1M18D

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
94
structure length
94
Chain Sequence
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146 Base Pair DNA Fragment
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 36
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m18D00
4YM6B 5B33B 5B1LB 5F99C 5B2IB 1ID3C 3AZJA 5E5AD 5CPIA 1EQZA 4WU8A 5CPJB 3KUYA 3AZED 1HQ3A 5CPKD 5B1MB 5AVCC 3X1TB 4HGAC 5AV6D 5DNND 5B2JA 3AZMB 5AY8A 3W96A 5B0YA 1KU5A 1JFIA 4YM6D 5B1LD 5B32C 4AWLC 5E5AA 5GSUC 3B0CT 5CPJD 3AZEA 5BS7A 3MGRB 3WAAB 5BNXA 5B1MD 3X1TD 5C3IC 3C1CB 1S32C 1P3OB 3AZMD 3AZNB 5CP6B 4ZUXB 3VH6T 4YM6A 5B1LA 5AV9B 4H9NB 5CPJA 3MGRD 3AZJC 3WAAD 3KXBB 5CPIC 3WTPB 3AZKB 4H9SA 3W97B 3KUYC 1M19B 4J8UB 1HQ3C 5B1MA 3X1TA 3C1CD 5AV5B 5BNVB 3AZMA 1P3OD 3AZND 5CP6D 4ZUXD 5AVBB 5B2JC 4J8XB 5AY8C 3R45B 3W96C 5B0YC 5AV9D 3B6FC 3LZ0B 3AZGB 3MGRA 1HTAA 3WAAA 1B67A 5E5AC 5F99B 4R8PB 3KXBD 3WTPD 3REJC 3AZEC 3AZKD 3W97D 3MGSB 1M19D 4J8UD 3W96D 4WU9D 5CPKC 3C1CA 3X1UB 5AV5D 1P3OA 3AZNA 3B0CW 5CP6A 4ZUXA 4WV4B 4XZQB 5DNNC 5AV6C 1P34B 4Z2MH 4EO5B 5AVBD 1ZLAD 5AVCB 4J8XD 5AV9A 3TU4B 4H9NA 4YM6C 5B1LC 3LZ0D 3AZGD 3KXBA 4R8PD 3B6GB 3WTPA 3AZKA 3W97A 5CPJC 3VH6W 1P3IB 1M19A 4J8UA 3MGSD 4WZSB 5AV5A 5BNVA 3X1UD 4H9SC 3AZLB 5B1MC 3X1TC 4XZQD 5AVBA 1P34D 3AZMC 1ZLAA 4J8XA 3NQUB 2RVQD 3R45A 3AFAD 3TU4D 4E45A 3B0DB 3LZ0A 3AZGA 4NFTA 4R8PA 3AZFB 3B6GD 2FJ7B 3A6NC 1P3ID 3MGSA 3WAAC 3MGRC 3AV2B 3W98B 3AZIB 1TZYB 3X1UA 3AZLD 4XZQA 3C1CC 1P34A 1P3AB 1P3OC 3AZNC 3AFAA 4ZUXC 3TU4A 5B32G 4G92B 5GXQB 5AV9C 2JSSA 3B6GA 4M6BA 3AZFD 1P3IA 2FJ7D 2IO5C 3AV2D 3W98D 3KXBC 3AZID 1TZYD 3B6FB 3WTPC 3VH5A 5BO0B 3AZKC 3AZLA 1M19C 2PYOB 4J8UC 3W97C 5E5AB 4WU9C 3WKJB 5AV5C 3REJB 4XUJB 1P3FB 1P3AD 3NQUA 2CWEA 5CPKB 5BT1C 1ZLAC 1KX5C 3LJAB 4J8XC 2F8NG 5GXQD 5AV6B 5DNNB 2YFWB 3AZFA 1P3KB 3LZ0C 2FJ7A 3AZGC 3AV2A 3AV1C 3W98A 4R8PC 1TZYA 3AZIA 3B6FD 2PYOD 3MGSC 3X1UC 4YS3B 3REJD 4XUJD 1P3AA 3MGQD 1P3FD 3WKJD 4XZQC 3B0BA 1P34C 4EO5C 5GXQA 2RVQC 3LJAD 3AFAC 1KX4B 3TU4C 1P3LD 1P3KD 4G91B 2AROB 3B6FA 2CV5B 3B6GC 5BO0A 1P3IC 2PYOA 3WKJA 3A6NB 4XUJA 4YS3D 3REJA 3AZLC 1P3FA 5KDMB 5CPKA 1Q9CA 3LJAA 5AV6A 5DNNA 2YFWA 1KX4D 4LD9B 3B0DC 1P3KA 2AROD 5B0ZB 3AZFC 2CV5D 3UTAB 2FJ7C 3AV2C 3W98C 4H9RB 5G49B 1TZYC 3AZIC 1F1EA 4YS3A 3A6ND 2IO5B 1P3GC 5JA4B 1P3AC 4WU9B 4H9OB 1KX4A 4UUZB 4LD9D 4G92C 2AROA 5GXQC 3UTBC 2CV5A 1KX5B 5B0ZD 1ZLAB 3UTAD 3AN2B 4X23B 3A6NA 2PYOC 3AV1B 5KDMA 4H9QB 4J8WB 3WKJC 5AV8B 4XUJC 4KUDD 3MGQC 1P3FC 3MNNB 3C1BB 4LD9A 2BYKB 4Z66B 3LJAC 4KGCB 3V9RB 5BT1D 1P3LC 5B0ZA 1KX5D 1H3OB 3UTAA 1P3KC 3AFAB 3AN2D 4ZBJC 4X23D 4H9RA 5G49A 4KHAB 3AV1D 4Z2MG 5DNMB 4J8WD 4YS3C 4KUDA 5JA4A 5AV8D 4WU9A 3MNND 4H9OA 5GT3B 4UUZA 3C1BD 2HIOC 2NZDB 4Z66D 4KGCD 1U35B 1KX4C 5B31B 1KX5A 2L5AA 4G91C 2AROC 3AN2A 4X23A 3WA9B 3MGPC 2CV5C 3AV1A 4H9QA 1AOID 3KWQB 4J8WA 5DNMD 5AV8A 3MNNA 4E44A 5GT3D 3C1BA 4NE6A 3LELD 2BYKA 4Z66A 3X1VB 1TAFB 4KGCA 2NZDD 3V9RA 1U35D 1P3GB 4LD9C 5B31D 1H3OA 3LZ1B 3VH6A 3WA9D 5B0ZC 4KHAA 3UTAC 3RELB 3UTBB 3VH5W 1AOIA 3KWQD 1M1AC 5DNMA 5B24B 5GT3A 3LELA 3REKB 4KUDC 5B31G 2NZDA 3X1VD 1KX3B 3AYWB 1U35A 1R4VA 3WTPE 1P3GD 5B31A 3MGQB 3NQJB 2BYMA 4J8VB 3LZ1D 3WA9A 1WWIA 3RELD 1M18B 3AN2C 5GT0D 4X23C 3KWQA 3UTBD 1P3BD 1P3LB 3REHB 4ZBJB 5B24D 4J8WC 5AV8C 3REKD 3X1VA 1ULYA 1TAFA 3MNNC 1KX3D 3AYWD 1P3GA 3C1BC 3O62B 4J8VD 4Z66C 3LZ1A 4KGCC 2HIOB 1EQZD 4WU8D 3RELA 1M18D 5GT0A 3UTBA 4CSRB 4H9PB 1F66B 3REHD 5B24A 1AOIC 4CAYB 3MGPB 5DNMC 3REKA 1KX3A 5GT3C 3AYWA 3LELC 3MGQA 3NQJA 3O62D 4J8VA 2NZDC 1WWSA 1U35C 1BH8A 3X1SC 2HIOD 5B31C 1M18A 1P3LA 3WA9C 2LY8A 3REHA 1F66D 1BH9B 3KWQC 3MGPD 1M1AB 5B33D 2YFVB 3O62A 2F8NK 5B2ID 4JJNC 3X1VC 2HIOA 2HUEB 4KUDB 1B6WA 3LZ1C 4CSRA 4H9PA 1F66A 3RELC 3REIB 5GT0C 4CAYA 1P3BC 3MGPA 5B24C 1P3MB 1M1AD 1N1JB 5B33A 3REKC 5B2IA 4QLCB 1KX3C 4WNNB 3AYWC 4J8VC 4Z5TB 1EQZC 4WU8C 3W99B 3VH5T 1BH9A 2NQBB 1M18C 3REID 1P3PB 3MVDB 3AZHB 5B40B 3REHC 1M1AA 5JRGB 1P3MD 2YFVA 1AOIB 4QLCD 3UT9B 3O62C 3LELB 4Z5TD 1ID3B 3W99D 5BS7C 2NQBD 3REIA 3X1SB 1P3PD 3MVDD 2BYMB 3AZHD 5B40D 1F66C 1BFMA 1P3MA 1N1JA 5JRGD 4HGAB 4QLCA 5FUGB 4WNNA 3UT9D 5B33C 5B2IC 4Z5TA 5F99D 5B32B 3W99A 4JJNB 1ID3D 4AWLB 2NQBA 5GSUB 4NE3A 1A7WA 3X1SD 3MVDA 3AZHA 1P3PA 5B40A 5JRGA 5AVCD 5C3IB 5GT0B 3UT9A 1S32B 1P3BB 5F99A 2HUEC 5B32D 1ID3A 2F8NB 4JJND 5GSUD 3X1SA 3AZJB 3REIC 5CPIB 1BH8B 1EQZB 4WU8B 3KUYB 1HQ3B 5AVCA 5CP6C 5FUGA 1S32D 1P3MC 4DRBA 4QLCC 4NE5A 5B2JB 5B32A 4JJNA 5AY8B 2F8ND 5B0YB 3W96B 5GSUA 1JFIB 4Z5TC 3W99C 5CHLB 2F8NH 2NQBC 3AZJD 5CPID 1P3PC 3MVDC 3AZEB 3KSYA 3KUYD 5B40C 3AZHC 4DRAA 1HQ3D 1S32A 1P3BA 5BNXB 5AVBC 5JRGC 3UT9C 5B2JD 2F8NA 5AY8D 5B0YD
chains in the Genus database with same CATH superfamily
4YM6B 2J8PA 5B1LB 5B33B 5F99C 5B2IB 1ID3C 3AZJA 5E5AD 5CPIA 1EQZA 4WU8A 5CPJB 3KUYA 3AZED 1HQ3A 5CPKD 5B1MB 5AVCC 3X1TB 4HGAC 5AV6D 5DNND 5B2JA 3AZMB 5AY8A 3W96A 5B0YA 1KU5A 2G5HC 1JFIA 4YM6D 5B1LD 5B32C 4AWLC 5E5AA 5GSUC 3B0CT 5CPJD 3AZEA 3H0RC 5BS7A 3MGRB 3WAAB 5BNXA 5B1MD 3X1TD 5C3IC 3C1CB 1S32C 1P3OB 3AZMD 2G5IC 3AZNB 5CP6B 4ZUXB 3VH6T 4YM6A 5B1LA 2F2AC 5AV9B 4H9NB 5CPJA 3MGRD 3AZJC 3WAAD 3KXBB 5CPIC 3WTPB 3AZKB 4H9SA 3W97B 3KUYC 1M19B 4J8UB 1HQ3C 5B1MA 3X1TA 2Y2MA 2ZY2A 3C1CD 5AV5B 5BNVB 3AZMA 1P3OD 3AZND 5CP6D 4ZUXD 5AVBB 5B2JC 4J8XB 5AY8C 3R45B 3W96C 5B0YC 5AV9D 4WJ3C 3B6FC 3LZ0B 3AZGB 3MGRA 1HTAA 3WAAA 1B67A 5E5AC 5F99B 4R8PB 3KXBD 3WTPD 3REJC 3AZEC 3AZKD 3W97D 3MGSB 1M19D 2RIQA 4J8UD 3W96D 4WU9D 3EPLA 5CPKC 3C1CA 3X1UB 5AV5D 1P3OA 2XD5A 3AZNA 3B0CW 5CP6A 4ZUXA 4WV4B 4XZQB 5DNNC 5AV6C 1P34B 4Z2MH 4EO5B 5AVBD 1ZLAD 5AVCB 4J8XD 5AV9A 3TU4B 4H9NA 4YM6C 5B1LC 3LZ0D 3AZGD 3KXBA 4R8PD 3B6GB 3WTPA 3AZKA 3W97A 5CPJC 3VH6W 1P3IB 1M19A 4J8UA 3MGSD 4WZSB 5AV5A 5BNVA 3X1UD 4H9SC 3AZLB 5B1MC 3X1TC 3EG5B 4XZQD 5AVBA 1P34D 3AZMC 1ZLAA 4J8XA 3NQUB 2RVQD 2Y2QA 3R45A 3AFAD 2Y2IA 3TU4D 4E45A 3B0DB 3LZ0A 3AZGA 4NFTA 4R8PA 3AZFB 3B6GD 2FJ7B 3A6NC 1P3ID 3MGSA 3WAAC 3MGRC 3AV2B 3W98B 1W2EA 1TZYB 3AZIB 3X1UA 3AZLD 4XZQA 3C1CC 1P34A 1P3AB 1P3OC 3AZNC 3AFAA 4ZUXC 3TU4A 5B32G 4G92B 5GXQB 5AV9C 2JSSA 3B6GA 4M6BA 3AZFD 1P3IA 2FJ7D 2IO5C 3AV2D 3W98D 3KXBC 3AZID 1TZYD 3B6FB 3WTPC 3VH5A 5BO0B 3AZKC 3AZLA 1M19C 2PYOB 4J8UC 3W97C 5E5AB 4WU9C 3WKJB 5AV5C 3REJB 4XUJB 1P3FB 1P3AD 3NQUA 2CWEA 5CPKB 5BT1C 1ZLAC 1KX5C 3LJAB 4J8XC 2F8NG 5GXQD 5AV6B 5DNNB 2YFWB 3AZFA 1P3KB 3LZ0C 2FJ7A 3AZGC 3AV2A 3AV1C 2Y2GA 3W98A 4R8PC 1TZYA 3AZIA 3B6FD 2PYOD 3MGSC 3X1UC 4YS3B 3REJD 4XUJD 1P3AA 3MGQD 1P3FD 3WKJD 4XZQC 3B0BA 1P34C 4EO5C 5GXQA 2RVQC 3LJAD 3AFAC 1PZRA 1KX4B 3TU4C 1P3LD 1P3KD 4G91B 2AROB 3B6FA 2CV5B 3B6GC 5BO0A 1P3IC 2PYOA 3WKJA 3A6NB 4XUJA 4YS3D 3REJA 3AZLC 1P3FA 5KDMB 5CPKA 3H0MC 1Q9CA 3EPHA 3LJAA 5AV6A 5DNNA 2YFWA 1KX4D 4LD9B 3B0DC 1P3KA 3EPJA 3EPKA 2AROD 5B0ZB 3AZFC 2CV5D 3UTAB 2FJ7C 3A1IA 3AV2C 3W98C 4H9RB 5G49B 1TZYC 3AZIC 1F1EA 4YS3A 3A6ND 2IO5B 1P3GC 5JA4B 1P3AC 3KFUG 4WU9B 4H9OB 1KX4A 4UUZB 4LD9D 4G92C 2AROA 5GXQC 3UTBC 2Y2KA 2JCHA 2CV5A 5B0ZD 1KX5B 1ZLAB 3AL0C 3UTAD 3AN2B 4X23B 3A6NA 2PYOC 3AV1B 5KDMA 4H9QB 4J8WB 3WKJC 2Y2NA 5AV8B 4XUJC 3MGQC 1P3FC 4KUDD 3MNNB 2ZM5A 3C1BB 4LD9A 2BYKB 4Z66B 3LJAC 4KGCB 3V9RB 5BT1D 2Y2PA 1P3LC 5B0ZA 1KX5D 1H3OB 3UTAA 1P3KC 3AFAB 3AN2D 4ZBJC 4X23D 4H9RA 5G49A 4KHAB 2DQNC 3AV1D 4Z2MG 5DNMB 4J8WD 4YS3C 4KUDA 5JA4A 5AV8D 4WU9A 3MNND 4H9OA 5GT3B 2FFFB 4UUZA 3C1BD 2HIOC 2NZDB 4Z66D 4KGCD 1U35B 1KX4C 5B31B 1KX5A 2L5AA 2ZY3A 4G91C 2AROC 3AN2A 4X23A 3WA9B 3MGPC 2CV5C 3AV1A 4H9QA 1AOID 3KWQB 4J8WA 5DNMD 5AV8A 3MNNA 4E44A 5GT3D 3FDDA 3C1BA 4NE6A 3LELD 2BYKA 4Z66A 3X1VB 1TAFB 4KGCA 2NZDD 3V9RA 1U35D 1P3GB 4LD9C 5B31D 1H3OA 3LZ1B 3VH6A 3WA9D 3P5JB 4KHAA 5B0ZC 3UTAC 3RELB 3UTBB 3VH5W 1AOIA 3KWQD 1M1AC 5DNMA 5B24B 5GT3A 3LELA 3REKB 4KUDC 5B31G 2NZDA 3X1VD 1KX3B 2BG1A 3AYWB 1U35A 1R4VA 2Y2HA 3WTPE 1P3GD 5B31A 3MGQB 3NQJB 2BYMA 4J8VB 3LZ1D 3WA9A 2Y2JA 1WWIA 3RELD 1M18B 3AN2C 5GT0D 4X23C 3KWQA 3UTBD 1P3BD 1P3LB 3REHB 4ZBJB 5B24D 4J8WC 5AV8C 3REKD 2Y2OA 1ULYA 1TAFA 3MNNC 3X1VA 1KX3D 3AYWD 1P3GA 1Z2CB 3C1BC 3O62B 4J8VD 4Z66C 3LZ1A 4KGCC 2DF4C 2HIOB 1EQZD 4WU8D 3RELA 2W8SA 1M18D 5GT0A 3UTBA 4CSRB 4H9PB 1F66B 3REHD 5B24A 1AOIC 4CAYB 3MGPB 5DNMC 3REKA 4UPKA 1KX3A 5GT3C 3AYWA 3LELC 3MGQA 3H0LC 3NQJA 3O62D 4J8VA 2NZDC 1WWSA 1U35C 1BH8A 3X1SC 2HIOD 5B31C 2JE5A 1M18A 1P3LA 3WA9C 2LY8A 3REHA 1F66D 1BH9B 3KWQC 3MGPD 1M1AB 5B33D 2YFVB 3O62A 2F8NK 5B2ID 4JJNC 3X1VC 4DQYB 2HIOA 2HUEB 4KUDB 1B6WA 3LZ1C 4CSRA 4H9PA 1F66A 3RELC 3REIB 2XD1A 5GT0C 4CAYA 1P3BC 3MGPA 2UWXA 2Y2LA 5B24C 1P3MB 1M1AD 1N1JB 5B33A 3REKC 5B2IA 4QLCB 1KX3C 4WNNB 3AYWC 4J8VC 4Z5TB 1EQZC 4WU8C 3W99B 3VH5T 1BH9A 2NQBB 1M18C 3REID 1P3PB 3MVDB 3AZHB 5B40B 3REHC 1M1AA 5JRGB 1P3MD 2YFVA 1AOIB 4QLCD 3UT9B 3O62C 1T3UA 3LELB 4Z5TD 1ID3B 3W99D 5BS7C 2NQBD 3A1KA 3REIA 2VQRA 3X1SB 1P3PD 3MVDD 2BYMB 3AZHD 5B40D 1F66C 1BFMA 1P3MA 1N1JA 5JRGD 4HGAB 4QLCA 2ZY5A 5FUGB 4WNNA 3UT9D 5B33C 5B2IC 4Z5TA 5F99D 5B32B 3W99A 4JJNB 1ID3D 4AWLB 2NQBA 5GSUB 4NE3A 1A7WA 3X1SD 3MVDA 3AZHA 1P3PA 5B40A 5JRGA 5AVCD 5C3IB 5GT0B 3F6TA 3UT9A 1S32B 1P3BB 5F99A 2HUEC 5B32D 1ID3A 2F8NB 4JJND 5GSUD 3X1SA 3AZJB 3REIC 5CPIB 1BH8B 1EQZB 4WU8B 3KUYB 1HQ3B 5AVCA 5CP6C 5FUGA 1S32D 1P3MC 4DRBA 4QLCC 4NE5A 5B2JB 5B32A 4JJNA 5AY8B 2F8ND 5B0YB 3W96B 5GSUA 1JFIB 4Z5TC 2ZY4A 3W99C 5CHLB 2F8NH 2NQBC 3AZJD 5CPID 1P3PC 3MVDC 3AZEB 3KSYA 3KUYD 5B40C 3AZHC 4DRAA 1HQ3D 1S32A 1P3BA 5BNXB 5AVBC 5JRGC 3UT9C 5B2JD 2F8NA 3IP4C 5AY8D 5B0YD
chains in the Genus database with same CATH topology
4YM6B 2J8PA 5B1LB 5B33B 5F99C 5B2IB 1ID3C 3AZJA 5E5AD 5CPIA 1EQZA 4WU8A 5CPJB 3KUYA 3AZED 1HQ3A 5CPKD 5B1MB 5AVCC 3X1TB 4HGAC 5AV6D 5DNND 5B2JA 3AZMB 5AY8A 3W96A 5B0YA 1KU5A 2G5HC 1JFIA 4YM6D 5B1LD 5B32C 4AWLC 5E5AA 5GSUC 3B0CT 5CPJD 3AZEA 3H0RC 5BS7A 3MGRB 3WAAB 5BNXA 5B1MD 3X1TD 5C3IC 3C1CB 1S32C 1P3OB 3AZMD 2G5IC 3AZNB 5CP6B 4ZUXB 3VH6T 4YM6A 5B1LA 2F2AC 5AV9B 4H9NB 5CPJA 3MGRD 3AZJC 3WAAD 3KXBB 5CPIC 3WTPB 3AZKB 4H9SA 3W97B 3KUYC 1M19B 4J8UB 1HQ3C 5B1MA 3X1TA 2Y2MA 2ZY2A 3C1CD 5AV5B 5BNVB 3AZMA 1P3OD 3AZND 5CP6D 4ZUXD 5AVBB 5B2JC 4J8XB 5AY8C 3R45B 3W96C 5B0YC 5AV9D 4WJ3C 3B6FC 3LZ0B 3AZGB 3MGRA 1HTAA 3WAAA 1B67A 5E5AC 5F99B 4R8PB 3KXBD 3WTPD 3REJC 3AZEC 3AZKD 3W97D 3MGSB 1M19D 2RIQA 4J8UD 3W96D 4WU9D 3EPLA 5CPKC 3C1CA 3X1UB 5AV5D 1P3OA 2XD5A 3AZNA 3B0CW 5CP6A 4ZUXA 4WV4B 4XZQB 5DNNC 5AV6C 1P34B 4Z2MH 4EO5B 5AVBD 1ZLAD 5AVCB 4J8XD 5AV9A 3TU4B 4H9NA 4YM6C 5B1LC 3LZ0D 3AZGD 3KXBA 4R8PD 3B6GB 3WTPA 3AZKA 3W97A 5CPJC 3VH6W 1P3IB 1M19A 4J8UA 3MGSD 4WZSB 5AV5A 5BNVA 3X1UD 4H9SC 3AZLB 5B1MC 3X1TC 3EG5B 4XZQD 5AVBA 1P34D 3AZMC 1ZLAA 4J8XA 3NQUB 2RVQD 2Y2QA 3R45A 3AFAD 2Y2IA 3TU4D 4E45A 3B0DB 3LZ0A 3AZGA 4NFTA 4R8PA 3AZFB 3B6GD 2FJ7B 3A6NC 1P3ID 3MGSA 3WAAC 3MGRC 3AV2B 3W98B 1W2EA 1TZYB 3AZIB 3X1UA 3AZLD 4XZQA 3C1CC 1P34A 1P3AB 1P3OC 3AZNC 3AFAA 4ZUXC 3TU4A 5B32G 4G92B 5GXQB 5AV9C 2JSSA 3B6GA 4M6BA 3AZFD 1P3IA 2FJ7D 2IO5C 3AV2D 3W98D 3KXBC 3AZID 1TZYD 3B6FB 3WTPC 3VH5A 5BO0B 3AZKC 3AZLA 1M19C 2PYOB 4J8UC 3W97C 5E5AB 4WU9C 3WKJB 5AV5C 3REJB 4XUJB 1P3FB 1P3AD 3NQUA 2CWEA 5CPKB 5BT1C 1ZLAC 1KX5C 3LJAB 4J8XC 2F8NG 5GXQD 5AV6B 5DNNB 2YFWB 3AZFA 1P3KB 3LZ0C 2FJ7A 3AZGC 3AV2A 3AV1C 2Y2GA 3W98A 4R8PC 1TZYA 3AZIA 3B6FD 2PYOD 3MGSC 3X1UC 4YS3B 3REJD 4XUJD 1P3AA 3MGQD 1P3FD 3WKJD 4XZQC 3B0BA 1P34C 4EO5C 5GXQA 2RVQC 3LJAD 3AFAC 1PZRA 1KX4B 3TU4C 1P3LD 1P3KD 4G91B 2AROB 3B6FA 2CV5B 3B6GC 5BO0A 1P3IC 2PYOA 3WKJA 3A6NB 4XUJA 4YS3D 3REJA 3AZLC 1P3FA 5KDMB 5CPKA 3H0MC 1Q9CA 3EPHA 3LJAA 5AV6A 5DNNA 2YFWA 1KX4D 4LD9B 3B0DC 1P3KA 3EPJA 3EPKA 2AROD 5B0ZB 3AZFC 2CV5D 3UTAB 2FJ7C 3A1IA 3AV2C 3W98C 4H9RB 5G49B 1TZYC 3AZIC 1F1EA 4YS3A 3A6ND 2IO5B 1P3GC 5JA4B 1P3AC 3KFUG 4WU9B 4H9OB 1KX4A 4UUZB 4LD9D 4G92C 2AROA 5GXQC 3UTBC 2Y2KA 2JCHA 2CV5A 5B0ZD 1KX5B 1ZLAB 3AL0C 3UTAD 3AN2B 4X23B 3A6NA 2PYOC 3AV1B 5KDMA 4H9QB 4J8WB 3WKJC 2Y2NA 5AV8B 4XUJC 3MGQC 1P3FC 4KUDD 3MNNB 2ZM5A 3C1BB 4LD9A 2BYKB 4Z66B 3LJAC 4KGCB 3V9RB 5BT1D 2Y2PA 1P3LC 5B0ZA 1KX5D 1H3OB 3UTAA 1P3KC 3AFAB 3AN2D 4ZBJC 4X23D 4H9RA 5G49A 4KHAB 2DQNC 3AV1D 4Z2MG 5DNMB 4J8WD 4YS3C 4KUDA 5JA4A 5AV8D 4WU9A 3MNND 4H9OA 5GT3B 2FFFB 4UUZA 3C1BD 2HIOC 2NZDB 4Z66D 4KGCD 1U35B 1KX4C 5B31B 1KX5A 2L5AA 2ZY3A 4G91C 2AROC 3AN2A 4X23A 3WA9B 3MGPC 2CV5C 3AV1A 4H9QA 1AOID 3KWQB 4J8WA 5DNMD 5AV8A 3MNNA 4E44A 5GT3D 3FDDA 3C1BA 4NE6A 3LELD 2BYKA 4Z66A 3X1VB 1TAFB 4KGCA 2NZDD 3V9RA 1U35D 1P3GB 4LD9C 5B31D 1H3OA 3LZ1B 3VH6A 3WA9D 3P5JB 4KHAA 5B0ZC 3UTAC 3RELB 3UTBB 3VH5W 1AOIA 3KWQD 1M1AC 5DNMA 5B24B 5GT3A 3LELA 3REKB 4KUDC 5B31G 2NZDA 3X1VD 1KX3B 2BG1A 3AYWB 1U35A 1R4VA 2Y2HA 3WTPE 1P3GD 5B31A 3MGQB 3NQJB 2BYMA 4J8VB 3LZ1D 3WA9A 2Y2JA 1WWIA 3RELD 1M18B 3AN2C 5GT0D 4X23C 3KWQA 3UTBD 1P3BD 1P3LB 3REHB 4ZBJB 5B24D 4J8WC 5AV8C 3REKD 2Y2OA 1ULYA 1TAFA 3MNNC 3X1VA 1KX3D 3AYWD 1P3GA 1Z2CB 3C1BC 3O62B 4J8VD 4Z66C 3LZ1A 4KGCC 2DF4C 2HIOB 1EQZD 4WU8D 3RELA 2W8SA 1M18D 5GT0A 3UTBA 4CSRB 4H9PB 1F66B 3REHD 5B24A 1AOIC 4CAYB 3MGPB 5DNMC 3REKA 4UPKA 1KX3A 5GT3C 3AYWA 3LELC 3MGQA 3H0LC 3NQJA 3O62D 4J8VA 2NZDC 1WWSA 1U35C 1BH8A 3X1SC 2HIOD 5B31C 2JE5A 1M18A 1P3LA 3WA9C 2LY8A 3REHA 1F66D 1BH9B 3KWQC 3MGPD 1M1AB 5B33D 2YFVB 3O62A 2F8NK 5B2ID 4JJNC 3X1VC 4DQYB 2HIOA 2HUEB 4KUDB 1B6WA 3LZ1C 4CSRA 4H9PA 1F66A 3RELC 3REIB 2XD1A 5GT0C 4CAYA 1P3BC 3MGPA 2UWXA 2Y2LA 5B24C 1P3MB 1M1AD 1N1JB 5B33A 3REKC 5B2IA 4QLCB 1KX3C 4WNNB 3AYWC 4J8VC 4Z5TB 1EQZC 4WU8C 3W99B 3VH5T 1BH9A 2NQBB 1M18C 3REID 1P3PB 3MVDB 3AZHB 5B40B 3REHC 1M1AA 5JRGB 1P3MD 2YFVA 1AOIB 4QLCD 3UT9B 3O62C 1T3UA 3LELB 4Z5TD 1ID3B 3W99D 5BS7C 2NQBD 3A1KA 3REIA 2VQRA 3X1SB 1P3PD 3MVDD 2BYMB 3AZHD 5B40D 1F66C 1BFMA 1P3MA 1N1JA 5JRGD 4HGAB 4QLCA 2ZY5A 5FUGB 4WNNA 3UT9D 5B33C 5B2IC 4Z5TA 5F99D 5B32B 3W99A 4JJNB 1ID3D 4AWLB 2NQBA 5GSUB 4NE3A 1A7WA 3X1SD 3MVDA 3AZHA 1P3PA 5B40A 5JRGA 5AVCD 5C3IB 5GT0B 3F6TA 3UT9A 1S32B 1P3BB 5F99A 2HUEC 5B32D 1ID3A 2F8NB 4JJND 5GSUD 3X1SA 3AZJB 3REIC 5CPIB 1BH8B 1EQZB 4WU8B 3KUYB 1HQ3B 5AVCA 5CP6C 5FUGA 1S32D 1P3MC 4DRBA 4QLCC 4NE5A 5B2JB 5B32A 4JJNA 5AY8B 2F8ND 5B0YB 3W96B 5GSUA 1JFIB 4Z5TC 2ZY4A 3W99C 5CHLB 2F8NH 2NQBC 3AZJD 5CPID 1P3PC 3MVDC 3AZEB 3KSYA 3KUYD 5B40C 3AZHC 4DRAA 1HQ3D 1S32A 1P3BA 5BNXB 5AVBC 5JRGC 3UT9C 5B2JD 2F8NA 3IP4C 5AY8D 5B0YD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YM6 B;  5B33 B;  5B1L B;  5F99 C;  5B2I B;  1ID3 C;  3AZJ A;  5E5A D;  5CPI A;  1EQZ A;  4WU8 A;  5CPJ B;  3KUY A;  3AZE D;  1HQ3 A;  5CPK D;  5B1M B;  5AVC C;  3X1T B;  4HGA C;  5AV6 D;  5DNN D;  5B2J A;  3AZM B;  5AY8 A;  3W96 A;  5B0Y A;  1KU5 A;  1JFI A;  4YM6 D;  5B1L D;  5B32 C;  4AWL C;  5E5A A;  5GSU C;  3B0C T;  5CPJ D;  3AZE A;  5BS7 A;  3MGR B;  3WAA B;  5BNX A;  5B1M D;  3X1T D;  5C3I C;  3C1C B;  1S32 C;  1P3O B;  3AZM D;  3AZN B;  5CP6 B;  4ZUX B;  3VH6 T;  4YM6 A;  5B1L A;  5AV9 B;  4H9N B;  5CPJ A;  3MGR D;  3AZJ C;  3WAA D;  3KXB B;  5CPI C;  3WTP B;  3AZK B;  4H9S A;  3W97 B;  3KUY C;  1M19 B;  4J8U B;  1HQ3 C;  5B1M A;  3X1T A;  3C1C D;  5AV5 B;  5BNV B;  3AZM A;  1P3O D;  3AZN D;  5CP6 D;  4ZUX D;  5AVB B;  5B2J C;  4J8X B;  5AY8 C;  3R45 B;  3W96 C;  5B0Y C;  5AV9 D;  3B6F C;  3LZ0 B;  3AZG B;  3MGR A;  1HTA A;  3WAA A;  1B67 A;  5E5A C;  5F99 B;  4R8P B;  3KXB D;  3WTP D;  3REJ C;  3AZE C;  3AZK D;  3W97 D;  3MGS B;  1M19 D;  4J8U D;  3W96 D;  4WU9 D;  5CPK C;  3C1C A;  3X1U B;  5AV5 D;  1P3O A;  3AZN A;  3B0C W;  5CP6 A;  4ZUX A;  4WV4 B;  4XZQ B;  5DNN C;  5AV6 C;  1P34 B;  4Z2M H;  4EO5 B;  5AVB D;  1ZLA D;  5AVC B;  4J8X D;  5AV9 A;  3TU4 B;  4H9N A;  4YM6 C;  5B1L C;  3LZ0 D;  3AZG D;  3KXB A;  4R8P D;  3B6G B;  3WTP A;  3AZK A;  3W97 A;  5CPJ C;  3VH6 W;  1P3I B;  1M19 A;  4J8U A;  3MGS D;  4WZS B;  5AV5 A;  5BNV A;  3X1U D;  4H9S C;  3AZL B;  5B1M C;  3X1T C;  4XZQ D;  5AVB A;  1P34 D;  3AZM C;  1ZLA A;  4J8X A;  3NQU B;  2RVQ D;  3R45 A;  3AFA D;  3TU4 D;  4E45 A;  3B0D B;  3LZ0 A;  3AZG A;  4NFT A;  4R8P A;  3AZF B;  3B6G D;  2FJ7 B;  3A6N C;  1P3I D;  3MGS A;  3WAA C;  3MGR C;  3AV2 B;  3W98 B;  3AZI B;  1TZY B;  3X1U A;  3AZL D;  4XZQ A;  3C1C C;  1P34 A;  1P3A B;  1P3O C;  3AZN C;  3AFA A;  4ZUX C;  3TU4 A;  5B32 G;  4G92 B;  5GXQ B;  5AV9 C;  2JSS A;  3B6G A;  4M6B A;  3AZF D;  1P3I A;  2FJ7 D;  2IO5 C;  3AV2 D;  3W98 D;  3KXB C;  3AZI D;  1TZY D;  3B6F B;  3WTP C;  3VH5 A;  5BO0 B;  3AZK C;  3AZL A;  1M19 C;  2PYO B;  4J8U C;  3W97 C;  5E5A B;  4WU9 C;  3WKJ B;  5AV5 C;  3REJ B;  4XUJ B;  1P3F B;  1P3A D;  3NQU A;  2CWE A;  5CPK B;  5BT1 C;  1ZLA C;  1KX5 C;  3LJA B;  4J8X C;  2F8N G;  5GXQ D;  5AV6 B;  5DNN B;  2YFW B;  3AZF A;  1P3K B;  3LZ0 C;  2FJ7 A;  3AZG C;  3AV2 A;  3AV1 C;  3W98 A;  4R8P C;  1TZY A;  3AZI A;  3B6F D;  2PYO D;  3MGS C;  3X1U C;  4YS3 B;  3REJ D;  4XUJ D;  1P3A A;  3MGQ D;  1P3F D;  3WKJ D;  4XZQ C;  3B0B A;  1P34 C;  4EO5 C;  5GXQ A;  2RVQ C;  3LJA D;  3AFA C;  1KX4 B;  3TU4 C;  1P3L D;  1P3K D;  4G91 B;  2ARO B;  3B6F A;  2CV5 B;  3B6G C;  5BO0 A;  1P3I C;  2PYO A;  3WKJ A;  3A6N B;  4XUJ A;  4YS3 D;  3REJ A;  3AZL C;  1P3F A;  5KDM B;  5CPK A;  1Q9C A;  3LJA A;  5AV6 A;  5DNN A;  2YFW A;  1KX4 D;  4LD9 B;  3B0D C;  1P3K A;  2ARO D;  5B0Z B;  3AZF C;  2CV5 D;  3UTA B;  2FJ7 C;  3AV2 C;  3W98 C;  4H9R B;  5G49 B;  1TZY C;  3AZI C;  1F1E A;  4YS3 A;  3A6N D;  2IO5 B;  1P3G C;  5JA4 B;  1P3A C;  4WU9 B;  4H9O B;  1KX4 A;  4UUZ B;  4LD9 D;  4G92 C;  2ARO A;  5GXQ C;  3UTB C;  2CV5 A;  1KX5 B;  5B0Z D;  1ZLA B;  3UTA D;  3AN2 B;  4X23 B;  3A6N A;  2PYO C;  3AV1 B;  5KDM A;  4H9Q B;  4J8W B;  3WKJ C;  5AV8 B;  4XUJ C;  4KUD D;  3MGQ C;  1P3F C;  3MNN B;  3C1B B;  4LD9 A;  2BYK B;  4Z66 B;  3LJA C;  4KGC B;  3V9R B;  5BT1 D;  1P3L C;  5B0Z A;  1KX5 D;  1H3O B;  3UTA A;  1P3K C;  3AFA B;  3AN2 D;  4ZBJ C;  4X23 D;  4H9R A;  5G49 A;  4KHA B;  3AV1 D;  4Z2M G;  5DNM B;  4J8W D;  4YS3 C;  4KUD A;  5JA4 A;  5AV8 D;  4WU9 A;  3MNN D;  4H9O A;  5GT3 B;  4UUZ A;  3C1B D;  2HIO C;  2NZD B;  4Z66 D;  4KGC D;  1U35 B;  1KX4 C;  5B31 B;  1KX5 A;  2L5A A;  4G91 C;  2ARO C;  3AN2 A;  4X23 A;  3WA9 B;  3MGP C;  2CV5 C;  3AV1 A;  4H9Q A;  1AOI D;  3KWQ B;  4J8W A;  5DNM D;  5AV8 A;  3MNN A;  4E44 A;  5GT3 D;  3C1B A;  4NE6 A;  3LEL D;  2BYK A;  4Z66 A;  3X1V B;  1TAF B;  4KGC A;  2NZD D;  3V9R A;  1U35 D;  1P3G B;  4LD9 C;  5B31 D;  1H3O A;  3LZ1 B;  3VH6 A;  3WA9 D;  5B0Z C;  4KHA A;  3UTA C;  3REL B;  3UTB B;  3VH5 W;  1AOI A;  3KWQ D;  1M1A C;  5DNM A;  5B24 B;  5GT3 A;  3LEL A;  3REK B;  4KUD C;  5B31 G;  2NZD A;  3X1V D;  1KX3 B;  3AYW B;  1U35 A;  1R4V A;  3WTP E;  1P3G D;  5B31 A;  3MGQ B;  3NQJ B;  2BYM A;  4J8V B;  3LZ1 D;  3WA9 A;  1WWI A;  3REL D;  1M18 B;  3AN2 C;  5GT0 D;  4X23 C;  3KWQ A;  3UTB D;  1P3B D;  1P3L B;  3REH B;  4ZBJ B;  5B24 D;  4J8W C;  5AV8 C;  3REK D;  3X1V A;  1ULY A;  1TAF A;  3MNN C;  1KX3 D;  3AYW D;  1P3G A;  3C1B C;  3O62 B;  4J8V D;  4Z66 C;  3LZ1 A;  4KGC C;  2HIO B;  1EQZ D;  4WU8 D;  3REL A;  1M18 D;  5GT0 A;  3UTB A;  4CSR B;  4H9P B;  1F66 B;  3REH D;  5B24 A;  1AOI C;  4CAY B;  3MGP B;  5DNM C;  3REK A;  1KX3 A;  5GT3 C;  3AYW A;  3LEL C;  3MGQ A;  3NQJ A;  3O62 D;  4J8V A;  2NZD C;  1WWS A;  1U35 C;  1BH8 A;  3X1S C;  2HIO D;  5B31 C;  1M18 A;  1P3L A;  3WA9 C;  2LY8 A;  3REH A;  1F66 D;  1BH9 B;  3KWQ C;  3MGP D;  1M1A B;  5B33 D;  2YFV B;  3O62 A;  2F8N K;  5B2I D;  4JJN C;  3X1V C;  2HIO A;  2HUE B;  4KUD B;  1B6W A;  3LZ1 C;  4CSR A;  4H9P A;  1F66 A;  3REL C;  3REI B;  5GT0 C;  4CAY A;  1P3B C;  3MGP A;  5B24 C;  1P3M B;  1M1A D;  1N1J B;  5B33 A;  3REK C;  5B2I A;  4QLC B;  1KX3 C;  4WNN B;  3AYW C;  4J8V C;  4Z5T B;  1EQZ C;  4WU8 C;  3W99 B;  3VH5 T;  1BH9 A;  2NQB B;  1M18 C;  3REI D;  1P3P B;  3MVD B;  3AZH B;  5B40 B;  3REH C;  1M1A A;  5JRG B;  1P3M D;  2YFV A;  1AOI B;  4QLC D;  3UT9 B;  3O62 C;  3LEL B;  4Z5T D;  1ID3 B;  3W99 D;  5BS7 C;  2NQB D;  3REI A;  3X1S B;  1P3P D;  3MVD D;  2BYM B;  3AZH D;  5B40 D;  1F66 C;  1BFM A;  1P3M A;  1N1J A;  5JRG D;  4HGA B;  4QLC A;  5FUG B;  4WNN A;  3UT9 D;  5B33 C;  5B2I C;  4Z5T A;  5F99 D;  5B32 B;  3W99 A;  4JJN B;  1ID3 D;  4AWL B;  2NQB A;  5GSU B;  4NE3 A;  1A7W A;  3X1S D;  3MVD A;  3AZH A;  1P3P A;  5B40 A;  5JRG A;  5AVC D;  5C3I B;  5GT0 B;  3UT9 A;  1S32 B;  1P3B B;  5F99 A;  2HUE C;  5B32 D;  1ID3 A;  2F8N B;  4JJN D;  5GSU D;  3X1S A;  3AZJ B;  3REI C;  5CPI B;  1BH8 B;  1EQZ B;  4WU8 B;  3KUY B;  1HQ3 B;  5AVC A;  5CP6 C;  5FUG A;  1S32 D;  1P3M C;  4DRB A;  4QLC C;  4NE5 A;  5B2J B;  5B32 A;  4JJN A;  5AY8 B;  2F8N D;  5B0Y B;  3W96 B;  5GSU A;  1JFI B;  4Z5T C;  3W99 C;  5CHL B;  2F8N H;  2NQB C;  3AZJ D;  5CPI D;  1P3P C;  3MVD C;  3AZE B;  3KSY A;  3KUY D;  5B40 C;  3AZH C;  4DRA A;  1HQ3 D;  1S32 A;  1P3B A;  5BNX B;  5AVB C;  5JRG C;  3UT9 C;  5B2J D;  2F8N A;  5AY8 D;  5B0Y D; 
#chains in the Genus database with same CATH topology
 4YM6 B;  2J8P A;  5B1L B;  5B33 B;  5F99 C;  5B2I B;  1ID3 C;  3AZJ A;  5E5A D;  5CPI A;  1EQZ A;  4WU8 A;  5CPJ B;  3KUY A;  3AZE D;  1HQ3 A;  5CPK D;  5B1M B;  5AVC C;  3X1T B;  4HGA C;  5AV6 D;  5DNN D;  5B2J A;  3AZM B;  5AY8 A;  3W96 A;  5B0Y A;  1KU5 A;  2G5H C;  1JFI A;  4YM6 D;  5B1L D;  5B32 C;  4AWL C;  5E5A A;  5GSU C;  3B0C T;  5CPJ D;  3AZE A;  3H0R C;  5BS7 A;  3MGR B;  3WAA B;  5BNX A;  5B1M D;  3X1T D;  5C3I C;  3C1C B;  1S32 C;  1P3O B;  3AZM D;  2G5I C;  3AZN B;  5CP6 B;  4ZUX B;  3VH6 T;  4YM6 A;  5B1L A;  2F2A C;  5AV9 B;  4H9N B;  5CPJ A;  3MGR D;  3AZJ C;  3WAA D;  3KXB B;  5CPI C;  3WTP B;  3AZK B;  4H9S A;  3W97 B;  3KUY C;  1M19 B;  4J8U B;  1HQ3 C;  5B1M A;  3X1T A;  2Y2M A;  2ZY2 A;  3C1C D;  5AV5 B;  5BNV B;  3AZM A;  1P3O D;  3AZN D;  5CP6 D;  4ZUX D;  5AVB B;  5B2J C;  4J8X B;  5AY8 C;  3R45 B;  3W96 C;  5B0Y C;  5AV9 D;  4WJ3 C;  3B6F C;  3LZ0 B;  3AZG B;  3MGR A;  1HTA A;  3WAA A;  1B67 A;  5E5A C;  5F99 B;  4R8P B;  3KXB D;  3WTP D;  3REJ C;  3AZE C;  3AZK D;  3W97 D;  3MGS B;  1M19 D;  2RIQ A;  4J8U D;  3W96 D;  4WU9 D;  3EPL A;  5CPK C;  3C1C A;  3X1U B;  5AV5 D;  1P3O A;  2XD5 A;  3AZN A;  3B0C W;  5CP6 A;  4ZUX A;  4WV4 B;  4XZQ B;  5DNN C;  5AV6 C;  1P34 B;  4Z2M H;  4EO5 B;  5AVB D;  1ZLA D;  5AVC B;  4J8X D;  5AV9 A;  3TU4 B;  4H9N A;  4YM6 C;  5B1L C;  3LZ0 D;  3AZG D;  3KXB A;  4R8P D;  3B6G B;  3WTP A;  3AZK A;  3W97 A;  5CPJ C;  3VH6 W;  1P3I B;  1M19 A;  4J8U A;  3MGS D;  4WZS B;  5AV5 A;  5BNV A;  3X1U D;  4H9S C;  3AZL B;  5B1M C;  3X1T C;  3EG5 B;  4XZQ D;  5AVB A;  1P34 D;  3AZM C;  1ZLA A;  4J8X A;  3NQU B;  2RVQ D;  2Y2Q A;  3R45 A;  3AFA D;  2Y2I A;  3TU4 D;  4E45 A;  3B0D B;  3LZ0 A;  3AZG A;  4NFT A;  4R8P A;  3AZF B;  3B6G D;  2FJ7 B;  3A6N C;  1P3I D;  3MGS A;  3WAA C;  3MGR C;  3AV2 B;  3W98 B;  1W2E A;  1TZY B;  3AZI B;  3X1U A;  3AZL D;  4XZQ A;  3C1C C;  1P34 A;  1P3A B;  1P3O C;  3AZN C;  3AFA A;  4ZUX C;  3TU4 A;  5B32 G;  4G92 B;  5GXQ B;  5AV9 C;  2JSS A;  3B6G A;  4M6B A;  3AZF D;  1P3I A;  2FJ7 D;  2IO5 C;  3AV2 D;  3W98 D;  3KXB C;  3AZI D;  1TZY D;  3B6F B;  3WTP C;  3VH5 A;  5BO0 B;  3AZK C;  3AZL A;  1M19 C;  2PYO B;  4J8U C;  3W97 C;  5E5A B;  4WU9 C;  3WKJ B;  5AV5 C;  3REJ B;  4XUJ B;  1P3F B;  1P3A D;  3NQU A;  2CWE A;  5CPK B;  5BT1 C;  1ZLA C;  1KX5 C;  3LJA B;  4J8X C;  2F8N G;  5GXQ D;  5AV6 B;  5DNN B;  2YFW B;  3AZF A;  1P3K B;  3LZ0 C;  2FJ7 A;  3AZG C;  3AV2 A;  3AV1 C;  2Y2G A;  3W98 A;  4R8P C;  1TZY A;  3AZI A;  3B6F D;  2PYO D;  3MGS C;  3X1U C;  4YS3 B;  3REJ D;  4XUJ D;  1P3A A;  3MGQ D;  1P3F D;  3WKJ D;  4XZQ C;  3B0B A;  1P34 C;  4EO5 C;  5GXQ A;  2RVQ C;  3LJA D;  3AFA C;  1PZR A;  1KX4 B;  3TU4 C;  1P3L D;  1P3K D;  4G91 B;  2ARO B;  3B6F A;  2CV5 B;  3B6G C;  5BO0 A;  1P3I C;  2PYO A;  3WKJ A;  3A6N B;  4XUJ A;  4YS3 D;  3REJ A;  3AZL C;  1P3F A;  5KDM B;  5CPK A;  3H0M C;  1Q9C A;  3EPH A;  3LJA A;  5AV6 A;  5DNN A;  2YFW A;  1KX4 D;  4LD9 B;  3B0D C;  1P3K A;  3EPJ A;  3EPK A;  2ARO D;  5B0Z B;  3AZF C;  2CV5 D;  3UTA B;  2FJ7 C;  3A1I A;  3AV2 C;  3W98 C;  4H9R B;  5G49 B;  1TZY C;  3AZI C;  1F1E A;  4YS3 A;  3A6N D;  2IO5 B;  1P3G C;  5JA4 B;  1P3A C;  3KFU G;  4WU9 B;  4H9O B;  1KX4 A;  4UUZ B;  4LD9 D;  4G92 C;  2ARO A;  5GXQ C;  3UTB C;  2Y2K A;  2JCH A;  2CV5 A;  5B0Z D;  1KX5 B;  1ZLA B;  3AL0 C;  3UTA D;  3AN2 B;  4X23 B;  3A6N A;  2PYO C;  3AV1 B;  5KDM A;  4H9Q B;  4J8W B;  3WKJ C;  2Y2N A;  5AV8 B;  4XUJ C;  3MGQ C;  1P3F C;  4KUD D;  3MNN B;  2ZM5 A;  3C1B B;  4LD9 A;  2BYK B;  4Z66 B;  3LJA C;  4KGC B;  3V9R B;  5BT1 D;  2Y2P A;  1P3L C;  5B0Z A;  1KX5 D;  1H3O B;  3UTA A;  1P3K C;  3AFA B;  3AN2 D;  4ZBJ C;  4X23 D;  4H9R A;  5G49 A;  4KHA B;  2DQN C;  3AV1 D;  4Z2M G;  5DNM B;  4J8W D;  4YS3 C;  4KUD A;  5JA4 A;  5AV8 D;  4WU9 A;  3MNN D;  4H9O A;  5GT3 B;  2FFF B;  4UUZ A;  3C1B D;  2HIO C;  2NZD B;  4Z66 D;  4KGC D;  1U35 B;  1KX4 C;  5B31 B;  1KX5 A;  2L5A A;  2ZY3 A;  4G91 C;  2ARO C;  3AN2 A;  4X23 A;  3WA9 B;  3MGP C;  2CV5 C;  3AV1 A;  4H9Q A;  1AOI D;  3KWQ B;  4J8W A;  5DNM D;  5AV8 A;  3MNN A;  4E44 A;  5GT3 D;  3FDD A;  3C1B A;  4NE6 A;  3LEL D;  2BYK A;  4Z66 A;  3X1V B;  1TAF B;  4KGC A;  2NZD D;  3V9R A;  1U35 D;  1P3G B;  4LD9 C;  5B31 D;  1H3O A;  3LZ1 B;  3VH6 A;  3WA9 D;  3P5J B;  4KHA A;  5B0Z C;  3UTA C;  3REL B;  3UTB B;  3VH5 W;  1AOI A;  3KWQ D;  1M1A C;  5DNM A;  5B24 B;  5GT3 A;  3LEL A;  3REK B;  4KUD C;  5B31 G;  2NZD A;  3X1V D;  1KX3 B;  2BG1 A;  3AYW B;  1U35 A;  1R4V A;  2Y2H A;  3WTP E;  1P3G D;  5B31 A;  3MGQ B;  3NQJ B;  2BYM A;  4J8V B;  3LZ1 D;  3WA9 A;  2Y2J A;  1WWI A;  3REL D;  1M18 B;  3AN2 C;  5GT0 D;  4X23 C;  3KWQ A;  3UTB D;  1P3B D;  1P3L B;  3REH B;  4ZBJ B;  5B24 D;  4J8W C;  5AV8 C;  3REK D;  2Y2O A;  1ULY A;  1TAF A;  3MNN C;  3X1V A;  1KX3 D;  3AYW D;  1P3G A;  1Z2C B;  3C1B C;  3O62 B;  4J8V D;  4Z66 C;  3LZ1 A;  4KGC C;  2DF4 C;  2HIO B;  1EQZ D;  4WU8 D;  3REL A;  2W8S A;  1M18 D;  5GT0 A;  3UTB A;  4CSR B;  4H9P B;  1F66 B;  3REH D;  5B24 A;  1AOI C;  4CAY B;  3MGP B;  5DNM C;  3REK A;  4UPK A;  1KX3 A;  5GT3 C;  3AYW A;  3LEL C;  3MGQ A;  3H0L C;  3NQJ A;  3O62 D;  4J8V A;  2NZD C;  1WWS A;  1U35 C;  1BH8 A;  3X1S C;  2HIO D;  5B31 C;  2JE5 A;  1M18 A;  1P3L A;  3WA9 C;  2LY8 A;  3REH A;  1F66 D;  1BH9 B;  3KWQ C;  3MGP D;  1M1A B;  5B33 D;  2YFV B;  3O62 A;  2F8N K;  5B2I D;  4JJN C;  3X1V C;  4DQY B;  2HIO A;  2HUE B;  4KUD B;  1B6W A;  3LZ1 C;  4CSR A;  4H9P A;  1F66 A;  3REL C;  3REI B;  2XD1 A;  5GT0 C;  4CAY A;  1P3B C;  3MGP A;  2UWX A;  2Y2L A;  5B24 C;  1P3M B;  1M1A D;  1N1J B;  5B33 A;  3REK C;  5B2I A;  4QLC B;  1KX3 C;  4WNN B;  3AYW C;  4J8V C;  4Z5T B;  1EQZ C;  4WU8 C;  3W99 B;  3VH5 T;  1BH9 A;  2NQB B;  1M18 C;  3REI D;  1P3P B;  3MVD B;  3AZH B;  5B40 B;  3REH C;  1M1A A;  5JRG B;  1P3M D;  2YFV A;  1AOI B;  4QLC D;  3UT9 B;  3O62 C;  1T3U A;  3LEL B;  4Z5T D;  1ID3 B;  3W99 D;  5BS7 C;  2NQB D;  3A1K A;  3REI A;  2VQR A;  3X1S B;  1P3P D;  3MVD D;  2BYM B;  3AZH D;  5B40 D;  1F66 C;  1BFM A;  1P3M A;  1N1J A;  5JRG D;  4HGA B;  4QLC A;  2ZY5 A;  5FUG B;  4WNN A;  3UT9 D;  5B33 C;  5B2I C;  4Z5T A;  5F99 D;  5B32 B;  3W99 A;  4JJN B;  1ID3 D;  4AWL B;  2NQB A;  5GSU B;  4NE3 A;  1A7W A;  3X1S D;  3MVD A;  3AZH A;  1P3P A;  5B40 A;  5JRG A;  5AVC D;  5C3I B;  5GT0 B;  3F6T A;  3UT9 A;  1S32 B;  1P3B B;  5F99 A;  2HUE C;  5B32 D;  1ID3 A;  2F8N B;  4JJN D;  5GSU D;  3X1S A;  3AZJ B;  3REI C;  5CPI B;  1BH8 B;  1EQZ B;  4WU8 B;  3KUY B;  1HQ3 B;  5AVC A;  5CP6 C;  5FUG A;  1S32 D;  1P3M C;  4DRB A;  4QLC C;  4NE5 A;  5B2J B;  5B32 A;  4JJN A;  5AY8 B;  2F8N D;  5B0Y B;  3W96 B;  5GSU A;  1JFI B;  4Z5T C;  2ZY4 A;  3W99 C;  5CHL B;  2F8N H;  2NQB C;  3AZJ D;  5CPI D;  1P3P C;  3MVD C;  3AZE B;  3KSY A;  3KUY D;  5B40 C;  3AZH C;  4DRA A;  1HQ3 D;  1S32 A;  1P3B A;  5BNX B;  5AVB C;  5JRG C;  3UT9 C;  5B2J D;  2F8N A;  3IP4 C;  5AY8 D;  5B0Y D; 
#chains in the Genus database with same CATH homology
 4YM6 B;  2J8P A;  5B1L B;  5B33 B;  5F99 C;  5B2I B;  1ID3 C;  3AZJ A;  5E5A D;  5CPI A;  1EQZ A;  4WU8 A;  5CPJ B;  3KUY A;  3AZE D;  1HQ3 A;  5CPK D;  5B1M B;  5AVC C;  3X1T B;  4HGA C;  5AV6 D;  5DNN D;  5B2J A;  3AZM B;  5AY8 A;  3W96 A;  5B0Y A;  1KU5 A;  2G5H C;  1JFI A;  4YM6 D;  5B1L D;  5B32 C;  4AWL C;  5E5A A;  5GSU C;  3B0C T;  5CPJ D;  3AZE A;  3H0R C;  5BS7 A;  3MGR B;  3WAA B;  5BNX A;  5B1M D;  3X1T D;  5C3I C;  3C1C B;  1S32 C;  1P3O B;  3AZM D;  2G5I C;  3AZN B;  5CP6 B;  4ZUX B;  3VH6 T;  4YM6 A;  5B1L A;  2F2A C;  5AV9 B;  4H9N B;  5CPJ A;  3MGR D;  3AZJ C;  3WAA D;  3KXB B;  5CPI C;  3WTP B;  3AZK B;  4H9S A;  3W97 B;  3KUY C;  1M19 B;  4J8U B;  1HQ3 C;  5B1M A;  3X1T A;  2Y2M A;  2ZY2 A;  3C1C D;  5AV5 B;  5BNV B;  3AZM A;  1P3O D;  3AZN D;  5CP6 D;  4ZUX D;  5AVB B;  5B2J C;  4J8X B;  5AY8 C;  3R45 B;  3W96 C;  5B0Y C;  5AV9 D;  4WJ3 C;  3B6F C;  3LZ0 B;  3AZG B;  3MGR A;  1HTA A;  3WAA A;  1B67 A;  5E5A C;  5F99 B;  4R8P B;  3KXB D;  3WTP D;  3REJ C;  3AZE C;  3AZK D;  3W97 D;  3MGS B;  1M19 D;  2RIQ A;  4J8U D;  3W96 D;  4WU9 D;  3EPL A;  5CPK C;  3C1C A;  3X1U B;  5AV5 D;  1P3O A;  2XD5 A;  3AZN A;  3B0C W;  5CP6 A;  4ZUX A;  4WV4 B;  4XZQ B;  5DNN C;  5AV6 C;  1P34 B;  4Z2M H;  4EO5 B;  5AVB D;  1ZLA D;  5AVC B;  4J8X D;  5AV9 A;  3TU4 B;  4H9N A;  4YM6 C;  5B1L C;  3LZ0 D;  3AZG D;  3KXB A;  4R8P D;  3B6G B;  3WTP A;  3AZK A;  3W97 A;  5CPJ C;  3VH6 W;  1P3I B;  1M19 A;  4J8U A;  3MGS D;  4WZS B;  5AV5 A;  5BNV A;  3X1U D;  4H9S C;  3AZL B;  5B1M C;  3X1T C;  3EG5 B;  4XZQ D;  5AVB A;  1P34 D;  3AZM C;  1ZLA A;  4J8X A;  3NQU B;  2RVQ D;  2Y2Q A;  3R45 A;  3AFA D;  2Y2I A;  3TU4 D;  4E45 A;  3B0D B;  3LZ0 A;  3AZG A;  4NFT A;  4R8P A;  3AZF B;  3B6G D;  2FJ7 B;  3A6N C;  1P3I D;  3MGS A;  3WAA C;  3MGR C;  3AV2 B;  3W98 B;  1W2E A;  1TZY B;  3AZI B;  3X1U A;  3AZL D;  4XZQ A;  3C1C C;  1P34 A;  1P3A B;  1P3O C;  3AZN C;  3AFA A;  4ZUX C;  3TU4 A;  5B32 G;  4G92 B;  5GXQ B;  5AV9 C;  2JSS A;  3B6G A;  4M6B A;  3AZF D;  1P3I A;  2FJ7 D;  2IO5 C;  3AV2 D;  3W98 D;  3KXB C;  3AZI D;  1TZY D;  3B6F B;  3WTP C;  3VH5 A;  5BO0 B;  3AZK C;  3AZL A;  1M19 C;  2PYO B;  4J8U C;  3W97 C;  5E5A B;  4WU9 C;  3WKJ B;  5AV5 C;  3REJ B;  4XUJ B;  1P3F B;  1P3A D;  3NQU A;  2CWE A;  5CPK B;  5BT1 C;  1ZLA C;  1KX5 C;  3LJA B;  4J8X C;  2F8N G;  5GXQ D;  5AV6 B;  5DNN B;  2YFW B;  3AZF A;  1P3K B;  3LZ0 C;  2FJ7 A;  3AZG C;  3AV2 A;  3AV1 C;  2Y2G A;  3W98 A;  4R8P C;  1TZY A;  3AZI A;  3B6F D;  2PYO D;  3MGS C;  3X1U C;  4YS3 B;  3REJ D;  4XUJ D;  1P3A A;  3MGQ D;  1P3F D;  3WKJ D;  4XZQ C;  3B0B A;  1P34 C;  4EO5 C;  5GXQ A;  2RVQ C;  3LJA D;  3AFA C;  1PZR A;  1KX4 B;  3TU4 C;  1P3L D;  1P3K D;  4G91 B;  2ARO B;  3B6F A;  2CV5 B;  3B6G C;  5BO0 A;  1P3I C;  2PYO A;  3WKJ A;  3A6N B;  4XUJ A;  4YS3 D;  3REJ A;  3AZL C;  1P3F A;  5KDM B;  5CPK A;  3H0M C;  1Q9C A;  3EPH A;  3LJA A;  5AV6 A;  5DNN A;  2YFW A;  1KX4 D;  4LD9 B;  3B0D C;  1P3K A;  3EPJ A;  3EPK A;  2ARO D;  5B0Z B;  3AZF C;  2CV5 D;  3UTA B;  2FJ7 C;  3A1I A;  3AV2 C;  3W98 C;  4H9R B;  5G49 B;  1TZY C;  3AZI C;  1F1E A;  4YS3 A;  3A6N D;  2IO5 B;  1P3G C;  5JA4 B;  1P3A C;  3KFU G;  4WU9 B;  4H9O B;  1KX4 A;  4UUZ B;  4LD9 D;  4G92 C;  2ARO A;  5GXQ C;  3UTB C;  2Y2K A;  2JCH A;  2CV5 A;  5B0Z D;  1KX5 B;  1ZLA B;  3AL0 C;  3UTA D;  3AN2 B;  4X23 B;  3A6N A;  2PYO C;  3AV1 B;  5KDM A;  4H9Q B;  4J8W B;  3WKJ C;  2Y2N A;  5AV8 B;  4XUJ C;  3MGQ C;  1P3F C;  4KUD D;  3MNN B;  2ZM5 A;  3C1B B;  4LD9 A;  2BYK B;  4Z66 B;  3LJA C;  4KGC B;  3V9R B;  5BT1 D;  2Y2P A;  1P3L C;  5B0Z A;  1KX5 D;  1H3O B;  3UTA A;  1P3K C;  3AFA B;  3AN2 D;  4ZBJ C;  4X23 D;  4H9R A;  5G49 A;  4KHA B;  2DQN C;  3AV1 D;  4Z2M G;  5DNM B;  4J8W D;  4YS3 C;  4KUD A;  5JA4 A;  5AV8 D;  4WU9 A;  3MNN D;  4H9O A;  5GT3 B;  2FFF B;  4UUZ A;  3C1B D;  2HIO C;  2NZD B;  4Z66 D;  4KGC D;  1U35 B;  1KX4 C;  5B31 B;  1KX5 A;  2L5A A;  2ZY3 A;  4G91 C;  2ARO C;  3AN2 A;  4X23 A;  3WA9 B;  3MGP C;  2CV5 C;  3AV1 A;  4H9Q A;  1AOI D;  3KWQ B;  4J8W A;  5DNM D;  5AV8 A;  3MNN A;  4E44 A;  5GT3 D;  3FDD A;  3C1B A;  4NE6 A;  3LEL D;  2BYK A;  4Z66 A;  3X1V B;  1TAF B;  4KGC A;  2NZD D;  3V9R A;  1U35 D;  1P3G B;  4LD9 C;  5B31 D;  1H3O A;  3LZ1 B;  3VH6 A;  3WA9 D;  3P5J B;  4KHA A;  5B0Z C;  3UTA C;  3REL B;  3UTB B;  3VH5 W;  1AOI A;  3KWQ D;  1M1A C;  5DNM A;  5B24 B;  5GT3 A;  3LEL A;  3REK B;  4KUD C;  5B31 G;  2NZD A;  3X1V D;  1KX3 B;  2BG1 A;  3AYW B;  1U35 A;  1R4V A;  2Y2H A;  3WTP E;  1P3G D;  5B31 A;  3MGQ B;  3NQJ B;  2BYM A;  4J8V B;  3LZ1 D;  3WA9 A;  2Y2J A;  1WWI A;  3REL D;  1M18 B;  3AN2 C;  5GT0 D;  4X23 C;  3KWQ A;  3UTB D;  1P3B D;  1P3L B;  3REH B;  4ZBJ B;  5B24 D;  4J8W C;  5AV8 C;  3REK D;  2Y2O A;  1ULY A;  1TAF A;  3MNN C;  3X1V A;  1KX3 D;  3AYW D;  1P3G A;  1Z2C B;  3C1B C;  3O62 B;  4J8V D;  4Z66 C;  3LZ1 A;  4KGC C;  2DF4 C;  2HIO B;  1EQZ D;  4WU8 D;  3REL A;  2W8S A;  1M18 D;  5GT0 A;  3UTB A;  4CSR B;  4H9P B;  1F66 B;  3REH D;  5B24 A;  1AOI C;  4CAY B;  3MGP B;  5DNM C;  3REK A;  4UPK A;  1KX3 A;  5GT3 C;  3AYW A;  3LEL C;  3MGQ A;  3H0L C;  3NQJ A;  3O62 D;  4J8V A;  2NZD C;  1WWS A;  1U35 C;  1BH8 A;  3X1S C;  2HIO D;  5B31 C;  2JE5 A;  1M18 A;  1P3L A;  3WA9 C;  2LY8 A;  3REH A;  1F66 D;  1BH9 B;  3KWQ C;  3MGP D;  1M1A B;  5B33 D;  2YFV B;  3O62 A;  2F8N K;  5B2I D;  4JJN C;  3X1V C;  4DQY B;  2HIO A;  2HUE B;  4KUD B;  1B6W A;  3LZ1 C;  4CSR A;  4H9P A;  1F66 A;  3REL C;  3REI B;  2XD1 A;  5GT0 C;  4CAY A;  1P3B C;  3MGP A;  2UWX A;  2Y2L A;  5B24 C;  1P3M B;  1M1A D;  1N1J B;  5B33 A;  3REK C;  5B2I A;  4QLC B;  1KX3 C;  4WNN B;  3AYW C;  4J8V C;  4Z5T B;  1EQZ C;  4WU8 C;  3W99 B;  3VH5 T;  1BH9 A;  2NQB B;  1M18 C;  3REI D;  1P3P B;  3MVD B;  3AZH B;  5B40 B;  3REH C;  1M1A A;  5JRG B;  1P3M D;  2YFV A;  1AOI B;  4QLC D;  3UT9 B;  3O62 C;  1T3U A;  3LEL B;  4Z5T D;  1ID3 B;  3W99 D;  5BS7 C;  2NQB D;  3A1K A;  3REI A;  2VQR A;  3X1S B;  1P3P D;  3MVD D;  2BYM B;  3AZH D;  5B40 D;  1F66 C;  1BFM A;  1P3M A;  1N1J A;  5JRG D;  4HGA B;  4QLC A;  2ZY5 A;  5FUG B;  4WNN A;  3UT9 D;  5B33 C;  5B2I C;  4Z5T A;  5F99 D;  5B32 B;  3W99 A;  4JJN B;  1ID3 D;  4AWL B;  2NQB A;  5GSU B;  4NE3 A;  1A7W A;  3X1S D;  3MVD A;  3AZH A;  1P3P A;  5B40 A;  5JRG A;  5AVC D;  5C3I B;  5GT0 B;  3F6T A;  3UT9 A;  1S32 B;  1P3B B;  5F99 A;  2HUE C;  5B32 D;  1ID3 A;  2F8N B;  4JJN D;  5GSU D;  3X1S A;  3AZJ B;  3REI C;  5CPI B;  1BH8 B;  1EQZ B;  4WU8 B;  3KUY B;  1HQ3 B;  5AVC A;  5CP6 C;  5FUG A;  1S32 D;  1P3M C;  4DRB A;  4QLC C;  4NE5 A;  5B2J B;  5B32 A;  4JJN A;  5AY8 B;  2F8N D;  5B0Y B;  3W96 B;  5GSU A;  1JFI B;  4Z5T C;  2ZY4 A;  3W99 C;  5CHL B;  2F8N H;  2NQB C;  3AZJ D;  5CPI D;  1P3P C;  3MVD C;  3AZE B;  3KSY A;  3KUY D;  5B40 C;  3AZH C;  4DRA A;  1HQ3 D;  1S32 A;  1P3B A;  5BNX B;  5AVB C;  5JRG C;  3UT9 C;  5B2J D;  2F8N A;  3IP4 C;  5AY8 D;  5B0Y D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...