3REKC

2.6 angstrom crystal structure of the nucleosome core particle assembled with a 146 bp alpha-satellite dna (ncp146b) derivatized with oxaliplatin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
103
structure length
103
Chain Sequence
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
pubmed doi rcsb
source organism Xenopus laevis
total genus 31
structure length 103
sequence length 103
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3rekC00
2NQBC 4Z5TD 5AVCC 4WNNB 4EO5C 4EO5B 5AV6B 5AV6C 3A6NB 4J8XD 1S32D 3B6GD 5B32D 4NE6A 3X1SC 3X1SB 3KXBC 3WA9C 3WA9B 1P3FB 3LZ0D 4R8PC 1P34B 4R8PB 5E5AA 2RVQD 1EQZC 5GSUD 1HQ3D 4Z5TC 4Z5TB 1B67A 1H3OA 2HUEB 3MGQA 4J8XB 1S32C 1S32B 5B0YD 1AOIA 5KDMA 1F66D 3B6GB 3X1TA 5CPKC 5CPKB 4H9PA 5B32B 4H9NA 5B24A 1M18D 2PYOA 4Z2MH 3LZ0C 3LZ0B 2RVQC 4YS3A 1BH8A 3REHC 4LD9A 1F1EA 4WU9A 2HIOA 1HQ3C 5GSUB 1HQ3B 3W98D 5B31G 4XZQC 3X1UC 5B0YC 1M19C 5B0YB 1F66B 2CWEA 3X1VD 1M18C 1M18B 3KWQA 3AZKD 1TAFB 5B33D 4WU8A 3AN2A 2NQBA 3W98C 3W98B 5AVCA 3LJAA 1P3IC 5CP6A 3X1VC 3NQUB 3REKC 3X1VB 3AZJA 2F8NG 3X1SA 1WWSA 3KXBA 5E5AD 3KSYA 1B6WA 3B0CW 1TZYC 5FUGB 1EQZA 2F8NK 1P3OD 4NE5A 3UTBA 3MGQD 1AOID 3X1TD 1P3GC 5CPKA 3R45A 5B24D 2PYOD 5DNNA 1A7WA 5E5AC 5E5AB 4YS3D 5GT3C 4LD9D 4WU9D 2HIOD 3VH6T 4E45A 1P3LA 3REHA 4WV4B 5B31A 1H3OB 3MGQC 3MGQB 5B1LC 1AOIB 5KDMB 4KUDA 3X1TC 1HTAA 3X1TB 3X1UA 4XZQA 3AZMA 1M19A 4H9PB 4H9NB 5B24C 5B24B 3O62A 3C1BA 3KWQD 5BNXA 3W99A 3C1CA 4YS3C 4YS3B 1BH8B 4LD9C 4LD9B 4CSRB 4E44A 2HIOC 4WU8D 2HIOB 4WU9B 4WU9C 2NQBD 5AVCD 4H9OA 4ZBJC 5AV6D 4ZBJB 3AZFC 3LJAD 4QLCA 5CP6D 1P3IA 2F8NA 5AY8A 3AZJD 2F8NH 3X1SD 3KXBD 3REKA 3AFAA 3KWQC 4J8WC 3KWQB 4J8WB 4CAYA 1EQZD 1TZYA 4WU8C 4WU8B 3UTBD 3B0BA 5BS7A 3AN2C 3AN2B 2NQBB 5AVCB 3AV1C 3VH5W 3LJAC 3LJAB 5CP6C 5CP6B 5CPKD 3UTAA 3AZIA 3AZJC 3AZJB 1P3GA 5DNND 3KXBB 5B0ZA 1P3LD 2FJ7C 5GT3A 3REHD 1EQZB 5CPJA 5B31D 3UTBC 3UTBB 4KUDD 3X1UD 4XZQD 3AZMD 1M19D 5B1LA 3R45B 3O62D 3C1BD 3RELA 4KGCA 4J8UA 4YM6A 5DNNC 3W99D 5DNNB 3C1CD 5JRGA 1P3LC 2AROC 3MGSC 1P3LB 1P3KA 4AWLC 4H9RA 4AWLB 4CSRA 1ULYA 3REHB 5B31C 1M1AA 5B31B 1P3AA 5B1MC 4KUDC 4QLCD 4KUDB 3AZFA 3AZMC 5B2JA 3X1UB 4XZQB 3AZMB 1P3ID 1M19B 3VH6A 5AY8D 2F8ND 4NE3A 3REKD 3O62C 3AFAD 3O62B 3C1BB 3C1BC 5BNXB 3W99C 3C1CC 3W99B 3C1CB 4J8WA 3AV2C 2CV5C 1TZYD 3B6FC 4H9OB 4QLCC 4QLCB 3AV1A 3UTAD 1P3IB 2F8NB 3AZID 5AY8C 5AY8B 1P3GD 1WWIA 3REKB 3AFAC 3AFAB 5B0ZD 3MNNA 3MGRC 2JSSA 4CAYB 5GT3D 5CPJD 1TZYB 2BYKA 2FJ7A 4WZSB 5BS7C 1BH9A 2YFWA 1ID3C 5G49A 5B1LD 3UTAC 3UTAB 3AZIC 3RELD 3AZIB 5JA4A 4KGCD 4J8UD 1P3GB 4YM6D 5JRGD 5AVBC 5GT0A 3W96C 5B0ZC 5B0ZB 5GT3B 1M1AD 5CPJC 5CPJB 2AROA 3MGSA 4H9QA 3LZ1A 3AZFD 1BFMA 5DNMA 5B2JD 5B40C 5B1MA 5B1LB 4UUZA 3RELC 3RELB 4M6BA 4KGCC 4J8UC 3MGPA 4J8UB 4KGCB 4YM6C 3WTPE 4YM6B 3AZHA 5JRGC 4J8WD 5JRGB 3WKJA 3AV2A 1P3KC 2CV5A 1P3KB 1M1AB 4H9RB 1M1AC 1P3AC 1P3AB 3AZNA 3REIA 3AN2D 3AV1D 3B6FA 3AZFB 5B2JC 5B2JB 3AZGC 1R4VA 4Z66A 3LELA 3KUYA 5GXQA 3UT9A 3MGRA 2FJ7D 4XUJA 4X23C 1KX3C 3B0CT 4X23B 2NZDA 3AV1B 5F99C 1ID3A 3AZEA 1ZLAC 3WTPA 5AV8C 1P3PC 4H9SC 5GT0D 3MNNC 3MNNB 3WAAC 5AVBA 3W96A 1KX5C 2BYMA 1KX4C 2AROD 5AV9A 2BYKB 4ZUXA 3LZ1D 3MGSD 2FJ7B 1BH9B 3AZKA 5DNMD 2YFWB 5BNVA 5G49B 4G91C 5B1MD 4G91B 3TU4C 5C3IC 1JFIA 5C3IB 5B40A 3A6NC 1P3MA 5JA4B 3MGPD 4DRAA 3AZHD 5GT0C 4KHAB 5GT0B 3WKJD 1Q9CA 3AV2D 2CV5D 1P3FC 1P3BA 5BO0A 2AROB 3MGSB 3LZ1C 4H9QB 3LZ1B 3AZND 3REID 1P34C 3B6FD 5DNMC 5DNMB 5CHLB 4JJNA 5B1MB 4Z66D 5B2IA 1P3OA 2HUEC 4UUZB 3MVDA 4J8XC 3LELD 3MGPC 3KUYD 3MGPB 3AZGA 5GXQD 3UT9D 3AZHC 3B6GC 3AZHB 3MGRD 5B32C 4HGAC 4HGAB 3WKJC 3WKJB 3AV2B 4XUJD 2CV5B 1U35A 5B32G 3VH6W 3AZNC 3AZNB 3REIC 3REIB 4X23A 1KX3A 2NZDD 3REJA 3B6FB 1ID3D 5GSUC 3AZED 3WTPD 2LY8A 3V9RA 4Z66B 5F99A 4Z66C 3AZLA 3VH5T 1ZLAA 3LELC 3KUYC 3LELB 3KUYB 5GXQC 5GXQB 3UT9C 5AV8A 3UT9B 1F66C 1P3PA 4H9SA 5AVBD 3W96D 3MGRB 3W97A 3WAAA 4XUJC 5AV9D 4XUJB 4ZUXD 3NQJA 1KX5A 1KX4A 1KU5A 3B0DC 3B0DB 2NZDC 2NZDB 2YFVB 5AV5A 3AYWA 5B40D 5CPIA 1ID3B 4J8VA 3AZEC 3TU4A 3AZEB 1P3MD 3WTPC 3WTPB 4WNNA 3A6NA 5AV6A 2L5AA 4NFTA 1N1JB 4KHAA 5AVBB 3W96B 2BYMB 1P3BD 5AV9C 3WA9A 4ZUXC 5AV9B 4ZUXB 1P3KD 1P3FA 3AZKC 3AZKB 1P3AD 5BT1D 1P34A 4R8PA 5BNVB 4JJND 5B33C 5B33B 1JFIB 5B40B 5B2ID 3AZGD 3MVDD 1P3MC 1P3MB 2IO5C 2IO5B 4Z5TA 4J8XA 1S32A 3B6GA 5CPIB 5B32A 1U35D 1P3BC 1P3BB 5BO0B 4DRBA 4X23D 3LZ0A 1KX3D 3REJD 5BT1C 4JJNC 4JJNB 3AZLD 5F99D 5B2IC 5B2IB 1P3OC 1P3OB 5GSUA 1HQ3A 3MVDB 3MVDC 3AZGB 1ZLAD 1AOIC 5AV8D 1P3PD 5B0YA 3MNND 1F66A 3W97D 3WAAD 2PYOC 1KX5D 1KX4D 1U35C 2PYOB 1U35B 1M18A 4Z2MG 1KX3B 3REJC 5AV5D 4G92C 3REJB 4G92B 3AYWD 1TAFA 5CPID 4J8VD 3TU4D 2YFVA 3V9RB 3AZLC 3AZLB 5F99B 3A6ND 1ZLAB 3W98A 5AV8B 1P3PB 3W97C 1N1JA 3W97B 3WAAB 3NQUA 3X1VA 3WA9D 3VH5A 3NQJB 1P3FD 1KX4B 1KX5B 1P34D 4R8PD 5AV5C 5AV5B 3AYWC 5CPIC 5FUGA 4J8VC 3AYWB 4J8VB 5B33A 3TU4B
chains in the Genus database with same CATH superfamily
3H0RC 2NQBC 4Z5TD 5AVCC 4WNNB 4EO5C 4EO5B 5AV6B 5AV6C 2ZY5A 3A6NB 4J8XD 1S32D 3B6GD 5B32D 4NE6A 3X1SC 3X1SB 3KXBC 3WA9C 3WA9B 1P3FB 3LZ0D 4R8PC 1P34B 4R8PB 5E5AA 2RVQD 1EQZC 3F6TA 5GSUD 1HQ3D 4Z5TC 4Z5TB 1B67A 1H3OA 2HUEB 3MGQA 4J8XB 1S32C 1S32B 5B0YD 1AOIA 5KDMA 1F66D 3B6GB 3X1TA 5CPKC 5CPKB 4H9PA 5B32B 4H9NA 5B24A 1M18D 2PYOA 4Z2MH 3LZ0C 3LZ0B 2RVQC 4YS3A 1BH8A 3REHC 4LD9A 1F1EA 4WU9A 2HIOA 1HQ3C 5GSUB 1HQ3B 3W98D 5B31G 4XZQC 3X1UC 5B0YC 1M19C 5B0YB 1F66B 2CWEA 2UWXA 3X1VD 1M18C 1M18B 3KWQA 3AZKD 1TAFB 5B33D 4WU8A 3AN2A 2NQBA 3W98C 3W98B 5AVCA 3LJAA 1P3IC 5CP6A 3X1VC 3NQUB 3REKC 3X1VB 3AZJA 2F8NG 3X1SA 1WWSA 3KXBA 5E5AD 3KSYA 1B6WA 3B0CW 1TZYC 5FUGB 1EQZA 2F8NK 1P3OD 4NE5A 3UTBA 3MGQD 1AOID 3X1TD 3EPKA 2Y2HA 1P3GC 5CPKA 3R45A 5B24D 2PYOD 3KFUG 5DNNA 1A7WA 5E5AC 5E5AB 4YS3D 5GT3C 4LD9D 4WU9D 2HIOD 3VH6T 4E45A 1P3LA 3REHA 4WV4B 2ZY2A 5B31A 1H3OB 3MGQC 3MGQB 5B1LC 1AOIB 5KDMB 4KUDA 3X1TC 1HTAA 3X1TB 3X1UA 4UPKA 4XZQA 3AZMA 1M19A 4H9PB 4H9NB 5B24C 5B24B 3O62A 3C1BA 3KWQD 5BNXA 3W99A 3C1CA 2ZY4A 4YS3C 4YS3B 1BH8B 4LD9C 4LD9B 4CSRB 4E44A 2HIOC 4WU8D 2HIOB 4WU9B 4WU9C 2NQBD 5AVCD 4H9OA 4ZBJC 5AV6D 4ZBJB 3AZFC 3LJAD 4QLCA 5CP6D 1P3IA 2F8NA 5AY8A 3AZJD 2F8NH 3X1SD 3KXBD 3REKA 3AFAA 3KWQC 4J8WC 3KWQB 4J8WB 4CAYA 1EQZD 1TZYA 4WU8C 4WU8B 3UTBD 3B0BA 5BS7A 3AN2C 3AN2B 2NQBB 5AVCB 3AV1C 3VH5W 3LJAC 3LJAB 5CP6C 5CP6B 5CPKD 3UTAA 3AZIA 3AZJC 3AZJB 1P3GA 5DNND 2ZY3A 3KXBB 5B0ZA 1P3LD 2FJ7C 5GT3A 3REHD 1EQZB 5CPJA 5B31D 3UTBC 3UTBB 4KUDD 3X1UD 4XZQD 3AZMD 1M19D 5B1LA 2J8PA 3R45B 3O62D 3C1BD 3RELA 4J8UA 4KGCA 4YM6A 5DNNC 3W99D 5DNNB 3C1CD 5JRGA 1P3LC 2AROC 2XD5A 3MGSC 1P3LB 1P3KA 4AWLC 4H9RA 4AWLB 4CSRA 1ULYA 3REHB 5B31C 1M1AA 5B31B 1P3AA 5B1MC 4KUDC 4QLCD 4KUDB 3AZFA 3AZMC 5B2JA 3X1UB 4XZQB 3AZMB 1P3ID 1M19B 3VH6A 5AY8D 2F8ND 4NE3A 3REKD 3O62C 3AFAD 3O62B 3C1BB 3C1BC 5BNXB 3W99C 3C1CC 3W99B 3C1CB 4J8WA 3AV2C 2CV5C 1TZYD 2FFFB 3B6FC 4H9OB 4QLCC 4QLCB 3AV1A 3UTAD 1P3IB 2F8NB 3AZID 5AY8C 5AY8B 1P3GD 1WWIA 3REKB 2G5IC 3AFAC 3AFAB 5B0ZD 3MNNA 3MGRC 2JSSA 1Z2CB 3EG5B 4CAYB 5GT3D 5CPJD 1TZYB 2BYKA 1PZRA 4WZSB 2FJ7A 5BS7C 1BH9A 1T3UA 2YFWA 1ID3C 5G49A 5B1LD 3UTAC 3UTAB 3AZIC 3RELD 3AZIB 5JA4A 4KGCD 4J8UD 1P3GB 2G5HC 4YM6D 3EPLA 5JRGD 5AVBC 5GT0A 3W96C 5B0ZC 5B0ZB 3AL0C 5GT3B 1M1AD 5CPJC 5CPJB 2AROA 3MGSA 4H9QA 3LZ1A 2XD1A 3AZFD 1BFMA 5DNMA 5B2JD 5B40C 2Y2QA 5B1MA 5B1LB 4UUZA 3RELC 3RELB 4M6BA 4KGCC 4J8UC 3MGPA 4J8UB 4KGCB 4YM6C 3WTPE 4YM6B 3AZHA 5JRGC 4J8WD 5JRGB 3WKJA 3AV2A 1P3KC 2CV5A 1P3KB 3FDDA 4H9RB 1M1AB 1M1AC 2Y2PA 1P3AC 1P3AB 3AZNA 3REIA 3AN2D 3AV1D 3B6FA 3AZFB 5B2JC 2JE5A 5B2JB 3AZGC 2VQRA 1R4VA 4Z66A 3LELA 3KUYA 2Y2LA 5GXQA 3UT9A 3MGRA 2FJ7D 4XUJA 4X23C 1KX3C 3B0CT 4X23B 2NZDA 3AV1B 5F99C 1ID3A 3AZEA 1ZLAC 3WTPA 5AV8C 1P3PC 4H9SC 5GT0D 3MNNC 3MNNB 3WAAC 5AVBA 3W96A 1KX5C 2BYMA 1KX4C 4J8VC 2AROD 2BYKB 5AV9A 4ZUXA 3LZ1D 3MGSD 2FJ7B 1BH9B 3AZKA 5DNMD 2YFWB 5BNVA 5G49B 4G91C 5B1MD 4G91B 3TU4C 5C3IC 1JFIA 5C3IB 5B40A 3A6NC 1P3MA 5JA4B 3MGPD 4DRAA 3EPJA 3AZHD 3H0LC 5GT0C 4KHAB 5GT0B 3WKJD 1Q9CA 3AV2D 2CV5D 1P3FC 1P3BA 5BO0A 2AROB 3MGSB 3LZ1C 4H9QB 3LZ1B 3AZND 3REID 1P34C 3B6FD 5DNMC 3EPHA 5DNMB 5CHLB 4JJNA 5B1MB 3H0MC 4Z66D 5B2IA 1P3OA 2HUEC 4UUZB 3MVDA 4J8XC 3LELD 3MGPC 3KUYD 2Y2MA 3MGPB 3AZGA 5GXQD 3UT9D 3AZHC 3B6GC 3AZHB 3MGRD 1W2EA 5B32C 4HGAC 4HGAB 3WKJC 3WKJB 3AV2B 4XUJD 2CV5B 1U35A 5B32G 3VH6W 3AZNC 4WJ3C 3AZNB 3REIC 3REIB 4X23A 1KX3A 2NZDD 3REJA 3B6FB 1ID3D 5GSUC 3AZED 3WTPD 2LY8A 3V9RA 4Z66B 5F99A 4Z66C 3AZLA 3VH5T 1ZLAA 3LELC 3KUYC 3LELB 3KUYB 2W8SA 5GXQC 5GXQB 3UT9C 5AV8A 3UT9B 1F66C 1P3PA 2Y2IA 4H9SA 5AVBD 3W96D 3MGRB 3W97A 3WAAA 4XUJC 5AV9D 4XUJB 4ZUXD 3NQJA 1KX5A 1KX4A 1KU5A 3B0DC 3B0DB 2NZDC 3A1KA 2NZDB 2YFVB 5AV5A 3AYWA 5B40D 5CPIA 1ID3B 4J8VA 3AZEC 3TU4A 3AZEB 1P3MD 3WTPC 3WTPB 4WNNA 3A6NA 2Y2JA 5AV6A 2L5AA 4NFTA 1N1JB 2ZM5A 4KHAA 5AVBB 3W96B 2BYMB 1P3BD 3P5JB 5AV9C 3WA9A 4ZUXC 5AV9B 4ZUXB 1P3KD 2DQNC 1P3FA 2Y2NA 3AZKC 3AZKB 1P3AD 2F2AC 5BT1D 1P34A 4R8PA 5BNVB 4JJND 5B33C 5B33B 1JFIB 5B40B 5B2ID 3AZGD 2Y2KA 3MVDD 1P3MB 2IO5C 1P3MC 2IO5B 4Z5TA 2Y2OA 4J8XA 4DQYB 1S32A 3B6GA 5CPIB 5B32A 1U35D 1P3BC 1P3BB 5BO0B 4DRBA 4X23D 3LZ0A 1KX3D 3REJD 5BT1C 2JCHA 4JJNC 4JJNB 3A1IA 3AZLD 5F99D 5B2IC 5B2IB 1P3OC 1P3OB 5GSUA 1HQ3A 3MVDB 3MVDC 3AZGB 1ZLAD 1AOIC 5AV8D 2RIQA 1P3PD 5B0YA 3MNND 1F66A 3W97D 3WAAD 2PYOC 1KX5D 1KX4D 2Y2GA 1U35C 1U35B 2PYOB 1M18A 2BG1A 4Z2MG 1KX3B 3REJC 5AV5D 4G92C 3REJB 4G92B 3AYWD 1TAFA 5CPID 4J8VD 3TU4D 2YFVA 3V9RB 3AZLC 3AZLB 5F99B 3A6ND 1ZLAB 2DF4C 3W98A 5AV8B 1P3PB 3W97C 1N1JA 3W97B 3WAAB 3NQUA 3X1VA 3WA9D 3VH5A 3NQJB 1P3FD 1KX4B 1KX5B 1P34D 4R8PD 5AV5C 5AV5B 3AYWC 3IP4C 5FUGA 5CPIC 3AYWB 4J8VB 5B33A 3TU4B
chains in the Genus database with same CATH topology
3H0RC 2NQBC 4Z5TD 5AVCC 4WNNB 4EO5C 4EO5B 5AV6B 5AV6C 2ZY5A 3A6NB 4J8XD 1S32D 3B6GD 5B32D 4NE6A 3X1SC 3X1SB 3KXBC 3WA9C 3WA9B 1P3FB 3LZ0D 4R8PC 1P34B 4R8PB 5E5AA 2RVQD 1EQZC 3F6TA 5GSUD 1HQ3D 4Z5TC 4Z5TB 1B67A 1H3OA 2HUEB 3MGQA 4J8XB 1S32C 1S32B 5B0YD 1AOIA 5KDMA 1F66D 3B6GB 3X1TA 5CPKC 5CPKB 4H9PA 5B32B 4H9NA 5B24A 1M18D 2PYOA 4Z2MH 3LZ0C 3LZ0B 2RVQC 4YS3A 1BH8A 3REHC 4LD9A 1F1EA 4WU9A 2HIOA 1HQ3C 5GSUB 1HQ3B 3W98D 5B31G 4XZQC 3X1UC 5B0YC 1M19C 5B0YB 1F66B 2CWEA 2UWXA 3X1VD 1M18C 1M18B 3KWQA 3AZKD 1TAFB 5B33D 4WU8A 3AN2A 2NQBA 3W98C 3W98B 5AVCA 3LJAA 1P3IC 5CP6A 3X1VC 3NQUB 3REKC 3X1VB 3AZJA 2F8NG 3X1SA 1WWSA 3KXBA 5E5AD 3KSYA 1B6WA 3B0CW 1TZYC 5FUGB 1EQZA 2F8NK 1P3OD 4NE5A 3UTBA 3MGQD 1AOID 3X1TD 3EPKA 2Y2HA 1P3GC 5CPKA 3R45A 5B24D 2PYOD 3KFUG 5DNNA 1A7WA 5E5AC 5E5AB 4YS3D 5GT3C 4LD9D 4WU9D 2HIOD 3VH6T 4E45A 1P3LA 3REHA 4WV4B 2ZY2A 5B31A 1H3OB 3MGQC 3MGQB 5B1LC 1AOIB 5KDMB 4KUDA 3X1TC 1HTAA 3X1TB 3X1UA 4UPKA 4XZQA 3AZMA 1M19A 4H9PB 4H9NB 5B24C 5B24B 3O62A 3C1BA 3KWQD 5BNXA 3W99A 3C1CA 2ZY4A 4YS3C 4YS3B 1BH8B 4LD9C 4LD9B 4CSRB 4E44A 2HIOC 4WU8D 2HIOB 4WU9B 4WU9C 2NQBD 5AVCD 4H9OA 4ZBJC 5AV6D 4ZBJB 3AZFC 3LJAD 4QLCA 5CP6D 1P3IA 2F8NA 5AY8A 3AZJD 2F8NH 3X1SD 3KXBD 3REKA 3AFAA 3KWQC 4J8WC 3KWQB 4J8WB 4CAYA 1EQZD 1TZYA 4WU8C 4WU8B 3UTBD 3B0BA 5BS7A 3AN2C 3AN2B 2NQBB 5AVCB 3AV1C 3VH5W 3LJAC 3LJAB 5CP6C 5CP6B 5CPKD 3UTAA 3AZIA 3AZJC 3AZJB 1P3GA 5DNND 2ZY3A 3KXBB 5B0ZA 1P3LD 2FJ7C 5GT3A 3REHD 1EQZB 5CPJA 5B31D 3UTBC 3UTBB 4KUDD 3X1UD 4XZQD 3AZMD 1M19D 5B1LA 2J8PA 3R45B 3O62D 3C1BD 3RELA 4J8UA 4KGCA 4YM6A 5DNNC 3W99D 5DNNB 3C1CD 5JRGA 1P3LC 2AROC 2XD5A 3MGSC 1P3LB 1P3KA 4AWLC 4H9RA 4AWLB 4CSRA 1ULYA 3REHB 5B31C 1M1AA 5B31B 1P3AA 5B1MC 4KUDC 4QLCD 4KUDB 3AZFA 3AZMC 5B2JA 3X1UB 4XZQB 3AZMB 1P3ID 1M19B 3VH6A 5AY8D 2F8ND 4NE3A 3REKD 3O62C 3AFAD 3O62B 3C1BB 3C1BC 5BNXB 3W99C 3C1CC 3W99B 3C1CB 4J8WA 3AV2C 2CV5C 1TZYD 2FFFB 3B6FC 4H9OB 4QLCC 4QLCB 3AV1A 3UTAD 1P3IB 2F8NB 3AZID 5AY8C 5AY8B 1P3GD 1WWIA 3REKB 2G5IC 3AFAC 3AFAB 5B0ZD 3MNNA 3MGRC 2JSSA 1Z2CB 3EG5B 4CAYB 5GT3D 5CPJD 1TZYB 2BYKA 1PZRA 4WZSB 2FJ7A 5BS7C 1BH9A 1T3UA 2YFWA 1ID3C 5G49A 5B1LD 3UTAC 3UTAB 3AZIC 3RELD 3AZIB 5JA4A 4KGCD 4J8UD 1P3GB 2G5HC 4YM6D 3EPLA 5JRGD 5AVBC 5GT0A 3W96C 5B0ZC 5B0ZB 3AL0C 5GT3B 1M1AD 5CPJC 5CPJB 2AROA 3MGSA 4H9QA 3LZ1A 2XD1A 3AZFD 1BFMA 5DNMA 5B2JD 5B40C 2Y2QA 5B1MA 5B1LB 4UUZA 3RELC 3RELB 4M6BA 4KGCC 4J8UC 3MGPA 4J8UB 4KGCB 4YM6C 3WTPE 4YM6B 3AZHA 5JRGC 4J8WD 5JRGB 3WKJA 3AV2A 1P3KC 2CV5A 1P3KB 3FDDA 4H9RB 1M1AB 1M1AC 2Y2PA 1P3AC 1P3AB 3AZNA 3REIA 3AN2D 3AV1D 3B6FA 3AZFB 5B2JC 2JE5A 5B2JB 3AZGC 2VQRA 1R4VA 4Z66A 3LELA 3KUYA 2Y2LA 5GXQA 3UT9A 3MGRA 2FJ7D 4XUJA 4X23C 1KX3C 3B0CT 4X23B 2NZDA 3AV1B 5F99C 1ID3A 3AZEA 1ZLAC 3WTPA 5AV8C 1P3PC 4H9SC 5GT0D 3MNNC 3MNNB 3WAAC 5AVBA 3W96A 1KX5C 2BYMA 1KX4C 4J8VC 2AROD 2BYKB 5AV9A 4ZUXA 3LZ1D 3MGSD 2FJ7B 1BH9B 3AZKA 5DNMD 2YFWB 5BNVA 5G49B 4G91C 5B1MD 4G91B 3TU4C 5C3IC 1JFIA 5C3IB 5B40A 3A6NC 1P3MA 5JA4B 3MGPD 4DRAA 3EPJA 3AZHD 3H0LC 5GT0C 4KHAB 5GT0B 3WKJD 1Q9CA 3AV2D 2CV5D 1P3FC 1P3BA 5BO0A 2AROB 3MGSB 3LZ1C 4H9QB 3LZ1B 3AZND 3REID 1P34C 3B6FD 5DNMC 3EPHA 5DNMB 5CHLB 4JJNA 5B1MB 3H0MC 4Z66D 5B2IA 1P3OA 2HUEC 4UUZB 3MVDA 4J8XC 3LELD 3MGPC 3KUYD 2Y2MA 3MGPB 3AZGA 5GXQD 3UT9D 3AZHC 3B6GC 3AZHB 3MGRD 1W2EA 5B32C 4HGAC 4HGAB 3WKJC 3WKJB 3AV2B 4XUJD 2CV5B 1U35A 5B32G 3VH6W 3AZNC 4WJ3C 3AZNB 3REIC 3REIB 4X23A 1KX3A 2NZDD 3REJA 3B6FB 1ID3D 5GSUC 3AZED 3WTPD 2LY8A 3V9RA 4Z66B 5F99A 4Z66C 3AZLA 3VH5T 1ZLAA 3LELC 3KUYC 3LELB 3KUYB 2W8SA 5GXQC 5GXQB 3UT9C 5AV8A 3UT9B 1F66C 1P3PA 2Y2IA 4H9SA 5AVBD 3W96D 3MGRB 3W97A 3WAAA 4XUJC 5AV9D 4XUJB 4ZUXD 3NQJA 1KX5A 1KX4A 1KU5A 3B0DC 3B0DB 2NZDC 3A1KA 2NZDB 2YFVB 5AV5A 3AYWA 5B40D 5CPIA 1ID3B 4J8VA 3AZEC 3TU4A 3AZEB 1P3MD 3WTPC 3WTPB 4WNNA 3A6NA 2Y2JA 5AV6A 2L5AA 4NFTA 1N1JB 2ZM5A 4KHAA 5AVBB 3W96B 2BYMB 1P3BD 3P5JB 5AV9C 3WA9A 4ZUXC 5AV9B 4ZUXB 1P3KD 2DQNC 1P3FA 2Y2NA 3AZKC 3AZKB 1P3AD 2F2AC 5BT1D 1P34A 4R8PA 5BNVB 4JJND 5B33C 5B33B 1JFIB 5B40B 5B2ID 3AZGD 2Y2KA 3MVDD 1P3MB 2IO5C 1P3MC 2IO5B 4Z5TA 2Y2OA 4J8XA 4DQYB 1S32A 3B6GA 5CPIB 5B32A 1U35D 1P3BC 1P3BB 5BO0B 4DRBA 4X23D 3LZ0A 1KX3D 3REJD 5BT1C 2JCHA 4JJNC 4JJNB 3A1IA 3AZLD 5F99D 5B2IC 5B2IB 1P3OC 1P3OB 5GSUA 1HQ3A 3MVDB 3MVDC 3AZGB 1ZLAD 1AOIC 5AV8D 2RIQA 1P3PD 5B0YA 3MNND 1F66A 3W97D 3WAAD 2PYOC 1KX5D 1KX4D 2Y2GA 1U35C 1U35B 2PYOB 1M18A 2BG1A 4Z2MG 1KX3B 3REJC 5AV5D 4G92C 3REJB 4G92B 3AYWD 1TAFA 5CPID 4J8VD 3TU4D 2YFVA 3V9RB 3AZLC 3AZLB 5F99B 3A6ND 1ZLAB 2DF4C 3W98A 5AV8B 1P3PB 3W97C 1N1JA 3W97B 3WAAB 3NQUA 3X1VA 3WA9D 3VH5A 3NQJB 1P3FD 1KX4B 1KX5B 1P34D 4R8PD 5AV5C 5AV5B 3AYWC 3IP4C 5FUGA 5CPIC 3AYWB 4J8VB 5B33A 3TU4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NQB C;  4Z5T D;  5AVC C;  4WNN B;  4EO5 C;  4EO5 B;  5AV6 B;  5AV6 C;  3A6N B;  4J8X D;  1S32 D;  3B6G D;  5B32 D;  4NE6 A;  3X1S C;  3X1S B;  3KXB C;  3WA9 C;  3WA9 B;  1P3F B;  3LZ0 D;  4R8P C;  1P34 B;  4R8P B;  5E5A A;  2RVQ D;  1EQZ C;  5GSU D;  1HQ3 D;  4Z5T C;  4Z5T B;  1B67 A;  1H3O A;  2HUE B;  3MGQ A;  4J8X B;  1S32 C;  1S32 B;  5B0Y D;  1AOI A;  5KDM A;  1F66 D;  3B6G B;  3X1T A;  5CPK C;  5CPK B;  4H9P A;  5B32 B;  4H9N A;  5B24 A;  1M18 D;  2PYO A;  4Z2M H;  3LZ0 C;  3LZ0 B;  2RVQ C;  4YS3 A;  1BH8 A;  3REH C;  4LD9 A;  1F1E A;  4WU9 A;  2HIO A;  1HQ3 C;  5GSU B;  1HQ3 B;  3W98 D;  5B31 G;  4XZQ C;  3X1U C;  5B0Y C;  1M19 C;  5B0Y B;  1F66 B;  2CWE A;  3X1V D;  1M18 C;  1M18 B;  3KWQ A;  3AZK D;  1TAF B;  5B33 D;  4WU8 A;  3AN2 A;  2NQB A;  3W98 C;  3W98 B;  5AVC A;  3LJA A;  1P3I C;  5CP6 A;  3X1V C;  3NQU B;  3REK C;  3X1V B;  3AZJ A;  2F8N G;  3X1S A;  1WWS A;  3KXB A;  5E5A D;  3KSY A;  1B6W A;  3B0C W;  1TZY C;  5FUG B;  1EQZ A;  2F8N K;  1P3O D;  4NE5 A;  3UTB A;  3MGQ D;  1AOI D;  3X1T D;  1P3G C;  5CPK A;  3R45 A;  5B24 D;  2PYO D;  5DNN A;  1A7W A;  5E5A C;  5E5A B;  4YS3 D;  5GT3 C;  4LD9 D;  4WU9 D;  2HIO D;  3VH6 T;  4E45 A;  1P3L A;  3REH A;  4WV4 B;  5B31 A;  1H3O B;  3MGQ C;  3MGQ B;  5B1L C;  1AOI B;  5KDM B;  4KUD A;  3X1T C;  1HTA A;  3X1T B;  3X1U A;  4XZQ A;  3AZM A;  1M19 A;  4H9P B;  4H9N B;  5B24 C;  5B24 B;  3O62 A;  3C1B A;  3KWQ D;  5BNX A;  3W99 A;  3C1C A;  4YS3 C;  4YS3 B;  1BH8 B;  4LD9 C;  4LD9 B;  4CSR B;  4E44 A;  2HIO C;  4WU8 D;  2HIO B;  4WU9 B;  4WU9 C;  2NQB D;  5AVC D;  4H9O A;  4ZBJ C;  5AV6 D;  4ZBJ B;  3AZF C;  3LJA D;  4QLC A;  5CP6 D;  1P3I A;  2F8N A;  5AY8 A;  3AZJ D;  2F8N H;  3X1S D;  3KXB D;  3REK A;  3AFA A;  3KWQ C;  4J8W C;  3KWQ B;  4J8W B;  4CAY A;  1EQZ D;  1TZY A;  4WU8 C;  4WU8 B;  3UTB D;  3B0B A;  5BS7 A;  3AN2 C;  3AN2 B;  2NQB B;  5AVC B;  3AV1 C;  3VH5 W;  3LJA C;  3LJA B;  5CP6 C;  5CP6 B;  5CPK D;  3UTA A;  3AZI A;  3AZJ C;  3AZJ B;  1P3G A;  5DNN D;  3KXB B;  5B0Z A;  1P3L D;  2FJ7 C;  5GT3 A;  3REH D;  1EQZ B;  5CPJ A;  5B31 D;  3UTB C;  3UTB B;  4KUD D;  3X1U D;  4XZQ D;  3AZM D;  1M19 D;  5B1L A;  3R45 B;  3O62 D;  3C1B D;  3REL A;  4KGC A;  4J8U A;  4YM6 A;  5DNN C;  3W99 D;  5DNN B;  3C1C D;  5JRG A;  1P3L C;  2ARO C;  3MGS C;  1P3L B;  1P3K A;  4AWL C;  4H9R A;  4AWL B;  4CSR A;  1ULY A;  3REH B;  5B31 C;  1M1A A;  5B31 B;  1P3A A;  5B1M C;  4KUD C;  4QLC D;  4KUD B;  3AZF A;  3AZM C;  5B2J A;  3X1U B;  4XZQ B;  3AZM B;  1P3I D;  1M19 B;  3VH6 A;  5AY8 D;  2F8N D;  4NE3 A;  3REK D;  3O62 C;  3AFA D;  3O62 B;  3C1B B;  3C1B C;  5BNX B;  3W99 C;  3C1C C;  3W99 B;  3C1C B;  4J8W A;  3AV2 C;  2CV5 C;  1TZY D;  3B6F C;  4H9O B;  4QLC C;  4QLC B;  3AV1 A;  3UTA D;  1P3I B;  2F8N B;  3AZI D;  5AY8 C;  5AY8 B;  1P3G D;  1WWI A;  3REK B;  3AFA C;  3AFA B;  5B0Z D;  3MNN A;  3MGR C;  2JSS A;  4CAY B;  5GT3 D;  5CPJ D;  1TZY B;  2BYK A;  2FJ7 A;  4WZS B;  5BS7 C;  1BH9 A;  2YFW A;  1ID3 C;  5G49 A;  5B1L D;  3UTA C;  3UTA B;  3AZI C;  3REL D;  3AZI B;  5JA4 A;  4KGC D;  4J8U D;  1P3G B;  4YM6 D;  5JRG D;  5AVB C;  5GT0 A;  3W96 C;  5B0Z C;  5B0Z B;  5GT3 B;  1M1A D;  5CPJ C;  5CPJ B;  2ARO A;  3MGS A;  4H9Q A;  3LZ1 A;  3AZF D;  1BFM A;  5DNM A;  5B2J D;  5B40 C;  5B1M A;  5B1L B;  4UUZ A;  3REL C;  3REL B;  4M6B A;  4KGC C;  4J8U C;  3MGP A;  4J8U B;  4KGC B;  4YM6 C;  3WTP E;  4YM6 B;  3AZH A;  5JRG C;  4J8W D;  5JRG B;  3WKJ A;  3AV2 A;  1P3K C;  2CV5 A;  1P3K B;  1M1A B;  4H9R B;  1M1A C;  1P3A C;  1P3A B;  3AZN A;  3REI A;  3AN2 D;  3AV1 D;  3B6F A;  3AZF B;  5B2J C;  5B2J B;  3AZG C;  1R4V A;  4Z66 A;  3LEL A;  3KUY A;  5GXQ A;  3UT9 A;  3MGR A;  2FJ7 D;  4XUJ A;  4X23 C;  1KX3 C;  3B0C T;  4X23 B;  2NZD A;  3AV1 B;  5F99 C;  1ID3 A;  3AZE A;  1ZLA C;  3WTP A;  5AV8 C;  1P3P C;  4H9S C;  5GT0 D;  3MNN C;  3MNN B;  3WAA C;  5AVB A;  3W96 A;  1KX5 C;  2BYM A;  1KX4 C;  2ARO D;  5AV9 A;  2BYK B;  4ZUX A;  3LZ1 D;  3MGS D;  2FJ7 B;  1BH9 B;  3AZK A;  5DNM D;  2YFW B;  5BNV A;  5G49 B;  4G91 C;  5B1M D;  4G91 B;  3TU4 C;  5C3I C;  1JFI A;  5C3I B;  5B40 A;  3A6N C;  1P3M A;  5JA4 B;  3MGP D;  4DRA A;  3AZH D;  5GT0 C;  4KHA B;  5GT0 B;  3WKJ D;  1Q9C A;  3AV2 D;  2CV5 D;  1P3F C;  1P3B A;  5BO0 A;  2ARO B;  3MGS B;  3LZ1 C;  4H9Q B;  3LZ1 B;  3AZN D;  3REI D;  1P34 C;  3B6F D;  5DNM C;  5DNM B;  5CHL B;  4JJN A;  5B1M B;  4Z66 D;  5B2I A;  1P3O A;  2HUE C;  4UUZ B;  3MVD A;  4J8X C;  3LEL D;  3MGP C;  3KUY D;  3MGP B;  3AZG A;  5GXQ D;  3UT9 D;  3AZH C;  3B6G C;  3AZH B;  3MGR D;  5B32 C;  4HGA C;  4HGA B;  3WKJ C;  3WKJ B;  3AV2 B;  4XUJ D;  2CV5 B;  1U35 A;  5B32 G;  3VH6 W;  3AZN C;  3AZN B;  3REI C;  3REI B;  4X23 A;  1KX3 A;  2NZD D;  3REJ A;  3B6F B;  1ID3 D;  5GSU C;  3AZE D;  3WTP D;  2LY8 A;  3V9R A;  4Z66 B;  5F99 A;  4Z66 C;  3AZL A;  3VH5 T;  1ZLA A;  3LEL C;  3KUY C;  3LEL B;  3KUY B;  5GXQ C;  5GXQ B;  3UT9 C;  5AV8 A;  3UT9 B;  1F66 C;  1P3P A;  4H9S A;  5AVB D;  3W96 D;  3MGR B;  3W97 A;  3WAA A;  4XUJ C;  5AV9 D;  4XUJ B;  4ZUX D;  3NQJ A;  1KX5 A;  1KX4 A;  1KU5 A;  3B0D C;  3B0D B;  2NZD C;  2NZD B;  2YFV B;  5AV5 A;  3AYW A;  5B40 D;  5CPI A;  1ID3 B;  4J8V A;  3AZE C;  3TU4 A;  3AZE B;  1P3M D;  3WTP C;  3WTP B;  4WNN A;  3A6N A;  5AV6 A;  2L5A A;  4NFT A;  1N1J B;  4KHA A;  5AVB B;  3W96 B;  2BYM B;  1P3B D;  5AV9 C;  3WA9 A;  4ZUX C;  5AV9 B;  4ZUX B;  1P3K D;  1P3F A;  3AZK C;  3AZK B;  1P3A D;  5BT1 D;  1P34 A;  4R8P A;  5BNV B;  4JJN D;  5B33 C;  5B33 B;  1JFI B;  5B40 B;  5B2I D;  3AZG D;  3MVD D;  1P3M C;  1P3M B;  2IO5 C;  2IO5 B;  4Z5T A;  4J8X A;  1S32 A;  3B6G A;  5CPI B;  5B32 A;  1U35 D;  1P3B C;  1P3B B;  5BO0 B;  4DRB A;  4X23 D;  3LZ0 A;  1KX3 D;  3REJ D;  5BT1 C;  4JJN C;  4JJN B;  3AZL D;  5F99 D;  5B2I C;  5B2I B;  1P3O C;  1P3O B;  5GSU A;  1HQ3 A;  3MVD B;  3MVD C;  3AZG B;  1ZLA D;  1AOI C;  5AV8 D;  1P3P D;  5B0Y A;  3MNN D;  1F66 A;  3W97 D;  3WAA D;  2PYO C;  1KX5 D;  1KX4 D;  1U35 C;  2PYO B;  1U35 B;  1M18 A;  4Z2M G;  1KX3 B;  3REJ C;  5AV5 D;  4G92 C;  3REJ B;  4G92 B;  3AYW D;  1TAF A;  5CPI D;  4J8V D;  3TU4 D;  2YFV A;  3V9R B;  3AZL C;  3AZL B;  5F99 B;  3A6N D;  1ZLA B;  3W98 A;  5AV8 B;  1P3P B;  3W97 C;  1N1J A;  3W97 B;  3WAA B;  3NQU A;  3X1V A;  3WA9 D;  3VH5 A;  3NQJ B;  1P3F D;  1KX4 B;  1KX5 B;  1P34 D;  4R8P D;  5AV5 C;  5AV5 B;  3AYW C;  5CPI C;  5FUG A;  4J8V C;  3AYW B;  4J8V B;  5B33 A;  3TU4 B; 
#chains in the Genus database with same CATH topology
 3H0R C;  2NQB C;  4Z5T D;  5AVC C;  4WNN B;  4EO5 C;  4EO5 B;  5AV6 B;  5AV6 C;  2ZY5 A;  3A6N B;  4J8X D;  1S32 D;  3B6G D;  5B32 D;  4NE6 A;  3X1S C;  3X1S B;  3KXB C;  3WA9 C;  3WA9 B;  1P3F B;  3LZ0 D;  4R8P C;  1P34 B;  4R8P B;  5E5A A;  2RVQ D;  1EQZ C;  3F6T A;  5GSU D;  1HQ3 D;  4Z5T C;  4Z5T B;  1B67 A;  1H3O A;  2HUE B;  3MGQ A;  4J8X B;  1S32 C;  1S32 B;  5B0Y D;  1AOI A;  5KDM A;  1F66 D;  3B6G B;  3X1T A;  5CPK C;  5CPK B;  4H9P A;  5B32 B;  4H9N A;  5B24 A;  1M18 D;  2PYO A;  4Z2M H;  3LZ0 C;  3LZ0 B;  2RVQ C;  4YS3 A;  1BH8 A;  3REH C;  4LD9 A;  1F1E A;  4WU9 A;  2HIO A;  1HQ3 C;  5GSU B;  1HQ3 B;  3W98 D;  5B31 G;  4XZQ C;  3X1U C;  5B0Y C;  1M19 C;  5B0Y B;  1F66 B;  2CWE A;  2UWX A;  3X1V D;  1M18 C;  1M18 B;  3KWQ A;  3AZK D;  1TAF B;  5B33 D;  4WU8 A;  3AN2 A;  2NQB A;  3W98 C;  3W98 B;  5AVC A;  3LJA A;  1P3I C;  5CP6 A;  3X1V C;  3NQU B;  3REK C;  3X1V B;  3AZJ A;  2F8N G;  3X1S A;  1WWS A;  3KXB A;  5E5A D;  3KSY A;  1B6W A;  3B0C W;  1TZY C;  5FUG B;  1EQZ A;  2F8N K;  1P3O D;  4NE5 A;  3UTB A;  3MGQ D;  1AOI D;  3X1T D;  3EPK A;  2Y2H A;  1P3G C;  5CPK A;  3R45 A;  5B24 D;  2PYO D;  3KFU G;  5DNN A;  1A7W A;  5E5A C;  5E5A B;  4YS3 D;  5GT3 C;  4LD9 D;  4WU9 D;  2HIO D;  3VH6 T;  4E45 A;  1P3L A;  3REH A;  4WV4 B;  2ZY2 A;  5B31 A;  1H3O B;  3MGQ C;  3MGQ B;  5B1L C;  1AOI B;  5KDM B;  4KUD A;  3X1T C;  1HTA A;  3X1T B;  3X1U A;  4UPK A;  4XZQ A;  3AZM A;  1M19 A;  4H9P B;  4H9N B;  5B24 C;  5B24 B;  3O62 A;  3C1B A;  3KWQ D;  5BNX A;  3W99 A;  3C1C A;  2ZY4 A;  4YS3 C;  4YS3 B;  1BH8 B;  4LD9 C;  4LD9 B;  4CSR B;  4E44 A;  2HIO C;  4WU8 D;  2HIO B;  4WU9 B;  4WU9 C;  2NQB D;  5AVC D;  4H9O A;  4ZBJ C;  5AV6 D;  4ZBJ B;  3AZF C;  3LJA D;  4QLC A;  5CP6 D;  1P3I A;  2F8N A;  5AY8 A;  3AZJ D;  2F8N H;  3X1S D;  3KXB D;  3REK A;  3AFA A;  3KWQ C;  4J8W C;  3KWQ B;  4J8W B;  4CAY A;  1EQZ D;  1TZY A;  4WU8 C;  4WU8 B;  3UTB D;  3B0B A;  5BS7 A;  3AN2 C;  3AN2 B;  2NQB B;  5AVC B;  3AV1 C;  3VH5 W;  3LJA C;  3LJA B;  5CP6 C;  5CP6 B;  5CPK D;  3UTA A;  3AZI A;  3AZJ C;  3AZJ B;  1P3G A;  5DNN D;  2ZY3 A;  3KXB B;  5B0Z A;  1P3L D;  2FJ7 C;  5GT3 A;  3REH D;  1EQZ B;  5CPJ A;  5B31 D;  3UTB C;  3UTB B;  4KUD D;  3X1U D;  4XZQ D;  3AZM D;  1M19 D;  5B1L A;  2J8P A;  3R45 B;  3O62 D;  3C1B D;  3REL A;  4J8U A;  4KGC A;  4YM6 A;  5DNN C;  3W99 D;  5DNN B;  3C1C D;  5JRG A;  1P3L C;  2ARO C;  2XD5 A;  3MGS C;  1P3L B;  1P3K A;  4AWL C;  4H9R A;  4AWL B;  4CSR A;  1ULY A;  3REH B;  5B31 C;  1M1A A;  5B31 B;  1P3A A;  5B1M C;  4KUD C;  4QLC D;  4KUD B;  3AZF A;  3AZM C;  5B2J A;  3X1U B;  4XZQ B;  3AZM B;  1P3I D;  1M19 B;  3VH6 A;  5AY8 D;  2F8N D;  4NE3 A;  3REK D;  3O62 C;  3AFA D;  3O62 B;  3C1B B;  3C1B C;  5BNX B;  3W99 C;  3C1C C;  3W99 B;  3C1C B;  4J8W A;  3AV2 C;  2CV5 C;  1TZY D;  2FFF B;  3B6F C;  4H9O B;  4QLC C;  4QLC B;  3AV1 A;  3UTA D;  1P3I B;  2F8N B;  3AZI D;  5AY8 C;  5AY8 B;  1P3G D;  1WWI A;  3REK B;  2G5I C;  3AFA C;  3AFA B;  5B0Z D;  3MNN A;  3MGR C;  2JSS A;  1Z2C B;  3EG5 B;  4CAY B;  5GT3 D;  5CPJ D;  1TZY B;  2BYK A;  1PZR A;  4WZS B;  2FJ7 A;  5BS7 C;  1BH9 A;  1T3U A;  2YFW A;  1ID3 C;  5G49 A;  5B1L D;  3UTA C;  3UTA B;  3AZI C;  3REL D;  3AZI B;  5JA4 A;  4KGC D;  4J8U D;  1P3G B;  2G5H C;  4YM6 D;  3EPL A;  5JRG D;  5AVB C;  5GT0 A;  3W96 C;  5B0Z C;  5B0Z B;  3AL0 C;  5GT3 B;  1M1A D;  5CPJ C;  5CPJ B;  2ARO A;  3MGS A;  4H9Q A;  3LZ1 A;  2XD1 A;  3AZF D;  1BFM A;  5DNM A;  5B2J D;  5B40 C;  2Y2Q A;  5B1M A;  5B1L B;  4UUZ A;  3REL C;  3REL B;  4M6B A;  4KGC C;  4J8U C;  3MGP A;  4J8U B;  4KGC B;  4YM6 C;  3WTP E;  4YM6 B;  3AZH A;  5JRG C;  4J8W D;  5JRG B;  3WKJ A;  3AV2 A;  1P3K C;  2CV5 A;  1P3K B;  3FDD A;  4H9R B;  1M1A B;  1M1A C;  2Y2P A;  1P3A C;  1P3A B;  3AZN A;  3REI A;  3AN2 D;  3AV1 D;  3B6F A;  3AZF B;  5B2J C;  2JE5 A;  5B2J B;  3AZG C;  2VQR A;  1R4V A;  4Z66 A;  3LEL A;  3KUY A;  2Y2L A;  5GXQ A;  3UT9 A;  3MGR A;  2FJ7 D;  4XUJ A;  4X23 C;  1KX3 C;  3B0C T;  4X23 B;  2NZD A;  3AV1 B;  5F99 C;  1ID3 A;  3AZE A;  1ZLA C;  3WTP A;  5AV8 C;  1P3P C;  4H9S C;  5GT0 D;  3MNN C;  3MNN B;  3WAA C;  5AVB A;  3W96 A;  1KX5 C;  2BYM A;  1KX4 C;  4J8V C;  2ARO D;  2BYK B;  5AV9 A;  4ZUX A;  3LZ1 D;  3MGS D;  2FJ7 B;  1BH9 B;  3AZK A;  5DNM D;  2YFW B;  5BNV A;  5G49 B;  4G91 C;  5B1M D;  4G91 B;  3TU4 C;  5C3I C;  1JFI A;  5C3I B;  5B40 A;  3A6N C;  1P3M A;  5JA4 B;  3MGP D;  4DRA A;  3EPJ A;  3AZH D;  3H0L C;  5GT0 C;  4KHA B;  5GT0 B;  3WKJ D;  1Q9C A;  3AV2 D;  2CV5 D;  1P3F C;  1P3B A;  5BO0 A;  2ARO B;  3MGS B;  3LZ1 C;  4H9Q B;  3LZ1 B;  3AZN D;  3REI D;  1P34 C;  3B6F D;  5DNM C;  3EPH A;  5DNM B;  5CHL B;  4JJN A;  5B1M B;  3H0M C;  4Z66 D;  5B2I A;  1P3O A;  2HUE C;  4UUZ B;  3MVD A;  4J8X C;  3LEL D;  3MGP C;  3KUY D;  2Y2M A;  3MGP B;  3AZG A;  5GXQ D;  3UT9 D;  3AZH C;  3B6G C;  3AZH B;  3MGR D;  1W2E A;  5B32 C;  4HGA C;  4HGA B;  3WKJ C;  3WKJ B;  3AV2 B;  4XUJ D;  2CV5 B;  1U35 A;  5B32 G;  3VH6 W;  3AZN C;  4WJ3 C;  3AZN B;  3REI C;  3REI B;  4X23 A;  1KX3 A;  2NZD D;  3REJ A;  3B6F B;  1ID3 D;  5GSU C;  3AZE D;  3WTP D;  2LY8 A;  3V9R A;  4Z66 B;  5F99 A;  4Z66 C;  3AZL A;  3VH5 T;  1ZLA A;  3LEL C;  3KUY C;  3LEL B;  3KUY B;  2W8S A;  5GXQ C;  5GXQ B;  3UT9 C;  5AV8 A;  3UT9 B;  1F66 C;  1P3P A;  2Y2I A;  4H9S A;  5AVB D;  3W96 D;  3MGR B;  3W97 A;  3WAA A;  4XUJ C;  5AV9 D;  4XUJ B;  4ZUX D;  3NQJ A;  1KX5 A;  1KX4 A;  1KU5 A;  3B0D C;  3B0D B;  2NZD C;  3A1K A;  2NZD B;  2YFV B;  5AV5 A;  3AYW A;  5B40 D;  5CPI A;  1ID3 B;  4J8V A;  3AZE C;  3TU4 A;  3AZE B;  1P3M D;  3WTP C;  3WTP B;  4WNN A;  3A6N A;  2Y2J A;  5AV6 A;  2L5A A;  4NFT A;  1N1J B;  2ZM5 A;  4KHA A;  5AVB B;  3W96 B;  2BYM B;  1P3B D;  3P5J B;  5AV9 C;  3WA9 A;  4ZUX C;  5AV9 B;  4ZUX B;  1P3K D;  2DQN C;  1P3F A;  2Y2N A;  3AZK C;  3AZK B;  1P3A D;  2F2A C;  5BT1 D;  1P34 A;  4R8P A;  5BNV B;  4JJN D;  5B33 C;  5B33 B;  1JFI B;  5B40 B;  5B2I D;  3AZG D;  2Y2K A;  3MVD D;  1P3M B;  2IO5 C;  1P3M C;  2IO5 B;  4Z5T A;  2Y2O A;  4J8X A;  4DQY B;  1S32 A;  3B6G A;  5CPI B;  5B32 A;  1U35 D;  1P3B C;  1P3B B;  5BO0 B;  4DRB A;  4X23 D;  3LZ0 A;  1KX3 D;  3REJ D;  5BT1 C;  2JCH A;  4JJN C;  4JJN B;  3A1I A;  3AZL D;  5F99 D;  5B2I C;  5B2I B;  1P3O C;  1P3O B;  5GSU A;  1HQ3 A;  3MVD B;  3MVD C;  3AZG B;  1ZLA D;  1AOI C;  5AV8 D;  2RIQ A;  1P3P D;  5B0Y A;  3MNN D;  1F66 A;  3W97 D;  3WAA D;  2PYO C;  1KX5 D;  1KX4 D;  2Y2G A;  1U35 C;  1U35 B;  2PYO B;  1M18 A;  2BG1 A;  4Z2M G;  1KX3 B;  3REJ C;  5AV5 D;  4G92 C;  3REJ B;  4G92 B;  3AYW D;  1TAF A;  5CPI D;  4J8V D;  3TU4 D;  2YFV A;  3V9R B;  3AZL C;  3AZL B;  5F99 B;  3A6N D;  1ZLA B;  2DF4 C;  3W98 A;  5AV8 B;  1P3P B;  3W97 C;  1N1J A;  3W97 B;  3WAA B;  3NQU A;  3X1V A;  3WA9 D;  3VH5 A;  3NQJ B;  1P3F D;  1KX4 B;  1KX5 B;  1P34 D;  4R8P D;  5AV5 C;  5AV5 B;  3AYW C;  3IP4 C;  5FUG A;  5CPI C;  3AYW B;  4J8V B;  5B33 A;  3TU4 B; 
#chains in the Genus database with same CATH homology
 3H0R C;  2NQB C;  4Z5T D;  5AVC C;  4WNN B;  4EO5 C;  4EO5 B;  5AV6 B;  5AV6 C;  2ZY5 A;  3A6N B;  4J8X D;  1S32 D;  3B6G D;  5B32 D;  4NE6 A;  3X1S C;  3X1S B;  3KXB C;  3WA9 C;  3WA9 B;  1P3F B;  3LZ0 D;  4R8P C;  1P34 B;  4R8P B;  5E5A A;  2RVQ D;  1EQZ C;  3F6T A;  5GSU D;  1HQ3 D;  4Z5T C;  4Z5T B;  1B67 A;  1H3O A;  2HUE B;  3MGQ A;  4J8X B;  1S32 C;  1S32 B;  5B0Y D;  1AOI A;  5KDM A;  1F66 D;  3B6G B;  3X1T A;  5CPK C;  5CPK B;  4H9P A;  5B32 B;  4H9N A;  5B24 A;  1M18 D;  2PYO A;  4Z2M H;  3LZ0 C;  3LZ0 B;  2RVQ C;  4YS3 A;  1BH8 A;  3REH C;  4LD9 A;  1F1E A;  4WU9 A;  2HIO A;  1HQ3 C;  5GSU B;  1HQ3 B;  3W98 D;  5B31 G;  4XZQ C;  3X1U C;  5B0Y C;  1M19 C;  5B0Y B;  1F66 B;  2CWE A;  2UWX A;  3X1V D;  1M18 C;  1M18 B;  3KWQ A;  3AZK D;  1TAF B;  5B33 D;  4WU8 A;  3AN2 A;  2NQB A;  3W98 C;  3W98 B;  5AVC A;  3LJA A;  1P3I C;  5CP6 A;  3X1V C;  3NQU B;  3REK C;  3X1V B;  3AZJ A;  2F8N G;  3X1S A;  1WWS A;  3KXB A;  5E5A D;  3KSY A;  1B6W A;  3B0C W;  1TZY C;  5FUG B;  1EQZ A;  2F8N K;  1P3O D;  4NE5 A;  3UTB A;  3MGQ D;  1AOI D;  3X1T D;  3EPK A;  2Y2H A;  1P3G C;  5CPK A;  3R45 A;  5B24 D;  2PYO D;  3KFU G;  5DNN A;  1A7W A;  5E5A C;  5E5A B;  4YS3 D;  5GT3 C;  4LD9 D;  4WU9 D;  2HIO D;  3VH6 T;  4E45 A;  1P3L A;  3REH A;  4WV4 B;  2ZY2 A;  5B31 A;  1H3O B;  3MGQ C;  3MGQ B;  5B1L C;  1AOI B;  5KDM B;  4KUD A;  3X1T C;  1HTA A;  3X1T B;  3X1U A;  4UPK A;  4XZQ A;  3AZM A;  1M19 A;  4H9P B;  4H9N B;  5B24 C;  5B24 B;  3O62 A;  3C1B A;  3KWQ D;  5BNX A;  3W99 A;  3C1C A;  2ZY4 A;  4YS3 C;  4YS3 B;  1BH8 B;  4LD9 C;  4LD9 B;  4CSR B;  4E44 A;  2HIO C;  4WU8 D;  2HIO B;  4WU9 B;  4WU9 C;  2NQB D;  5AVC D;  4H9O A;  4ZBJ C;  5AV6 D;  4ZBJ B;  3AZF C;  3LJA D;  4QLC A;  5CP6 D;  1P3I A;  2F8N A;  5AY8 A;  3AZJ D;  2F8N H;  3X1S D;  3KXB D;  3REK A;  3AFA A;  3KWQ C;  4J8W C;  3KWQ B;  4J8W B;  4CAY A;  1EQZ D;  1TZY A;  4WU8 C;  4WU8 B;  3UTB D;  3B0B A;  5BS7 A;  3AN2 C;  3AN2 B;  2NQB B;  5AVC B;  3AV1 C;  3VH5 W;  3LJA C;  3LJA B;  5CP6 C;  5CP6 B;  5CPK D;  3UTA A;  3AZI A;  3AZJ C;  3AZJ B;  1P3G A;  5DNN D;  2ZY3 A;  3KXB B;  5B0Z A;  1P3L D;  2FJ7 C;  5GT3 A;  3REH D;  1EQZ B;  5CPJ A;  5B31 D;  3UTB C;  3UTB B;  4KUD D;  3X1U D;  4XZQ D;  3AZM D;  1M19 D;  5B1L A;  2J8P A;  3R45 B;  3O62 D;  3C1B D;  3REL A;  4J8U A;  4KGC A;  4YM6 A;  5DNN C;  3W99 D;  5DNN B;  3C1C D;  5JRG A;  1P3L C;  2ARO C;  2XD5 A;  3MGS C;  1P3L B;  1P3K A;  4AWL C;  4H9R A;  4AWL B;  4CSR A;  1ULY A;  3REH B;  5B31 C;  1M1A A;  5B31 B;  1P3A A;  5B1M C;  4KUD C;  4QLC D;  4KUD B;  3AZF A;  3AZM C;  5B2J A;  3X1U B;  4XZQ B;  3AZM B;  1P3I D;  1M19 B;  3VH6 A;  5AY8 D;  2F8N D;  4NE3 A;  3REK D;  3O62 C;  3AFA D;  3O62 B;  3C1B B;  3C1B C;  5BNX B;  3W99 C;  3C1C C;  3W99 B;  3C1C B;  4J8W A;  3AV2 C;  2CV5 C;  1TZY D;  2FFF B;  3B6F C;  4H9O B;  4QLC C;  4QLC B;  3AV1 A;  3UTA D;  1P3I B;  2F8N B;  3AZI D;  5AY8 C;  5AY8 B;  1P3G D;  1WWI A;  3REK B;  2G5I C;  3AFA C;  3AFA B;  5B0Z D;  3MNN A;  3MGR C;  2JSS A;  1Z2C B;  3EG5 B;  4CAY B;  5GT3 D;  5CPJ D;  1TZY B;  2BYK A;  1PZR A;  4WZS B;  2FJ7 A;  5BS7 C;  1BH9 A;  1T3U A;  2YFW A;  1ID3 C;  5G49 A;  5B1L D;  3UTA C;  3UTA B;  3AZI C;  3REL D;  3AZI B;  5JA4 A;  4KGC D;  4J8U D;  1P3G B;  2G5H C;  4YM6 D;  3EPL A;  5JRG D;  5AVB C;  5GT0 A;  3W96 C;  5B0Z C;  5B0Z B;  3AL0 C;  5GT3 B;  1M1A D;  5CPJ C;  5CPJ B;  2ARO A;  3MGS A;  4H9Q A;  3LZ1 A;  2XD1 A;  3AZF D;  1BFM A;  5DNM A;  5B2J D;  5B40 C;  2Y2Q A;  5B1M A;  5B1L B;  4UUZ A;  3REL C;  3REL B;  4M6B A;  4KGC C;  4J8U C;  3MGP A;  4J8U B;  4KGC B;  4YM6 C;  3WTP E;  4YM6 B;  3AZH A;  5JRG C;  4J8W D;  5JRG B;  3WKJ A;  3AV2 A;  1P3K C;  2CV5 A;  1P3K B;  3FDD A;  4H9R B;  1M1A B;  1M1A C;  2Y2P A;  1P3A C;  1P3A B;  3AZN A;  3REI A;  3AN2 D;  3AV1 D;  3B6F A;  3AZF B;  5B2J C;  2JE5 A;  5B2J B;  3AZG C;  2VQR A;  1R4V A;  4Z66 A;  3LEL A;  3KUY A;  2Y2L A;  5GXQ A;  3UT9 A;  3MGR A;  2FJ7 D;  4XUJ A;  4X23 C;  1KX3 C;  3B0C T;  4X23 B;  2NZD A;  3AV1 B;  5F99 C;  1ID3 A;  3AZE A;  1ZLA C;  3WTP A;  5AV8 C;  1P3P C;  4H9S C;  5GT0 D;  3MNN C;  3MNN B;  3WAA C;  5AVB A;  3W96 A;  1KX5 C;  2BYM A;  1KX4 C;  4J8V C;  2ARO D;  2BYK B;  5AV9 A;  4ZUX A;  3LZ1 D;  3MGS D;  2FJ7 B;  1BH9 B;  3AZK A;  5DNM D;  2YFW B;  5BNV A;  5G49 B;  4G91 C;  5B1M D;  4G91 B;  3TU4 C;  5C3I C;  1JFI A;  5C3I B;  5B40 A;  3A6N C;  1P3M A;  5JA4 B;  3MGP D;  4DRA A;  3EPJ A;  3AZH D;  3H0L C;  5GT0 C;  4KHA B;  5GT0 B;  3WKJ D;  1Q9C A;  3AV2 D;  2CV5 D;  1P3F C;  1P3B A;  5BO0 A;  2ARO B;  3MGS B;  3LZ1 C;  4H9Q B;  3LZ1 B;  3AZN D;  3REI D;  1P34 C;  3B6F D;  5DNM C;  3EPH A;  5DNM B;  5CHL B;  4JJN A;  5B1M B;  3H0M C;  4Z66 D;  5B2I A;  1P3O A;  2HUE C;  4UUZ B;  3MVD A;  4J8X C;  3LEL D;  3MGP C;  3KUY D;  2Y2M A;  3MGP B;  3AZG A;  5GXQ D;  3UT9 D;  3AZH C;  3B6G C;  3AZH B;  3MGR D;  1W2E A;  5B32 C;  4HGA C;  4HGA B;  3WKJ C;  3WKJ B;  3AV2 B;  4XUJ D;  2CV5 B;  1U35 A;  5B32 G;  3VH6 W;  3AZN C;  4WJ3 C;  3AZN B;  3REI C;  3REI B;  4X23 A;  1KX3 A;  2NZD D;  3REJ A;  3B6F B;  1ID3 D;  5GSU C;  3AZE D;  3WTP D;  2LY8 A;  3V9R A;  4Z66 B;  5F99 A;  4Z66 C;  3AZL A;  3VH5 T;  1ZLA A;  3LEL C;  3KUY C;  3LEL B;  3KUY B;  2W8S A;  5GXQ C;  5GXQ B;  3UT9 C;  5AV8 A;  3UT9 B;  1F66 C;  1P3P A;  2Y2I A;  4H9S A;  5AVB D;  3W96 D;  3MGR B;  3W97 A;  3WAA A;  4XUJ C;  5AV9 D;  4XUJ B;  4ZUX D;  3NQJ A;  1KX5 A;  1KX4 A;  1KU5 A;  3B0D C;  3B0D B;  2NZD C;  3A1K A;  2NZD B;  2YFV B;  5AV5 A;  3AYW A;  5B40 D;  5CPI A;  1ID3 B;  4J8V A;  3AZE C;  3TU4 A;  3AZE B;  1P3M D;  3WTP C;  3WTP B;  4WNN A;  3A6N A;  2Y2J A;  5AV6 A;  2L5A A;  4NFT A;  1N1J B;  2ZM5 A;  4KHA A;  5AVB B;  3W96 B;  2BYM B;  1P3B D;  3P5J B;  5AV9 C;  3WA9 A;  4ZUX C;  5AV9 B;  4ZUX B;  1P3K D;  2DQN C;  1P3F A;  2Y2N A;  3AZK C;  3AZK B;  1P3A D;  2F2A C;  5BT1 D;  1P34 A;  4R8P A;  5BNV B;  4JJN D;  5B33 C;  5B33 B;  1JFI B;  5B40 B;  5B2I D;  3AZG D;  2Y2K A;  3MVD D;  1P3M B;  2IO5 C;  1P3M C;  2IO5 B;  4Z5T A;  2Y2O A;  4J8X A;  4DQY B;  1S32 A;  3B6G A;  5CPI B;  5B32 A;  1U35 D;  1P3B C;  1P3B B;  5BO0 B;  4DRB A;  4X23 D;  3LZ0 A;  1KX3 D;  3REJ D;  5BT1 C;  2JCH A;  4JJN C;  4JJN B;  3A1I A;  3AZL D;  5F99 D;  5B2I C;  5B2I B;  1P3O C;  1P3O B;  5GSU A;  1HQ3 A;  3MVD B;  3MVD C;  3AZG B;  1ZLA D;  1AOI C;  5AV8 D;  2RIQ A;  1P3P D;  5B0Y A;  3MNN D;  1F66 A;  3W97 D;  3WAA D;  2PYO C;  1KX5 D;  1KX4 D;  2Y2G A;  1U35 C;  1U35 B;  2PYO B;  1M18 A;  2BG1 A;  4Z2M G;  1KX3 B;  3REJ C;  5AV5 D;  4G92 C;  3REJ B;  4G92 B;  3AYW D;  1TAF A;  5CPI D;  4J8V D;  3TU4 D;  2YFV A;  3V9R B;  3AZL C;  3AZL B;  5F99 B;  3A6N D;  1ZLA B;  2DF4 C;  3W98 A;  5AV8 B;  1P3P B;  3W97 C;  1N1J A;  3W97 B;  3WAA B;  3NQU A;  3X1V A;  3WA9 D;  3VH5 A;  3NQJ B;  1P3F D;  1KX4 B;  1KX5 B;  1P34 D;  4R8P D;  5AV5 C;  5AV5 B;  3AYW C;  3IP4 C;  5FUG A;  5CPI C;  3AYW B;  4J8V B;  5B33 A;  3TU4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...