1M18D

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
94
structure length
94
Chain Sequence
b'TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146 Base Pair DNA Fragment
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 36
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m18D00
3C1BA 3AZGC 1P34D 3W99A 4JJNA 3AZIB 1ID3B 1KX5B 4KUDB 3KUYB 4JJNC 4H9PB 1P3PA 3A6NA 5B40D 3A6NC 5BNXA 4HGAB 2NZDD 3REKD 5AVBB 3WKJD 5E5AB 3LZ1B 5B32B 4G91C 3TU4A 3TU4C 3X1SB 4H9OA 3KWQB 3AZJC 1WWSA 4J8WD 5DNNA 3C1CB 2FJ7B 4WU8B 3VH6T 4ZUXA 3R45B 3MGSA 4ZUXC 3MGQB 3MGSC 5JRGB 1BH8B 3LELA 3AZED 3NQUA 4KHAB 3MVDB 5B31G 1WWIA 1P3FB 1P3BB 5GSUD 5GXQD 3AZHA 4CSRB 3AN2B 3AZHC 4EO5B 1N1JB 3AFAD 5BNVB 4UUZA 5AV8B 2YFVB 3REJD 4LD9D 4H9SA 4X23B 5AV5D 3VH5A 5CPJB 1BH9A 4QLCA 5B0YA 3AZIA 1ID3A 4KUDA 1ID3C 1KX5C 4H9PA 3KUYC 1P3MC 4XUJB 4M6BA 1ZLAD 4ZBJB 3REHD 5CPKC 4H9QA 5AVBA 4KGCB 5E5AA 3LZ1A 3LZ0B 5AVBC 1TZYB 5B32C 3VH6A 3WTPE 5B2JD 3X1SA 4J8UD 3KWQA 3X1SC 3KWQC 5B1MC 3C1CA 4WU8A 3AV2C 3R45A 4G92C 2FJ7C 1HQ3B 4J8XC 5JRGA 3MGQC 1BH8A 1KX4B 5JRGC 4KHAA 3MVDA 1U35D 3MVDC 1P3FA 1P3BA 1P3FC 4CSRA 3AN2A 4CAYB 3UT9D 3WA9B 1N1JA 5BNVA 4YS3D 3MGRB 2YFVA 5AV8C 5CPIB 1P3LD 4X23A 1BH9B 5CPJA 3O62D 2IO5C 5DNMD 5B33B 3UTAC 2BYMB 4XUJC 3C1BD 3W99D 4JJND 4KGCA 1P3PD 3LZ0A 3A6ND 3AZGB 1P3OC 1TZYA 2F8ND 1F66B 2RVQC 4AWLC 1P3IC 3WAAB 4H9RB 2BYKB 3B0CT 3TU4D 2F8NB 3REIC 5GT0C 1HQ3A 5KDMB 1AOIC 3AZJD 1HQ3C 1KX4A 3B0DC 1KX4C 5DNND 5F99B 4WU9B 4ZUXD 2AROB 3MGSD 4CAYA 4J8VB 1KX3B 3WA9A 2NQBB 3WA9C 3MGRA 2CV5B 4NE5A 5CPIA 1B67A 3AZHD 1M1AB 3X1TC 5B33A 1P3AC 2BYMA 5CP6B 4QLCD 3VH6W 3AZMB 5G49A 1ID3D 1KX5D 4KUDD 3KUYD 3AYWB 3AZNB 3MNNC 3AZGA 2F8NH 1F66C 3WAAA 1P3MB 5AVBD 4H9RA 3WAAC 5E5AD 3LZ1D 2BYKA 3VH5T 5B32D 2F8NA 3W98B 5KDMA 5CPKB 1P3KB 1H3OB 3X1SD 3KWQD 3AZFB 5F99A 3C1CD 4WU8D 2L5AA 4WU9A 2FJ7D 2AROA 4E45A 5F99C 4WU9C 3MGQD 2AROC 4XZQB 3AZJA 5JRGD 4J8VA 2NQBA 5B1MB 4J8VC 3MVDD 3AV2B 1KX3C 2NQBC 4G92B 1P3FD 2CV5A 3V9RB 4J8XB 1P3BD 2CV5C 4R8PC 1M1AA 3AN2D 1M1AC 1BFMA 3AZKB 5AV8D 3UTBB 5B0ZC 2PYOB 5CP6A 4X23D 5CPJD 1EQZB 5CP6C 3AZMA 3W96B 3AZMC 3AYWA 5AVCB 3AZNA 3AYWC 3AZNC 4XUJD 4Z2MG 2IO5B 3RELC 1KX5A 1M18C 3KUYA 3UTAB 4NE3A 1P3MA 4KGCD 3LZ0D 1TZYD 2RVQD 3W98A 5CPKA 1P3KA 1H3OA 5AV6C 3W98C 1P3KC 5B31B 3AZFA 5AV9B 1P3OB 3AZFC 4Z66B 5B32A 3KXBB 5C3IB 4AWLB 1P3IB 3WTPB 1AOID 1HQ3D 4XZQA 1KX4D 4XZQC 5B1MA 3AV2A 3REIB 2FJ7A 5GT0B 3V9RA 4J8XA 1AOIB 5AY8C 3MGQA 3WA9D 3B0DB 3MGRD 3AZKA 3UTBA 2PYOA 3AZKC 3UTBC 3B0CW 5CPID 2PYOC 1EQZC 1KU5A 1F1EA 5AVCA 5B33D 3W96C 2HIOB 5AV8A 5AVCC 5B1LB 3LJAC 3X1TB 3B6FC 3X1UB 5B2IB 1B6WA 2NZDC 3UTAA 1P3AB 3REKC 3MGPB 4XUJA 1M19B 3AZGD 1F66D 3B6GC 3WAAD 2YFWB 5B31A 3MNNB 1P3OA 5B31C 4Z66A 3KXBA 5AV9C 4Z66C 3KXBC 1P3IA 5C3IC 3WTPC 3AZEC 1S32B 3REIA 5F99D 4WU9D 5GT0A 2AROD 5GSUC 1AOIA 2F8NG 4J8VD 1KX3D 3AFAC 4Z5TB 2NQBD 4LD9C 4YM6B 2CV5D 1JFIB 3VH5W 1M1AD 2HIOA 5B1LA 1P3GB 2HIOC 5CP6D 4R8PB 5B1LC 5GT3B 3X1TA 3X1UA 3AZMD 4DRBA 3X1UC 5B2IC 5B0ZB 3REHC 3AYWD 3AZND 1P3AA 3MGPA 1M19A 3MGPC 1M19C 1M18D 5BT1C 1P3MD 3W97B 3MNNA 5FUGB 3RELB 1M18B 1F66A 3W98D 3X1VB 5CPKD 1P3KD 1S32A 3AZFD 1S32C 1U35C 4NFTA 5AV6B 3LELB 4XZQD 4Z5TA 5B1MD 3AV2D 4Z5TC 4YM6A 5B32G 3KSYA 4J8XD 4YM6C 3AV1B 2F8NK 3AZLB 1KX3A 4UUZB 5DNMC 3AZKD 3UTBD 2PYOD 5AY8B 5B0YB 1P3GA 4R8PA 3C1BC 5GT3A 1P3GC 3W99C 1EQZD 5GT3C 3W96D 1TAFB 5B0ZA 5AVCD 1P3PC 5B24B 3LJAD 5JA4B 1P34B 3B6FD 3B0BA 4H9QB 3UTAD 3W97A 1ULYA 5B40B 3LJAB 5FUGA 3W97C 3B6FB 3RELA 3B6GD 1M18A 1Q9CA 2NZDB 1R4VA 3REKB 3WKJB 3X1VA 5BO0B 5BS7A 3X1VC 5B31D 5BS7C 5AV9D 1P3OD 5DNNC 4Z66D 3KXBD 3B6GB 1P3ID 3WTPD 5AV6A 3LELC 4J8WB 3REID 5GT0D 3AV1A 3AZEB 3AZLA 3AV1C 3AZLC 4H9SC 5GSUB 5GXQB 5AY8A 4QLCC 5B0YC 3AFAB 3AZIC 4KUDC 1TAFA 3REJB 4LD9B 2HIOD 5B24A 5AV5B 5B1LD 5JA4A 1P34A 5B24C 1P34C 3X1TD 1EQZA 4HGAC 3X1UD 5B2ID 4DRAA 3W96A 1P3AD 5E5AC 3LZ1C 3MGPD 5B40A 3LJAA 1M19D 3B6FA 5B40C 5BT1D 1ZLAB 2NZDA 3REHB 3REKA 3WKJA 5BO0A 3WKJC 4WNNB 3MNND 4E44A 3C1CC 4WU8C 5B2JB 3B6GA 4J8UB 4J8WA 1S32D 5AV9A 4J8WC 1HTAA 4Z2MH 1P3BC 1A7WA 3WTPA 3AZEA 3AN2C 4EO5C 4Z5TD 1U35B 4YM6D 5GSUA 5GXQA 4X23C 5CPJC 3UT9B 5GXQC 3AFAA 4YS3B 2CWEA 2LY8A 3REJA 4LD9A 5CHLB 3REJC 1P3LB 5AV5A 3NQJB 4WV4B 1P3GD 3O62B 5AV5C 5G49B 4R8PD 5GT3D 4WZSB 5DNMB 2JSSA 4ZBJC 2HUEB 5B0ZD 4KGCC 3LZ0C 4H9NB 3C1BB 3W99B 4JJNB 1TZYC 1ZLAA 5B2IA 3REHA 1ZLAC 1P3PB 3A6NB 3W97D 4WNNA 5BNXB 3RELD 5B2JA 5B2JC 4J8UA 3X1VD 2YFWA 4J8UC 4G91B 3TU4B 3AZJB 5AV6D 3LELD 4H9OB 1U35A 5DNNB 3MGRC 4ZUXB 3MGSB 5CPIC 3UT9A 3AV1D 4NE6A 3AZLD 3NQUB 3UT9C 4YS3A 5B33C 4YS3C 1P3LA 3NQJA 5AY8D 5B0YD 3AZHB 3O62A 1P3LC 3AZID 1JFIA 3O62C 5DNMA 2HUEC 5B24D 4H9NA 4QLCB
chains in the Genus database with same CATH superfamily
3C1BA 3AZGC 1P34D 3W99A 4JJNA 3AZIB 1ID3B 1KX5B 4KUDB 3KUYB 4JJNC 4H9PB 1P3PA 3A6NA 5B40D 3A6NC 5BNXA 4HGAB 2NZDD 3REKD 5AVBB 3WKJD 5E5AB 3LZ1B 5B32B 2Y2GA 4G91C 3TU4A 3TU4C 3X1SB 4H9OA 3KWQB 3AZJC 1WWSA 3F6TA 4J8WD 5DNNA 3C1CB 2FJ7B 4WU8B 3VH6T 4ZUXA 3R45B 3MGSA 4ZUXC 3MGQB 3MGSC 5JRGB 1BH8B 3LELA 3AZED 3NQUA 4KHAB 3MVDB 5B31G 1WWIA 1P3FB 1P3BB 5GSUD 5GXQD 3AZHA 4CSRB 3AN2B 3AZHC 4EO5B 1N1JB 3AFAD 5BNVB 4UUZA 5AV8B 2YFVB 3REJD 4LD9D 4H9SA 4X23B 5AV5D 3VH5A 5CPJB 1BH9A 4QLCA 5B0YA 3AZIA 1ID3A 2JE5A 4KUDA 1ID3C 1KX5C 4H9PA 3KUYC 1P3MC 4XUJB 4M6BA 1ZLAD 4ZBJB 3REHD 5CPKC 4H9QA 5AVBA 4KGCB 5E5AA 3LZ1A 3LZ0B 5AVBC 1TZYB 5B32C 3VH6A 3WTPE 5B2JD 2ZM5A 3X1SA 4J8UD 3KWQA 3X1SC 3KWQC 5B1MC 3C1CA 4WU8A 3AV2C 3R45A 4G92C 2FJ7C 1HQ3B 4J8XC 5JRGA 3MGQC 1BH8A 1KX4B 5JRGC 4KHAA 3MVDA 1U35D 3MVDC 1P3FA 1P3BA 1P3FC 4CSRA 3H0MC 3AN2A 4CAYB 3UT9D 3FDDA 3WA9B 1N1JA 5BNVA 4YS3D 3MGRB 2YFVA 5AV8C 5CPIB 1P3LD 4X23A 5CPJA 3O62D 2IO5C 5DNMD 5B33B 3UTAC 2BYMB 4XUJC 3C1BD 3W99D 4JJND 4KGCA 1P3PD 2Y2NA 3AL0C 3LZ0A 3A6ND 3AZGB 1P3OC 1TZYA 2F8ND 1F66B 2RVQC 4AWLC 1P3IC 3WAAB 4H9RB 2BYKB 3B0CT 3TU4D 2F8NB 3REIC 3EPHA 5GT0C 1HQ3A 5KDMB 1AOIC 3AZJD 1HQ3C 1KX4A 3B0DC 1KX4C 5DNND 5F99B 4WU9B 4ZUXD 2AROB 3MGSD 4CAYA 4J8VB 1KX3B 3WA9A 2NQBB 3WA9C 3MGRA 2CV5B 4NE5A 5CPIA 1B67A 3AZHD 1M1AB 3X1TC 5B33A 2J8PA 1P3AC 2BYMA 5CP6B 4QLCD 3VH6W 3AZMB 5G49A 1ID3D 2BG1A 1KX5D 4KUDD 3KUYD 3AYWB 3AZNB 3MNNC 3AZGA 2F8NH 1F66C 3WAAA 1P3MB 5AVBD 4H9RA 3WAAC 5E5AD 3LZ1D 2BYKA 3VH5T 5B32D 2F8NA 3W98B 5KDMA 5CPKB 1P3KB 1H3OB 3X1SD 3KWQD 3AZFB 5F99A 3C1CD 4WU8D 2L5AA 4WU9A 2FJ7D 2AROA 4E45A 5F99C 4WU9C 3MGQD 2AROC 2Y2HA 4XZQB 3AZJA 5JRGD 4J8VA 2NQBA 4WJ3C 5B1MB 4J8VC 3MVDD 3AV2B 1KX3C 2NQBC 4G92B 1P3FD 2CV5A 3V9RB 4J8XB 1P3BD 1T3UA 2CV5C 4R8PC 1M1AA 3AN2D 1M1AC 1BFMA 3AZKB 5AV8D 3UTBB 5B0ZC 2PYOB 5CP6A 4X23D 5CPJD 1EQZB 5CP6C 3AZMA 2FFFB 3W96B 3AZMC 3AYWA 5AVCB 3P5JB 3AZNA 3AYWC 3AZNC 4XUJD 4Z2MG 2IO5B 3RELC 1KX5A 1M18C 3KUYA 3UTAB 4NE3A 1P3MA 4KGCD 3IP4C 3LZ0D 1TZYD 2RVQD 2F2AC 3W98A 5CPKA 1P3KA 1H3OA 5AV6C 3W98C 1P3KC 5B31B 3AZFA 2DQNC 5AV9B 1P3OB 3AZFC 4Z66B 5B32A 3KXBB 5C3IB 4AWLB 1P3IB 3WTPB 1AOID 1HQ3D 4XZQA 1KX4D 1Z2CB 4XZQC 5B1MA 3AV2A 3REIB 2FJ7A 5GT0B 3V9RA 4J8XA 1AOIB 5AY8C 3MGQA 3WA9D 3B0DB 3MGRD 3AZKA 3UTBA 2PYOA 3AZKC 3UTBC 3B0CW 5CPID 2PYOC 1EQZC 1KU5A 1F1EA 5AVCA 5B33D 3W96C 2HIOB 5AV8A 2Y2MA 5AVCC 5B1LB 3LJAC 3X1TB 3B6FC 3X1UB 5B2IB 1B6WA 2NZDC 3UTAA 1P3AB 3REKC 3MGPB 4XUJA 1M19B 3AZGD 2Y2LA 3EG5B 1F66D 3B6GC 3WAAD 2YFWB 5B31A 3MNNB 1P3OA 5B31C 4Z66A 3KXBA 5AV9C 4Z66C 3KXBC 1P3IA 5C3IC 3WTPC 3AZEC 1S32B 3REIA 5F99D 4WU9D 5GT0A 2AROD 5GSUC 1AOIA 2F8NG 4QLCB 2G5HC 4J8VD 1KX3D 3AFAC 4Z5TB 2NQBD 4LD9C 4YM6B 2CV5D 1JFIB 3VH5W 3EPLA 1M1AD 3H0LC 2HIOA 5B1LA 1P3GB 2HIOC 5CP6D 4R8PB 5B1LC 5GT3B 3X1TA 3X1UA 3AZMD 2W8SA 4DRBA 3X1UC 5B2IC 5B0ZB 3REHC 3AYWD 3AZND 1P3AA 3MGPA 1M19A 3MGPC 2XD1A 1M19C 2Y2QA 1M18D 5BT1C 1P3MD 3W97B 3MNNA 5FUGB 3RELB 1M18B 3A1KA 1F66A 3W98D 3X1VB 5CPKD 1P3KD 1S32A 3AZFD 1S32C 1U35C 4NFTA 5AV6B 3LELB 2Y2OA 4XZQD 2UWXA 4Z5TA 5B1MD 3AV2D 4Z5TC 4YM6A 5B32G 3KSYA 4J8XD 4YM6C 3AV1B 2F8NK 3AZLB 1KX3A 4UUZB 5DNMC 3AZKD 3UTBD 2PYOD 5AY8B 5B0YB 1P3GA 4R8PA 3C1BC 5GT3A 1P3GC 3W99C 1EQZD 5GT3C 3W96D 1TAFB 5B0ZA 5AVCD 1P3PC 5B24B 3EPJA 3LJAD 5JA4B 1P34B 3B6FD 2Y2JA 3B0BA 4H9QB 3UTAD 2ZY3A 3W97A 1ULYA 2G5IC 5B40B 3LJAB 5FUGA 3W97C 3B6FB 3RELA 3B6GD 1M18A 1Q9CA 2NZDB 1R4VA 3REKB 3WKJB 3X1VA 5BO0B 5BS7A 3X1VC 5B31D 5BS7C 5AV9D 1P3OD 5DNNC 4Z66D 3KXBD 3B6GB 1P3ID 3WTPD 5AV6A 3LELC 4J8WB 3REID 5GT0D 3AV1A 3AZEB 3AZLA 3AV1C 3AZLC 2Y2KA 4H9SC 5GSUB 5GXQB 5AY8A 4QLCC 2ZY2A 5B0YC 3AFAB 3AZIC 4KUDC 1TAFA 3REJB 4LD9B 2HIOD 5B24A 5AV5B 5B1LD 4DQYB 5JA4A 1P34A 5B24C 1P34C 3X1TD 1EQZA 4HGAC 3X1UD 5B2ID 4DRAA 3W96A 1P3AD 5E5AC 3LZ1C 3MGPD 5B40A 3LJAA 1M19D 3B6FA 5B40C 5BT1D 1ZLAB 2NZDA 3REHB 3REKA 3WKJA 5BO0A 3WKJC 4WNNB 3MNND 4E44A 3C1CC 4WU8C 5B2JB 3B6GA 4J8UB 4J8WA 1S32D 5AV9A 4J8WC 1HTAA 4Z2MH 1P3BC 1A7WA 3WTPA 3AZEA 3AN2C 4EO5C 4Z5TD 1U35B 2RIQA 4YM6D 5GSUA 5GXQA 4X23C 5CPJC 3UT9B 5GXQC 3AFAA 4UPKA 4YS3B 2CWEA 2LY8A 3REJA 4LD9A 5CHLB 2ZY4A 3REJC 1P3LB 5AV5A 3NQJB 4WV4B 1P3GD 3O62B 5AV5C 2Y2PA 5G49B 2DF4C 4R8PD 5GT3D 4WZSB 5DNMB 2JSSA 4ZBJC 2XD5A 2HUEB 5B0ZD 4KGCC 3LZ0C 4H9NB 1W2EA 3C1BB 3W99B 4JJNB 1PZRA 1TZYC 1ZLAA 5B2IA 3REHA 1ZLAC 1P3PB 2VQRA 3A6NB 3W97D 4WNNA 5BNXB 3RELD 5B2JA 5B2JC 4J8UA 3X1VD 2YFWA 3A1IA 4J8UC 4G91B 3TU4B 2ZY5A 3AZJB 5AV6D 3LELD 4H9OB 3H0RC 5DNNB 1U35A 3MGRC 4ZUXB 3MGSB 5CPIC 3UT9A 3AV1D 4NE6A 3AZLD 3NQUB 3UT9C 4YS3A 5B33C 4YS3C 1P3LA 3KFUG 3NQJA 5AY8D 5B0YD 3AZHB 3O62A 1P3LC 2JCHA 3AZID 1JFIA 3O62C 5DNMA 2Y2IA 3EPKA 2HUEC 5B24D 4H9NA 1BH9B
chains in the Genus database with same CATH topology
3C1BA 3AZGC 1P34D 3W99A 4JJNA 3AZIB 1ID3B 1KX5B 4KUDB 3KUYB 4JJNC 4H9PB 1P3PA 3A6NA 5B40D 3A6NC 5BNXA 4HGAB 2NZDD 3REKD 5AVBB 3WKJD 5E5AB 3LZ1B 5B32B 2Y2GA 4G91C 3TU4A 3TU4C 3X1SB 4H9OA 3KWQB 3AZJC 1WWSA 3F6TA 4J8WD 5DNNA 3C1CB 2FJ7B 4WU8B 3VH6T 4ZUXA 3R45B 3MGSA 4ZUXC 3MGQB 3MGSC 5JRGB 1BH8B 3LELA 3AZED 3NQUA 4KHAB 3MVDB 5B31G 1WWIA 1P3FB 1P3BB 5GSUD 5GXQD 3AZHA 4CSRB 3AN2B 3AZHC 4EO5B 1N1JB 3AFAD 5BNVB 4UUZA 5AV8B 2YFVB 3REJD 4LD9D 4H9SA 4X23B 5AV5D 3VH5A 5CPJB 1BH9A 4QLCA 5B0YA 3AZIA 1ID3A 2JE5A 4KUDA 1ID3C 1KX5C 4H9PA 3KUYC 1P3MC 4XUJB 4M6BA 1ZLAD 4ZBJB 3REHD 5CPKC 4H9QA 5AVBA 4KGCB 5E5AA 3LZ1A 3LZ0B 5AVBC 1TZYB 5B32C 3VH6A 3WTPE 5B2JD 2ZM5A 3X1SA 4J8UD 3KWQA 3X1SC 3KWQC 5B1MC 3C1CA 4WU8A 3AV2C 3R45A 4G92C 2FJ7C 1HQ3B 4J8XC 5JRGA 3MGQC 1BH8A 1KX4B 5JRGC 4KHAA 3MVDA 1U35D 3MVDC 1P3FA 1P3BA 1P3FC 4CSRA 3H0MC 3AN2A 4CAYB 3UT9D 3FDDA 3WA9B 1N1JA 5BNVA 4YS3D 3MGRB 2YFVA 5AV8C 5CPIB 1P3LD 4X23A 5CPJA 3O62D 2IO5C 5DNMD 5B33B 3UTAC 2BYMB 4XUJC 3C1BD 3W99D 4JJND 4KGCA 1P3PD 2Y2NA 3AL0C 3LZ0A 3A6ND 3AZGB 1P3OC 1TZYA 2F8ND 1F66B 2RVQC 4AWLC 1P3IC 3WAAB 4H9RB 2BYKB 3B0CT 3TU4D 2F8NB 3REIC 3EPHA 5GT0C 1HQ3A 5KDMB 1AOIC 3AZJD 1HQ3C 1KX4A 3B0DC 1KX4C 5DNND 5F99B 4WU9B 4ZUXD 2AROB 3MGSD 4CAYA 4J8VB 1KX3B 3WA9A 2NQBB 3WA9C 3MGRA 2CV5B 4NE5A 5CPIA 1B67A 3AZHD 1M1AB 3X1TC 5B33A 2J8PA 1P3AC 2BYMA 5CP6B 4QLCD 3VH6W 3AZMB 5G49A 1ID3D 2BG1A 1KX5D 4KUDD 3KUYD 3AYWB 3AZNB 3MNNC 3AZGA 2F8NH 1F66C 3WAAA 1P3MB 5AVBD 4H9RA 3WAAC 5E5AD 3LZ1D 2BYKA 3VH5T 5B32D 2F8NA 3W98B 5KDMA 5CPKB 1P3KB 1H3OB 3X1SD 3KWQD 3AZFB 5F99A 3C1CD 4WU8D 2L5AA 4WU9A 2FJ7D 2AROA 4E45A 5F99C 4WU9C 3MGQD 2AROC 2Y2HA 4XZQB 3AZJA 5JRGD 4J8VA 2NQBA 4WJ3C 5B1MB 4J8VC 3MVDD 3AV2B 1KX3C 2NQBC 4G92B 1P3FD 2CV5A 3V9RB 4J8XB 1P3BD 1T3UA 2CV5C 4R8PC 1M1AA 3AN2D 1M1AC 1BFMA 3AZKB 5AV8D 3UTBB 5B0ZC 2PYOB 5CP6A 4X23D 5CPJD 1EQZB 5CP6C 3AZMA 2FFFB 3W96B 3AZMC 3AYWA 5AVCB 3P5JB 3AZNA 3AYWC 3AZNC 4XUJD 4Z2MG 2IO5B 3RELC 1KX5A 1M18C 3KUYA 3UTAB 4NE3A 1P3MA 4KGCD 3IP4C 3LZ0D 1TZYD 2RVQD 2F2AC 3W98A 5CPKA 1P3KA 1H3OA 5AV6C 3W98C 1P3KC 5B31B 3AZFA 2DQNC 5AV9B 1P3OB 3AZFC 4Z66B 5B32A 3KXBB 5C3IB 4AWLB 1P3IB 3WTPB 1AOID 1HQ3D 4XZQA 1KX4D 1Z2CB 4XZQC 5B1MA 3AV2A 3REIB 2FJ7A 5GT0B 3V9RA 4J8XA 1AOIB 5AY8C 3MGQA 3WA9D 3B0DB 3MGRD 3AZKA 3UTBA 2PYOA 3AZKC 3UTBC 3B0CW 5CPID 2PYOC 1EQZC 1KU5A 1F1EA 5AVCA 5B33D 3W96C 2HIOB 5AV8A 2Y2MA 5AVCC 5B1LB 3LJAC 3X1TB 3B6FC 3X1UB 5B2IB 1B6WA 2NZDC 3UTAA 1P3AB 3REKC 3MGPB 4XUJA 1M19B 3AZGD 2Y2LA 3EG5B 1F66D 3B6GC 3WAAD 2YFWB 5B31A 3MNNB 1P3OA 5B31C 4Z66A 3KXBA 5AV9C 4Z66C 3KXBC 1P3IA 5C3IC 3WTPC 3AZEC 1S32B 3REIA 5F99D 4WU9D 5GT0A 2AROD 5GSUC 1AOIA 2F8NG 4QLCB 2G5HC 4J8VD 1KX3D 3AFAC 4Z5TB 2NQBD 4LD9C 4YM6B 2CV5D 1JFIB 3VH5W 3EPLA 1M1AD 3H0LC 2HIOA 5B1LA 1P3GB 2HIOC 5CP6D 4R8PB 5B1LC 5GT3B 3X1TA 3X1UA 3AZMD 2W8SA 4DRBA 3X1UC 5B2IC 5B0ZB 3REHC 3AYWD 3AZND 1P3AA 3MGPA 1M19A 3MGPC 2XD1A 1M19C 2Y2QA 1M18D 5BT1C 1P3MD 3W97B 3MNNA 5FUGB 3RELB 1M18B 3A1KA 1F66A 3W98D 3X1VB 5CPKD 1P3KD 1S32A 3AZFD 1S32C 1U35C 4NFTA 5AV6B 3LELB 2Y2OA 4XZQD 2UWXA 4Z5TA 5B1MD 3AV2D 4Z5TC 4YM6A 5B32G 3KSYA 4J8XD 4YM6C 3AV1B 2F8NK 3AZLB 1KX3A 4UUZB 5DNMC 3AZKD 3UTBD 2PYOD 5AY8B 5B0YB 1P3GA 4R8PA 3C1BC 5GT3A 1P3GC 3W99C 1EQZD 5GT3C 3W96D 1TAFB 5B0ZA 5AVCD 1P3PC 5B24B 3EPJA 3LJAD 5JA4B 1P34B 3B6FD 2Y2JA 3B0BA 4H9QB 3UTAD 2ZY3A 3W97A 1ULYA 2G5IC 5B40B 3LJAB 5FUGA 3W97C 3B6FB 3RELA 3B6GD 1M18A 1Q9CA 2NZDB 1R4VA 3REKB 3WKJB 3X1VA 5BO0B 5BS7A 3X1VC 5B31D 5BS7C 5AV9D 1P3OD 5DNNC 4Z66D 3KXBD 3B6GB 1P3ID 3WTPD 5AV6A 3LELC 4J8WB 3REID 5GT0D 3AV1A 3AZEB 3AZLA 3AV1C 3AZLC 2Y2KA 4H9SC 5GSUB 5GXQB 5AY8A 4QLCC 2ZY2A 5B0YC 3AFAB 3AZIC 4KUDC 1TAFA 3REJB 4LD9B 2HIOD 5B24A 5AV5B 5B1LD 4DQYB 5JA4A 1P34A 5B24C 1P34C 3X1TD 1EQZA 4HGAC 3X1UD 5B2ID 4DRAA 3W96A 1P3AD 5E5AC 3LZ1C 3MGPD 5B40A 3LJAA 1M19D 3B6FA 5B40C 5BT1D 1ZLAB 2NZDA 3REHB 3REKA 3WKJA 5BO0A 3WKJC 4WNNB 3MNND 4E44A 3C1CC 4WU8C 5B2JB 3B6GA 4J8UB 4J8WA 1S32D 5AV9A 4J8WC 1HTAA 4Z2MH 1P3BC 1A7WA 3WTPA 3AZEA 3AN2C 4EO5C 4Z5TD 1U35B 2RIQA 4YM6D 5GSUA 5GXQA 4X23C 5CPJC 3UT9B 5GXQC 3AFAA 4UPKA 4YS3B 2CWEA 2LY8A 3REJA 4LD9A 5CHLB 2ZY4A 3REJC 1P3LB 5AV5A 3NQJB 4WV4B 1P3GD 3O62B 5AV5C 2Y2PA 5G49B 2DF4C 4R8PD 5GT3D 4WZSB 5DNMB 2JSSA 4ZBJC 2XD5A 2HUEB 5B0ZD 4KGCC 3LZ0C 4H9NB 1W2EA 3C1BB 3W99B 4JJNB 1PZRA 1TZYC 1ZLAA 5B2IA 3REHA 1ZLAC 1P3PB 2VQRA 3A6NB 3W97D 4WNNA 5BNXB 3RELD 5B2JA 5B2JC 4J8UA 3X1VD 2YFWA 3A1IA 4J8UC 4G91B 3TU4B 2ZY5A 3AZJB 5AV6D 3LELD 4H9OB 3H0RC 5DNNB 1U35A 3MGRC 4ZUXB 3MGSB 5CPIC 3UT9A 3AV1D 4NE6A 3AZLD 3NQUB 3UT9C 4YS3A 5B33C 4YS3C 1P3LA 3KFUG 3NQJA 5AY8D 5B0YD 3AZHB 3O62A 1P3LC 2JCHA 3AZID 1JFIA 3O62C 5DNMA 2Y2IA 3EPKA 2HUEC 5B24D 4H9NA 1BH9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1B A;  3AZG C;  1P34 D;  3W99 A;  4JJN A;  3AZI B;  1ID3 B;  1KX5 B;  4KUD B;  3KUY B;  4JJN C;  4H9P B;  1P3P A;  3A6N A;  5B40 D;  3A6N C;  5BNX A;  4HGA B;  2NZD D;  3REK D;  5AVB B;  3WKJ D;  5E5A B;  3LZ1 B;  5B32 B;  4G91 C;  3TU4 A;  3TU4 C;  3X1S B;  4H9O A;  3KWQ B;  3AZJ C;  1WWS A;  4J8W D;  5DNN A;  3C1C B;  2FJ7 B;  4WU8 B;  3VH6 T;  4ZUX A;  3R45 B;  3MGS A;  4ZUX C;  3MGQ B;  3MGS C;  5JRG B;  1BH8 B;  3LEL A;  3AZE D;  3NQU A;  4KHA B;  3MVD B;  5B31 G;  1WWI A;  1P3F B;  1P3B B;  5GSU D;  5GXQ D;  3AZH A;  4CSR B;  3AN2 B;  3AZH C;  4EO5 B;  1N1J B;  3AFA D;  5BNV B;  4UUZ A;  5AV8 B;  2YFV B;  3REJ D;  4LD9 D;  4H9S A;  4X23 B;  5AV5 D;  3VH5 A;  5CPJ B;  1BH9 A;  4QLC A;  5B0Y A;  3AZI A;  1ID3 A;  4KUD A;  1ID3 C;  1KX5 C;  4H9P A;  3KUY C;  1P3M C;  4XUJ B;  4M6B A;  1ZLA D;  4ZBJ B;  3REH D;  5CPK C;  4H9Q A;  5AVB A;  4KGC B;  5E5A A;  3LZ1 A;  3LZ0 B;  5AVB C;  1TZY B;  5B32 C;  3VH6 A;  3WTP E;  5B2J D;  3X1S A;  4J8U D;  3KWQ A;  3X1S C;  3KWQ C;  5B1M C;  3C1C A;  4WU8 A;  3AV2 C;  3R45 A;  4G92 C;  2FJ7 C;  1HQ3 B;  4J8X C;  5JRG A;  3MGQ C;  1BH8 A;  1KX4 B;  5JRG C;  4KHA A;  3MVD A;  1U35 D;  3MVD C;  1P3F A;  1P3B A;  1P3F C;  4CSR A;  3AN2 A;  4CAY B;  3UT9 D;  3WA9 B;  1N1J A;  5BNV A;  4YS3 D;  3MGR B;  2YFV A;  5AV8 C;  5CPI B;  1P3L D;  4X23 A;  1BH9 B;  5CPJ A;  3O62 D;  2IO5 C;  5DNM D;  5B33 B;  3UTA C;  2BYM B;  4XUJ C;  3C1B D;  3W99 D;  4JJN D;  4KGC A;  1P3P D;  3LZ0 A;  3A6N D;  3AZG B;  1P3O C;  1TZY A;  2F8N D;  1F66 B;  2RVQ C;  4AWL C;  1P3I C;  3WAA B;  4H9R B;  2BYK B;  3B0C T;  3TU4 D;  2F8N B;  3REI C;  5GT0 C;  1HQ3 A;  5KDM B;  1AOI C;  3AZJ D;  1HQ3 C;  1KX4 A;  3B0D C;  1KX4 C;  5DNN D;  5F99 B;  4WU9 B;  4ZUX D;  2ARO B;  3MGS D;  4CAY A;  4J8V B;  1KX3 B;  3WA9 A;  2NQB B;  3WA9 C;  3MGR A;  2CV5 B;  4NE5 A;  5CPI A;  1B67 A;  3AZH D;  1M1A B;  3X1T C;  5B33 A;  1P3A C;  2BYM A;  5CP6 B;  4QLC D;  3VH6 W;  3AZM B;  5G49 A;  1ID3 D;  1KX5 D;  4KUD D;  3KUY D;  3AYW B;  3AZN B;  3MNN C;  3AZG A;  2F8N H;  1F66 C;  3WAA A;  1P3M B;  5AVB D;  4H9R A;  3WAA C;  5E5A D;  3LZ1 D;  2BYK A;  3VH5 T;  5B32 D;  2F8N A;  3W98 B;  5KDM A;  5CPK B;  1P3K B;  1H3O B;  3X1S D;  3KWQ D;  3AZF B;  5F99 A;  3C1C D;  4WU8 D;  2L5A A;  4WU9 A;  2FJ7 D;  2ARO A;  4E45 A;  5F99 C;  4WU9 C;  3MGQ D;  2ARO C;  4XZQ B;  3AZJ A;  5JRG D;  4J8V A;  2NQB A;  5B1M B;  4J8V C;  3MVD D;  3AV2 B;  1KX3 C;  2NQB C;  4G92 B;  1P3F D;  2CV5 A;  3V9R B;  4J8X B;  1P3B D;  2CV5 C;  4R8P C;  1M1A A;  3AN2 D;  1M1A C;  1BFM A;  3AZK B;  5AV8 D;  3UTB B;  5B0Z C;  2PYO B;  5CP6 A;  4X23 D;  5CPJ D;  1EQZ B;  5CP6 C;  3AZM A;  3W96 B;  3AZM C;  3AYW A;  5AVC B;  3AZN A;  3AYW C;  3AZN C;  4XUJ D;  4Z2M G;  2IO5 B;  3REL C;  1KX5 A;  1M18 C;  3KUY A;  3UTA B;  4NE3 A;  1P3M A;  4KGC D;  3LZ0 D;  1TZY D;  2RVQ D;  3W98 A;  5CPK A;  1P3K A;  1H3O A;  5AV6 C;  3W98 C;  1P3K C;  5B31 B;  3AZF A;  5AV9 B;  1P3O B;  3AZF C;  4Z66 B;  5B32 A;  3KXB B;  5C3I B;  4AWL B;  1P3I B;  3WTP B;  1AOI D;  1HQ3 D;  4XZQ A;  1KX4 D;  4XZQ C;  5B1M A;  3AV2 A;  3REI B;  2FJ7 A;  5GT0 B;  3V9R A;  4J8X A;  1AOI B;  5AY8 C;  3MGQ A;  3WA9 D;  3B0D B;  3MGR D;  3AZK A;  3UTB A;  2PYO A;  3AZK C;  3UTB C;  3B0C W;  5CPI D;  2PYO C;  1EQZ C;  1KU5 A;  1F1E A;  5AVC A;  5B33 D;  3W96 C;  2HIO B;  5AV8 A;  5AVC C;  5B1L B;  3LJA C;  3X1T B;  3B6F C;  3X1U B;  5B2I B;  1B6W A;  2NZD C;  3UTA A;  1P3A B;  3REK C;  3MGP B;  4XUJ A;  1M19 B;  3AZG D;  1F66 D;  3B6G C;  3WAA D;  2YFW B;  5B31 A;  3MNN B;  1P3O A;  5B31 C;  4Z66 A;  3KXB A;  5AV9 C;  4Z66 C;  3KXB C;  1P3I A;  5C3I C;  3WTP C;  3AZE C;  1S32 B;  3REI A;  5F99 D;  4WU9 D;  5GT0 A;  2ARO D;  5GSU C;  1AOI A;  2F8N G;  4J8V D;  1KX3 D;  3AFA C;  4Z5T B;  2NQB D;  4LD9 C;  4YM6 B;  2CV5 D;  1JFI B;  3VH5 W;  1M1A D;  2HIO A;  5B1L A;  1P3G B;  2HIO C;  5CP6 D;  4R8P B;  5B1L C;  5GT3 B;  3X1T A;  3X1U A;  3AZM D;  4DRB A;  3X1U C;  5B2I C;  5B0Z B;  3REH C;  3AYW D;  3AZN D;  1P3A A;  3MGP A;  1M19 A;  3MGP C;  1M19 C;  1M18 D;  5BT1 C;  1P3M D;  3W97 B;  3MNN A;  5FUG B;  3REL B;  1M18 B;  1F66 A;  3W98 D;  3X1V B;  5CPK D;  1P3K D;  1S32 A;  3AZF D;  1S32 C;  1U35 C;  4NFT A;  5AV6 B;  3LEL B;  4XZQ D;  4Z5T A;  5B1M D;  3AV2 D;  4Z5T C;  4YM6 A;  5B32 G;  3KSY A;  4J8X D;  4YM6 C;  3AV1 B;  2F8N K;  3AZL B;  1KX3 A;  4UUZ B;  5DNM C;  3AZK D;  3UTB D;  2PYO D;  5AY8 B;  5B0Y B;  1P3G A;  4R8P A;  3C1B C;  5GT3 A;  1P3G C;  3W99 C;  1EQZ D;  5GT3 C;  3W96 D;  1TAF B;  5B0Z A;  5AVC D;  1P3P C;  5B24 B;  3LJA D;  5JA4 B;  1P34 B;  3B6F D;  3B0B A;  4H9Q B;  3UTA D;  3W97 A;  1ULY A;  5B40 B;  3LJA B;  5FUG A;  3W97 C;  3B6F B;  3REL A;  3B6G D;  1M18 A;  1Q9C A;  2NZD B;  1R4V A;  3REK B;  3WKJ B;  3X1V A;  5BO0 B;  5BS7 A;  3X1V C;  5B31 D;  5BS7 C;  5AV9 D;  1P3O D;  5DNN C;  4Z66 D;  3KXB D;  3B6G B;  1P3I D;  3WTP D;  5AV6 A;  3LEL C;  4J8W B;  3REI D;  5GT0 D;  3AV1 A;  3AZE B;  3AZL A;  3AV1 C;  3AZL C;  4H9S C;  5GSU B;  5GXQ B;  5AY8 A;  4QLC C;  5B0Y C;  3AFA B;  3AZI C;  4KUD C;  1TAF A;  3REJ B;  4LD9 B;  2HIO D;  5B24 A;  5AV5 B;  5B1L D;  5JA4 A;  1P34 A;  5B24 C;  1P34 C;  3X1T D;  1EQZ A;  4HGA C;  3X1U D;  5B2I D;  4DRA A;  3W96 A;  1P3A D;  5E5A C;  3LZ1 C;  3MGP D;  5B40 A;  3LJA A;  1M19 D;  3B6F A;  5B40 C;  5BT1 D;  1ZLA B;  2NZD A;  3REH B;  3REK A;  3WKJ A;  5BO0 A;  3WKJ C;  4WNN B;  3MNN D;  4E44 A;  3C1C C;  4WU8 C;  5B2J B;  3B6G A;  4J8U B;  4J8W A;  1S32 D;  5AV9 A;  4J8W C;  1HTA A;  4Z2M H;  1P3B C;  1A7W A;  3WTP A;  3AZE A;  3AN2 C;  4EO5 C;  4Z5T D;  1U35 B;  4YM6 D;  5GSU A;  5GXQ A;  4X23 C;  5CPJ C;  3UT9 B;  5GXQ C;  3AFA A;  4YS3 B;  2CWE A;  2LY8 A;  3REJ A;  4LD9 A;  5CHL B;  3REJ C;  1P3L B;  5AV5 A;  3NQJ B;  4WV4 B;  1P3G D;  3O62 B;  5AV5 C;  5G49 B;  4R8P D;  5GT3 D;  4WZS B;  5DNM B;  2JSS A;  4ZBJ C;  2HUE B;  5B0Z D;  4KGC C;  3LZ0 C;  4H9N B;  3C1B B;  3W99 B;  4JJN B;  1TZY C;  1ZLA A;  5B2I A;  3REH A;  1ZLA C;  1P3P B;  3A6N B;  3W97 D;  4WNN A;  5BNX B;  3REL D;  5B2J A;  5B2J C;  4J8U A;  3X1V D;  2YFW A;  4J8U C;  4G91 B;  3TU4 B;  3AZJ B;  5AV6 D;  3LEL D;  4H9O B;  1U35 A;  5DNN B;  3MGR C;  4ZUX B;  3MGS B;  5CPI C;  3UT9 A;  3AV1 D;  4NE6 A;  3AZL D;  3NQU B;  3UT9 C;  4YS3 A;  5B33 C;  4YS3 C;  1P3L A;  3NQJ A;  5AY8 D;  5B0Y D;  3AZH B;  3O62 A;  1P3L C;  3AZI D;  1JFI A;  3O62 C;  5DNM A;  2HUE C;  5B24 D;  4H9N A;  4QLC B; 
#chains in the Genus database with same CATH topology
 3C1B A;  3AZG C;  1P34 D;  3W99 A;  4JJN A;  3AZI B;  1ID3 B;  1KX5 B;  4KUD B;  3KUY B;  4JJN C;  4H9P B;  1P3P A;  3A6N A;  5B40 D;  3A6N C;  5BNX A;  4HGA B;  2NZD D;  3REK D;  5AVB B;  3WKJ D;  5E5A B;  3LZ1 B;  5B32 B;  2Y2G A;  4G91 C;  3TU4 A;  3TU4 C;  3X1S B;  4H9O A;  3KWQ B;  3AZJ C;  1WWS A;  3F6T A;  4J8W D;  5DNN A;  3C1C B;  2FJ7 B;  4WU8 B;  3VH6 T;  4ZUX A;  3R45 B;  3MGS A;  4ZUX C;  3MGQ B;  3MGS C;  5JRG B;  1BH8 B;  3LEL A;  3AZE D;  3NQU A;  4KHA B;  3MVD B;  5B31 G;  1WWI A;  1P3F B;  1P3B B;  5GSU D;  5GXQ D;  3AZH A;  4CSR B;  3AN2 B;  3AZH C;  4EO5 B;  1N1J B;  3AFA D;  5BNV B;  4UUZ A;  5AV8 B;  2YFV B;  3REJ D;  4LD9 D;  4H9S A;  4X23 B;  5AV5 D;  3VH5 A;  5CPJ B;  1BH9 A;  4QLC A;  5B0Y A;  3AZI A;  1ID3 A;  2JE5 A;  4KUD A;  1ID3 C;  1KX5 C;  4H9P A;  3KUY C;  1P3M C;  4XUJ B;  4M6B A;  1ZLA D;  4ZBJ B;  3REH D;  5CPK C;  4H9Q A;  5AVB A;  4KGC B;  5E5A A;  3LZ1 A;  3LZ0 B;  5AVB C;  1TZY B;  5B32 C;  3VH6 A;  3WTP E;  5B2J D;  2ZM5 A;  3X1S A;  4J8U D;  3KWQ A;  3X1S C;  3KWQ C;  5B1M C;  3C1C A;  4WU8 A;  3AV2 C;  3R45 A;  4G92 C;  2FJ7 C;  1HQ3 B;  4J8X C;  5JRG A;  3MGQ C;  1BH8 A;  1KX4 B;  5JRG C;  4KHA A;  3MVD A;  1U35 D;  3MVD C;  1P3F A;  1P3B A;  1P3F C;  4CSR A;  3H0M C;  3AN2 A;  4CAY B;  3UT9 D;  3FDD A;  3WA9 B;  1N1J A;  5BNV A;  4YS3 D;  3MGR B;  2YFV A;  5AV8 C;  5CPI B;  1P3L D;  4X23 A;  5CPJ A;  3O62 D;  2IO5 C;  5DNM D;  5B33 B;  3UTA C;  2BYM B;  4XUJ C;  3C1B D;  3W99 D;  4JJN D;  4KGC A;  1P3P D;  2Y2N A;  3AL0 C;  3LZ0 A;  3A6N D;  3AZG B;  1P3O C;  1TZY A;  2F8N D;  1F66 B;  2RVQ C;  4AWL C;  1P3I C;  3WAA B;  4H9R B;  2BYK B;  3B0C T;  3TU4 D;  2F8N B;  3REI C;  3EPH A;  5GT0 C;  1HQ3 A;  5KDM B;  1AOI C;  3AZJ D;  1HQ3 C;  1KX4 A;  3B0D C;  1KX4 C;  5DNN D;  5F99 B;  4WU9 B;  4ZUX D;  2ARO B;  3MGS D;  4CAY A;  4J8V B;  1KX3 B;  3WA9 A;  2NQB B;  3WA9 C;  3MGR A;  2CV5 B;  4NE5 A;  5CPI A;  1B67 A;  3AZH D;  1M1A B;  3X1T C;  5B33 A;  2J8P A;  1P3A C;  2BYM A;  5CP6 B;  4QLC D;  3VH6 W;  3AZM B;  5G49 A;  1ID3 D;  2BG1 A;  1KX5 D;  4KUD D;  3KUY D;  3AYW B;  3AZN B;  3MNN C;  3AZG A;  2F8N H;  1F66 C;  3WAA A;  1P3M B;  5AVB D;  4H9R A;  3WAA C;  5E5A D;  3LZ1 D;  2BYK A;  3VH5 T;  5B32 D;  2F8N A;  3W98 B;  5KDM A;  5CPK B;  1P3K B;  1H3O B;  3X1S D;  3KWQ D;  3AZF B;  5F99 A;  3C1C D;  4WU8 D;  2L5A A;  4WU9 A;  2FJ7 D;  2ARO A;  4E45 A;  5F99 C;  4WU9 C;  3MGQ D;  2ARO C;  2Y2H A;  4XZQ B;  3AZJ A;  5JRG D;  4J8V A;  2NQB A;  4WJ3 C;  5B1M B;  4J8V C;  3MVD D;  3AV2 B;  1KX3 C;  2NQB C;  4G92 B;  1P3F D;  2CV5 A;  3V9R B;  4J8X B;  1P3B D;  1T3U A;  2CV5 C;  4R8P C;  1M1A A;  3AN2 D;  1M1A C;  1BFM A;  3AZK B;  5AV8 D;  3UTB B;  5B0Z C;  2PYO B;  5CP6 A;  4X23 D;  5CPJ D;  1EQZ B;  5CP6 C;  3AZM A;  2FFF B;  3W96 B;  3AZM C;  3AYW A;  5AVC B;  3P5J B;  3AZN A;  3AYW C;  3AZN C;  4XUJ D;  4Z2M G;  2IO5 B;  3REL C;  1KX5 A;  1M18 C;  3KUY A;  3UTA B;  4NE3 A;  1P3M A;  4KGC D;  3IP4 C;  3LZ0 D;  1TZY D;  2RVQ D;  2F2A C;  3W98 A;  5CPK A;  1P3K A;  1H3O A;  5AV6 C;  3W98 C;  1P3K C;  5B31 B;  3AZF A;  2DQN C;  5AV9 B;  1P3O B;  3AZF C;  4Z66 B;  5B32 A;  3KXB B;  5C3I B;  4AWL B;  1P3I B;  3WTP B;  1AOI D;  1HQ3 D;  4XZQ A;  1KX4 D;  1Z2C B;  4XZQ C;  5B1M A;  3AV2 A;  3REI B;  2FJ7 A;  5GT0 B;  3V9R A;  4J8X A;  1AOI B;  5AY8 C;  3MGQ A;  3WA9 D;  3B0D B;  3MGR D;  3AZK A;  3UTB A;  2PYO A;  3AZK C;  3UTB C;  3B0C W;  5CPI D;  2PYO C;  1EQZ C;  1KU5 A;  1F1E A;  5AVC A;  5B33 D;  3W96 C;  2HIO B;  5AV8 A;  2Y2M A;  5AVC C;  5B1L B;  3LJA C;  3X1T B;  3B6F C;  3X1U B;  5B2I B;  1B6W A;  2NZD C;  3UTA A;  1P3A B;  3REK C;  3MGP B;  4XUJ A;  1M19 B;  3AZG D;  2Y2L A;  3EG5 B;  1F66 D;  3B6G C;  3WAA D;  2YFW B;  5B31 A;  3MNN B;  1P3O A;  5B31 C;  4Z66 A;  3KXB A;  5AV9 C;  4Z66 C;  3KXB C;  1P3I A;  5C3I C;  3WTP C;  3AZE C;  1S32 B;  3REI A;  5F99 D;  4WU9 D;  5GT0 A;  2ARO D;  5GSU C;  1AOI A;  2F8N G;  4QLC B;  2G5H C;  4J8V D;  1KX3 D;  3AFA C;  4Z5T B;  2NQB D;  4LD9 C;  4YM6 B;  2CV5 D;  1JFI B;  3VH5 W;  3EPL A;  1M1A D;  3H0L C;  2HIO A;  5B1L A;  1P3G B;  2HIO C;  5CP6 D;  4R8P B;  5B1L C;  5GT3 B;  3X1T A;  3X1U A;  3AZM D;  2W8S A;  4DRB A;  3X1U C;  5B2I C;  5B0Z B;  3REH C;  3AYW D;  3AZN D;  1P3A A;  3MGP A;  1M19 A;  3MGP C;  2XD1 A;  1M19 C;  2Y2Q A;  1M18 D;  5BT1 C;  1P3M D;  3W97 B;  3MNN A;  5FUG B;  3REL B;  1M18 B;  3A1K A;  1F66 A;  3W98 D;  3X1V B;  5CPK D;  1P3K D;  1S32 A;  3AZF D;  1S32 C;  1U35 C;  4NFT A;  5AV6 B;  3LEL B;  2Y2O A;  4XZQ D;  2UWX A;  4Z5T A;  5B1M D;  3AV2 D;  4Z5T C;  4YM6 A;  5B32 G;  3KSY A;  4J8X D;  4YM6 C;  3AV1 B;  2F8N K;  3AZL B;  1KX3 A;  4UUZ B;  5DNM C;  3AZK D;  3UTB D;  2PYO D;  5AY8 B;  5B0Y B;  1P3G A;  4R8P A;  3C1B C;  5GT3 A;  1P3G C;  3W99 C;  1EQZ D;  5GT3 C;  3W96 D;  1TAF B;  5B0Z A;  5AVC D;  1P3P C;  5B24 B;  3EPJ A;  3LJA D;  5JA4 B;  1P34 B;  3B6F D;  2Y2J A;  3B0B A;  4H9Q B;  3UTA D;  2ZY3 A;  3W97 A;  1ULY A;  2G5I C;  5B40 B;  3LJA B;  5FUG A;  3W97 C;  3B6F B;  3REL A;  3B6G D;  1M18 A;  1Q9C A;  2NZD B;  1R4V A;  3REK B;  3WKJ B;  3X1V A;  5BO0 B;  5BS7 A;  3X1V C;  5B31 D;  5BS7 C;  5AV9 D;  1P3O D;  5DNN C;  4Z66 D;  3KXB D;  3B6G B;  1P3I D;  3WTP D;  5AV6 A;  3LEL C;  4J8W B;  3REI D;  5GT0 D;  3AV1 A;  3AZE B;  3AZL A;  3AV1 C;  3AZL C;  2Y2K A;  4H9S C;  5GSU B;  5GXQ B;  5AY8 A;  4QLC C;  2ZY2 A;  5B0Y C;  3AFA B;  3AZI C;  4KUD C;  1TAF A;  3REJ B;  4LD9 B;  2HIO D;  5B24 A;  5AV5 B;  5B1L D;  4DQY B;  5JA4 A;  1P34 A;  5B24 C;  1P34 C;  3X1T D;  1EQZ A;  4HGA C;  3X1U D;  5B2I D;  4DRA A;  3W96 A;  1P3A D;  5E5A C;  3LZ1 C;  3MGP D;  5B40 A;  3LJA A;  1M19 D;  3B6F A;  5B40 C;  5BT1 D;  1ZLA B;  2NZD A;  3REH B;  3REK A;  3WKJ A;  5BO0 A;  3WKJ C;  4WNN B;  3MNN D;  4E44 A;  3C1C C;  4WU8 C;  5B2J B;  3B6G A;  4J8U B;  4J8W A;  1S32 D;  5AV9 A;  4J8W C;  1HTA A;  4Z2M H;  1P3B C;  1A7W A;  3WTP A;  3AZE A;  3AN2 C;  4EO5 C;  4Z5T D;  1U35 B;  2RIQ A;  4YM6 D;  5GSU A;  5GXQ A;  4X23 C;  5CPJ C;  3UT9 B;  5GXQ C;  3AFA A;  4UPK A;  4YS3 B;  2CWE A;  2LY8 A;  3REJ A;  4LD9 A;  5CHL B;  2ZY4 A;  3REJ C;  1P3L B;  5AV5 A;  3NQJ B;  4WV4 B;  1P3G D;  3O62 B;  5AV5 C;  2Y2P A;  5G49 B;  2DF4 C;  4R8P D;  5GT3 D;  4WZS B;  5DNM B;  2JSS A;  4ZBJ C;  2XD5 A;  2HUE B;  5B0Z D;  4KGC C;  3LZ0 C;  4H9N B;  1W2E A;  3C1B B;  3W99 B;  4JJN B;  1PZR A;  1TZY C;  1ZLA A;  5B2I A;  3REH A;  1ZLA C;  1P3P B;  2VQR A;  3A6N B;  3W97 D;  4WNN A;  5BNX B;  3REL D;  5B2J A;  5B2J C;  4J8U A;  3X1V D;  2YFW A;  3A1I A;  4J8U C;  4G91 B;  3TU4 B;  2ZY5 A;  3AZJ B;  5AV6 D;  3LEL D;  4H9O B;  3H0R C;  5DNN B;  1U35 A;  3MGR C;  4ZUX B;  3MGS B;  5CPI C;  3UT9 A;  3AV1 D;  4NE6 A;  3AZL D;  3NQU B;  3UT9 C;  4YS3 A;  5B33 C;  4YS3 C;  1P3L A;  3KFU G;  3NQJ A;  5AY8 D;  5B0Y D;  3AZH B;  3O62 A;  1P3L C;  2JCH A;  3AZI D;  1JFI A;  3O62 C;  5DNM A;  2Y2I A;  3EPK A;  2HUE C;  5B24 D;  4H9N A;  1BH9 B; 
#chains in the Genus database with same CATH homology
 3C1B A;  3AZG C;  1P34 D;  3W99 A;  4JJN A;  3AZI B;  1ID3 B;  1KX5 B;  4KUD B;  3KUY B;  4JJN C;  4H9P B;  1P3P A;  3A6N A;  5B40 D;  3A6N C;  5BNX A;  4HGA B;  2NZD D;  3REK D;  5AVB B;  3WKJ D;  5E5A B;  3LZ1 B;  5B32 B;  2Y2G A;  4G91 C;  3TU4 A;  3TU4 C;  3X1S B;  4H9O A;  3KWQ B;  3AZJ C;  1WWS A;  3F6T A;  4J8W D;  5DNN A;  3C1C B;  2FJ7 B;  4WU8 B;  3VH6 T;  4ZUX A;  3R45 B;  3MGS A;  4ZUX C;  3MGQ B;  3MGS C;  5JRG B;  1BH8 B;  3LEL A;  3AZE D;  3NQU A;  4KHA B;  3MVD B;  5B31 G;  1WWI A;  1P3F B;  1P3B B;  5GSU D;  5GXQ D;  3AZH A;  4CSR B;  3AN2 B;  3AZH C;  4EO5 B;  1N1J B;  3AFA D;  5BNV B;  4UUZ A;  5AV8 B;  2YFV B;  3REJ D;  4LD9 D;  4H9S A;  4X23 B;  5AV5 D;  3VH5 A;  5CPJ B;  1BH9 A;  4QLC A;  5B0Y A;  3AZI A;  1ID3 A;  2JE5 A;  4KUD A;  1ID3 C;  1KX5 C;  4H9P A;  3KUY C;  1P3M C;  4XUJ B;  4M6B A;  1ZLA D;  4ZBJ B;  3REH D;  5CPK C;  4H9Q A;  5AVB A;  4KGC B;  5E5A A;  3LZ1 A;  3LZ0 B;  5AVB C;  1TZY B;  5B32 C;  3VH6 A;  3WTP E;  5B2J D;  2ZM5 A;  3X1S A;  4J8U D;  3KWQ A;  3X1S C;  3KWQ C;  5B1M C;  3C1C A;  4WU8 A;  3AV2 C;  3R45 A;  4G92 C;  2FJ7 C;  1HQ3 B;  4J8X C;  5JRG A;  3MGQ C;  1BH8 A;  1KX4 B;  5JRG C;  4KHA A;  3MVD A;  1U35 D;  3MVD C;  1P3F A;  1P3B A;  1P3F C;  4CSR A;  3H0M C;  3AN2 A;  4CAY B;  3UT9 D;  3FDD A;  3WA9 B;  1N1J A;  5BNV A;  4YS3 D;  3MGR B;  2YFV A;  5AV8 C;  5CPI B;  1P3L D;  4X23 A;  5CPJ A;  3O62 D;  2IO5 C;  5DNM D;  5B33 B;  3UTA C;  2BYM B;  4XUJ C;  3C1B D;  3W99 D;  4JJN D;  4KGC A;  1P3P D;  2Y2N A;  3AL0 C;  3LZ0 A;  3A6N D;  3AZG B;  1P3O C;  1TZY A;  2F8N D;  1F66 B;  2RVQ C;  4AWL C;  1P3I C;  3WAA B;  4H9R B;  2BYK B;  3B0C T;  3TU4 D;  2F8N B;  3REI C;  3EPH A;  5GT0 C;  1HQ3 A;  5KDM B;  1AOI C;  3AZJ D;  1HQ3 C;  1KX4 A;  3B0D C;  1KX4 C;  5DNN D;  5F99 B;  4WU9 B;  4ZUX D;  2ARO B;  3MGS D;  4CAY A;  4J8V B;  1KX3 B;  3WA9 A;  2NQB B;  3WA9 C;  3MGR A;  2CV5 B;  4NE5 A;  5CPI A;  1B67 A;  3AZH D;  1M1A B;  3X1T C;  5B33 A;  2J8P A;  1P3A C;  2BYM A;  5CP6 B;  4QLC D;  3VH6 W;  3AZM B;  5G49 A;  1ID3 D;  2BG1 A;  1KX5 D;  4KUD D;  3KUY D;  3AYW B;  3AZN B;  3MNN C;  3AZG A;  2F8N H;  1F66 C;  3WAA A;  1P3M B;  5AVB D;  4H9R A;  3WAA C;  5E5A D;  3LZ1 D;  2BYK A;  3VH5 T;  5B32 D;  2F8N A;  3W98 B;  5KDM A;  5CPK B;  1P3K B;  1H3O B;  3X1S D;  3KWQ D;  3AZF B;  5F99 A;  3C1C D;  4WU8 D;  2L5A A;  4WU9 A;  2FJ7 D;  2ARO A;  4E45 A;  5F99 C;  4WU9 C;  3MGQ D;  2ARO C;  2Y2H A;  4XZQ B;  3AZJ A;  5JRG D;  4J8V A;  2NQB A;  4WJ3 C;  5B1M B;  4J8V C;  3MVD D;  3AV2 B;  1KX3 C;  2NQB C;  4G92 B;  1P3F D;  2CV5 A;  3V9R B;  4J8X B;  1P3B D;  1T3U A;  2CV5 C;  4R8P C;  1M1A A;  3AN2 D;  1M1A C;  1BFM A;  3AZK B;  5AV8 D;  3UTB B;  5B0Z C;  2PYO B;  5CP6 A;  4X23 D;  5CPJ D;  1EQZ B;  5CP6 C;  3AZM A;  2FFF B;  3W96 B;  3AZM C;  3AYW A;  5AVC B;  3P5J B;  3AZN A;  3AYW C;  3AZN C;  4XUJ D;  4Z2M G;  2IO5 B;  3REL C;  1KX5 A;  1M18 C;  3KUY A;  3UTA B;  4NE3 A;  1P3M A;  4KGC D;  3IP4 C;  3LZ0 D;  1TZY D;  2RVQ D;  2F2A C;  3W98 A;  5CPK A;  1P3K A;  1H3O A;  5AV6 C;  3W98 C;  1P3K C;  5B31 B;  3AZF A;  2DQN C;  5AV9 B;  1P3O B;  3AZF C;  4Z66 B;  5B32 A;  3KXB B;  5C3I B;  4AWL B;  1P3I B;  3WTP B;  1AOI D;  1HQ3 D;  4XZQ A;  1KX4 D;  1Z2C B;  4XZQ C;  5B1M A;  3AV2 A;  3REI B;  2FJ7 A;  5GT0 B;  3V9R A;  4J8X A;  1AOI B;  5AY8 C;  3MGQ A;  3WA9 D;  3B0D B;  3MGR D;  3AZK A;  3UTB A;  2PYO A;  3AZK C;  3UTB C;  3B0C W;  5CPI D;  2PYO C;  1EQZ C;  1KU5 A;  1F1E A;  5AVC A;  5B33 D;  3W96 C;  2HIO B;  5AV8 A;  2Y2M A;  5AVC C;  5B1L B;  3LJA C;  3X1T B;  3B6F C;  3X1U B;  5B2I B;  1B6W A;  2NZD C;  3UTA A;  1P3A B;  3REK C;  3MGP B;  4XUJ A;  1M19 B;  3AZG D;  2Y2L A;  3EG5 B;  1F66 D;  3B6G C;  3WAA D;  2YFW B;  5B31 A;  3MNN B;  1P3O A;  5B31 C;  4Z66 A;  3KXB A;  5AV9 C;  4Z66 C;  3KXB C;  1P3I A;  5C3I C;  3WTP C;  3AZE C;  1S32 B;  3REI A;  5F99 D;  4WU9 D;  5GT0 A;  2ARO D;  5GSU C;  1AOI A;  2F8N G;  4QLC B;  2G5H C;  4J8V D;  1KX3 D;  3AFA C;  4Z5T B;  2NQB D;  4LD9 C;  4YM6 B;  2CV5 D;  1JFI B;  3VH5 W;  3EPL A;  1M1A D;  3H0L C;  2HIO A;  5B1L A;  1P3G B;  2HIO C;  5CP6 D;  4R8P B;  5B1L C;  5GT3 B;  3X1T A;  3X1U A;  3AZM D;  2W8S A;  4DRB A;  3X1U C;  5B2I C;  5B0Z B;  3REH C;  3AYW D;  3AZN D;  1P3A A;  3MGP A;  1M19 A;  3MGP C;  2XD1 A;  1M19 C;  2Y2Q A;  1M18 D;  5BT1 C;  1P3M D;  3W97 B;  3MNN A;  5FUG B;  3REL B;  1M18 B;  3A1K A;  1F66 A;  3W98 D;  3X1V B;  5CPK D;  1P3K D;  1S32 A;  3AZF D;  1S32 C;  1U35 C;  4NFT A;  5AV6 B;  3LEL B;  2Y2O A;  4XZQ D;  2UWX A;  4Z5T A;  5B1M D;  3AV2 D;  4Z5T C;  4YM6 A;  5B32 G;  3KSY A;  4J8X D;  4YM6 C;  3AV1 B;  2F8N K;  3AZL B;  1KX3 A;  4UUZ B;  5DNM C;  3AZK D;  3UTB D;  2PYO D;  5AY8 B;  5B0Y B;  1P3G A;  4R8P A;  3C1B C;  5GT3 A;  1P3G C;  3W99 C;  1EQZ D;  5GT3 C;  3W96 D;  1TAF B;  5B0Z A;  5AVC D;  1P3P C;  5B24 B;  3EPJ A;  3LJA D;  5JA4 B;  1P34 B;  3B6F D;  2Y2J A;  3B0B A;  4H9Q B;  3UTA D;  2ZY3 A;  3W97 A;  1ULY A;  2G5I C;  5B40 B;  3LJA B;  5FUG A;  3W97 C;  3B6F B;  3REL A;  3B6G D;  1M18 A;  1Q9C A;  2NZD B;  1R4V A;  3REK B;  3WKJ B;  3X1V A;  5BO0 B;  5BS7 A;  3X1V C;  5B31 D;  5BS7 C;  5AV9 D;  1P3O D;  5DNN C;  4Z66 D;  3KXB D;  3B6G B;  1P3I D;  3WTP D;  5AV6 A;  3LEL C;  4J8W B;  3REI D;  5GT0 D;  3AV1 A;  3AZE B;  3AZL A;  3AV1 C;  3AZL C;  2Y2K A;  4H9S C;  5GSU B;  5GXQ B;  5AY8 A;  4QLC C;  2ZY2 A;  5B0Y C;  3AFA B;  3AZI C;  4KUD C;  1TAF A;  3REJ B;  4LD9 B;  2HIO D;  5B24 A;  5AV5 B;  5B1L D;  4DQY B;  5JA4 A;  1P34 A;  5B24 C;  1P34 C;  3X1T D;  1EQZ A;  4HGA C;  3X1U D;  5B2I D;  4DRA A;  3W96 A;  1P3A D;  5E5A C;  3LZ1 C;  3MGP D;  5B40 A;  3LJA A;  1M19 D;  3B6F A;  5B40 C;  5BT1 D;  1ZLA B;  2NZD A;  3REH B;  3REK A;  3WKJ A;  5BO0 A;  3WKJ C;  4WNN B;  3MNN D;  4E44 A;  3C1C C;  4WU8 C;  5B2J B;  3B6G A;  4J8U B;  4J8W A;  1S32 D;  5AV9 A;  4J8W C;  1HTA A;  4Z2M H;  1P3B C;  1A7W A;  3WTP A;  3AZE A;  3AN2 C;  4EO5 C;  4Z5T D;  1U35 B;  2RIQ A;  4YM6 D;  5GSU A;  5GXQ A;  4X23 C;  5CPJ C;  3UT9 B;  5GXQ C;  3AFA A;  4UPK A;  4YS3 B;  2CWE A;  2LY8 A;  3REJ A;  4LD9 A;  5CHL B;  2ZY4 A;  3REJ C;  1P3L B;  5AV5 A;  3NQJ B;  4WV4 B;  1P3G D;  3O62 B;  5AV5 C;  2Y2P A;  5G49 B;  2DF4 C;  4R8P D;  5GT3 D;  4WZS B;  5DNM B;  2JSS A;  4ZBJ C;  2XD5 A;  2HUE B;  5B0Z D;  4KGC C;  3LZ0 C;  4H9N B;  1W2E A;  3C1B B;  3W99 B;  4JJN B;  1PZR A;  1TZY C;  1ZLA A;  5B2I A;  3REH A;  1ZLA C;  1P3P B;  2VQR A;  3A6N B;  3W97 D;  4WNN A;  5BNX B;  3REL D;  5B2J A;  5B2J C;  4J8U A;  3X1V D;  2YFW A;  3A1I A;  4J8U C;  4G91 B;  3TU4 B;  2ZY5 A;  3AZJ B;  5AV6 D;  3LEL D;  4H9O B;  3H0R C;  5DNN B;  1U35 A;  3MGR C;  4ZUX B;  3MGS B;  5CPI C;  3UT9 A;  3AV1 D;  4NE6 A;  3AZL D;  3NQU B;  3UT9 C;  4YS3 A;  5B33 C;  4YS3 C;  1P3L A;  3KFU G;  3NQJ A;  5AY8 D;  5B0Y D;  3AZH B;  3O62 A;  1P3L C;  2JCH A;  3AZI D;  1JFI A;  3O62 C;  5DNM A;  2Y2I A;  3EPK A;  2HUE C;  5B24 D;  4H9N A;  1BH9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...