNNA 3UTAD 3AN2D 5CPIB 1BFMA 1M19A 3W96B 5B0ZD 4LD9B 4DRAA 1P3IC 3V9RB 5E5AD 5GSUC 4YM6D 5BS7C 4H9NB 3B0CW 3KWQA 4Z66C 3AZID 3MGRC 3AZLB 1P3GC 3W97C 3MNND 3UTAA 3AN2A 3X1TD 3AZLC 3WAAD 1ZLAA 4XZQB 4Z2MH 5AV9C 5B0ZA 1KX3C 1M18A 2YFVA 2FJ7B 2XD1A 5AY8C 5G49A 5E5AA 5B33A 4XUJB 3UT9A 3REID 1U35B 3AZNB 2YFWB 3X1TA 3WTPC 3AYWB 3AV2B 3MGQC 5B32B 5CPIA 1TZYC 1AOID 3WA9B 4NFTA 5B33D 4G91B 2AROA 4J8WB 3KXBB 4R8PC 5GT0D 5GT3B 5B2IC 4NE5A 3RELD 3X1VA 4WZSB 3AZKC 3B6GC 2HIOA 4XZQC 1P3BC 2L5AA 1HQ3D 5DNMB 1M18C 3UTAC 5AV5D 1P3MB 3W99A 1M18B 5AV8B 4Z66A 2FJ7A 3MGPB 1P3LB 1ULYA 1Q9CA 3C1BD 1H3OB 2AROD 3AN2C 5GSUA 3AZGD 5GT0A 4H9SA 2HUEC 3AYWC 3LZ1B 1M19D 5JA4B 1ID3C 3MNNC 3W99D 4Z66D 3C1BA 3KFUG 5GSUD 4YM6C 3WTPA 3AFAD 5GT3C 5B2IB 3WAAA 3REHC 1P3FA 1ZLAD 1P3AA 1KX3D 3H0RC 3B0DB 3X1VB 1A7WA 5B24C 1M1AB 2ZY3A 5AV8C 5B1LA 5BO0A 3UT9D 3LELD 3WTPD 3O62B 4H9PB 3AFAA 3AZEB 4JJNC 4KUDD 4Z5TA 1F1EA 4J8VB 4JJNB 1P3AD 5CPID 1AOIA 3LZ1A 4H9SC 4ZBJB 2F8NB 3AZJB 4J8XC 5B1LD 1N1JA 1P3BD 3LELA 5CPKA 2XD5A 1TZYB 4KUDA 2NQBC 5CP6B 2IO5C 4XUJA 5JRGA 2HIOD 3AV1B 4KHAB 3WAAB 5AV5C 4QLCC 4XZQD 4J8WC 3X1SD 2FJ7D 3AZFB 2AROC 1P3BA 5CPKD 3LJAA 4H9NA 3P5JB 3AZGA 1P3KD 1KX4B 4XUJD 2LY8A 1KX4C 3REKB 3R45A 1PZRA 3VH5T 5AV6C 4AWLC 3EG5B 3AFAC 5B33C 2G5HC 5AV8A 1P3FD 2Y2JA 5AV9B 1KX3A 3KXBD 3WKJB 3RELB 2CV5A 1KX5C 4H9OB 4CAYA 1ZLAC 5CPJC 5GXQB 1HTAA 2ZY4A 3MVDC 1P3PC 1HQ3B 4G92B 1P3PB 3UTBB 5AVBB 3AZHD 5AV8D 1BH9B 2PYOC 3MGPD 1P3LD 4Z5TD 1R4VA 3KXBA 3REKC 2ZY2A 4ZUXB 3A1KA 2F2AC 4X23D 3LZ1D 3VH6W 3REKA 2JCHA 5B2JA 4WU9D 2NZDB 5BNXB 3W99B 3W98A 1M1AA 2JE5A 3MGPA 1P3LA 3B6FD 4NE3A 5C3IB 3O62A 5JRGD 4X23A 2HIOC 4XZQA 3X1SC 3WKJA 5B1MA 1P3MC 4WU9A 5CPJA 3X1SA 4QLCD 3AZIC 3LJAD 1EQZB 3W98D 1M1AD 3AZJA 3WAAC 1WWSA 3AV2C 1P3KA 3WTPB 2ZY5A 3O62D 4UUZB 4ZUXC 1TZYA 5CHLB 4J8VD 2BYMA 5B1MD 4ZUXA 2Y2KA 4G91C 3X1TC 2NZDC 4YS3B 3REIC 4YS3C 1P34A 3AZJD 5AV6B 3W96C 5B1LB 4LD9C 5BT1D 1P3BB 3REHB 4DQYB 2NQBD 5C3IC 3MVDD 2PYOA 1TZYD 3A6NB 4WNNB 2CV5D 3A6NC 4HGAB 3AZLA 4H9RB 3AN2B 3REJD 3MGPC 3C1CB 3MGQD 1P3LC 5CPKC 5B0ZB 3AZHA 3AZFD 2NQBA 5GXQC 2HUEB 2PYOD 3LZ0D 3LZ1C 4DRBA 2RVQD 5B0YB 3REKD 3AZLD 5B2JD 4J8XB 3REJA 3MGQA 3AV2A 3AZFA 5B32A 2UWXA 3B6FA 4Z2MG 1B6WA 3A1IA 5AVBA 3AV1C 3LJAC 3MGRB 1P3FB 3AZEA 5AV9D 3WKJD 5CPJD 3WTPE 3O62C 2JSSA 4QLCA 5GT3A 4NE6A 5B31D 3AYWD 3AV2D 5B32D 3X1UC 2Y2QA 3TU4C 5DNMC 5AVBD 2F8NA 1JFIB 2ZM5A 4J8VA 3AZNC 4ZUXD 2YFWA 5GT0B 2F8NH 5GT3D 3AYWA 5B0YA 3AZNA 1P34D 1Z2CB 5AV5B 3MVDA 1BH9A 2IO5B 2Y2MA 1KX5B 5JRGB 1HQ3C 3IP4C 3NQUA 5BNXA 4YS3A 3X1VC 2Y2GA 4M6BA 4HGAC 3EPJA 4KGCC 3LZ0A 5AVCB 1F66B 3R45B 5DNNC 5KDMA 1P3ID 1ID3D 2BYKB 1S32D 1P3KC 3KUYB 2CWEA 5JA4A 4YS3D 4WV4B 3UT9C 5E5AB 3WKJC 5FUGB 4YM6B 3UT9B 3AZED 5AV9A 3A6ND 5B31C 1P3AC 3UTBC 4KUDB 3AZIB 4XUJC 5B31A 1S32A 3H0LC 3FDDA 3REJB 2Y2NA 3MGQB 2F8ND 3V9RA 5AVCC 1F66C 1P34C 3LZ0B 5AVCA 1F66A 3REIB 3TU4B 5B0YD 3AZND 3MGSB 5B2JB 3KUYC 3NQJB 3MGSC 4J8UC 5B40B 2FJ7C 4KGCA 4H9QA 2YFVB 4AWLB 3X1SB 3AZMB 2DQNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQZ A;  1P3O B;  1H3O A;  3AZM C;  5B33 B;  1EQZ C;  1KX4 D;  4J8W D;  5B0Z C;  4KHA A;  3B6F C;  5B32 C;  3C1B C;  3REL C;  1KU5 A;  4KGC D;  3AV1 A;  4EO5 C;  5DNM D;  3B0C T;  4EO5 B;  5AV6 A;  5F99 B;  1KX4 A;  1P3I A;  1ID3 A;  3AZG B;  3AZG C;  5DNN B;  5DNM A;  3AZH C;  5BO0 B;  1TAF B;  3C1C A;  4Z66 B;  3UTB D;  3A6N A;  3AZH B;  3W99 C;  5B31 G;  1P3G B;  1KX5 D;  3C1C C;  5G49 B;  3W97 B;  5B24 D;  2F8N K;  3X1U B;  1ZLA B;  4WU8 B;  4H9O A;  1KX3 B;  4E45 A;  4X23 B;  3LEL C;  2BYK A;  5AY8 B;  3VH6 A;  4J8X A;  5B0Y C;  2NZD D;  4J8U D;  5CPI C;  1U35 C;  3REJ C;  5AVC D;  1F66 D;  3WA9 A;  3B0B A;  3WA9 C;  5F99 A;  5BNV A;  1P3I B;  3B0D C;  1S32 B;  3LZ0 C;  3NQU B;  3KUY D;  4QLC B;  3LJA B;  1EQZ D;  3AZK B;  3B6G B;  3AZE C;  1BH8 A;  4R8P B;  1TAF A;  3REH A;  4J8W A;  1P3M A;  3W97 A;  1P3G A;  5CP6 D;  3KWQ B;  4WU8 C;  2HIO B;  3W98 C;  3KWQ C;  3AV1 D;  3MGS A;  3KUY A;  3UTA B;  4E44 A;  1WWI A;  3W96 D;  4H9Q B;  4LD9 D;  1N1J B;  5AV6 D;  5CPK B;  3REH D;  2NQB B;  4UUZ A;  1P3K B;  3TU4 D;  2BYM B;  3MGS D;  2F8N G;  3MNN B;  3X1T B;  5B40 D;  3C1C D;  3UTB A;  4CSR B;  5B1L C;  2CV5 C;  1KX5 A;  3VH6 T;  3AZM D;  1P3P A;  3AZK A;  5B24 A;  1P3O D;  3B6G A;  5AVB C;  2PYO B;  1BH8 B;  4R8P A;  1U35 D;  4WNN A;  1P3F C;  3NQJ A;  4J8X D;  5KDM B;  2NZD A;  5GXQ D;  5B40 A;  5B32 G;  4KGC B;  5DNN A;  4J8U A;  1AOI B;  1P3P D;  2RVQ C;  3WA9 D;  5B2J C;  5F99 D;  1JFI A;  4Z5T B;  1U35 A;  3MGR D;  4ZBJ C;  5CPJ B;  3AZI A;  5GXQ A;  5GT0 C;  3VH5 W;  5B31 B;  5E5A C;  5AY8 A;  4WU9 B;  5DNN D;  3VH5 A;  1S32 C;  5CP6 C;  4CSR A;  1P3M D;  1M18 D;  3B6F B;  1P3G D;  3W97 D;  5CP6 A;  3C1B B;  3MGR A;  5B24 B;  2ARO B;  1M1A C;  5JRG C;  3X1U D;  5BS7 A;  5B2I A;  4WU8 D;  3REI A;  5AY8 D;  3W96 A;  1M19 B;  4LD9 A;  1P34 B;  1AOI C;  1M19 C;  4J8V C;  3W98 B;  4J8U B;  3KXB C;  4Z5T C;  5B40 C;  3TU4 A;  5GSU B;  4H9P A;  3AFA B;  3AZJ C;  3X1U A;  5B2I D;  4WU8 A;  4H9R A;  5B1M B;  4JJN A;  4WU9 C;  5B1M C;  3REL A;  3X1V D;  1P3O C;  4CAY B;  3AZM A;  3AZK D;  1P3O A;  3B6G D;  1B67 A;  1HQ3 A;  4R8P D;  5AV5 A;  5BT1 C;  3MVD B;  4X23 C;  3LEL B;  4G92 C;  5FUG A;  4YM6 A;  5BNV B;  3AZF C;  2CV5 B;  3KWQ D;  4JJN D;  1P3A B;  1ID3 B;  4KUD C;  3KSY A;  5F99 C;  3MNN A;  3UTA D;  3AN2 D;  5CPI B;  1BFM A;  1M19 A;  3W96 B;  5B0Z D;  4LD9 B;  4DRA A;  1P3I C;  3V9R B;  5E5A D;  5GSU C;  4YM6 D;  5BS7 C;  4H9N B;  3B0C W;  3KWQ A;  4Z66 C;  3AZI D;  3MGR C;  3AZL B;  1P3G C;  3W97 C;  3MNN D;  3UTA A;  3AN2 A;  3X1T D;  3AZL C;  3WAA D;  1ZLA A;  4XZQ B;  4Z2M H;  5AV9 C;  5B0Z A;  1KX3 C;  1M18 A;  2YFV A;  2FJ7 B;  5AY8 C;  5E5A A;  5G49 A;  5B33 A;  4XUJ B;  3UT9 A;  3REI D;  1U35 B;  3AZN B;  2YFW B;  3X1T A;  3WTP C;  3AYW B;  3AV2 B;  3MGQ C;  5B32 B;  5CPI A;  1TZY C;  1AOI D;  3WA9 B;  4NFT A;  5B33 D;  4G91 B;  2ARO A;  4J8W B;  3KXB B;  4R8P C;  5GT0 D;  5GT3 B;  5B2I C;  4NE5 A;  3REL D;  3X1V A;  4WZS B;  3AZK C;  3B6G C;  2HIO A;  4XZQ C;  1P3B C;  2L5A A;  1HQ3 D;  5DNM B;  1M18 C;  3UTA C;  5AV5 D;  1P3M B;  3W99 A;  1M18 B;  5AV8 B;  4Z66 A;  2FJ7 A;  3MGP B;  1P3L B;  1ULY A;  1Q9C A;  3C1B D;  1H3O B;  2ARO D;  3AN2 C;  5GSU A;  3AZG D;  5GT0 A;  4H9S A;  2HUE C;  3AYW C;  3LZ1 B;  1M19 D;  5JA4 B;  1ID3 C;  3MNN C;  3W99 D;  4Z66 D;  3C1B A;  5GSU D;  3WTP A;  4YM6 C;  3AFA D;  5GT3 C;  5B2I B;  3WAA A;  3REH C;  1P3F A;  1ZLA D;  1P3A A;  1KX3 D;  3B0D B;  3X1V B;  1A7W A;  5B24 C;  1M1A B;  5AV8 C;  5B1L A;  5BO0 A;  3UT9 D;  3LEL D;  3WTP D;  3O62 B;  4H9P B;  3AFA A;  3AZE B;  4JJN C;  4KUD D;  4Z5T A;  1F1E A;  4J8V B;  4JJN B;  1P3A D;  5CPI D;  1AOI A;  3LZ1 A;  4H9S C;  4ZBJ B;  2F8N B;  3AZJ B;  4J8X C;  5B1L D;  1N1J A;  1P3B D;  3LEL A;  5CPK A;  1TZY B;  4KUD A;  2NQB C;  5CP6 B;  2IO5 C;  4XUJ A;  5JRG A;  2HIO D;  3AV1 B;  4KHA B;  3WAA B;  5AV5 C;  4QLC C;  4XZQ D;  4J8W C;  3X1S D;  2FJ7 D;  3AZF B;  2ARO C;  1P3B A;  5CPK D;  3LJA A;  4H9N A;  3AZG A;  1P3K D;  1KX4 B;  4XUJ D;  2LY8 A;  1KX4 C;  3REK B;  3R45 A;  5AV6 C;  3VH5 T;  4AWL C;  3AFA C;  5B33 C;  5AV8 A;  1P3F D;  5AV9 B;  1KX3 A;  3KXB D;  3WKJ B;  3REL B;  2CV5 A;  1KX5 C;  4H9O B;  4CAY A;  1ZLA C;  5CPJ C;  5GXQ B;  1HTA A;  3MVD C;  1P3P C;  1HQ3 B;  4G92 B;  1P3P B;  3UTB B;  5AVB B;  3AZH D;  5AV8 D;  1BH9 B;  2PYO C;  3MGP D;  1P3L D;  4Z5T D;  1R4V A;  3KXB A;  3REK C;  4ZUX B;  4X23 D;  3LZ1 D;  3VH6 W;  3REK A;  5B2J A;  4WU9 D;  2NZD B;  5BNX B;  3W99 B;  3W98 A;  1M1A A;  3MGP A;  1P3L A;  3B6F D;  4NE3 A;  5C3I B;  3O62 A;  5JRG D;  4X23 A;  2HIO C;  4XZQ A;  3X1S C;  3WKJ A;  5B1M A;  1P3M C;  4WU9 A;  5CPJ A;  3X1S A;  4QLC D;  3AZI C;  3LJA D;  1EQZ B;  3W98 D;  1M1A D;  3AZJ A;  3WAA C;  1WWS A;  3AV2 C;  1P3K A;  3WTP B;  3O62 D;  4UUZ B;  4ZUX C;  1TZY A;  5CHL B;  4J8V D;  2BYM A;  5B1M D;  4ZUX A;  4G91 C;  3X1T C;  2NZD C;  4YS3 B;  3REI C;  4YS3 C;  1P34 A;  3AZJ D;  5AV6 B;  3W96 C;  5B1L B;  4LD9 C;  5BT1 D;  1P3B B;  3REH B;  2NQB D;  5C3I C;  3MVD D;  2PYO A;  1TZY D;  3A6N B;  4WNN B;  2CV5 D;  3A6N C;  4HGA B;  3AZL A;  4H9R B;  3AN2 B;  3REJ D;  3MGP C;  3C1C B;  3MGQ D;  1P3L C;  5CPK C;  5B0Z B;  3AZH A;  3AZF D;  2NQB A;  5GXQ C;  2HUE B;  2PYO D;  3LZ0 D;  3LZ1 C;  4DRB A;  2RVQ D;  5B0Y B;  3REK D;  3AZL D;  5B2J D;  4J8X B;  3REJ A;  3MGQ A;  3AV2 A;  3AZF A;  5B32 A;  3B6F A;  4Z2M G;  1B6W A;  5AVB A;  3AV1 C;  3LJA C;  3MGR B;  1P3F B;  3AZE A;  5AV9 D;  3WKJ D;  5CPJ D;  3WTP E;  3O62 C;  2JSS A;  4QLC A;  5GT3 A;  4NE6 A;  5B31 D;  3AYW D;  3AV2 D;  5B32 D;  3X1U C;  3TU4 C;  5DNM C;  5AVB D;  2F8N A;  1JFI B;  4J8V A;  3AZN C;  4ZUX D;  2YFW A;  5GT0 B;  2F8N H;  5GT3 D;  3AYW A;  5B0Y A;  3AZN A;  1P34 D;  5AV5 B;  3MVD A;  1BH9 A;  2IO5 B;  1KX5 B;  5JRG B;  1HQ3 C;  3NQU A;  5BNX A;  4YS3 A;  3X1V C;  4M6B A;  4HGA C;  4KGC C;  3LZ0 A;  5AVC B;  1F66 B;  3R45 B;  5DNN C;  5KDM A;  1P3I D;  1ID3 D;  2BYK B;  1S32 D;  1P3K C;  3KUY B;  2CWE A;  5JA4 A;  4YS3 D;  4WV4 B;  3UT9 C;  5E5A B;  3WKJ C;  5FUG B;  4YM6 B;  3UT9 B;  3AZE D;  5AV9 A;  3A6N D;  5B31 C;  1P3A C;  3UTB C;  4KUD B;  3AZI B;  4XUJ C;  5B31 A;  1S32 A;  3REJ B;  3MGQ B;  2F8N D;  3V9R A;  5AVC C;  1F66 C;  1P34 C;  3LZ0 B;  5AVC A;  1F66 A;  3REI B;  3TU4 B;  5B0Y D;  3AZN D;  3MGS B;  5B2J B;  3KUY C;  3NQJ B;  3MGS C;  4J8U C;  5B40 B;  2FJ7 C;  4KGC A;  4H9Q A;  2YFV B;  4AWL B;  3X1S B;  3AZM B; 
#chains in the Genus database with same CATH topology
 1EQZ A;  1P3O B;  1H3O A;  3F6T A;  5B33 B;  3AZM C;  1EQZ C;  1KX4 D;  4J8W D;  5B0Z C;  4KHA A;  3B6F C;  5B32 C;  3C1B C;  3REL C;  1KU5 A;  4KGC D;  3AV1 A;  2Y2I A;  4EO5 C;  5DNM D;  3B0C T;  3H0M C;  4EO5 B;  5AV6 A;  5F99 B;  1KX4 A;  1P3I A;  1ID3 A;  3AZG B;  3AZG C;  5DNN B;  5DNM A;  2BG1 A;  3AZH C;  5BO0 B;  1TAF B;  3C1C A;  4Z66 B;  3UTB D;  2Y2P A;  3A6N A;  3AZH B;  3W99 C;  5B31 G;  1P3G B;  1KX5 D;  3C1C C;  5G49 B;  3W97 B;  5B24 D;  2Y2O A;  2F8N K;  3X1U B;  1ZLA B;  4WU8 B;  4H9O A;  1KX3 B;  4E45 A;  4X23 B;  3LEL C;  2BYK A;  5AY8 B;  3VH6 A;  4J8X A;  5B0Y C;  2NZD D;  3EPK A;  4J8U D;  5CPI C;  1U35 C;  3REJ C;  5AVC D;  1F66 D;  3WA9 A;  3B0B A;  3WA9 C;  5F99 A;  5BNV A;  1P3I B;  3B0D C;  1S32 B;  3LZ0 C;  3NQU B;  3KUY D;  4QLC B;  3LJA B;  1EQZ D;  3AZK B;  3B6G B;  3AZE C;  1BH8 A;  4R8P B;  1TAF A;  3REH A;  4J8W A;  1P3M A;  3W97 A;  1P3G A;  2FFF B;  5CP6 D;  3KWQ B;  4WJ3 C;  4WU8 C;  2HIO B;  3W98 C;  3KWQ C;  3AV1 D;  3MGS A;  3KUY A;  3UTA B;  2DF4 C;  4E44 A;  1WWI A;  3W96 D;  4H9Q B;  4LD9 D;  1N1J B;  5AV6 D;  5CPK B;  3REH D;  2NQB B;  4UUZ A;  1P3K B;  3TU4 D;  2BYM B;  3MGS D;  2F8N G;  3MNN B;  2J8P A;  3X1T B;  5B40 D;  3C1C D;  3UTB A;  4CSR B;  5B1L C;  2CV5 C;  1KX5 A;  3VH6 T;  3AZM D;  1P3P A;  3AZK A;  5B24 A;  1P3O D;  3B6G A;  5AVB C;  2PYO B;  1BH8 B;  4R8P A;  1U35 D;  4WNN A;  1P3F C;  3NQJ A;  4J8X D;  5KDM B;  2NZD A;  5GXQ D;  5B40 A;  5B32 G;  4KGC B;  5DNN A;  4J8U A;  1AOI B;  1P3P D;  2RVQ C;  3WA9 D;  5B2J C;  5F99 D;  1JFI A;  4Z5T B;  3EPL A;  1U35 A;  3MGR D;  2W8S A;  4ZBJ C;  5CPJ B;  3AZI A;  5GXQ A;  5GT0 C;  3VH5 W;  5B31 B;  5E5A C;  5AY8 A;  4WU9 B;  5DNN D;  3VH5 A;  3AL0 C;  2Y2L A;  3EPH A;  1S32 C;  5CP6 C;  4CSR A;  1P3M D;  1M18 D;  3B6F B;  1P3G D;  3W97 D;  5CP6 A;  2RIQ A;  3C1B B;  3MGR A;  5B24 B;  2ARO B;  4UPK A;  1M1A C;  2G5I C;  5JRG C;  3X1U D;  5BS7 A;  2VQR A;  1T3U A;  5B2I A;  4WU8 D;  3REI A;  5AY8 D;  3W96 A;  1M19 B;  4LD9 A;  1P34 B;  1AOI C;  1M19 C;  2Y2H A;  4J8V C;  3W98 B;  4J8U B;  3KXB C;  4Z5T C;  5B40 C;  3TU4 A;  5GSU B;  4H9P A;  3AFA B;  3AZJ C;  1W2E A;  3X1U A;  5B2I D;  4WU8 A;  4H9R A;  5B1M B;  4JJN A;  4WU9 C;  5B1M C;  3REL A;  3X1V D;  1P3O C;  4CAY B;  3AZM A;  3AZK D;  1P3O A;  3B6G D;  1B67 A;  1HQ3 A;  4R8P D;  5AV5 A;  5BT1 C;  4X23 C;  3MVD B;  3LEL B;  4G92 C;  5FUG A;  4YM6 A;  5BNV B;  3AZF C;  2CV5 B;  3KWQ D;  4JJN D;  1P3A B;  1ID3 B;  4KUD C;  3KSY A;  5F99 C;  3MNN A;  3UTA D;  3AN2 D;  5CPI B;  1BFM A;  1M19 A;  3W96 B;  5B0Z D;  4LD9 B;  4DRA A;  1P3I C;  3V9R B;  5E5A D;  5GSU C;  4YM6 D;  5BS7 C;  4H9N B;  3B0C W;  3KWQ A;  4Z66 C;  3AZI D;  3MGR C;  3AZL B;  1P3G C;  3W97 C;  3MNN D;  3UTA A;  3AN2 A;  3X1T D;  3AZL C;  3WAA D;  1ZLA A;  4XZQ B;  4Z2M H;  5AV9 C;  5B0Z A;  1KX3 C;  1M18 A;  2YFV A;  2FJ7 B;  2XD1 A;  5AY8 C;  5G49 A;  5E5A A;  5B33 A;  4XUJ B;  3UT9 A;  3REI D;  1U35 B;  3AZN B;  2YFW B;  3X1T A;  3WTP C;  3AYW B;  3AV2 B;  3MGQ C;  5B32 B;  5CPI A;  1TZY C;  1AOI D;  3WA9 B;  4NFT A;  5B33 D;  4G91 B;  2ARO A;  4J8W B;  3KXB B;  4R8P C;  5GT0 D;  5GT3 B;  5B2I C;  4NE5 A;  3REL D;  3X1V A;  4WZS B;  3AZK C;  3B6G C;  2HIO A;  4XZQ C;  1P3B C;  2L5A A;  1HQ3 D;  5DNM B;  1M18 C;  3UTA C;  5AV5 D;  1P3M B;  3W99 A;  1M18 B;  5AV8 B;  4Z66 A;  2FJ7 A;  3MGP B;  1P3L B;  1ULY A;  1Q9C A;  3C1B D;  1H3O B;  2ARO D;  3AN2 C;  5GSU A;  3AZG D;  5GT0 A;  4H9S A;  2HUE C;  3AYW C;  3LZ1 B;  1M19 D;  5JA4 B;  1ID3 C;  3MNN C;  3W99 D;  4Z66 D;  3C1B A;  3KFU G;  5GSU D;  4YM6 C;  3WTP A;  3AFA D;  5GT3 C;  5B2I B;  3WAA A;  3REH C;  1P3F A;  1ZLA D;  1P3A A;  1KX3 D;  3H0R C;  3B0D B;  3X1V B;  1A7W A;  5B24 C;  1M1A B;  2ZY3 A;  5AV8 C;  5B1L A;  5BO0 A;  3UT9 D;  3LEL D;  3WTP D;  3O62 B;  4H9P B;  3AFA A;  3AZE B;  4JJN C;  4KUD D;  4Z5T A;  1F1E A;  4J8V B;  4JJN B;  1P3A D;  5CPI D;  1AOI A;  3LZ1 A;  4H9S C;  4ZBJ B;  2F8N B;  3AZJ B;  4J8X C;  5B1L D;  1N1J A;  1P3B D;  3LEL A;  5CPK A;  2XD5 A;  1TZY B;  4KUD A;  2NQB C;  5CP6 B;  2IO5 C;  4XUJ A;  5JRG A;  2HIO D;  3AV1 B;  4KHA B;  3WAA B;  5AV5 C;  4QLC C;  4XZQ D;  4J8W C;  3X1S D;  2FJ7 D;  3AZF B;  2ARO C;  1P3B A;  5CPK D;  3LJA A;  4H9N A;  3P5J B;  3AZG A;  1P3K D;  1KX4 B;  4XUJ D;  2LY8 A;  1KX4 C;  3REK B;  3R45 A;  1PZR A;  3VH5 T;  5AV6 C;  4AWL C;  3EG5 B;  3AFA C;  5B33 C;  2G5H C;  5AV8 A;  1P3F D;  2Y2J A;  5AV9 B;  1KX3 A;  3KXB D;  3WKJ B;  3REL B;  2CV5 A;  1KX5 C;  4H9O B;  4CAY A;  1ZLA C;  5CPJ C;  5GXQ B;  1HTA A;  2ZY4 A;  3MVD C;  1P3P C;  1HQ3 B;  4G92 B;  1P3P B;  3UTB B;  5AVB B;  3AZH D;  5AV8 D;  1BH9 B;  2PYO C;  3MGP D;  1P3L D;  4Z5T D;  1R4V A;  3KXB A;  3REK C;  2ZY2 A;  4ZUX B;  3A1K A;  2F2A C;  4X23 D;  3LZ1 D;  3VH6 W;  3REK A;  2JCH A;  5B2J A;  4WU9 D;  2NZD B;  5BNX B;  3W99 B;  3W98 A;  1M1A A;  2JE5 A;  3MGP A;  1P3L A;  3B6F D;  4NE3 A;  5C3I B;  3O62 A;  5JRG D;  4X23 A;  2HIO C;  4XZQ A;  3X1S C;  3WKJ A;  5B1M A;  1P3M C;  4WU9 A;  5CPJ A;  3X1S A;  4QLC D;  3AZI C;  3LJA D;  1EQZ B;  3W98 D;  1M1A D;  3AZJ A;  3WAA C;  1WWS A;  3AV2 C;  1P3K A;  3WTP B;  2ZY5 A;  3O62 D;  4UUZ B;  4ZUX C;  1TZY A;  5CHL B;  4J8V D;  2BYM A;  5B1M D;  4ZUX A;  2Y2K A;  4G91 C;  3X1T C;  2NZD C;  4YS3 B;  3REI C;  4YS3 C;  1P34 A;  3AZJ D;  5AV6 B;  3W96 C;  5B1L B;  4LD9 C;  5BT1 D;  1P3B B;  3REH B;  4DQY B;  2NQB D;  5C3I C;  3MVD D;  2PYO A;  1TZY D;  3A6N B;  4WNN B;  2CV5 D;  3A6N C;  4HGA B;  3AZL A;  4H9R B;  3AN2 B;  3REJ D;  3MGP C;  3C1C B;  3MGQ D;  1P3L C;  5CPK C;  5B0Z B;  3AZH A;  3AZF D;  2NQB A;  5GXQ C;  2HUE B;  2PYO D;  3LZ0 D;  3LZ1 C;  4DRB A;  2RVQ D;  5B0Y B;  3REK D;  3AZL D;  5B2J D;  4J8X B;  3REJ A;  3MGQ A;  3AV2 A;  3AZF A;  5B32 A;  2UWX A;  3B6F A;  4Z2M G;  1B6W A;  3A1I A;  5AVB A;  3AV1 C;  3LJA C;  3MGR B;  1P3F B;  3AZE A;  5AV9 D;  3WKJ D;  5CPJ D;  3WTP E;  3O62 C;  2JSS A;  4QLC A;  5GT3 A;  4NE6 A;  5B31 D;  3AYW D;  3AV2 D;  5B32 D;  3X1U C;  2Y2Q A;  3TU4 C;  5DNM C;  5AVB D;  2F8N A;  1JFI B;  2ZM5 A;  4J8V A;  3AZN C;  4ZUX D;  2YFW A;  5GT0 B;  2F8N H;  5GT3 D;  3AYW A;  5B0Y A;  3AZN A;  1P34 D;  1Z2C B;  5AV5 B;  3MVD A;  1BH9 A;  2IO5 B;  2Y2M A;  1KX5 B;  5JRG B;  1HQ3 C;  3IP4 C;  3NQU A;  5BNX A;  4YS3 A;  3X1V C;  2Y2G A;  4M6B A;  4HGA C;  3EPJ A;  4KGC C;  3LZ0 A;  5AVC B;  1F66 B;  3R45 B;  5DNN C;  5KDM A;  1P3I D;  1ID3 D;  2BYK B;  1S32 D;  1P3K C;  3KUY B;  2CWE A;  5JA4 A;  4YS3 D;  4WV4 B;  3UT9 C;  5E5A B;  3WKJ C;  5FUG B;  4YM6 B;  3UT9 B;  3AZE D;  5AV9 A;  3A6N D;  5B31 C;  1P3A C;  3UTB C;  4KUD B;  3AZI B;  4XUJ C;  5B31 A;  1S32 A;  3H0L C;  3FDD A;  3REJ B;  2Y2N A;  3MGQ B;  2F8N D;  3V9R A;  5AVC C;  1F66 C;  1P34 C;  3LZ0 B;  5AVC A;  1F66 A;  3REI B;  3TU4 B;  5B0Y D;  3AZN D;  3MGS B;  5B2J B;  3KUY C;  3NQJ B;  3MGS C;  4J8U C;  5B40 B;  2FJ7 C;  4KGC A;  4H9Q A;  2YFV B;  4AWL B;  3X1S B;  3AZM B;  2DQN C; 
#chains in the Genus database with same CATH homology
 1EQZ A;  1P3O B;  1H3O A;  3F6T A;  5B33 B;  3AZM C;  1EQZ C;  1KX4 D;  4J8W D;  5B0Z C;  4KHA A;  3B6F C;  5B32 C;  3C1B C;  3REL C;  1KU5 A;  4KGC D;  3AV1 A;  2Y2I A;  4EO5 C;  5DNM D;  3B0C T;  3H0M C;  4EO5 B;  5AV6 A;  5F99 B;  1KX4 A;  1P3I A;  1ID3 A;  3AZG B;  3AZG C;  5DNN B;  5DNM A;  2BG1 A;  3AZH C;  5BO0 B;  1TAF B;  3C1C A;  4Z66 B;  3UTB D;  2Y2P A;  3A6N A;  3AZH B;  3W99 C;  5B31 G;  1P3G B;  1KX5 D;  3C1C C;  5G49 B;  3W97 B;  5B24 D;  2Y2O A;  2F8N K;  3X1U B;  1ZLA B;  4WU8 B;  4H9O A;  1KX3 B;  4E45 A;  4X23 B;  3LEL C;  2BYK A;  5AY8 B;  3VH6 A;  4J8X A;  5B0Y C;  2NZD D;  3EPK A;  4J8U D;  5CPI C;  1U35 C;  3REJ C;  5AVC D;  1F66 D;  3WA9 A;  3B0B A;  3WA9 C;  5F99 A;  5BNV A;  1P3I B;  3B0D C;  1S32 B;  3LZ0 C;  3NQU B;  3KUY D;  4QLC B;  3LJA B;  1EQZ D;  3AZK B;  3B6G B;  3AZE C;  1BH8 A;  4R8P B;  1TAF A;  3REH A;  4J8W A;  1P3M A;  3W97 A;  1P3G A;  2FFF B;  5CP6 D;  3KWQ B;  4WJ3 C;  4WU8 C;  2HIO B;  3W98 C;  3KWQ C;  3AV1 D;  3MGS A;  3KUY A;  3UTA B;  2DF4 C;  4E44 A;  1WWI A;  3W96 D;  4H9Q B;  4LD9 D;  1N1J B;  5AV6 D;  5CPK B;  3REH D;  2NQB B;  4UUZ A;  1P3K B;  3TU4 D;  2BYM B;  3MGS D;  2F8N G;  3MNN B;  2J8P A;  3X1T B;  5B40 D;  3C1C D;  3UTB A;  4CSR B;  5B1L C;  2CV5 C;  1KX5 A;  3VH6 T;  3AZM D;  1P3P A;  3AZK A;  5B24 A;  1P3O D;  3B6G A;  5AVB C;  2PYO B;  1BH8 B;  4R8P A;  1U35 D;  4WNN A;  1P3F C;  3NQJ A;  4J8X D;  5KDM B;  2NZD A;  5GXQ D;  5B40 A;  5B32 G;  4KGC B;  5DNN A;  4J8U A;  1AOI B;  1P3P D;  2RVQ C;  3WA9 D;  5B2J C;  5F99 D;  1JFI A;  4Z5T B;  3EPL A;  1U35 A;  3MGR D;  2W8S A;  4ZBJ C;  5CPJ B;  3AZI A;  5GXQ A;  5GT0 C;  3VH5 W;  5B31 B;  5E5A C;  5AY8 A;  4WU9 B;  5DNN D;  3VH5 A;  3AL0 C;  2Y2L A;  3EPH A;  1S32 C;  5CP6 C;  4CSR A;  1P3M D;  1M18 D;  3B6F B;  1P3G D;  3W97 D;  5CP6 A;  2RIQ A;  3C1B B;  3MGR A;  5B24 B;  2ARO B;  4UPK A;  1M1A C;  2G5I C;  5JRG C;  3X1U D;  5BS7 A;  2VQR A;  1T3U A;  5B2I A;  4WU8 D;  3REI A;  5AY8 D;  3W96 A;  1M19 B;  4LD9 A;  1P34 B;  1AOI C;  1M19 C;  2Y2H A;  4J8V C;  3W98 B;  4J8U B;  3KXB C;  4Z5T C;  5B40 C;  3TU4 A;  5GSU B;  4H9P A;  3AFA B;  3AZJ C;  1W2E A;  3X1U A;  5B2I D;  4WU8 A;  4H9R A;  5B1M B;  4JJN A;  4WU9 C;  5B1M C;  3REL A;  3X1V D;  1P3O C;  4CAY B;  3AZM A;  3AZK D;  1P3O A;  3B6G D;  1B67 A;  1HQ3 A;  4R8P D;  5AV5 A;  5BT1 C;  4X23 C;  3MVD B;  3LEL B;  4G92 C;  5FUG A;  4YM6 A;  5BNV B;  3AZF C;  2CV5 B;  3KWQ D;  4JJN D;  1P3A B;  1ID3 B;  4KUD C;  3KSY A;  5F99 C;  3MNN A;  3UTA D;  3AN2 D;  5CPI B;  1BFM A;  1M19 A;  3W96 B;  5B0Z D;  4LD9 B;  4DRA A;  1P3I C;  3V9R B;  5E5A D;  5GSU C;  4YM6 D;  5BS7 C;  4H9N B;  3B0C W;  3KWQ A;  4Z66 C;  3AZI D;  3MGR C;  3AZL B;  1P3G C;  3W97 C;  3MNN D;  3UTA A;  3AN2 A;  3X1T D;  3AZL C;  3WAA D;  1ZLA A;  4XZQ B;  4Z2M H;  5AV9 C;  5B0Z A;  1KX3 C;  1M18 A;  2YFV A;  2FJ7 B;  2XD1 A;  5AY8 C;  5G49 A;  5E5A A;  5B33 A;  4XUJ B;  3UT9 A;  3REI D;  1U35 B;  3AZN B;  2YFW B;  3X1T A;  3WTP C;  3AYW B;  3AV2 B;  3MGQ C;  5B32 B;  5CPI A;  1TZY C;  1AOI D;  3WA9 B;  4NFT A;  5B33 D;  4G91 B;  2ARO A;  4J8W B;  3KXB B;  4R8P C;  5GT0 D;  5GT3 B;  5B2I C;  4NE5 A;  3REL D;  3X1V A;  4WZS B;  3AZK C;  3B6G C;  2HIO A;  4XZQ C;  1P3B C;  2L5A A;  1HQ3 D;  5DNM B;  1M18 C;  3UTA C;  5AV5 D;  1P3M B;  3W99 A;  1M18 B;  5AV8 B;  4Z66 A;  2FJ7 A;  3MGP B;  1P3L B;  1ULY A;  1Q9C A;  3C1B D;  1H3O B;  2ARO D;  3AN2 C;  5GSU A;  3AZG D;  5GT0 A;  4H9S A;  2HUE C;  3AYW C;  3LZ1 B;  1M19 D;  5JA4 B;  1ID3 C;  3MNN C;  3W99 D;  4Z66 D;  3C1B A;  3KFU G;  5GSU D;  4YM6 C;  3WTP A;  3AFA D;  5GT3 C;  5B2I B;  3WAA A;  3REH C;  1P3F A;  1ZLA D;  1P3A A;  1KX3 D;  3H0R C;  3B0D B;  3X1V B;  1A7W A;  5B24 C;  1M1A B;  2ZY3 A;  5AV8 C;  5B1L A;  5BO0 A;  3UT9 D;  3LEL D;  3WTP D;  3O62 B;  4H9P B;  3AFA A;  3AZE B;  4JJN C;  4KUD D;  4Z5T A;  1F1E A;  4J8V B;  4JJN B;  1P3A D;  5CPI D;  1AOI A;  3LZ1 A;  4H9S C;  4ZBJ B;  2F8N B;  3AZJ B;  4J8X C;  5B1L D;  1N1J A;  1P3B D;  3LEL A;  5CPK A;  2XD5 A;  1TZY B;  4KUD A;  2NQB C;  5CP6 B;  2IO5 C;  4XUJ A;  5JRG A;  2HIO D;  3AV1 B;  4KHA B;  3WAA B;  5AV5 C;  4QLC C;  4XZQ D;  4J8W C;  3X1S D;  2FJ7 D;  3AZF B;  2ARO C;  1P3B A;  5CPK D;  3LJA A;  4H9N A;  3P5J B;  3AZG A;  1P3K D;  1KX4 B;  4XUJ D;  2LY8 A;  1KX4 C;  3REK B;  3R45 A;  1PZR A;  3VH5 T;  5AV6 C;  4AWL C;  3EG5 B;  3AFA C;  5B33 C;  2G5H C;  5AV8 A;  1P3F D;  2Y2J A;  5AV9 B;  1KX3 A;  3KXB D;  3WKJ B;  3REL B;  2CV5 A;  1KX5 C;  4H9O B;  4CAY A;  1ZLA C;  5CPJ C;  5GXQ B;  1HTA A;  2ZY4 A;  3MVD C;  1P3P C;  1HQ3 B;  4G92 B;  1P3P B;  3UTB B;  5AVB B;  3AZH D;  5AV8 D;  1BH9 B;  2PYO C;  3MGP D;  1P3L D;  4Z5T D;  1R4V A;  3KXB A;  3REK C;  2ZY2 A;  4ZUX B;  3A1K A;  2F2A C;  4X23 D;  3LZ1 D;  3VH6 W;  3REK A;  2JCH A;  5B2J A;  4WU9 D;  2NZD B;  5BNX B;  3W99 B;  3W98 A;  1M1A A;  2JE5 A;  3MGP A;  1P3L A;  3B6F D;  4NE3 A;  5C3I B;  3O62 A;  5JRG D;  4X23 A;  2HIO C;  4XZQ A;  3X1S C;  3WKJ A;  5B1M A;  1P3M C;  4WU9 A;  5CPJ A;  3X1S A;  4QLC D;  3AZI C;  3LJA D;  1EQZ B;  3W98 D;  1M1A D;  3AZJ A;  3WAA C;  1WWS A;  3AV2 C;  1P3K A;  3WTP B;  2ZY5 A;  3O62 D;  4UUZ B;  4ZUX C;  1TZY A;  5CHL B;  4J8V D;  2BYM A;  5B1M D;  4ZUX A;  2Y2K A;  4G91 C;  3X1T C;  2NZD C;  4YS3 B;  3REI C;  4YS3 C;  1P34 A;  3AZJ D;  5AV6 B;  3W96 C;  5B1L B;  4LD9 C;  5BT1 D;  1P3B B;  3REH B;  4DQY B;  2NQB D;  5C3I C;  3MVD D;  2PYO A;  1TZY D;  3A6N B;  4WNN B;  2CV5 D;  3A6N C;  4HGA B;  3AZL A;  4H9R B;  3AN2 B;  3REJ D;  3MGP C;  3C1C B;  3MGQ D;  1P3L C;  5CPK C;  5B0Z B;  3AZH A;  3AZF D;  2NQB A;  5GXQ C;  2HUE B;  2PYO D;  3LZ0 D;  3LZ1 C;  4DRB A;  2RVQ D;  5B0Y B;  3REK D;  3AZL D;  5B2J D;  4J8X B;  3REJ A;  3MGQ A;  3AV2 A;  3AZF A;  5B32 A;  2UWX A;  3B6F A;  4Z2M G;  1B6W A;  3A1I A;  5AVB A;  3AV1 C;  3LJA C;  3MGR B;  1P3F B;  3AZE A;  5AV9 D;  3WKJ D;  5CPJ D;  3WTP E;  3O62 C;  2JSS A;  4QLC A;  5GT3 A;  4NE6 A;  5B31 D;  3AYW D;  3AV2 D;  5B32 D;  3X1U C;  2Y2Q A;  3TU4 C;  5DNM C;  5AVB D;  2F8N A;  1JFI B;  2ZM5 A;  4J8V A;  3AZN C;  4ZUX D;  2YFW A;  5GT0 B;  2F8N H;  5GT3 D;  3AYW A;  5B0Y A;  3AZN A;  1P34 D;  1Z2C B;  5AV5 B;  3MVD A;  1BH9 A;  2IO5 B;  2Y2M A;  1KX5 B;  5JRG B;  1HQ3 C;  3IP4 C;  3NQU A;  5BNX A;  4YS3 A;  3X1V C;  2Y2G A;  4M6B A;  4HGA C;  3EPJ A;  4KGC C;  3LZ0 A;  5AVC B;  1F66 B;  3R45 B;  5DNN C;  5KDM A;  1P3I D;  1ID3 D;  2BYK B;  1S32 D;  1P3K C;  3KUY B;  2CWE A;  5JA4 A;  4YS3 D;  4WV4 B;  3UT9 C;  5E5A B;  3WKJ C;  5FUG B;  4YM6 B;  3UT9 B;  3AZE D;  5AV9 A;  3A6N D;  5B31 C;  1P3A C;  3UTB C;  4KUD B;  3AZI B;  4XUJ C;  5B31 A;  1S32 A;  3H0L C;  3FDD A;  3REJ B;  2Y2N A;  3MGQ B;  2F8N D;  3V9R A;  5AVC C;  1F66 C;  1P34 C;  3LZ0 B;  5AVC A;  1F66 A;  3REI B;  3TU4 B;  5B0Y D;  3AZN D;  3MGS B;  5B2J B;  3KUY C;  3NQJ B;  3MGS C;  4J8U C;  5B40 B;  2FJ7 C;  4KGC A;  4H9Q A;  2YFV B;  4AWL B;  3X1S B;  3AZM B;  2DQN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...