1M18D

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
94
structure length
94
Chain Sequence
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146 Base Pair DNA Fragment
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 36
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m18D00
4X23A 1P3PC 1ULYA 1P3AA 5GT0C 4QLCC 1P3MA 5DNMD 3UTBA 3O62B 1BH8B 1TAFA 3B0CT 5B33D 5DNMC 4DRAA 1KX5D 4HGAB 3A6NB 1ZLAD 2BYMB 4J8WB 5AV5D 5B33C 4JJNA 3AN2B 5B31B 3MVDA 1KX5C 5JA4B 5GT3A 3NQUA 5AV5C 5CPJD 2HIOB 2CV5B 5G49B 5BS7C 4NE6A 4EO5C 5CPJC 3WTPB 3AZNB 5JRGA 4CAYB 1N1JA 3AZFB 5AY8D 5DNNA 3AYWD 1P3PB 3AZJA 5GT0B 4QLCB 5AY8C 5E5AD 2YFWA 3B0BA 3LELA 3AV1A 4YS3A 2NQBA 3AYWC 3AZGD 5GSUD 5AV6C 1M19B 3X1SA 5DNMB 1P34A 3TU4B 3AZGC 4DRBA 4H9OA 2CWEA 2F8NA 1ID3D 5GSUC 5B33B 4X23D 1P3IA 1P3AD 1ID3C 4UUZB 1P3MD 5AV5B 3UTBD 1KU5A 4NE3A 1P3AC 1P3MC 4G92C 5CPJB 4KHAB 4KGCD 3REHD 4JJND 3MVDD 3AN2A 5GT3D 3WKJB 2BYKA 5JA4A 5AY8B 1F66A 4KGCC 5BNXB 3REHC 4JJNC 3AYWB 1M18C 3MVDC 5AV6B 2CV5A 5G49A 3AZGB 5JRGD 3AZNA 5DNND 4Z5TA 5B40D 3AZJD 5JRGC 1P3PA 1ID3B 4YM6B 3LELD 5DNNC 3AV1D 5B40C 1B67A 3AZJC 1P3AB 1EQZA 1P3MB 5C3IC 4G92B 3X1SD 3LELC 1P34D 3AV1C 1M19A 5DNMA 1TAFB 2F8ND 3TU4A 3VH5T 3AZLD 3X1SC 4ZUXD 1P3ID 3AZLC 1P3BA 1M1AA 4KGCB 3REHB 4JJNB 4ZUXC 1M18B 3MVDB 4J8XA 1P3IC 2RVQD 3AZEA 5BNVA 3NQUB 4CSRB 5CPJA 1KX4D 2RVQC 1BH9A 5B31G 3AN2D 2NZDA 1N1JB 2YFVA 1KX4C 4HGAC 5AVCA 1F66D 5DNNB 3WKJA 5AY8A 5B40B 4E45A 3AZJB 4KUDA 3AYWA 1KX3A 5C3IB 2CV5D 5AV6A 3LELB 1F66C 3AV1B 1P3KA 5CP6D 4Z2MH 3AZND 3X1SB 3WAAC 4Z5TD 5CP6C 5B0YD 2F8NB 1P3PD 4WZSB 3AZLB 5B1MA 4Z5TC 4ZUXB 4YM6A 4NFTA 4LD9A 1P3IB 5B0YC 1EQZD 5B2JD 1M19D 4XUJA 3TU4D 1EQZC 5B2JC 1M19C 3LZ0C 4NE5A 1KX4B 3W99A 3TU4C 1P3BD 1M1AD 5F99C 1P3FA 4KGCA 3W96D 3REHA 1M18A 4J8XD 3NQJB 2BYKB 1HTAA 3AZED 1P3BC 1M1AC 1F66B 3WA9A 3W97C 3W96C 4J8XC 4CSRA 3AZEC 3WAAB 5CP6B 2NZDD 5B1LA 5AVCD 3WKJD 4Z5TB 4KUDD 5B40A 5B0YB 2NZDC 5FUGB 3AFAA 1KX3D 5AVCC 5AV6D 3WKJC 1P3KD 3AZKC 5BO0B 5B32A 5CPKA 4KUDC 3LZ1A 1EQZB 1KX3C 5B2JB 1P3KC 3LZ0B 1P3OA 1S32B 5F99B 3REIC 5B1MD 3AZLA 4YM6D 3V9RA 3AZMA 3AZHA 4LD9D 4ZUXA 1P3BB 1M1AB 1JFIA 3W97B 5B1MC 4XUJD 1F1EA 4YM6C 3W96B 4LD9C 3KSYA 4J8XB 3AZEB 5BNVB 3WTPE 4XUJC 3W99D 1KX4A 1BH9B 1TZYA 3KUYA 1P3FD 1M18D 3W99C 2YFVB 2NZDB 2JSSA 5AVCB 3WA9D 3AZIA 3NQJA 3AZKB 1P3FC 4KUDB 3KWQB 3REJB 4H9PB 1KX3B 3WA9C 1P3KB 3WAAA 5CP6A 5B1LD 3REIB 3B6GC 2AROD 5AVBB 2LY8A 3AFAD 5B1LC 5B0YA 5FUGA 5B1MB 4WU8C 5B32D 5CPKD 2AROC 4LD9B 3LZ1D 5BO0A 3AFAC 3MNND 3MGPB 4XUJB 5B32C 5B2JA 5CPKC 2F8NG 1P3OD 3LZ1C 3LZ0A 3UT9A 3MNNC 1S32A 5F99A 3AZMD 3AZHD 1P3OC 4H9RA 3W99B 3VH6A 1P3FB 3W97A 3R45B 3AZMC 3AZHC 3VH6W 4R8PA 3W96A 5B0ZA 3WA9B 3UTAC 1BFMA 2HUEC 1TZYD 4H9NB 4WU9D 3KUYD 3B6GB 5BT1D 3AV2A 5B1LB 5B24A 4WU8B 3AZID 1TZYC 3KUYC 4WU9C 3C1BA 2F8NK 2AROB 3REKB 3AZKA 5BT1C 4G91C 3AFAB 3KWQA 3REJA 4Z66C 4H9PA 3AZIC 5B32B 5CPKB 3WAAD 3LZ1B 1P3LA 2FJ7A 3X1UA 3MNNB 1AOIA 1WWSA 3REIA 1P3OB 3B0DC 2IO5C 5AVBA 4WNNA 3V9RB 3AZMB 3AZHB 4M6BA 5KDMA 1JFIB 5CPIC 3UTAB 3MGPA 3LZ0D 3UT9D 2HUEB 1H3OB 1S32D 2PYOA 5F99D 5AV8A 4AWLB 3UT9C 1S32C 3W98A 1TZYB 4H9QB 3KUYB 4J8VA 4WU9B 5GXQA 3W97D 4R8PD 4G91B 3RELA 3R45A 5B0ZD 5B2IA 3MGSD 4Z66B 3AZIB 3MGQA 4R8PC 4XZQA 5B0ZC 5CHLB 3MGSC 4E44A 4H9NA 3B0DB 3AV2D 3B6GA 2IO5B 3B0CW 3KXBA 5B24D 3X1VD 3C1BD 4WU8A 3AZKD 3AV2C 2AROA 3REKA 3KWQD 3REJD 5B24C 1B6WA 5CPIB 3X1VC 3LJAB 4J8UA 3C1BC 1P3LD 2FJ7D 3X1UD 3KWQC 1AOID 3REJC 3MNNA 3C1CB 3REID 1ZLAC 1R4VA 3UT9B 1P3LC 2FJ7C 3X1UC 5AVBD 1AOIC 1A7WA 3X1TA 4H9RB 5AVBC 3MGPD 3UTAA 4R8PB 5B0ZB 3MGSB 2PYOD 1H3OA 3B6FA 3MGPC 5AV8D 1U35A 3W98D 2PYOC 4J8VD 5GXQD 4H9QA 4WU9A 3AV2B 5AV9D 3RELD 5AV8C 1HQ3A 5E5AC 5B2ID 5B24B 1P3GA 3W98C 3X1VB 4Z66A 1WWIA 3C1BB 5GXQC 4J8VC 3MGQD 4XZQD 5AV9C 3MGRA 3RELC 4H9SA 5B2IC 1KX5B 1ZLAB 3MGQC 3B6GD 4XZQC 1P3LB 2FJ7B 3X1UB 3KXBD 1AOIB 4X23C 3O62A 1BH8A 4WU8D 3REKD 3KXBC 4WNNB 4EO5B 3UTBC 5B32G 4J8UD 5CPIA 3LJAA 3A6NA 2BYMA 3REKC 5KDMB 4J8WA 4ZBJC 4J8UC 5B31A 3C1CA 2PYOB 3X1TD 2HIOA 5GT3C 5AV8B 5E5AB 2L5AA 3W98B 4J8VB 5GXQB 3X1TC 3WTPA 3UTAD 5GSUB 5AV9B 4CAYA 3RELB 3AZFA 5B2IB 3MGSA 3B6FD 3MGQB 4XZQB 5GT0A 3VH6T 4QLCA 3VH5A 4YS3D 1U35D 2NQBD 4X23B 3B6FC 3VH5W 1HQ3D 3KXBB 3UTBB 4YS3C 4AWLC 1P3GD 1U35C 2F8NH 2NQBC 4Z66D 3X1VA 3MGRD 1HQ3C 1P34C 1P3GC 5B33A 4ZBJB 4J8UB 1Q9CA 1KX5A 3MGRC 1ZLAA 4H9SC 4UUZA 4Z2MG 5AV5A 3O62D 5GT3B 5BS7A 3X1TB 5CPID 3O62C 4KHAA 3LJAD 3A6ND 4J8WD 5JRGB 5B31D 3C1CD 3LJAC 3A6NC 4J8WC 3B6FB 5BNXA 2HIOD 3AN2C 5B31C 3C1CC 2YFWB 4YS3B 5E5AA 1U35B 2NQBB 2HIOC 3WTPD 3AZGA 1HQ3B 3AZFD 2CV5C 5GSUA 1P34B 5AV9A 1P3GB 4WV4B 4H9OB 3WTPC 3AZNC 3MGRB 5GT0D 3AZFC 4QLCD 1ID3A
chains in the Genus database with same CATH superfamily
4X23A 1P3PC 1ULYA 1P3AA 5GT0C 4QLCC 1P3MA 5DNMD 3UTBA 3O62B 1BH8B 1TAFA 2Y2QA 3B0CT 5B33D 5DNMC 4DRAA 1KX5D 4HGAB 3A6NB 1ZLAD 2BYMB 4J8WB 5AV5D 5B33C 4JJNA 3AN2B 5B31B 3MVDA 1KX5C 5JA4B 5GT3A 3NQUA 5AV5C 5CPJD 2HIOB 2FFFB 2CV5B 2VQRA 5G49B 5BS7C 4NE6A 2ZM5A 4EO5C 5CPJC 3WTPB 3AZNB 5JRGA 4CAYB 1N1JA 3AZFB 2JE5A 5AY8D 5DNNA 3AYWD 1P3PB 3AZJA 5GT0B 4QLCB 3EG5B 5AY8C 5E5AD 2YFWA 3B0BA 3LELA 3AV1A 4YS3A 2NQBA 3AYWC 3AZGD 5GSUD 5AV6C 1M19B 3X1SA 5DNMB 3EPKA 1P34A 3TU4B 3AZGC 3H0RC 4DRBA 4H9OA 2CWEA 2F8NA 1ID3D 5GSUC 5B33B 4X23D 1P3IA 1P3AD 1ID3C 4UUZB 1P3MD 5AV5B 3UTBD 1KU5A 4NE3A 2W8SA 1P3AC 3F6TA 1P3MC 4G92C 5CPJB 4KHAB 4KGCD 3REHD 4JJND 3MVDD 3AN2A 5GT3D 3WKJB 2BYKA 5JA4A 5AY8B 1F66A 4KGCC 5BNXB 3REHC 1Z2CB 4JJNC 3AYWB 1M18C 3MVDC 5AV6B 2CV5A 5G49A 3AZGB 5JRGD 3EPJA 3AZNA 5DNND 4Z5TA 5B40D 3AZJD 2XD5A 5JRGC 1P3PA 1ID3B 4YM6B 2Y2LA 3LELD 2G5HC 5DNNC 3AV1D 5B40C 1B67A 3AZJC 1P3AB 1EQZA 1P3MB 5C3IC 4G92B 3X1SD 3LELC 1P34D 3AV1C 1M19A 5DNMA 1TAFB 3EPLA 2F8ND 3TU4A 3VH5T 3KFUG 3AZLD 3X1SC 4ZUXD 1P3ID 3AZLC 1P3BA 1M1AA 4KGCB 3REHB 4JJNB 4ZUXC 1M18B 3MVDB 4J8XA 1P3IC 2RVQD 3AZEA 5BNVA 3NQUB 3FDDA 4CSRB 5CPJA 1KX4D 2RVQC 1BH9A 5B31G 3AN2D 2NZDA 1N1JB 2YFVA 1KX4C 4HGAC 2Y2NA 5AVCA 1F66D 5DNNB 3WKJA 5AY8A 5B40B 4E45A 3AZJB 4KUDA 3AYWA 1KX3A 5C3IB 2CV5D 5AV6A 3LELB 1F66C 3AV1B 1P3KA 5CP6D 4Z2MH 3AZND 3X1SB 3WAAC 4Z5TD 5CP6C 5B0YD 2F8NB 1P3PD 4WZSB 3AZLB 5B1MA 4Z5TC 4ZUXB 4YM6A 4NFTA 4LD9A 1P3IB 5B0YC 1EQZD 5B2JD 1M19D 4XUJA 2Y2GA 3TU4D 1EQZC 5B2JC 1M19C 3LZ0C 4NE5A 1KX4B 3W99A 3TU4C 1P3BD 1M1AD 5F99C 1P3FA 4KGCA 3W96D 3REHA 1M18A 4J8XD 3NQJB 2BYKB 1HTAA 3AZED 1P3BC 1M1AC 1F66B 3WA9A 3W97C 3W96C 4J8XC 4CSRA 3AZEC 3WAAB 5CP6B 2NZDD 5B1LA 5AVCD 3WKJD 4Z5TB 4KUDD 5B40A 5B0YB 2NZDC 5FUGB 3AFAA 1KX3D 5AVCC 5AV6D 3WKJC 2BG1A 1P3KD 3AZKC 5BO0B 5B32A 5CPKA 4KUDC 3LZ1A 1EQZB 1KX3C 5B2JB 1P3KC 3LZ0B 1P3OA 1S32B 5F99B 3REIC 5B1MD 3AZLA 4YM6D 3V9RA 3AZMA 3AZHA 4LD9D 4ZUXA 1P3BB 1M1AB 1JFIA 3W97B 5B1MC 4XUJD 1F1EA 4YM6C 3W96B 4LD9C 3KSYA 4J8XB 3AZEB 5BNVB 3WTPE 4XUJC 3W99D 3A1KA 2DQNC 1KX4A 1BH9B 2ZY2A 1TZYA 3KUYA 1P3FD 2UWXA 1M18D 3W99C 2YFVB 2NZDB 2JSSA 5AVCB 3WA9D 3AZIA 3NQJA 3AZKB 1P3FC 4KUDB 3KWQB 3REJB 4H9PB 1KX3B 3WA9C 1P3KB 3WAAA 5CP6A 5B1LD 4UPKA 3REIB 3B6GC 2AROD 5AVBB 2LY8A 3AFAD 5B1LC 5B0YA 5FUGA 5B1MB 4WU8C 5B32D 5CPKD 2AROC 4LD9B 3LZ1D 5BO0A 3AFAC 3MNND 2ZY3A 3MGPB 4XUJB 5B32C 5B2JA 5CPKC 2F8NG 1P3OD 3LZ1C 3LZ0A 3UT9A 3MNNC 1S32A 2JCHA 5F99A 2RIQA 3AZMD 3AZHD 1P3OC 4H9RA 3W99B 3VH6A 1P3FB 3W97A 3R45B 3AZMC 3AZHC 3VH6W 4R8PA 3W96A 5B0ZA 3WA9B 2G5IC 3UTAC 1BFMA 2HUEC 1TZYD 4H9NB 4WU9D 3KUYD 3B6GB 2Y2IA 5BT1D 3AV2A 5B1LB 5B24A 4WU8B 3AZID 1TZYC 3KUYC 4WU9C 3C1BA 2F8NK 2AROB 3REKB 3AZKA 5BT1C 4G91C 3AFAB 3KWQA 3REJA 4Z66C 4H9PA 3AZIC 5B32B 5CPKB 3WAAD 3LZ1B 1P3LA 2FJ7A 3X1UA 3MNNB 1AOIA 1WWSA 3REIA 1P3OB 3B0DC 2IO5C 5AVBA 4WNNA 3V9RB 3AZMB 3AZHB 4M6BA 5KDMA 1JFIB 5CPIC 3UTAB 3MGPA 1PZRA 3LZ0D 3UT9D 2HUEB 1H3OB 1S32D 2PYOA 5F99D 5AV8A 4AWLB 3UT9C 1S32C 3W98A 3H0MC 1TZYB 4H9QB 3KUYB 4J8VA 4WU9B 5GXQA 3W97D 4R8PD 4G91B 3RELA 3R45A 5B0ZD 5B2IA 3MGSD 4Z66B 3AZIB 3MGQA 4R8PC 4XZQA 5B0ZC 5CHLB 2ZY5A 3MGSC 4E44A 4H9NA 3B0DB 3AV2D 3B6GA 2IO5B 3B0CW 3KXBA 5B24D 3X1VD 3C1BD 2F2AC 2Y2HA 4WU8A 3AZKD 3AV2C 2AROA 3REKA 3KWQD 3REJD 5B24C 1B6WA 5CPIB 3X1VC 3LJAB 4J8UA 3C1BC 1P3LD 2FJ7D 3X1UD 3KWQC 1AOID 3REJC 3P5JB 3MNNA 3C1CB 3REID 1ZLAC 1R4VA 3UT9B 1P3LC 2FJ7C 3X1UC 5AVBD 1AOIC 1A7WA 3X1TA 4H9RB 5AVBC 3MGPD 3UTAA 4R8PB 5B0ZB 3MGSB 2PYOD 1H3OA 3B6FA 3MGPC 5AV8D 2Y2JA 1U35A 3W98D 2PYOC 4J8VD 5GXQD 3H0LC 4H9QA 4WU9A 3AV2B 5AV9D 3RELD 5AV8C 1HQ3A 5E5AC 5B2ID 5B24B 1P3GA 3W98C 3X1VB 4Z66A 1WWIA 3C1BB 5GXQC 4J8VC 3MGQD 3AL0C 4XZQD 5AV9C 3MGRA 3RELC 4H9SA 5B2IC 1KX5B 1ZLAB 3MGQC 3B6GD 4XZQC 1P3LB 2FJ7B 3X1UB 1T3UA 3KXBD 1AOIB 4X23C 3O62A 1BH8A 4WU8D 3REKD 2XD1A 4WNNB 4EO5B 3KXBC 3UTBC 5B32G 4J8UD 5CPIA 3LJAA 3A6NA 2Y2MA 2BYMA 3REKC 5KDMB 4J8WA 4ZBJC 4J8UC 5B31A 3C1CA 2PYOB 2Y2KA 3X1TD 2HIOA 5GT3C 5AV8B 5E5AB 2L5AA 3W98B 4J8VB 5GXQB 3X1TC 3WTPA 3UTAD 5GSUB 5AV9B 4CAYA 3RELB 3AZFA 5B2IB 3MGSA 3B6FD 3MGQB 4XZQB 5GT0A 3VH6T 4QLCA 3VH5A 4YS3D 1U35D 2NQBD 4X23B 3B6FC 4DQYB 2Y2OA 3VH5W 1HQ3D 3KXBB 3UTBB 4YS3C 4AWLC 1P3GD 1U35C 2F8NH 2NQBC 4Z66D 3X1VA 3MGRD 1HQ3C 1P34C 2ZY4A 1P3GC 5B33A 4ZBJB 4J8UB 1Q9CA 1KX5A 3MGRC 1ZLAA 4H9SC 4UUZA 4Z2MG 5AV5A 3O62D 5GT3B 5BS7A 3X1TB 5CPID 3O62C 4KHAA 3LJAD 3A6ND 3A1IA 1W2EA 4J8WD 5JRGB 2Y2PA 5B31D 3C1CD 3LJAC 3A6NC 3EPHA 4WJ3C 4J8WC 3B6FB 5BNXA 2HIOD 3AN2C 5B31C 3C1CC 2DF4C 2YFWB 3IP4C 4YS3B 5E5AA 1U35B 2NQBB 2HIOC 3WTPD 3AZGA 1HQ3B 3AZFD 2CV5C 5GSUA 1P34B 5AV9A 1P3GB 4WV4B 4H9OB 3WTPC 3AZNC 3MGRB 5GT0D 3AZFC 4QLCD 1ID3A 2J8PA
chains in the Genus database with same CATH topology
4X23A 1P3PC 1ULYA 1P3AA 5GT0C 4QLCC 1P3MA 5DNMD 3UTBA 3O62B 1BH8B 1TAFA 2Y2QA 3B0CT 5B33D 5DNMC 4DRAA 1KX5D 4HGAB 3A6NB 1ZLAD 2BYMB 4J8WB 5AV5D 5B33C 4JJNA 3AN2B 5B31B 3MVDA 1KX5C 5JA4B 5GT3A 3NQUA 5AV5C 5CPJD 2HIOB 2FFFB 2CV5B 2VQRA 5G49B 5BS7C 4NE6A 2ZM5A 4EO5C 5CPJC 3WTPB 3AZNB 5JRGA 4CAYB 1N1JA 3AZFB 2JE5A 5AY8D 5DNNA 3AYWD 1P3PB 3AZJA 5GT0B 4QLCB 3EG5B 5AY8C 5E5AD 2YFWA 3B0BA 3LELA 3AV1A 4YS3A 2NQBA 3AYWC 3AZGD 5GSUD 5AV6C 1M19B 3X1SA 5DNMB 3EPKA 1P34A 3TU4B 3AZGC 3H0RC 4DRBA 4H9OA 2CWEA 2F8NA 1ID3D 5GSUC 5B33B 4X23D 1P3IA 1P3AD 1ID3C 4UUZB 1P3MD 5AV5B 3UTBD 1KU5A 4NE3A 2W8SA 1P3AC 3F6TA 1P3MC 4G92C 5CPJB 4KHAB 4KGCD 3REHD 4JJND 3MVDD 3AN2A 5GT3D 3WKJB 2BYKA 5JA4A 5AY8B 1F66A 4KGCC 5BNXB 3REHC 1Z2CB 4JJNC 3AYWB 1M18C 3MVDC 5AV6B 2CV5A 5G49A 3AZGB 5JRGD 3EPJA 3AZNA 5DNND 4Z5TA 5B40D 3AZJD 2XD5A 5JRGC 1P3PA 1ID3B 4YM6B 2Y2LA 3LELD 2G5HC 5DNNC 3AV1D 5B40C 1B67A 3AZJC 1P3AB 1EQZA 1P3MB 5C3IC 4G92B 3X1SD 3LELC 1P34D 3AV1C 1M19A 5DNMA 1TAFB 3EPLA 2F8ND 3TU4A 3VH5T 3KFUG 3AZLD 3X1SC 4ZUXD 1P3ID 3AZLC 1P3BA 1M1AA 4KGCB 3REHB 4JJNB 4ZUXC 1M18B 3MVDB 4J8XA 1P3IC 2RVQD 3AZEA 5BNVA 3NQUB 3FDDA 4CSRB 5CPJA 1KX4D 2RVQC 1BH9A 5B31G 3AN2D 2NZDA 1N1JB 2YFVA 1KX4C 4HGAC 2Y2NA 5AVCA 1F66D 5DNNB 3WKJA 5AY8A 5B40B 4E45A 3AZJB 4KUDA 3AYWA 1KX3A 5C3IB 2CV5D 5AV6A 3LELB 1F66C 3AV1B 1P3KA 5CP6D 4Z2MH 3AZND 3X1SB 3WAAC 4Z5TD 5CP6C 5B0YD 2F8NB 1P3PD 4WZSB 3AZLB 5B1MA 4Z5TC 4ZUXB 4YM6A 4NFTA 4LD9A 1P3IB 5B0YC 1EQZD 5B2JD 1M19D 4XUJA 2Y2GA 3TU4D 1EQZC 5B2JC 1M19C 3LZ0C 4NE5A 1KX4B 3W99A 3TU4C 1P3BD 1M1AD 5F99C 1P3FA 4KGCA 3W96D 3REHA 1M18A 4J8XD 3NQJB 2BYKB 1HTAA 3AZED 1P3BC 1M1AC 1F66B 3WA9A 3W97C 3W96C 4J8XC 4CSRA 3AZEC 3WAAB 5CP6B 2NZDD 5B1LA 5AVCD 3WKJD 4Z5TB 4KUDD 5B40A 5B0YB 2NZDC 5FUGB 3AFAA 1KX3D 5AVCC 5AV6D 3WKJC 2BG1A 1P3KD 3AZKC 5BO0B 5B32A 5CPKA 4KUDC 3LZ1A 1EQZB 1KX3C 5B2JB 1P3KC 3LZ0B 1P3OA 1S32B 5F99B 3REIC 5B1MD 3AZLA 4YM6D 3V9RA 3AZMA 3AZHA 4LD9D 4ZUXA 1P3BB 1M1AB 1JFIA 3W97B 5B1MC 4XUJD 1F1EA 4YM6C 3W96B 4LD9C 3KSYA 4J8XB 3AZEB 5BNVB 3WTPE 4XUJC 3W99D 3A1KA 2DQNC 1KX4A 1BH9B 2ZY2A 1TZYA 3KUYA 1P3FD 2UWXA 1M18D 3W99C 2YFVB 2NZDB 2JSSA 5AVCB 3WA9D 3AZIA 3NQJA 3AZKB 1P3FC 4KUDB 3KWQB 3REJB 4H9PB 1KX3B 3WA9C 1P3KB 3WAAA 5CP6A 5B1LD 4UPKA 3REIB 3B6GC 2AROD 5AVBB 2LY8A 3AFAD 5B1LC 5B0YA 5FUGA 5B1MB 4WU8C 5B32D 5CPKD 2AROC 4LD9B 3LZ1D 5BO0A 3AFAC 3MNND 2ZY3A 3MGPB 4XUJB 5B32C 5B2JA 5CPKC 2F8NG 1P3OD 3LZ1C 3LZ0A 3UT9A 3MNNC 1S32A 2JCHA 5F99A 2RIQA 3AZMD 3AZHD 1P3OC 4H9RA 3W99B 3VH6A 1P3FB 3W97A 3R45B 3AZMC 3AZHC 3VH6W 4R8PA 3W96A 5B0ZA 3WA9B 2G5IC 3UTAC 1BFMA 2HUEC 1TZYD 4H9NB 4WU9D 3KUYD 3B6GB 2Y2IA 5BT1D 3AV2A 5B1LB 5B24A 4WU8B 3AZID 1TZYC 3KUYC 4WU9C 3C1BA 2F8NK 2AROB 3REKB 3AZKA 5BT1C 4G91C 3AFAB 3KWQA 3REJA 4Z66C 4H9PA 3AZIC 5B32B 5CPKB 3WAAD 3LZ1B 1P3LA 2FJ7A 3X1UA 3MNNB 1AOIA 1WWSA 3REIA 1P3OB 3B0DC 2IO5C 5AVBA 4WNNA 3V9RB 3AZMB 3AZHB 4M6BA 5KDMA 1JFIB 5CPIC 3UTAB 3MGPA 1PZRA 3LZ0D 3UT9D 2HUEB 1H3OB 1S32D 2PYOA 5F99D 5AV8A 4AWLB 3UT9C 1S32C 3W98A 3H0MC 1TZYB 4H9QB 3KUYB 4J8VA 4WU9B 5GXQA 3W97D 4R8PD 4G91B 3RELA 3R45A 5B0ZD 5B2IA 3MGSD 4Z66B 3AZIB 3MGQA 4R8PC 4XZQA 5B0ZC 5CHLB 2ZY5A 3MGSC 4E44A 4H9NA 3B0DB 3AV2D 3B6GA 2IO5B 3B0CW 3KXBA 5B24D 3X1VD 3C1BD 2F2AC 2Y2HA 4WU8A 3AZKD 3AV2C 2AROA 3REKA 3KWQD 3REJD 5B24C 1B6WA 5CPIB 3X1VC 3LJAB 4J8UA 3C1BC 1P3LD 2FJ7D 3X1UD 3KWQC 1AOID 3REJC 3P5JB 3MNNA 3C1CB 3REID 1ZLAC 1R4VA 3UT9B 1P3LC 2FJ7C 3X1UC 5AVBD 1AOIC 1A7WA 3X1TA 4H9RB 5AVBC 3MGPD 3UTAA 4R8PB 5B0ZB 3MGSB 2PYOD 1H3OA 3B6FA 3MGPC 5AV8D 2Y2JA 1U35A 3W98D 2PYOC 4J8VD 5GXQD 3H0LC 4H9QA 4WU9A 3AV2B 5AV9D 3RELD 5AV8C 1HQ3A 5E5AC 5B2ID 5B24B 1P3GA 3W98C 3X1VB 4Z66A 1WWIA 3C1BB 5GXQC 4J8VC 3MGQD 3AL0C 4XZQD 5AV9C 3MGRA 3RELC 4H9SA 5B2IC 1KX5B 1ZLAB 3MGQC 3B6GD 4XZQC 1P3LB 2FJ7B 3X1UB 1T3UA 3KXBD 1AOIB 4X23C 3O62A 1BH8A 4WU8D 3REKD 2XD1A 4WNNB 4EO5B 3KXBC 3UTBC 5B32G 4J8UD 5CPIA 3LJAA 3A6NA 2Y2MA 2BYMA 3REKC 5KDMB 4J8WA 4ZBJC 4J8UC 5B31A 3C1CA 2PYOB 2Y2KA 3X1TD 2HIOA 5GT3C 5AV8B 5E5AB 2L5AA 3W98B 4J8VB 5GXQB 3X1TC 3WTPA 3UTAD 5GSUB 5AV9B 4CAYA 3RELB 3AZFA 5B2IB 3MGSA 3B6FD 3MGQB 4XZQB 5GT0A 3VH6T 4QLCA 3VH5A 4YS3D 1U35D 2NQBD 4X23B 3B6FC 4DQYB 2Y2OA 3VH5W 1HQ3D 3KXBB 3UTBB 4YS3C 4AWLC 1P3GD 1U35C 2F8NH 2NQBC 4Z66D 3X1VA 3MGRD 1HQ3C 1P34C 2ZY4A 1P3GC 5B33A 4ZBJB 4J8UB 1Q9CA 1KX5A 3MGRC 1ZLAA 4H9SC 4UUZA 4Z2MG 5AV5A 3O62D 5GT3B 5BS7A 3X1TB 5CPID 3O62C 4KHAA 3LJAD 3A6ND 3A1IA 1W2EA 4J8WD 5JRGB 2Y2PA 5B31D 3C1CD 3LJAC 3A6NC 3EPHA 4WJ3C 4J8WC 3B6FB 5BNXA 2HIOD 3AN2C 5B31C 3C1CC 2DF4C 2YFWB 3IP4C 4YS3B 5E5AA 1U35B 2NQBB 2HIOC 3WTPD 3AZGA 1HQ3B 3AZFD 2CV5C 5GSUA 1P34B 5AV9A 1P3GB 4WV4B 4H9OB 3WTPC 3AZNC 3MGRB 5GT0D 3AZFC 4QLCD 1ID3A 2J8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X23 A;  1P3P C;  1ULY A;  1P3A A;  5GT0 C;  4QLC C;  1P3M A;  5DNM D;  3UTB A;  3O62 B;  1BH8 B;  1TAF A;  3B0C T;  5B33 D;  5DNM C;  4DRA A;  1KX5 D;  4HGA B;  3A6N B;  1ZLA D;  2BYM B;  4J8W B;  5AV5 D;  5B33 C;  4JJN A;  3AN2 B;  5B31 B;  3MVD A;  1KX5 C;  5JA4 B;  5GT3 A;  3NQU A;  5AV5 C;  5CPJ D;  2HIO B;  2CV5 B;  5G49 B;  5BS7 C;  4NE6 A;  4EO5 C;  5CPJ C;  3WTP B;  3AZN B;  5JRG A;  4CAY B;  1N1J A;  3AZF B;  5AY8 D;  5DNN A;  3AYW D;  1P3P B;  3AZJ A;  5GT0 B;  4QLC B;  5AY8 C;  5E5A D;  2YFW A;  3B0B A;  3LEL A;  3AV1 A;  4YS3 A;  2NQB A;  3AYW C;  3AZG D;  5GSU D;  5AV6 C;  1M19 B;  3X1S A;  5DNM B;  1P34 A;  3TU4 B;  3AZG C;  4DRB A;  4H9O A;  2CWE A;  2F8N A;  1ID3 D;  5GSU C;  5B33 B;  4X23 D;  1P3I A;  1P3A D;  1ID3 C;  4UUZ B;  1P3M D;  5AV5 B;  3UTB D;  1KU5 A;  4NE3 A;  1P3A C;  1P3M C;  4G92 C;  5CPJ B;  4KHA B;  4KGC D;  3REH D;  4JJN D;  3MVD D;  3AN2 A;  5GT3 D;  3WKJ B;  2BYK A;  5JA4 A;  5AY8 B;  1F66 A;  4KGC C;  5BNX B;  3REH C;  4JJN C;  3AYW B;  1M18 C;  3MVD C;  5AV6 B;  2CV5 A;  5G49 A;  3AZG B;  5JRG D;  3AZN A;  5DNN D;  4Z5T A;  5B40 D;  3AZJ D;  5JRG C;  1P3P A;  1ID3 B;  4YM6 B;  3LEL D;  5DNN C;  3AV1 D;  5B40 C;  1B67 A;  3AZJ C;  1P3A B;  1EQZ A;  1P3M B;  5C3I C;  4G92 B;  3X1S D;  3LEL C;  1P34 D;  3AV1 C;  1M19 A;  5DNM A;  1TAF B;  2F8N D;  3TU4 A;  3VH5 T;  3AZL D;  3X1S C;  4ZUX D;  1P3I D;  3AZL C;  1P3B A;  1M1A A;  4KGC B;  3REH B;  4JJN B;  4ZUX C;  1M18 B;  3MVD B;  4J8X A;  1P3I C;  2RVQ D;  3AZE A;  5BNV A;  3NQU B;  4CSR B;  5CPJ A;  1KX4 D;  2RVQ C;  1BH9 A;  5B31 G;  3AN2 D;  2NZD A;  1N1J B;  2YFV A;  1KX4 C;  4HGA C;  5AVC A;  1F66 D;  5DNN B;  3WKJ A;  5AY8 A;  5B40 B;  4E45 A;  3AZJ B;  4KUD A;  3AYW A;  1KX3 A;  5C3I B;  2CV5 D;  5AV6 A;  3LEL B;  1F66 C;  3AV1 B;  1P3K A;  5CP6 D;  4Z2M H;  3AZN D;  3X1S B;  3WAA C;  4Z5T D;  5CP6 C;  5B0Y D;  2F8N B;  1P3P D;  4WZS B;  3AZL B;  5B1M A;  4Z5T C;  4ZUX B;  4YM6 A;  4NFT A;  4LD9 A;  1P3I B;  5B0Y C;  1EQZ D;  5B2J D;  1M19 D;  4XUJ A;  3TU4 D;  1EQZ C;  5B2J C;  1M19 C;  3LZ0 C;  4NE5 A;  1KX4 B;  3W99 A;  3TU4 C;  1P3B D;  1M1A D;  5F99 C;  1P3F A;  4KGC A;  3W96 D;  3REH A;  1M18 A;  4J8X D;  3NQJ B;  2BYK B;  1HTA A;  3AZE D;  1P3B C;  1M1A C;  1F66 B;  3WA9 A;  3W97 C;  3W96 C;  4J8X C;  4CSR A;  3AZE C;  3WAA B;  5CP6 B;  2NZD D;  5B1L A;  5AVC D;  3WKJ D;  4Z5T B;  4KUD D;  5B40 A;  5B0Y B;  2NZD C;  5FUG B;  3AFA A;  1KX3 D;  5AVC C;  5AV6 D;  3WKJ C;  1P3K D;  3AZK C;  5BO0 B;  5B32 A;  5CPK A;  4KUD C;  3LZ1 A;  1EQZ B;  1KX3 C;  5B2J B;  1P3K C;  3LZ0 B;  1P3O A;  1S32 B;  5F99 B;  3REI C;  5B1M D;  3AZL A;  4YM6 D;  3V9R A;  3AZM A;  3AZH A;  4LD9 D;  4ZUX A;  1P3B B;  1M1A B;  1JFI A;  3W97 B;  5B1M C;  4XUJ D;  1F1E A;  4YM6 C;  3W96 B;  4LD9 C;  3KSY A;  4J8X B;  3AZE B;  5BNV B;  3WTP E;  4XUJ C;  3W99 D;  1KX4 A;  1BH9 B;  1TZY A;  3KUY A;  1P3F D;  1M18 D;  3W99 C;  2YFV B;  2NZD B;  2JSS A;  5AVC B;  3WA9 D;  3AZI A;  3NQJ A;  3AZK B;  1P3F C;  4KUD B;  3KWQ B;  3REJ B;  4H9P B;  1KX3 B;  3WA9 C;  1P3K B;  3WAA A;  5CP6 A;  5B1L D;  3REI B;  3B6G C;  2ARO D;  5AVB B;  2LY8 A;  3AFA D;  5B1L C;  5B0Y A;  5FUG A;  5B1M B;  4WU8 C;  5B32 D;  5CPK D;  2ARO C;  4LD9 B;  3LZ1 D;  5BO0 A;  3AFA C;  3MNN D;  3MGP B;  4XUJ B;  5B32 C;  5B2J A;  5CPK C;  2F8N G;  1P3O D;  3LZ1 C;  3LZ0 A;  3UT9 A;  3MNN C;  1S32 A;  5F99 A;  3AZM D;  3AZH D;  1P3O C;  4H9R A;  3W99 B;  3VH6 A;  1P3F B;  3W97 A;  3R45 B;  3AZM C;  3AZH C;  3VH6 W;  4R8P A;  3W96 A;  5B0Z A;  3WA9 B;  3UTA C;  1BFM A;  2HUE C;  1TZY D;  4H9N B;  4WU9 D;  3KUY D;  3B6G B;  5BT1 D;  3AV2 A;  5B1L B;  5B24 A;  4WU8 B;  3AZI D;  1TZY C;  3KUY C;  4WU9 C;  3C1B A;  2F8N K;  2ARO B;  3REK B;  3AZK A;  5BT1 C;  4G91 C;  3AFA B;  3KWQ A;  3REJ A;  4Z66 C;  4H9P A;  3AZI C;  5B32 B;  5CPK B;  3WAA D;  3LZ1 B;  1P3L A;  2FJ7 A;  3X1U A;  3MNN B;  1AOI A;  1WWS A;  3REI A;  1P3O B;  3B0D C;  2IO5 C;  5AVB A;  4WNN A;  3V9R B;  3AZM B;  3AZH B;  4M6B A;  5KDM A;  1JFI B;  5CPI C;  3UTA B;  3MGP A;  3LZ0 D;  3UT9 D;  2HUE B;  1H3O B;  1S32 D;  2PYO A;  5F99 D;  5AV8 A;  4AWL B;  3UT9 C;  1S32 C;  3W98 A;  1TZY B;  4H9Q B;  3KUY B;  4J8V A;  4WU9 B;  5GXQ A;  3W97 D;  4R8P D;  4G91 B;  3REL A;  3R45 A;  5B0Z D;  5B2I A;  3MGS D;  4Z66 B;  3AZI B;  3MGQ A;  4R8P C;  4XZQ A;  5B0Z C;  5CHL B;  3MGS C;  4E44 A;  4H9N A;  3B0D B;  3AV2 D;  3B6G A;  2IO5 B;  3B0C W;  3KXB A;  5B24 D;  3X1V D;  3C1B D;  4WU8 A;  3AZK D;  3AV2 C;  2ARO A;  3REK A;  3KWQ D;  3REJ D;  5B24 C;  1B6W A;  5CPI B;  3X1V C;  3LJA B;  4J8U A;  3C1B C;  1P3L D;  2FJ7 D;  3X1U D;  3KWQ C;  1AOI D;  3REJ C;  3MNN A;  3C1C B;  3REI D;  1ZLA C;  1R4V A;  3UT9 B;  1P3L C;  2FJ7 C;  3X1U C;  5AVB D;  1AOI C;  1A7W A;  3X1T A;  4H9R B;  5AVB C;  3MGP D;  3UTA A;  4R8P B;  5B0Z B;  3MGS B;  2PYO D;  1H3O A;  3B6F A;  3MGP C;  5AV8 D;  1U35 A;  3W98 D;  2PYO C;  4J8V D;  5GXQ D;  4H9Q A;  4WU9 A;  3AV2 B;  5AV9 D;  3REL D;  5AV8 C;  1HQ3 A;  5E5A C;  5B2I D;  5B24 B;  1P3G A;  3W98 C;  3X1V B;  4Z66 A;  1WWI A;  3C1B B;  5GXQ C;  4J8V C;  3MGQ D;  4XZQ D;  5AV9 C;  3MGR A;  3REL C;  4H9S A;  5B2I C;  1KX5 B;  1ZLA B;  3MGQ C;  3B6G D;  4XZQ C;  1P3L B;  2FJ7 B;  3X1U B;  3KXB D;  1AOI B;  4X23 C;  3O62 A;  1BH8 A;  4WU8 D;  3REK D;  3KXB C;  4WNN B;  4EO5 B;  3UTB C;  5B32 G;  4J8U D;  5CPI A;  3LJA A;  3A6N A;  2BYM A;  3REK C;  5KDM B;  4J8W A;  4ZBJ C;  4J8U C;  5B31 A;  3C1C A;  2PYO B;  3X1T D;  2HIO A;  5GT3 C;  5AV8 B;  5E5A B;  2L5A A;  3W98 B;  4J8V B;  5GXQ B;  3X1T C;  3WTP A;  3UTA D;  5GSU B;  5AV9 B;  4CAY A;  3REL B;  3AZF A;  5B2I B;  3MGS A;  3B6F D;  3MGQ B;  4XZQ B;  5GT0 A;  3VH6 T;  4QLC A;  3VH5 A;  4YS3 D;  1U35 D;  2NQB D;  4X23 B;  3B6F C;  3VH5 W;  1HQ3 D;  3KXB B;  3UTB B;  4YS3 C;  4AWL C;  1P3G D;  1U35 C;  2F8N H;  2NQB C;  4Z66 D;  3X1V A;  3MGR D;  1HQ3 C;  1P34 C;  1P3G C;  5B33 A;  4ZBJ B;  4J8U B;  1Q9C A;  1KX5 A;  3MGR C;  1ZLA A;  4H9S C;  4UUZ A;  4Z2M G;  5AV5 A;  3O62 D;  5GT3 B;  5BS7 A;  3X1T B;  5CPI D;  3O62 C;  4KHA A;  3LJA D;  3A6N D;  4J8W D;  5JRG B;  5B31 D;  3C1C D;  3LJA C;  3A6N C;  4J8W C;  3B6F B;  5BNX A;  2HIO D;  3AN2 C;  5B31 C;  3C1C C;  2YFW B;  4YS3 B;  5E5A A;  1U35 B;  2NQB B;  2HIO C;  3WTP D;  3AZG A;  1HQ3 B;  3AZF D;  2CV5 C;  5GSU A;  1P34 B;  5AV9 A;  1P3G B;  4WV4 B;  4H9O B;  3WTP C;  3AZN C;  3MGR B;  5GT0 D;  3AZF C;  4QLC D;  1ID3 A; 
#chains in the Genus database with same CATH topology
 4X23 A;  1P3P C;  1ULY A;  1P3A A;  5GT0 C;  4QLC C;  1P3M A;  5DNM D;  3UTB A;  3O62 B;  1BH8 B;  1TAF A;  2Y2Q A;  3B0C T;  5B33 D;  5DNM C;  4DRA A;  1KX5 D;  4HGA B;  3A6N B;  1ZLA D;  2BYM B;  4J8W B;  5AV5 D;  5B33 C;  4JJN A;  3AN2 B;  5B31 B;  3MVD A;  1KX5 C;  5JA4 B;  5GT3 A;  3NQU A;  5AV5 C;  5CPJ D;  2HIO B;  2FFF B;  2CV5 B;  2VQR A;  5G49 B;  5BS7 C;  4NE6 A;  2ZM5 A;  4EO5 C;  5CPJ C;  3WTP B;  3AZN B;  5JRG A;  4CAY B;  1N1J A;  3AZF B;  2JE5 A;  5AY8 D;  5DNN A;  3AYW D;  1P3P B;  3AZJ A;  5GT0 B;  4QLC B;  3EG5 B;  5AY8 C;  5E5A D;  2YFW A;  3B0B A;  3LEL A;  3AV1 A;  4YS3 A;  2NQB A;  3AYW C;  3AZG D;  5GSU D;  5AV6 C;  1M19 B;  3X1S A;  5DNM B;  3EPK A;  1P34 A;  3TU4 B;  3AZG C;  3H0R C;  4DRB A;  4H9O A;  2CWE A;  2F8N A;  1ID3 D;  5GSU C;  5B33 B;  4X23 D;  1P3I A;  1P3A D;  1ID3 C;  4UUZ B;  1P3M D;  5AV5 B;  3UTB D;  1KU5 A;  4NE3 A;  2W8S A;  1P3A C;  3F6T A;  1P3M C;  4G92 C;  5CPJ B;  4KHA B;  4KGC D;  3REH D;  4JJN D;  3MVD D;  3AN2 A;  5GT3 D;  3WKJ B;  2BYK A;  5JA4 A;  5AY8 B;  1F66 A;  4KGC C;  5BNX B;  3REH C;  1Z2C B;  4JJN C;  3AYW B;  1M18 C;  3MVD C;  5AV6 B;  2CV5 A;  5G49 A;  3AZG B;  5JRG D;  3EPJ A;  3AZN A;  5DNN D;  4Z5T A;  5B40 D;  3AZJ D;  2XD5 A;  5JRG C;  1P3P A;  1ID3 B;  4YM6 B;  2Y2L A;  3LEL D;  2G5H C;  5DNN C;  3AV1 D;  5B40 C;  1B67 A;  3AZJ C;  1P3A B;  1EQZ A;  1P3M B;  5C3I C;  4G92 B;  3X1S D;  3LEL C;  1P34 D;  3AV1 C;  1M19 A;  5DNM A;  1TAF B;  3EPL A;  2F8N D;  3TU4 A;  3VH5 T;  3KFU G;  3AZL D;  3X1S C;  4ZUX D;  1P3I D;  3AZL C;  1P3B A;  1M1A A;  4KGC B;  3REH B;  4JJN B;  4ZUX C;  1M18 B;  3MVD B;  4J8X A;  1P3I C;  2RVQ D;  3AZE A;  5BNV A;  3NQU B;  3FDD A;  4CSR B;  5CPJ A;  1KX4 D;  2RVQ C;  1BH9 A;  5B31 G;  3AN2 D;  2NZD A;  1N1J B;  2YFV A;  1KX4 C;  4HGA C;  2Y2N A;  5AVC A;  1F66 D;  5DNN B;  3WKJ A;  5AY8 A;  5B40 B;  4E45 A;  3AZJ B;  4KUD A;  3AYW A;  1KX3 A;  5C3I B;  2CV5 D;  5AV6 A;  3LEL B;  1F66 C;  3AV1 B;  1P3K A;  5CP6 D;  4Z2M H;  3AZN D;  3X1S B;  3WAA C;  4Z5T D;  5CP6 C;  5B0Y D;  2F8N B;  1P3P D;  4WZS B;  3AZL B;  5B1M A;  4Z5T C;  4ZUX B;  4YM6 A;  4NFT A;  4LD9 A;  1P3I B;  5B0Y C;  1EQZ D;  5B2J D;  1M19 D;  4XUJ A;  2Y2G A;  3TU4 D;  1EQZ C;  5B2J C;  1M19 C;  3LZ0 C;  4NE5 A;  1KX4 B;  3W99 A;  3TU4 C;  1P3B D;  1M1A D;  5F99 C;  1P3F A;  4KGC A;  3W96 D;  3REH A;  1M18 A;  4J8X D;  3NQJ B;  2BYK B;  1HTA A;  3AZE D;  1P3B C;  1M1A C;  1F66 B;  3WA9 A;  3W97 C;  3W96 C;  4J8X C;  4CSR A;  3AZE C;  3WAA B;  5CP6 B;  2NZD D;  5B1L A;  5AVC D;  3WKJ D;  4Z5T B;  4KUD D;  5B40 A;  5B0Y B;  2NZD C;  5FUG B;  3AFA A;  1KX3 D;  5AVC C;  5AV6 D;  3WKJ C;  2BG1 A;  1P3K D;  3AZK C;  5BO0 B;  5B32 A;  5CPK A;  4KUD C;  3LZ1 A;  1EQZ B;  1KX3 C;  5B2J B;  1P3K C;  3LZ0 B;  1P3O A;  1S32 B;  5F99 B;  3REI C;  5B1M D;  3AZL A;  4YM6 D;  3V9R A;  3AZM A;  3AZH A;  4LD9 D;  4ZUX A;  1P3B B;  1M1A B;  1JFI A;  3W97 B;  5B1M C;  4XUJ D;  1F1E A;  4YM6 C;  3W96 B;  4LD9 C;  3KSY A;  4J8X B;  3AZE B;  5BNV B;  3WTP E;  4XUJ C;  3W99 D;  3A1K A;  2DQN C;  1KX4 A;  1BH9 B;  2ZY2 A;  1TZY A;  3KUY A;  1P3F D;  2UWX A;  1M18 D;  3W99 C;  2YFV B;  2NZD B;  2JSS A;  5AVC B;  3WA9 D;  3AZI A;  3NQJ A;  3AZK B;  1P3F C;  4KUD B;  3KWQ B;  3REJ B;  4H9P B;  1KX3 B;  3WA9 C;  1P3K B;  3WAA A;  5CP6 A;  5B1L D;  4UPK A;  3REI B;  3B6G C;  2ARO D;  5AVB B;  2LY8 A;  3AFA D;  5B1L C;  5B0Y A;  5FUG A;  5B1M B;  4WU8 C;  5B32 D;  5CPK D;  2ARO C;  4LD9 B;  3LZ1 D;  5BO0 A;  3AFA C;  3MNN D;  2ZY3 A;  3MGP B;  4XUJ B;  5B32 C;  5B2J A;  5CPK C;  2F8N G;  1P3O D;  3LZ1 C;  3LZ0 A;  3UT9 A;  3MNN C;  1S32 A;  2JCH A;  5F99 A;  2RIQ A;  3AZM D;  3AZH D;  1P3O C;  4H9R A;  3W99 B;  3VH6 A;  1P3F B;  3W97 A;  3R45 B;  3AZM C;  3AZH C;  3VH6 W;  4R8P A;  3W96 A;  5B0Z A;  3WA9 B;  2G5I C;  3UTA C;  1BFM A;  2HUE C;  1TZY D;  4H9N B;  4WU9 D;  3KUY D;  3B6G B;  2Y2I A;  5BT1 D;  3AV2 A;  5B1L B;  5B24 A;  4WU8 B;  3AZI D;  1TZY C;  3KUY C;  4WU9 C;  3C1B A;  2F8N K;  2ARO B;  3REK B;  3AZK A;  5BT1 C;  4G91 C;  3AFA B;  3KWQ A;  3REJ A;  4Z66 C;  4H9P A;  3AZI C;  5B32 B;  5CPK B;  3WAA D;  3LZ1 B;  1P3L A;  2FJ7 A;  3X1U A;  3MNN B;  1AOI A;  1WWS A;  3REI A;  1P3O B;  3B0D C;  2IO5 C;  5AVB A;  4WNN A;  3V9R B;  3AZM B;  3AZH B;  4M6B A;  5KDM A;  1JFI B;  5CPI C;  3UTA B;  3MGP A;  1PZR A;  3LZ0 D;  3UT9 D;  2HUE B;  1H3O B;  1S32 D;  2PYO A;  5F99 D;  5AV8 A;  4AWL B;  3UT9 C;  1S32 C;  3W98 A;  3H0M C;  1TZY B;  4H9Q B;  3KUY B;  4J8V A;  4WU9 B;  5GXQ A;  3W97 D;  4R8P D;  4G91 B;  3REL A;  3R45 A;  5B0Z D;  5B2I A;  3MGS D;  4Z66 B;  3AZI B;  3MGQ A;  4R8P C;  4XZQ A;  5B0Z C;  5CHL B;  2ZY5 A;  3MGS C;  4E44 A;  4H9N A;  3B0D B;  3AV2 D;  3B6G A;  2IO5 B;  3B0C W;  3KXB A;  5B24 D;  3X1V D;  3C1B D;  2F2A C;  2Y2H A;  4WU8 A;  3AZK D;  3AV2 C;  2ARO A;  3REK A;  3KWQ D;  3REJ D;  5B24 C;  1B6W A;  5CPI B;  3X1V C;  3LJA B;  4J8U A;  3C1B C;  1P3L D;  2FJ7 D;  3X1U D;  3KWQ C;  1AOI D;  3REJ C;  3P5J B;  3MNN A;  3C1C B;  3REI D;  1ZLA C;  1R4V A;  3UT9 B;  1P3L C;  2FJ7 C;  3X1U C;  5AVB D;  1AOI C;  1A7W A;  3X1T A;  4H9R B;  5AVB C;  3MGP D;  3UTA A;  4R8P B;  5B0Z B;  3MGS B;  2PYO D;  1H3O A;  3B6F A;  3MGP C;  5AV8 D;  2Y2J A;  1U35 A;  3W98 D;  2PYO C;  4J8V D;  5GXQ D;  3H0L C;  4H9Q A;  4WU9 A;  3AV2 B;  5AV9 D;  3REL D;  5AV8 C;  1HQ3 A;  5E5A C;  5B2I D;  5B24 B;  1P3G A;  3W98 C;  3X1V B;  4Z66 A;  1WWI A;  3C1B B;  5GXQ C;  4J8V C;  3MGQ D;  3AL0 C;  4XZQ D;  5AV9 C;  3MGR A;  3REL C;  4H9S A;  5B2I C;  1KX5 B;  1ZLA B;  3MGQ C;  3B6G D;  4XZQ C;  1P3L B;  2FJ7 B;  3X1U B;  1T3U A;  3KXB D;  1AOI B;  4X23 C;  3O62 A;  1BH8 A;  4WU8 D;  3REK D;  2XD1 A;  4WNN B;  4EO5 B;  3KXB C;  3UTB C;  5B32 G;  4J8U D;  5CPI A;  3LJA A;  3A6N A;  2Y2M A;  2BYM A;  3REK C;  5KDM B;  4J8W A;  4ZBJ C;  4J8U C;  5B31 A;  3C1C A;  2PYO B;  2Y2K A;  3X1T D;  2HIO A;  5GT3 C;  5AV8 B;  5E5A B;  2L5A A;  3W98 B;  4J8V B;  5GXQ B;  3X1T C;  3WTP A;  3UTA D;  5GSU B;  5AV9 B;  4CAY A;  3REL B;  3AZF A;  5B2I B;  3MGS A;  3B6F D;  3MGQ B;  4XZQ B;  5GT0 A;  3VH6 T;  4QLC A;  3VH5 A;  4YS3 D;  1U35 D;  2NQB D;  4X23 B;  3B6F C;  4DQY B;  2Y2O A;  3VH5 W;  1HQ3 D;  3KXB B;  3UTB B;  4YS3 C;  4AWL C;  1P3G D;  1U35 C;  2F8N H;  2NQB C;  4Z66 D;  3X1V A;  3MGR D;  1HQ3 C;  1P34 C;  2ZY4 A;  1P3G C;  5B33 A;  4ZBJ B;  4J8U B;  1Q9C A;  1KX5 A;  3MGR C;  1ZLA A;  4H9S C;  4UUZ A;  4Z2M G;  5AV5 A;  3O62 D;  5GT3 B;  5BS7 A;  3X1T B;  5CPI D;  3O62 C;  4KHA A;  3LJA D;  3A6N D;  3A1I A;  1W2E A;  4J8W D;  5JRG B;  2Y2P A;  5B31 D;  3C1C D;  3LJA C;  3A6N C;  3EPH A;  4WJ3 C;  4J8W C;  3B6F B;  5BNX A;  2HIO D;  3AN2 C;  5B31 C;  3C1C C;  2DF4 C;  2YFW B;  3IP4 C;  4YS3 B;  5E5A A;  1U35 B;  2NQB B;  2HIO C;  3WTP D;  3AZG A;  1HQ3 B;  3AZF D;  2CV5 C;  5GSU A;  1P34 B;  5AV9 A;  1P3G B;  4WV4 B;  4H9O B;  3WTP C;  3AZN C;  3MGR B;  5GT0 D;  3AZF C;  4QLC D;  1ID3 A;  2J8P A; 
#chains in the Genus database with same CATH homology
 4X23 A;  1P3P C;  1ULY A;  1P3A A;  5GT0 C;  4QLC C;  1P3M A;  5DNM D;  3UTB A;  3O62 B;  1BH8 B;  1TAF A;  2Y2Q A;  3B0C T;  5B33 D;  5DNM C;  4DRA A;  1KX5 D;  4HGA B;  3A6N B;  1ZLA D;  2BYM B;  4J8W B;  5AV5 D;  5B33 C;  4JJN A;  3AN2 B;  5B31 B;  3MVD A;  1KX5 C;  5JA4 B;  5GT3 A;  3NQU A;  5AV5 C;  5CPJ D;  2HIO B;  2FFF B;  2CV5 B;  2VQR A;  5G49 B;  5BS7 C;  4NE6 A;  2ZM5 A;  4EO5 C;  5CPJ C;  3WTP B;  3AZN B;  5JRG A;  4CAY B;  1N1J A;  3AZF B;  2JE5 A;  5AY8 D;  5DNN A;  3AYW D;  1P3P B;  3AZJ A;  5GT0 B;  4QLC B;  3EG5 B;  5AY8 C;  5E5A D;  2YFW A;  3B0B A;  3LEL A;  3AV1 A;  4YS3 A;  2NQB A;  3AYW C;  3AZG D;  5GSU D;  5AV6 C;  1M19 B;  3X1S A;  5DNM B;  3EPK A;  1P34 A;  3TU4 B;  3AZG C;  3H0R C;  4DRB A;  4H9O A;  2CWE A;  2F8N A;  1ID3 D;  5GSU C;  5B33 B;  4X23 D;  1P3I A;  1P3A D;  1ID3 C;  4UUZ B;  1P3M D;  5AV5 B;  3UTB D;  1KU5 A;  4NE3 A;  2W8S A;  1P3A C;  3F6T A;  1P3M C;  4G92 C;  5CPJ B;  4KHA B;  4KGC D;  3REH D;  4JJN D;  3MVD D;  3AN2 A;  5GT3 D;  3WKJ B;  2BYK A;  5JA4 A;  5AY8 B;  1F66 A;  4KGC C;  5BNX B;  3REH C;  1Z2C B;  4JJN C;  3AYW B;  1M18 C;  3MVD C;  5AV6 B;  2CV5 A;  5G49 A;  3AZG B;  5JRG D;  3EPJ A;  3AZN A;  5DNN D;  4Z5T A;  5B40 D;  3AZJ D;  2XD5 A;  5JRG C;  1P3P A;  1ID3 B;  4YM6 B;  2Y2L A;  3LEL D;  2G5H C;  5DNN C;  3AV1 D;  5B40 C;  1B67 A;  3AZJ C;  1P3A B;  1EQZ A;  1P3M B;  5C3I C;  4G92 B;  3X1S D;  3LEL C;  1P34 D;  3AV1 C;  1M19 A;  5DNM A;  1TAF B;  3EPL A;  2F8N D;  3TU4 A;  3VH5 T;  3KFU G;  3AZL D;  3X1S C;  4ZUX D;  1P3I D;  3AZL C;  1P3B A;  1M1A A;  4KGC B;  3REH B;  4JJN B;  4ZUX C;  1M18 B;  3MVD B;  4J8X A;  1P3I C;  2RVQ D;  3AZE A;  5BNV A;  3NQU B;  3FDD A;  4CSR B;  5CPJ A;  1KX4 D;  2RVQ C;  1BH9 A;  5B31 G;  3AN2 D;  2NZD A;  1N1J B;  2YFV A;  1KX4 C;  4HGA C;  2Y2N A;  5AVC A;  1F66 D;  5DNN B;  3WKJ A;  5AY8 A;  5B40 B;  4E45 A;  3AZJ B;  4KUD A;  3AYW A;  1KX3 A;  5C3I B;  2CV5 D;  5AV6 A;  3LEL B;  1F66 C;  3AV1 B;  1P3K A;  5CP6 D;  4Z2M H;  3AZN D;  3X1S B;  3WAA C;  4Z5T D;  5CP6 C;  5B0Y D;  2F8N B;  1P3P D;  4WZS B;  3AZL B;  5B1M A;  4Z5T C;  4ZUX B;  4YM6 A;  4NFT A;  4LD9 A;  1P3I B;  5B0Y C;  1EQZ D;  5B2J D;  1M19 D;  4XUJ A;  2Y2G A;  3TU4 D;  1EQZ C;  5B2J C;  1M19 C;  3LZ0 C;  4NE5 A;  1KX4 B;  3W99 A;  3TU4 C;  1P3B D;  1M1A D;  5F99 C;  1P3F A;  4KGC A;  3W96 D;  3REH A;  1M18 A;  4J8X D;  3NQJ B;  2BYK B;  1HTA A;  3AZE D;  1P3B C;  1M1A C;  1F66 B;  3WA9 A;  3W97 C;  3W96 C;  4J8X C;  4CSR A;  3AZE C;  3WAA B;  5CP6 B;  2NZD D;  5B1L A;  5AVC D;  3WKJ D;  4Z5T B;  4KUD D;  5B40 A;  5B0Y B;  2NZD C;  5FUG B;  3AFA A;  1KX3 D;  5AVC C;  5AV6 D;  3WKJ C;  2BG1 A;  1P3K D;  3AZK C;  5BO0 B;  5B32 A;  5CPK A;  4KUD C;  3LZ1 A;  1EQZ B;  1KX3 C;  5B2J B;  1P3K C;  3LZ0 B;  1P3O A;  1S32 B;  5F99 B;  3REI C;  5B1M D;  3AZL A;  4YM6 D;  3V9R A;  3AZM A;  3AZH A;  4LD9 D;  4ZUX A;  1P3B B;  1M1A B;  1JFI A;  3W97 B;  5B1M C;  4XUJ D;  1F1E A;  4YM6 C;  3W96 B;  4LD9 C;  3KSY A;  4J8X B;  3AZE B;  5BNV B;  3WTP E;  4XUJ C;  3W99 D;  3A1K A;  2DQN C;  1KX4 A;  1BH9 B;  2ZY2 A;  1TZY A;  3KUY A;  1P3F D;  2UWX A;  1M18 D;  3W99 C;  2YFV B;  2NZD B;  2JSS A;  5AVC B;  3WA9 D;  3AZI A;  3NQJ A;  3AZK B;  1P3F C;  4KUD B;  3KWQ B;  3REJ B;  4H9P B;  1KX3 B;  3WA9 C;  1P3K B;  3WAA A;  5CP6 A;  5B1L D;  4UPK A;  3REI B;  3B6G C;  2ARO D;  5AVB B;  2LY8 A;  3AFA D;  5B1L C;  5B0Y A;  5FUG A;  5B1M B;  4WU8 C;  5B32 D;  5CPK D;  2ARO C;  4LD9 B;  3LZ1 D;  5BO0 A;  3AFA C;  3MNN D;  2ZY3 A;  3MGP B;  4XUJ B;  5B32 C;  5B2J A;  5CPK C;  2F8N G;  1P3O D;  3LZ1 C;  3LZ0 A;  3UT9 A;  3MNN C;  1S32 A;  2JCH A;  5F99 A;  2RIQ A;  3AZM D;  3AZH D;  1P3O C;  4H9R A;  3W99 B;  3VH6 A;  1P3F B;  3W97 A;  3R45 B;  3AZM C;  3AZH C;  3VH6 W;  4R8P A;  3W96 A;  5B0Z A;  3WA9 B;  2G5I C;  3UTA C;  1BFM A;  2HUE C;  1TZY D;  4H9N B;  4WU9 D;  3KUY D;  3B6G B;  2Y2I A;  5BT1 D;  3AV2 A;  5B1L B;  5B24 A;  4WU8 B;  3AZI D;  1TZY C;  3KUY C;  4WU9 C;  3C1B A;  2F8N K;  2ARO B;  3REK B;  3AZK A;  5BT1 C;  4G91 C;  3AFA B;  3KWQ A;  3REJ A;  4Z66 C;  4H9P A;  3AZI C;  5B32 B;  5CPK B;  3WAA D;  3LZ1 B;  1P3L A;  2FJ7 A;  3X1U A;  3MNN B;  1AOI A;  1WWS A;  3REI A;  1P3O B;  3B0D C;  2IO5 C;  5AVB A;  4WNN A;  3V9R B;  3AZM B;  3AZH B;  4M6B A;  5KDM A;  1JFI B;  5CPI C;  3UTA B;  3MGP A;  1PZR A;  3LZ0 D;  3UT9 D;  2HUE B;  1H3O B;  1S32 D;  2PYO A;  5F99 D;  5AV8 A;  4AWL B;  3UT9 C;  1S32 C;  3W98 A;  3H0M C;  1TZY B;  4H9Q B;  3KUY B;  4J8V A;  4WU9 B;  5GXQ A;  3W97 D;  4R8P D;  4G91 B;  3REL A;  3R45 A;  5B0Z D;  5B2I A;  3MGS D;  4Z66 B;  3AZI B;  3MGQ A;  4R8P C;  4XZQ A;  5B0Z C;  5CHL B;  2ZY5 A;  3MGS C;  4E44 A;  4H9N A;  3B0D B;  3AV2 D;  3B6G A;  2IO5 B;  3B0C W;  3KXB A;  5B24 D;  3X1V D;  3C1B D;  2F2A C;  2Y2H A;  4WU8 A;  3AZK D;  3AV2 C;  2ARO A;  3REK A;  3KWQ D;  3REJ D;  5B24 C;  1B6W A;  5CPI B;  3X1V C;  3LJA B;  4J8U A;  3C1B C;  1P3L D;  2FJ7 D;  3X1U D;  3KWQ C;  1AOI D;  3REJ C;  3P5J B;  3MNN A;  3C1C B;  3REI D;  1ZLA C;  1R4V A;  3UT9 B;  1P3L C;  2FJ7 C;  3X1U C;  5AVB D;  1AOI C;  1A7W A;  3X1T A;  4H9R B;  5AVB C;  3MGP D;  3UTA A;  4R8P B;  5B0Z B;  3MGS B;  2PYO D;  1H3O A;  3B6F A;  3MGP C;  5AV8 D;  2Y2J A;  1U35 A;  3W98 D;  2PYO C;  4J8V D;  5GXQ D;  3H0L C;  4H9Q A;  4WU9 A;  3AV2 B;  5AV9 D;  3REL D;  5AV8 C;  1HQ3 A;  5E5A C;  5B2I D;  5B24 B;  1P3G A;  3W98 C;  3X1V B;  4Z66 A;  1WWI A;  3C1B B;  5GXQ C;  4J8V C;  3MGQ D;  3AL0 C;  4XZQ D;  5AV9 C;  3MGR A;  3REL C;  4H9S A;  5B2I C;  1KX5 B;  1ZLA B;  3MGQ C;  3B6G D;  4XZQ C;  1P3L B;  2FJ7 B;  3X1U B;  1T3U A;  3KXB D;  1AOI B;  4X23 C;  3O62 A;  1BH8 A;  4WU8 D;  3REK D;  2XD1 A;  4WNN B;  4EO5 B;  3KXB C;  3UTB C;  5B32 G;  4J8U D;  5CPI A;  3LJA A;  3A6N A;  2Y2M A;  2BYM A;  3REK C;  5KDM B;  4J8W A;  4ZBJ C;  4J8U C;  5B31 A;  3C1C A;  2PYO B;  2Y2K A;  3X1T D;  2HIO A;  5GT3 C;  5AV8 B;  5E5A B;  2L5A A;  3W98 B;  4J8V B;  5GXQ B;  3X1T C;  3WTP A;  3UTA D;  5GSU B;  5AV9 B;  4CAY A;  3REL B;  3AZF A;  5B2I B;  3MGS A;  3B6F D;  3MGQ B;  4XZQ B;  5GT0 A;  3VH6 T;  4QLC A;  3VH5 A;  4YS3 D;  1U35 D;  2NQB D;  4X23 B;  3B6F C;  4DQY B;  2Y2O A;  3VH5 W;  1HQ3 D;  3KXB B;  3UTB B;  4YS3 C;  4AWL C;  1P3G D;  1U35 C;  2F8N H;  2NQB C;  4Z66 D;  3X1V A;  3MGR D;  1HQ3 C;  1P34 C;  2ZY4 A;  1P3G C;  5B33 A;  4ZBJ B;  4J8U B;  1Q9C A;  1KX5 A;  3MGR C;  1ZLA A;  4H9S C;  4UUZ A;  4Z2M G;  5AV5 A;  3O62 D;  5GT3 B;  5BS7 A;  3X1T B;  5CPI D;  3O62 C;  4KHA A;  3LJA D;  3A6N D;  3A1I A;  1W2E A;  4J8W D;  5JRG B;  2Y2P A;  5B31 D;  3C1C D;  3LJA C;  3A6N C;  3EPH A;  4WJ3 C;  4J8W C;  3B6F B;  5BNX A;  2HIO D;  3AN2 C;  5B31 C;  3C1C C;  2DF4 C;  2YFW B;  3IP4 C;  4YS3 B;  5E5A A;  1U35 B;  2NQB B;  2HIO C;  3WTP D;  3AZG A;  1HQ3 B;  3AZF D;  2CV5 C;  5GSU A;  1P34 B;  5AV9 A;  1P3G B;  4WV4 B;  4H9O B;  3WTP C;  3AZN C;  3MGR B;  5GT0 D;  3AZF C;  4QLC D;  1ID3 A;  2J8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...