1M18D

Ligand binding alters the structure and dynamics of nucleosomal dna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
94
structure length
94
Chain Sequence
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein/dna
molecule keywords Palindromic 146 Base Pair DNA Fragment
publication title Crystal Structures of Nucleosome Core Particles in Complex with Minor Groove DNA-binding Ligands
pubmed doi rcsb
source organism Xenopus laevis
total genus 36
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1m18D00
4XZQA 3KWQC 5CP6B 3RELD 3X1UD 4Z66C 4J8WC 3AZMB 4G91B 4H9NB 4ZUXC 1P3PA 3B6GA 3WKJD 3WTPB 3REKD 3O62B 2F8NK 4Z5TD 4R8PB 4H9QA 5AVCA 5G49A 3X1TB 3B6FB 5AV6C 3C1CB 4H9SC 3B0DC 3UT9B 1KX3C 1KX5C 5DNMB 3AYWA 5BT1D 3AV1C 5CPJA 1B6WA 3AZEC 1HQ3A 5B1LC 3KSYA 3MVDA 3REHD 1P3IA 4EO5B 5GXQA 4G92B 1F66C 5BNXA 1ZLAD 3AZLA 4ZUXA 2HIOB 4KGCB 3V9RB 5B1MA 3VH6A 3KXBA 5DNMA 5F99B 1S32C 2JSSA 4YM6B 2NZDD 3NQJA 4NE6A 1P3BB 3R45A 1P3AC 1P3MB 5FUGA 5GT0D 4H9OA 2AROC 4WU9D 4XUJB 4J8VC 4YS3B 3X1SB 5AY8A 3MNNB 3MGSD 4LD9C 5B31B 5KDMA 3TU4D 3REJD 5B32C 1P3OC 3UTAD 3KUYD 3LELA 1AOID 5B1LA 3UTBB 4WU8D 1A7WA 3LZ0D 3MGRB 5AVBD 2YFVA 5CPID 5B0ZD 1P3FD 4HGAC 1P3MA 5B2IB 1HTAA 5C3IC 5GSUB 3WAAD 5B33C 4WZSB 3X1SA 3AFAB 3AZND 3AZIB 3KWQD 1BH9B 5AV9C 2BYMB 4Z66D 4J8WD 5CHLB 3REKC 1P3GB 5B2JB 1P34A 3AV2A 3W98B 2F8ND 4E45A 1M18C 5JRGD 2PYOC 1KU5A 4QLCB 4JJNA 1P3LB 5BO0A 3C1BB 1WWIA 1U35B 1P3KA 5AV6D 1P3OA 5DNNB 3AZJA 1EQZB 5AV5C 2CV5B 3LJAB 1KX3D 1KX5D 3X1VC 1ID3B 3W97B 4J8XB 4KHAB 4J8UA 3AV1D 4X23A 5BNVB 5E5AC 5B31G 3W99C 3REHC 3W98A 3RELA 3AZED 3X1UA 3REIB 4QLCA 2FJ7C 1KX4B 1F66D 3MGQB 1F1EA 3WKJA 5GT3C 5DNNA 5B0YC 4Z5TA 3AZKB 5B40B 3AZFC 4H9RA 5B24B 5CPKB 1S32D 1H3OB 3VH5A 1P3AD 2AROD 4NE3A 3MGSC 4J8VD 4NFTA 3A6NC 3LZ1C 1M1AC 4LD9D 1P3PB 1AOIC 3B6GB 5BS7A 4KUDB 5AVBC 5B0ZC 4H9QB 1BH8B 5AVCB 1ZLAA 3B0CW 3WA9C 5G49B 3W96C 3AZHD 3AZNC 5B33D 2NZDA 4E44A 2BYKA 3AYWB 5CPJB 5AV9D 3WTPE 5GT0A 4WU9A 4KUDA 4Z2MH 1HQ3B 5JRGC 1BH8A 3MVDB 1P3IB 5GXQB 5CP6C 3TU4A 1M18D 3REJA 2PYOD 5BNXB 3AZMC 5AV8D 3UTAA 3AZLB 4ZUXB 3KUYA 1AOIA 4WU8A 3LZ0A 5B1MB 3KXBB 3WTPC 5AV5D 5CPIA 3O62C 5B0ZA 4R8PC 2IO5C 3AZGD 1P3FA 3NQJB 3X1VD 3WAAA 3R45B 3X1TC 3B6FC 5E5AD 3C1CC 5FUGB 2NQBD 5JA4A 4H9OB 3UT9C 3W99D 3KWQA 5AY8B 4Z66A 4J8WA 3VH6W 2FJ7D 5KDMB 5GT3D 5B0YD 2F8NA 3LELB 5B1LB 5JRGA 3MGPD 4CAYA 3AZFD 2YFVB 4EO5C 1F66B 5AV6A 4H9SA 2HIOC 4KGCC 2YFWA 1KX3A 1KX5A 5F99C 1Q9CA 3AV1A 4YM6C 3A6ND 1P3BC 3LZ1D 1M1AD 3AZEA 1P34B 3AV2B 4XUJC 4YS3C 4UUZA 1WWSA 1F66A 1M19D 3MNNC 4JJNB 5BO0B 1TAFB 3WA9D 3AZHC 5B31C 3W96D 1P3KB 5B32B 1P3OB 3AZJB 1S32A 3UTBC 3MGRC 2RVQD 4J8UB 1P3AA 1TZYD 4X23B 3AN2D 4Z2MG 5B2IC 2AROA 4J8VA 3RELB 3AFAC 3X1UB 5AV8C 4LD9A 3AZIC 1TAFA 4ZBJB 5CP6D 5B32A 3AZMD 3WKJB 3REKB 4Z5TB 3AZGC 1P3GC 5B2JC 3WTPD 4H9RB 3O62D 4R8PD 1P3LC 2NQBC 1U35C 5B33A 3X1TD 3B6FD 3C1CD 2CV5C 3LJAC 2HUEB 3UT9D 5AV9A 1ID3C 3W97C 4J8XC 2LY8A 3REKA 3MGPC 4M6BA 3REHB 3B0CT 1M18A 4WV4B 2PYOA 1ZLAB 3VH5W 4DRBA 1JFIA 3MGQC 5AV5A 2HIOD 4KGCD 3AZGA 2NZDB 5B40C 3X1VA 2BYKB 5F99D 5CPKC 4YM6D 5E5AA 1P3BD 5GT0B 4WU9B 3W99A 3REHA 1P3MD 4WNNA 3NQUA 3MGSB 1M19C 4XUJD 4XZQC 2FJ7A 4YS3D 3X1SD 3TU4B 3REJB 2F8NH 5GT3A 5B0YA 3MNND 4AWLB 3UTAB 3KUYB 1AOIB 5B31D 1P3PC 3MGPA 3B6GC 4WU8B 3LZ0B 3AZFA 2RVQC 5AVBB 5CPIB 5B0ZB 3UTBD 1P3FB 5AVCC 1TZYC 3MGRD 3AN2C 3WAAB 5B2ID 5JA4B 4H9PA 3AZNB 5GSUD 3MGSA 4CSRA 3KWQB 3VH6T 3A6NA 3AFAD 4Z66B 1ULYA 3LZ1A 4J8WB 1M1AA 3AYWC 4G91C 1R4VA 3AZID 5CPJC 2F8NB 5AVBA 5JRGB 1P3GD 4CAYB 5B2JD 3MVDC 3WA9A 3W98D 1P3IC 3W96A 5GXQC 5AV6B 4QLCD 1P3LD 3C1BD 3AZLC 3AZNA 3B0DB 1U35D 2YFWB 1KX3B 5B1MC 1KX5B 5DNND 3KXBC 5DNMC 1EQZD 2CV5D 2IO5B 3LJAD 3AV1B 1TZYA 3AN2A 1ID3D 3W97D 4J8XD 3AZEB 5CP6A 4UUZB 5AY8C 4G92C 3AZMA 3REID 4H9NA 1KX4D 3MGQD 4DRAA 3WTPA 1S32B 3O62A 3LELC 4R8PA 3AZKD 5B40D 5B24D 5CPKD 3X1TA 3B6FA 1P3AB 1BFMA 1P3MC 3C1CA 2AROB 3UT9A 4NE5A 4J8VB 3X1SC 2F8NG 4LD9B 4XZQD 1P3PD 3B6GD 4KUDD 1P34C 3AV2C 4HGAB 5AVCD 4JJNC 5C3IB 2HIOA 3AZHB 4KGCA 5GSUC 5B33B 3V9RA 1P3KC 3AZJC 5F99A 4YM6A 5AV9B 1P3BA 4J8UC 3AYWD 4X23C 5CPJD 4XUJA 3VH5T 3W98C 4YS3A 1M18B 3RELC 2PYOB 1HQ3D 1N1JB 3X1UC 3MNNA 5AV8B 3MVDD 4QLCC 1P3ID 3C1BC 5B31A 3AZHA 5GXQD 4ZBJC 1JFIB 3WKJC 5DNNC 3AZLD 4ZUXD 5AV5B 1EQZC 4Z5TC 3UTBA 3AZGB 3MGRA 5B1MD 3X1VB 3KXBD 5DNMD 5E5AB 2NQBB 5B2IA 5GSUA 3W99B 4WNNB 5B32G 3AFAA 3NQUB 1N1JA 1B67A 2HUEC 5BT1C 5AV8A 3REIC 3AZIA 2FJ7B 1BH9A 2BYMA 5AY8D 1KX4C 5GT3B 5B0YB 3MGPB 3AZKC 5BS7C 5B2JA 1P3GA 3AZFB 5B24C 3LELD 3B0BA 5B1LD 1ZLAC 1P3LA 2NQBA 3C1BA 1U35A 1EQZA 4H9PB 2CV5A 3LJAA 4CSRB 2NZDC 3A6NB 1ID3A 3W97A 4J8XA 4KHAA 3LZ1B 1M1AB 5BNVA 5GT0C 4WU9C 4KUDC 1M19B 3REIA 4XZQB 1P34D 3AV2D 3WA9B 3W96B 1KX4A 3TU4C 3REJC 3MGQA 2L5AA 4JJND 4AWLC 3UTAC 3KUYC 3AZKA 4WU8C 5B40A 2CWEA 5B32D 3LZ0C 1P3KD 1P3OD 3AZJD 5B24A 5CPKA 5CPIC 1P3FC 1TZYB 3AN2B 3WAAC 4J8UD 1H3OA 4X23D 1HQ3C 1M19A
chains in the Genus database with same CATH superfamily
4XZQA 3KWQC 5CP6B 3RELD 3X1UD 4Z66C 4J8WC 3AZMB 4G91B 4H9NB 4ZUXC 1P3PA 3B6GA 3WKJD 3WTPB 3REKD 3O62B 2F8NK 4Z5TD 4R8PB 4H9QA 5AVCA 5G49A 3X1TB 3B6FB 5AV6C 2DF4C 3C1CB 4H9SC 3B0DC 3UT9B 1KX3C 1KX5C 2Y2JA 5DNMB 2FFFB 3AYWA 5BT1D 3AV1C 5CPJA 1B6WA 3AZEC 1HQ3A 5B1LC 3KSYA 3MVDA 3REHD 1P3IA 4EO5B 5GXQA 2Y2NA 4G92B 3F6TA 1F66C 5BNXA 1ZLAD 3AZLA 4ZUXA 2HIOB 4KGCB 3V9RB 5B1MA 3VH6A 2ZY3A 3KXBA 5DNMA 5F99B 1S32C 3EPLA 2JSSA 4YM6B 2NZDD 3NQJA 4NE6A 1P3BB 3R45A 2Y2PA 1P3AC 1P3MB 5FUGA 5GT0D 4H9OA 2AROC 4WU9D 4XUJB 4J8VC 4YS3B 3X1SB 5AY8A 3MNNB 3MGSD 4LD9C 5B31B 5KDMA 3TU4D 3REJD 5B32C 1P3OC 3UTAD 3KUYD 3LELA 1AOID 5B1LA 3UTBB 4WU8D 1A7WA 3LZ0D 3MGRB 5AVBD 2YFVA 5CPID 3H0RC 3H0LC 5B0ZD 1P3FD 4HGAC 1P3MA 5B2IB 1HTAA 5C3IC 5GSUB 3WAAD 5B33C 2W8SA 4WZSB 3X1SA 3AFAB 3AZND 3AZIB 3KWQD 1BH9B 5AV9C 2BYMB 4Z66D 4J8WD 2J8PA 5CHLB 3REKC 1P3GB 5B2JB 1P34A 3AV2A 3W98B 2F8ND 4E45A 3IP4C 1M18C 5JRGD 2PYOC 1KU5A 4QLCB 4JJNA 1P3LB 5BO0A 3C1BB 1WWIA 1U35B 1P3KA 5AV6D 1P3OA 5DNNB 3AZJA 1EQZB 5AV5C 2CV5B 3LJAB 1KX3D 1KX5D 3X1VC 1ID3B 3W97B 4J8XB 4KHAB 2UWXA 4J8UA 3AV1D 4X23A 5BNVB 5E5AC 5B31G 1Z2CB 3W99C 3REHC 3W98A 3RELA 3AZED 3X1UA 3REIB 4QLCA 2FJ7C 1KX4B 1F66D 3MGQB 1F1EA 3WKJA 5GT3C 5DNNA 5B0YC 4Z5TA 3AZKB 5B40B 3AZFC 4H9RA 5B24B 5CPKB 1S32D 1H3OB 3VH5A 1P3AD 2AROD 2JE5A 4NE3A 3MGSC 4J8VD 4NFTA 3A6NC 3LZ1C 1M1AC 4LD9D 1P3PB 1AOIC 3B6GB 5BS7A 4KUDB 5AVBC 5B0ZC 2XD5A 1BH8B 4H9QB 5AVCB 1ZLAA 3B0CW 3WA9C 5G49B 3W96C 3AZHD 3AZNC 5B33D 2NZDA 4E44A 2BYKA 3AYWB 5CPJB 5AV9D 2G5HC 5GT0A 3WTPE 4WU9A 4KUDA 4Z2MH 1HQ3B 5JRGC 1BH8A 3MVDB 1P3IB 5GXQB 5CP6C 3TU4A 1M18D 3REJA 2PYOD 5BNXB 2DQNC 3AZMC 5AV8D 4WJ3C 3UTAA 3AZLB 4ZUXB 3KUYA 1AOIA 4WU8A 3LZ0A 5B1MB 3KXBB 3WTPC 5AV5D 5CPIA 3O62C 5B0ZA 4R8PC 2IO5C 3AZGD 1P3FA 3AL0C 3NQJB 3X1VD 2G5IC 3WAAA 3R45B 3X1TC 3B6FC 5E5AD 3C1CC 5FUGB 2NQBD 5JA4A 2Y2OA 4H9OB 3UT9C 3W99D 3KWQA 5AY8B 4Z66A 4J8WA 3VH6W 2FJ7D 5KDMB 5GT3D 5B0YD 2F8NA 3LELB 5B1LB 5JRGA 3MGPD 4CAYA 2Y2HA 3AZFD 2YFVB 4EO5C 1F66B 5AV6A 3EPJA 4H9SA 2HIOC 4KGCC 2YFWA 1KX3A 1KX5A 5F99C 2XD1A 1Q9CA 3AV1A 4YM6C 3A6ND 1P3BC 3LZ1D 1M1AD 3AZEA 1P34B 3AV2B 4XUJC 4YS3C 4UUZA 1WWSA 1F66A 1M19D 3MNNC 4JJNB 5BO0B 1TAFB 3WA9D 3AZHC 5B31C 3W96D 1P3KB 5B32B 1P3OB 3AZJB 1S32A 3UTBC 3MGRC 2RVQD 4J8UB 1P3AA 1TZYD 4X23B 3AN2D 4Z2MG 5B2IC 2AROA 3A1IA 4J8VA 3RELB 3AFAC 3X1UB 5AV8C 4LD9A 3AZIC 1TAFA 4ZBJB 5CP6D 5B32A 3AZMD 3WKJB 3REKB 4Z5TB 3AZGC 1P3GC 5B2JC 3WTPD 4H9RB 3O62D 4R8PD 1P3LC 2NQBC 1U35C 5B33A 3X1TD 3B6FD 3C1CD 2BG1A 2CV5C 3LJAC 2HUEB 3UT9D 3KFUG 5AV9A 1ID3C 2ZY2A 3W97C 4J8XC 2LY8A 3EPHA 3REKA 3MGPC 4M6BA 3REHB 3B0CT 1M18A 4WV4B 2PYOA 1ZLAB 3VH5W 3P5JB 4DRBA 1JFIA 3MGQC 5AV5A 2HIOD 4KGCD 3AZGA 2NZDB 5B40C 3X1VA 2BYKB 5F99D 5CPKC 4YM6D 5E5AA 1P3BD 5GT0B 4WU9B 3W99A 3REHA 1P3MD 4WNNA 3NQUA 2ZM5A 3MGSB 1M19C 4XUJD 4XZQC 2FJ7A 4YS3D 3X1SD 3TU4B 3REJB 2F8NH 5GT3A 5B0YA 3MNND 2VQRA 4AWLB 3UTAB 3KUYB 1AOIB 5B31D 1P3PC 3MGPA 3B6GC 4WU8B 3LZ0B 3AZFA 2RVQC 5AVBB 5CPIB 5B0ZB 3UTBD 1P3FB 5AVCC 1TZYC 3MGRD 3AN2C 3WAAB 5B2ID 5JA4B 4H9PA 3AZNB 5GSUD 3MGSA 4CSRA 3KWQB 3VH6T 3A6NA 3AFAD 4Z66B 1ULYA 3LZ1A 4J8WB 1M1AA 3AYWC 4G91C 1R4VA 3AZID 5CPJC 3A1KA 2F8NB 5AVBA 5JRGB 1P3GD 4CAYB 5B2JD 3MVDC 3WA9A 3FDDA 3W98D 1P3IC 3W96A 5GXQC 5AV6B 4QLCD 1P3LD 3C1BD 3AZLC 3AZNA 3B0DB 1U35D 2YFWB 1KX3B 5B1MC 1KX5B 5DNND 3KXBC 5DNMC 1EQZD 2CV5D 2IO5B 3LJAD 3AV1B 1TZYA 3AN2A 1ID3D 3W97D 4J8XD 3AZEB 5CP6A 3EG5B 4UUZB 5AY8C 4G92C 3AZMA 3REID 4H9NA 1KX4D 3MGQD 4DRAA 3WTPA 1S32B 3O62A 3LELC 4R8PA 2ZY5A 3AZKD 5B40D 5B24D 5CPKD 3X1TA 3B6FA 1P3AB 1BFMA 1P3MC 3C1CA 2AROB 3UT9A 4NE5A 4J8VB 3X1SC 2F8NG 4LD9B 4XZQD 1P3PD 3B6GD 4KUDD 1P34C 3AV2C 4HGAB 5AVCD 4JJNC 2Y2KA 5C3IB 2HIOA 4DQYB 3AZHB 4KGCA 5GSUC 5B33B 3V9RA 1P3KC 3AZJC 5F99A 4YM6A 5AV9B 1P3BA 3H0MC 4J8UC 3AYWD 4X23C 5CPJD 4XUJA 3VH5T 3W98C 4YS3A 1M18B 3RELC 2PYOB 1HQ3D 1N1JB 3X1UC 3MNNA 5AV8B 3MVDD 4QLCC 2RIQA 1P3ID 3C1BC 5B31A 3AZHA 5GXQD 4ZBJC 1JFIB 3WKJC 2Y2IA 5DNNC 3AZLD 4ZUXD 5AV5B 1EQZC 4Z5TC 3UTBA 3AZGB 3MGRA 5B1MD 3X1VB 3KXBD 5DNMD 2JCHA 3EPKA 5E5AB 2NQBB 5B2IA 5GSUA 3W99B 4WNNB 2Y2MA 5B32G 3AFAA 3NQUB 1N1JA 1B67A 2HUEC 5BT1C 5AV8A 3REIC 3AZIA 2FJ7B 1BH9A 2BYMA 5AY8D 1KX4C 5GT3B 2Y2GA 5B0YB 3MGPB 3AZKC 5BS7C 5B2JA 1P3GA 3AZFB 5B24C 3LELD 3B0BA 5B1LD 1ZLAC 1P3LA 2NQBA 3C1BA 4UPKA 1U35A 2Y2QA 1EQZA 4H9PB 2CV5A 3LJAA 4CSRB 2NZDC 3A6NB 1ID3A 3W97A 4J8XA 4KHAA 3LZ1B 1M1AB 5BNVA 5GT0C 4WU9C 4KUDC 1M19B 3REIA 2ZY4A 4XZQB 1P34D 3AV2D 3WA9B 3W96B 1KX4A 3TU4C 3REJC 3MGQA 1T3UA 2L5AA 4JJND 4AWLC 3UTAC 3KUYC 2F2AC 3AZKA 4WU8C 5B40A 2CWEA 5B32D 1PZRA 3LZ0C 1P3KD 3AZJD 1P3OD 5B24A 5CPKA 5CPIC 1P3FC 1TZYB 3AN2B 2Y2LA 3WAAC 4J8UD 1H3OA 1W2EA 4X23D 1HQ3C 1M19A
chains in the Genus database with same CATH topology
4XZQA 3KWQC 5CP6B 3RELD 3X1UD 4Z66C 4J8WC 3AZMB 4G91B 4H9NB 4ZUXC 1P3PA 3B6GA 3WKJD 3WTPB 3REKD 3O62B 2F8NK 4Z5TD 4R8PB 4H9QA 5AVCA 5G49A 3X1TB 3B6FB 5AV6C 2DF4C 3C1CB 4H9SC 3B0DC 3UT9B 1KX3C 1KX5C 2Y2JA 5DNMB 2FFFB 3AYWA 5BT1D 3AV1C 5CPJA 1B6WA 3AZEC 1HQ3A 5B1LC 3KSYA 3MVDA 3REHD 1P3IA 4EO5B 5GXQA 2Y2NA 4G92B 3F6TA 1F66C 5BNXA 1ZLAD 3AZLA 4ZUXA 2HIOB 4KGCB 3V9RB 5B1MA 3VH6A 2ZY3A 3KXBA 5DNMA 5F99B 1S32C 3EPLA 2JSSA 4YM6B 2NZDD 3NQJA 4NE6A 1P3BB 3R45A 2Y2PA 1P3AC 1P3MB 5FUGA 5GT0D 4H9OA 2AROC 4WU9D 4XUJB 4J8VC 4YS3B 3X1SB 5AY8A 3MNNB 3MGSD 4LD9C 5B31B 5KDMA 3TU4D 3REJD 5B32C 1P3OC 3UTAD 3KUYD 3LELA 1AOID 5B1LA 3UTBB 4WU8D 1A7WA 3LZ0D 3MGRB 5AVBD 2YFVA 5CPID 3H0RC 3H0LC 5B0ZD 1P3FD 4HGAC 1P3MA 5B2IB 1HTAA 5C3IC 5GSUB 3WAAD 5B33C 2W8SA 4WZSB 3X1SA 3AFAB 3AZND 3AZIB 3KWQD 1BH9B 5AV9C 2BYMB 4Z66D 4J8WD 2J8PA 5CHLB 3REKC 1P3GB 5B2JB 1P34A 3AV2A 3W98B 2F8ND 4E45A 3IP4C 1M18C 5JRGD 2PYOC 1KU5A 4QLCB 4JJNA 1P3LB 5BO0A 3C1BB 1WWIA 1U35B 1P3KA 5AV6D 1P3OA 5DNNB 3AZJA 1EQZB 5AV5C 2CV5B 3LJAB 1KX3D 1KX5D 3X1VC 1ID3B 3W97B 4J8XB 4KHAB 2UWXA 4J8UA 3AV1D 4X23A 5BNVB 5E5AC 5B31G 1Z2CB 3W99C 3REHC 3W98A 3RELA 3AZED 3X1UA 3REIB 4QLCA 2FJ7C 1KX4B 1F66D 3MGQB 1F1EA 3WKJA 5GT3C 5DNNA 5B0YC 4Z5TA 3AZKB 5B40B 3AZFC 4H9RA 5B24B 5CPKB 1S32D 1H3OB 3VH5A 1P3AD 2AROD 2JE5A 4NE3A 3MGSC 4J8VD 4NFTA 3A6NC 3LZ1C 1M1AC 4LD9D 1P3PB 1AOIC 3B6GB 5BS7A 4KUDB 5AVBC 5B0ZC 2XD5A 1BH8B 4H9QB 5AVCB 1ZLAA 3B0CW 3WA9C 5G49B 3W96C 3AZHD 3AZNC 5B33D 2NZDA 4E44A 2BYKA 3AYWB 5CPJB 5AV9D 2G5HC 5GT0A 3WTPE 4WU9A 4KUDA 4Z2MH 1HQ3B 5JRGC 1BH8A 3MVDB 1P3IB 5GXQB 5CP6C 3TU4A 1M18D 3REJA 2PYOD 5BNXB 2DQNC 3AZMC 5AV8D 4WJ3C 3UTAA 3AZLB 4ZUXB 3KUYA 1AOIA 4WU8A 3LZ0A 5B1MB 3KXBB 3WTPC 5AV5D 5CPIA 3O62C 5B0ZA 4R8PC 2IO5C 3AZGD 1P3FA 3AL0C 3NQJB 3X1VD 2G5IC 3WAAA 3R45B 3X1TC 3B6FC 5E5AD 3C1CC 5FUGB 2NQBD 5JA4A 2Y2OA 4H9OB 3UT9C 3W99D 3KWQA 5AY8B 4Z66A 4J8WA 3VH6W 2FJ7D 5KDMB 5GT3D 5B0YD 2F8NA 3LELB 5B1LB 5JRGA 3MGPD 4CAYA 2Y2HA 3AZFD 2YFVB 4EO5C 1F66B 5AV6A 3EPJA 4H9SA 2HIOC 4KGCC 2YFWA 1KX3A 1KX5A 5F99C 2XD1A 1Q9CA 3AV1A 4YM6C 3A6ND 1P3BC 3LZ1D 1M1AD 3AZEA 1P34B 3AV2B 4XUJC 4YS3C 4UUZA 1WWSA 1F66A 1M19D 3MNNC 4JJNB 5BO0B 1TAFB 3WA9D 3AZHC 5B31C 3W96D 1P3KB 5B32B 1P3OB 3AZJB 1S32A 3UTBC 3MGRC 2RVQD 4J8UB 1P3AA 1TZYD 4X23B 3AN2D 4Z2MG 5B2IC 2AROA 3A1IA 4J8VA 3RELB 3AFAC 3X1UB 5AV8C 4LD9A 3AZIC 1TAFA 4ZBJB 5CP6D 5B32A 3AZMD 3WKJB 3REKB 4Z5TB 3AZGC 1P3GC 5B2JC 3WTPD 4H9RB 3O62D 4R8PD 1P3LC 2NQBC 1U35C 5B33A 3X1TD 3B6FD 3C1CD 2BG1A 2CV5C 3LJAC 2HUEB 3UT9D 3KFUG 5AV9A 1ID3C 2ZY2A 3W97C 4J8XC 2LY8A 3EPHA 3REKA 3MGPC 4M6BA 3REHB 3B0CT 1M18A 4WV4B 2PYOA 1ZLAB 3VH5W 3P5JB 4DRBA 1JFIA 3MGQC 5AV5A 2HIOD 4KGCD 3AZGA 2NZDB 5B40C 3X1VA 2BYKB 5F99D 5CPKC 4YM6D 5E5AA 1P3BD 5GT0B 4WU9B 3W99A 3REHA 1P3MD 4WNNA 3NQUA 2ZM5A 3MGSB 1M19C 4XUJD 4XZQC 2FJ7A 4YS3D 3X1SD 3TU4B 3REJB 2F8NH 5GT3A 5B0YA 3MNND 2VQRA 4AWLB 3UTAB 3KUYB 1AOIB 5B31D 1P3PC 3MGPA 3B6GC 4WU8B 3LZ0B 3AZFA 2RVQC 5AVBB 5CPIB 5B0ZB 3UTBD 1P3FB 5AVCC 1TZYC 3MGRD 3AN2C 3WAAB 5B2ID 5JA4B 4H9PA 3AZNB 5GSUD 3MGSA 4CSRA 3KWQB 3VH6T 3A6NA 3AFAD 4Z66B 1ULYA 3LZ1A 4J8WB 1M1AA 3AYWC 4G91C 1R4VA 3AZID 5CPJC 3A1KA 2F8NB 5AVBA 5JRGB 1P3GD 4CAYB 5B2JD 3MVDC 3WA9A 3FDDA 3W98D 1P3IC 3W96A 5GXQC 5AV6B 4QLCD 1P3LD 3C1BD 3AZLC 3AZNA 3B0DB 1U35D 2YFWB 1KX3B 5B1MC 1KX5B 5DNND 3KXBC 5DNMC 1EQZD 2CV5D 2IO5B 3LJAD 3AV1B 1TZYA 3AN2A 1ID3D 3W97D 4J8XD 3AZEB 5CP6A 3EG5B 4UUZB 5AY8C 4G92C 3AZMA 3REID 4H9NA 1KX4D 3MGQD 4DRAA 3WTPA 1S32B 3O62A 3LELC 4R8PA 2ZY5A 3AZKD 5B40D 5B24D 5CPKD 3X1TA 3B6FA 1P3AB 1BFMA 1P3MC 3C1CA 2AROB 3UT9A 4NE5A 4J8VB 3X1SC 2F8NG 4LD9B 4XZQD 1P3PD 3B6GD 4KUDD 1P34C 3AV2C 4HGAB 5AVCD 4JJNC 2Y2KA 5C3IB 2HIOA 4DQYB 3AZHB 4KGCA 5GSUC 5B33B 3V9RA 1P3KC 3AZJC 5F99A 4YM6A 5AV9B 1P3BA 3H0MC 4J8UC 3AYWD 4X23C 5CPJD 4XUJA 3VH5T 3W98C 4YS3A 1M18B 3RELC 2PYOB 1HQ3D 1N1JB 3X1UC 3MNNA 5AV8B 3MVDD 4QLCC 2RIQA 1P3ID 3C1BC 5B31A 3AZHA 5GXQD 4ZBJC 1JFIB 3WKJC 2Y2IA 5DNNC 3AZLD 4ZUXD 5AV5B 1EQZC 4Z5TC 3UTBA 3AZGB 3MGRA 5B1MD 3X1VB 3KXBD 5DNMD 2JCHA 3EPKA 5E5AB 2NQBB 5B2IA 5GSUA 3W99B 4WNNB 2Y2MA 5B32G 3AFAA 3NQUB 1N1JA 1B67A 2HUEC 5BT1C 5AV8A 3REIC 3AZIA 2FJ7B 1BH9A 2BYMA 5AY8D 1KX4C 5GT3B 2Y2GA 5B0YB 3MGPB 3AZKC 5BS7C 5B2JA 1P3GA 3AZFB 5B24C 3LELD 3B0BA 5B1LD 1ZLAC 1P3LA 2NQBA 3C1BA 4UPKA 1U35A 2Y2QA 1EQZA 4H9PB 2CV5A 3LJAA 4CSRB 2NZDC 3A6NB 1ID3A 3W97A 4J8XA 4KHAA 3LZ1B 1M1AB 5BNVA 5GT0C 4WU9C 4KUDC 1M19B 3REIA 2ZY4A 4XZQB 1P34D 3AV2D 3WA9B 3W96B 1KX4A 3TU4C 3REJC 3MGQA 1T3UA 2L5AA 4JJND 4AWLC 3UTAC 3KUYC 2F2AC 3AZKA 4WU8C 5B40A 2CWEA 5B32D 1PZRA 3LZ0C 1P3KD 3AZJD 1P3OD 5B24A 5CPKA 5CPIC 1P3FC 1TZYB 3AN2B 2Y2LA 3WAAC 4J8UD 1H3OA 1W2EA 4X23D 1HQ3C 1M19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XZQ A;  3KWQ C;  5CP6 B;  3REL D;  3X1U D;  4Z66 C;  4J8W C;  3AZM B;  4G91 B;  4H9N B;  4ZUX C;  1P3P A;  3B6G A;  3WKJ D;  3WTP B;  3REK D;  3O62 B;  2F8N K;  4Z5T D;  4R8P B;  4H9Q A;  5AVC A;  5G49 A;  3X1T B;  3B6F B;  5AV6 C;  3C1C B;  4H9S C;  3B0D C;  3UT9 B;  1KX3 C;  1KX5 C;  5DNM B;  3AYW A;  5BT1 D;  3AV1 C;  5CPJ A;  1B6W A;  3AZE C;  1HQ3 A;  5B1L C;  3KSY A;  3MVD A;  3REH D;  1P3I A;  4EO5 B;  5GXQ A;  4G92 B;  1F66 C;  5BNX A;  1ZLA D;  3AZL A;  4ZUX A;  2HIO B;  4KGC B;  3V9R B;  5B1M A;  3VH6 A;  3KXB A;  5DNM A;  5F99 B;  1S32 C;  2JSS A;  4YM6 B;  2NZD D;  3NQJ A;  4NE6 A;  1P3B B;  3R45 A;  1P3A C;  1P3M B;  5FUG A;  5GT0 D;  4H9O A;  2ARO C;  4WU9 D;  4XUJ B;  4J8V C;  4YS3 B;  3X1S B;  5AY8 A;  3MNN B;  3MGS D;  4LD9 C;  5B31 B;  5KDM A;  3TU4 D;  3REJ D;  5B32 C;  1P3O C;  3UTA D;  3KUY D;  3LEL A;  1AOI D;  5B1L A;  3UTB B;  4WU8 D;  1A7W A;  3LZ0 D;  3MGR B;  5AVB D;  2YFV A;  5CPI D;  5B0Z D;  1P3F D;  4HGA C;  1P3M A;  5B2I B;  1HTA A;  5C3I C;  5GSU B;  3WAA D;  5B33 C;  4WZS B;  3X1S A;  3AFA B;  3AZN D;  3AZI B;  3KWQ D;  1BH9 B;  5AV9 C;  2BYM B;  4Z66 D;  4J8W D;  5CHL B;  3REK C;  1P3G B;  5B2J B;  1P34 A;  3AV2 A;  3W98 B;  2F8N D;  4E45 A;  1M18 C;  5JRG D;  2PYO C;  1KU5 A;  4QLC B;  4JJN A;  1P3L B;  5BO0 A;  3C1B B;  1WWI A;  1U35 B;  1P3K A;  5AV6 D;  1P3O A;  5DNN B;  3AZJ A;  1EQZ B;  5AV5 C;  2CV5 B;  3LJA B;  1KX3 D;  1KX5 D;  3X1V C;  1ID3 B;  3W97 B;  4J8X B;  4KHA B;  4J8U A;  3AV1 D;  4X23 A;  5BNV B;  5E5A C;  5B31 G;  3W99 C;  3REH C;  3W98 A;  3REL A;  3AZE D;  3X1U A;  3REI B;  4QLC A;  2FJ7 C;  1KX4 B;  1F66 D;  3MGQ B;  1F1E A;  3WKJ A;  5GT3 C;  5DNN A;  5B0Y C;  4Z5T A;  3AZK B;  5B40 B;  3AZF C;  4H9R A;  5B24 B;  5CPK B;  1S32 D;  1H3O B;  3VH5 A;  1P3A D;  2ARO D;  4NE3 A;  3MGS C;  4J8V D;  4NFT A;  3A6N C;  3LZ1 C;  1M1A C;  4LD9 D;  1P3P B;  1AOI C;  3B6G B;  5BS7 A;  4KUD B;  5AVB C;  5B0Z C;  4H9Q B;  1BH8 B;  5AVC B;  1ZLA A;  3B0C W;  3WA9 C;  5G49 B;  3W96 C;  3AZH D;  3AZN C;  5B33 D;  2NZD A;  4E44 A;  2BYK A;  3AYW B;  5CPJ B;  5AV9 D;  3WTP E;  5GT0 A;  4WU9 A;  4KUD A;  4Z2M H;  1HQ3 B;  5JRG C;  1BH8 A;  3MVD B;  1P3I B;  5GXQ B;  5CP6 C;  3TU4 A;  1M18 D;  3REJ A;  2PYO D;  5BNX B;  3AZM C;  5AV8 D;  3UTA A;  3AZL B;  4ZUX B;  3KUY A;  1AOI A;  4WU8 A;  3LZ0 A;  5B1M B;  3KXB B;  3WTP C;  5AV5 D;  5CPI A;  3O62 C;  5B0Z A;  4R8P C;  2IO5 C;  3AZG D;  1P3F A;  3NQJ B;  3X1V D;  3WAA A;  3R45 B;  3X1T C;  3B6F C;  5E5A D;  3C1C C;  5FUG B;  2NQB D;  5JA4 A;  4H9O B;  3UT9 C;  3W99 D;  3KWQ A;  5AY8 B;  4Z66 A;  4J8W A;  3VH6 W;  2FJ7 D;  5KDM B;  5GT3 D;  5B0Y D;  2F8N A;  3LEL B;  5B1L B;  5JRG A;  3MGP D;  4CAY A;  3AZF D;  2YFV B;  4EO5 C;  1F66 B;  5AV6 A;  4H9S A;  2HIO C;  4KGC C;  2YFW A;  1KX3 A;  1KX5 A;  5F99 C;  1Q9C A;  3AV1 A;  4YM6 C;  3A6N D;  1P3B C;  3LZ1 D;  1M1A D;  3AZE A;  1P34 B;  3AV2 B;  4XUJ C;  4YS3 C;  4UUZ A;  1WWS A;  1F66 A;  1M19 D;  3MNN C;  4JJN B;  5BO0 B;  1TAF B;  3WA9 D;  3AZH C;  5B31 C;  3W96 D;  1P3K B;  5B32 B;  1P3O B;  3AZJ B;  1S32 A;  3UTB C;  3MGR C;  2RVQ D;  4J8U B;  1P3A A;  1TZY D;  4X23 B;  3AN2 D;  4Z2M G;  5B2I C;  2ARO A;  4J8V A;  3REL B;  3AFA C;  3X1U B;  5AV8 C;  4LD9 A;  3AZI C;  1TAF A;  4ZBJ B;  5CP6 D;  5B32 A;  3AZM D;  3WKJ B;  3REK B;  4Z5T B;  3AZG C;  1P3G C;  5B2J C;  3WTP D;  4H9R B;  3O62 D;  4R8P D;  1P3L C;  2NQB C;  1U35 C;  5B33 A;  3X1T D;  3B6F D;  3C1C D;  2CV5 C;  3LJA C;  2HUE B;  3UT9 D;  5AV9 A;  1ID3 C;  3W97 C;  4J8X C;  2LY8 A;  3REK A;  3MGP C;  4M6B A;  3REH B;  3B0C T;  1M18 A;  4WV4 B;  2PYO A;  1ZLA B;  3VH5 W;  4DRB A;  1JFI A;  3MGQ C;  5AV5 A;  2HIO D;  4KGC D;  3AZG A;  2NZD B;  5B40 C;  3X1V A;  2BYK B;  5F99 D;  5CPK C;  4YM6 D;  5E5A A;  1P3B D;  5GT0 B;  4WU9 B;  3W99 A;  3REH A;  1P3M D;  4WNN A;  3NQU A;  3MGS B;  1M19 C;  4XUJ D;  4XZQ C;  2FJ7 A;  4YS3 D;  3X1S D;  3TU4 B;  3REJ B;  2F8N H;  5GT3 A;  5B0Y A;  3MNN D;  4AWL B;  3UTA B;  3KUY B;  1AOI B;  5B31 D;  1P3P C;  3MGP A;  3B6G C;  4WU8 B;  3LZ0 B;  3AZF A;  2RVQ C;  5AVB B;  5CPI B;  5B0Z B;  3UTB D;  1P3F B;  5AVC C;  1TZY C;  3MGR D;  3AN2 C;  3WAA B;  5B2I D;  5JA4 B;  4H9P A;  3AZN B;  5GSU D;  3MGS A;  4CSR A;  3KWQ B;  3VH6 T;  3A6N A;  3AFA D;  4Z66 B;  1ULY A;  3LZ1 A;  4J8W B;  1M1A A;  3AYW C;  4G91 C;  1R4V A;  3AZI D;  5CPJ C;  2F8N B;  5AVB A;  5JRG B;  1P3G D;  4CAY B;  5B2J D;  3MVD C;  3WA9 A;  3W98 D;  1P3I C;  3W96 A;  5GXQ C;  5AV6 B;  4QLC D;  1P3L D;  3C1B D;  3AZL C;  3AZN A;  3B0D B;  1U35 D;  2YFW B;  1KX3 B;  5B1M C;  1KX5 B;  5DNN D;  3KXB C;  5DNM C;  1EQZ D;  2CV5 D;  2IO5 B;  3LJA D;  3AV1 B;  1TZY A;  3AN2 A;  1ID3 D;  3W97 D;  4J8X D;  3AZE B;  5CP6 A;  4UUZ B;  5AY8 C;  4G92 C;  3AZM A;  3REI D;  4H9N A;  1KX4 D;  3MGQ D;  4DRA A;  3WTP A;  1S32 B;  3O62 A;  3LEL C;  4R8P A;  3AZK D;  5B40 D;  5B24 D;  5CPK D;  3X1T A;  3B6F A;  1P3A B;  1BFM A;  1P3M C;  3C1C A;  2ARO B;  3UT9 A;  4NE5 A;  4J8V B;  3X1S C;  2F8N G;  4LD9 B;  4XZQ D;  1P3P D;  3B6G D;  4KUD D;  1P34 C;  3AV2 C;  4HGA B;  5AVC D;  4JJN C;  5C3I B;  2HIO A;  3AZH B;  4KGC A;  5GSU C;  5B33 B;  3V9R A;  1P3K C;  3AZJ C;  5F99 A;  4YM6 A;  5AV9 B;  1P3B A;  4J8U C;  3AYW D;  4X23 C;  5CPJ D;  4XUJ A;  3VH5 T;  3W98 C;  4YS3 A;  1M18 B;  3REL C;  2PYO B;  1HQ3 D;  1N1J B;  3X1U C;  3MNN A;  5AV8 B;  3MVD D;  4QLC C;  1P3I D;  3C1B C;  5B31 A;  3AZH A;  5GXQ D;  4ZBJ C;  1JFI B;  3WKJ C;  5DNN C;  3AZL D;  4ZUX D;  5AV5 B;  1EQZ C;  4Z5T C;  3UTB A;  3AZG B;  3MGR A;  5B1M D;  3X1V B;  3KXB D;  5DNM D;  5E5A B;  2NQB B;  5B2I A;  5GSU A;  3W99 B;  4WNN B;  5B32 G;  3AFA A;  3NQU B;  1N1J A;  1B67 A;  2HUE C;  5BT1 C;  5AV8 A;  3REI C;  3AZI A;  2FJ7 B;  1BH9 A;  2BYM A;  5AY8 D;  1KX4 C;  5GT3 B;  5B0Y B;  3MGP B;  3AZK C;  5BS7 C;  5B2J A;  1P3G A;  3AZF B;  5B24 C;  3LEL D;  3B0B A;  5B1L D;  1ZLA C;  1P3L A;  2NQB A;  3C1B A;  1U35 A;  1EQZ A;  4H9P B;  2CV5 A;  3LJA A;  4CSR B;  2NZD C;  3A6N B;  1ID3 A;  3W97 A;  4J8X A;  4KHA A;  3LZ1 B;  1M1A B;  5BNV A;  5GT0 C;  4WU9 C;  4KUD C;  1M19 B;  3REI A;  4XZQ B;  1P34 D;  3AV2 D;  3WA9 B;  3W96 B;  1KX4 A;  3TU4 C;  3REJ C;  3MGQ A;  2L5A A;  4JJN D;  4AWL C;  3UTA C;  3KUY C;  3AZK A;  4WU8 C;  5B40 A;  2CWE A;  5B32 D;  3LZ0 C;  1P3K D;  1P3O D;  3AZJ D;  5B24 A;  5CPK A;  5CPI C;  1P3F C;  1TZY B;  3AN2 B;  3WAA C;  4J8U D;  1H3O A;  4X23 D;  1HQ3 C;  1M19 A; 
#chains in the Genus database with same CATH topology
 4XZQ A;  3KWQ C;  5CP6 B;  3REL D;  3X1U D;  4Z66 C;  4J8W C;  3AZM B;  4G91 B;  4H9N B;  4ZUX C;  1P3P A;  3B6G A;  3WKJ D;  3WTP B;  3REK D;  3O62 B;  2F8N K;  4Z5T D;  4R8P B;  4H9Q A;  5AVC A;  5G49 A;  3X1T B;  3B6F B;  5AV6 C;  2DF4 C;  3C1C B;  4H9S C;  3B0D C;  3UT9 B;  1KX3 C;  1KX5 C;  2Y2J A;  5DNM B;  2FFF B;  3AYW A;  5BT1 D;  3AV1 C;  5CPJ A;  1B6W A;  3AZE C;  1HQ3 A;  5B1L C;  3KSY A;  3MVD A;  3REH D;  1P3I A;  4EO5 B;  5GXQ A;  2Y2N A;  4G92 B;  3F6T A;  1F66 C;  5BNX A;  1ZLA D;  3AZL A;  4ZUX A;  2HIO B;  4KGC B;  3V9R B;  5B1M A;  3VH6 A;  2ZY3 A;  3KXB A;  5DNM A;  5F99 B;  1S32 C;  3EPL A;  2JSS A;  4YM6 B;  2NZD D;  3NQJ A;  4NE6 A;  1P3B B;  3R45 A;  2Y2P A;  1P3A C;  1P3M B;  5FUG A;  5GT0 D;  4H9O A;  2ARO C;  4WU9 D;  4XUJ B;  4J8V C;  4YS3 B;  3X1S B;  5AY8 A;  3MNN B;  3MGS D;  4LD9 C;  5B31 B;  5KDM A;  3TU4 D;  3REJ D;  5B32 C;  1P3O C;  3UTA D;  3KUY D;  3LEL A;  1AOI D;  5B1L A;  3UTB B;  4WU8 D;  1A7W A;  3LZ0 D;  3MGR B;  5AVB D;  2YFV A;  5CPI D;  3H0R C;  3H0L C;  5B0Z D;  1P3F D;  4HGA C;  1P3M A;  5B2I B;  1HTA A;  5C3I C;  5GSU B;  3WAA D;  5B33 C;  2W8S A;  4WZS B;  3X1S A;  3AFA B;  3AZN D;  3AZI B;  3KWQ D;  1BH9 B;  5AV9 C;  2BYM B;  4Z66 D;  4J8W D;  2J8P A;  5CHL B;  3REK C;  1P3G B;  5B2J B;  1P34 A;  3AV2 A;  3W98 B;  2F8N D;  4E45 A;  3IP4 C;  1M18 C;  5JRG D;  2PYO C;  1KU5 A;  4QLC B;  4JJN A;  1P3L B;  5BO0 A;  3C1B B;  1WWI A;  1U35 B;  1P3K A;  5AV6 D;  1P3O A;  5DNN B;  3AZJ A;  1EQZ B;  5AV5 C;  2CV5 B;  3LJA B;  1KX3 D;  1KX5 D;  3X1V C;  1ID3 B;  3W97 B;  4J8X B;  4KHA B;  2UWX A;  4J8U A;  3AV1 D;  4X23 A;  5BNV B;  5E5A C;  5B31 G;  1Z2C B;  3W99 C;  3REH C;  3W98 A;  3REL A;  3AZE D;  3X1U A;  3REI B;  4QLC A;  2FJ7 C;  1KX4 B;  1F66 D;  3MGQ B;  1F1E A;  3WKJ A;  5GT3 C;  5DNN A;  5B0Y C;  4Z5T A;  3AZK B;  5B40 B;  3AZF C;  4H9R A;  5B24 B;  5CPK B;  1S32 D;  1H3O B;  3VH5 A;  1P3A D;  2ARO D;  2JE5 A;  4NE3 A;  3MGS C;  4J8V D;  4NFT A;  3A6N C;  3LZ1 C;  1M1A C;  4LD9 D;  1P3P B;  1AOI C;  3B6G B;  5BS7 A;  4KUD B;  5AVB C;  5B0Z C;  2XD5 A;  1BH8 B;  4H9Q B;  5AVC B;  1ZLA A;  3B0C W;  3WA9 C;  5G49 B;  3W96 C;  3AZH D;  3AZN C;  5B33 D;  2NZD A;  4E44 A;  2BYK A;  3AYW B;  5CPJ B;  5AV9 D;  2G5H C;  5GT0 A;  3WTP E;  4WU9 A;  4KUD A;  4Z2M H;  1HQ3 B;  5JRG C;  1BH8 A;  3MVD B;  1P3I B;  5GXQ B;  5CP6 C;  3TU4 A;  1M18 D;  3REJ A;  2PYO D;  5BNX B;  2DQN C;  3AZM C;  5AV8 D;  4WJ3 C;  3UTA A;  3AZL B;  4ZUX B;  3KUY A;  1AOI A;  4WU8 A;  3LZ0 A;  5B1M B;  3KXB B;  3WTP C;  5AV5 D;  5CPI A;  3O62 C;  5B0Z A;  4R8P C;  2IO5 C;  3AZG D;  1P3F A;  3AL0 C;  3NQJ B;  3X1V D;  2G5I C;  3WAA A;  3R45 B;  3X1T C;  3B6F C;  5E5A D;  3C1C C;  5FUG B;  2NQB D;  5JA4 A;  2Y2O A;  4H9O B;  3UT9 C;  3W99 D;  3KWQ A;  5AY8 B;  4Z66 A;  4J8W A;  3VH6 W;  2FJ7 D;  5KDM B;  5GT3 D;  5B0Y D;  2F8N A;  3LEL B;  5B1L B;  5JRG A;  3MGP D;  4CAY A;  2Y2H A;  3AZF D;  2YFV B;  4EO5 C;  1F66 B;  5AV6 A;  3EPJ A;  4H9S A;  2HIO C;  4KGC C;  2YFW A;  1KX3 A;  1KX5 A;  5F99 C;  2XD1 A;  1Q9C A;  3AV1 A;  4YM6 C;  3A6N D;  1P3B C;  3LZ1 D;  1M1A D;  3AZE A;  1P34 B;  3AV2 B;  4XUJ C;  4YS3 C;  4UUZ A;  1WWS A;  1F66 A;  1M19 D;  3MNN C;  4JJN B;  5BO0 B;  1TAF B;  3WA9 D;  3AZH C;  5B31 C;  3W96 D;  1P3K B;  5B32 B;  1P3O B;  3AZJ B;  1S32 A;  3UTB C;  3MGR C;  2RVQ D;  4J8U B;  1P3A A;  1TZY D;  4X23 B;  3AN2 D;  4Z2M G;  5B2I C;  2ARO A;  3A1I A;  4J8V A;  3REL B;  3AFA C;  3X1U B;  5AV8 C;  4LD9 A;  3AZI C;  1TAF A;  4ZBJ B;  5CP6 D;  5B32 A;  3AZM D;  3WKJ B;  3REK B;  4Z5T B;  3AZG C;  1P3G C;  5B2J C;  3WTP D;  4H9R B;  3O62 D;  4R8P D;  1P3L C;  2NQB C;  1U35 C;  5B33 A;  3X1T D;  3B6F D;  3C1C D;  2BG1 A;  2CV5 C;  3LJA C;  2HUE B;  3UT9 D;  3KFU G;  5AV9 A;  1ID3 C;  2ZY2 A;  3W97 C;  4J8X C;  2LY8 A;  3EPH A;  3REK A;  3MGP C;  4M6B A;  3REH B;  3B0C T;  1M18 A;  4WV4 B;  2PYO A;  1ZLA B;  3VH5 W;  3P5J B;  4DRB A;  1JFI A;  3MGQ C;  5AV5 A;  2HIO D;  4KGC D;  3AZG A;  2NZD B;  5B40 C;  3X1V A;  2BYK B;  5F99 D;  5CPK C;  4YM6 D;  5E5A A;  1P3B D;  5GT0 B;  4WU9 B;  3W99 A;  3REH A;  1P3M D;  4WNN A;  3NQU A;  2ZM5 A;  3MGS B;  1M19 C;  4XUJ D;  4XZQ C;  2FJ7 A;  4YS3 D;  3X1S D;  3TU4 B;  3REJ B;  2F8N H;  5GT3 A;  5B0Y A;  3MNN D;  2VQR A;  4AWL B;  3UTA B;  3KUY B;  1AOI B;  5B31 D;  1P3P C;  3MGP A;  3B6G C;  4WU8 B;  3LZ0 B;  3AZF A;  2RVQ C;  5AVB B;  5CPI B;  5B0Z B;  3UTB D;  1P3F B;  5AVC C;  1TZY C;  3MGR D;  3AN2 C;  3WAA B;  5B2I D;  5JA4 B;  4H9P A;  3AZN B;  5GSU D;  3MGS A;  4CSR A;  3KWQ B;  3VH6 T;  3A6N A;  3AFA D;  4Z66 B;  1ULY A;  3LZ1 A;  4J8W B;  1M1A A;  3AYW C;  4G91 C;  1R4V A;  3AZI D;  5CPJ C;  3A1K A;  2F8N B;  5AVB A;  5JRG B;  1P3G D;  4CAY B;  5B2J D;  3MVD C;  3WA9 A;  3FDD A;  3W98 D;  1P3I C;  3W96 A;  5GXQ C;  5AV6 B;  4QLC D;  1P3L D;  3C1B D;  3AZL C;  3AZN A;  3B0D B;  1U35 D;  2YFW B;  1KX3 B;  5B1M C;  1KX5 B;  5DNN D;  3KXB C;  5DNM C;  1EQZ D;  2CV5 D;  2IO5 B;  3LJA D;  3AV1 B;  1TZY A;  3AN2 A;  1ID3 D;  3W97 D;  4J8X D;  3AZE B;  5CP6 A;  3EG5 B;  4UUZ B;  5AY8 C;  4G92 C;  3AZM A;  3REI D;  4H9N A;  1KX4 D;  3MGQ D;  4DRA A;  3WTP A;  1S32 B;  3O62 A;  3LEL C;  4R8P A;  2ZY5 A;  3AZK D;  5B40 D;  5B24 D;  5CPK D;  3X1T A;  3B6F A;  1P3A B;  1BFM A;  1P3M C;  3C1C A;  2ARO B;  3UT9 A;  4NE5 A;  4J8V B;  3X1S C;  2F8N G;  4LD9 B;  4XZQ D;  1P3P D;  3B6G D;  4KUD D;  1P34 C;  3AV2 C;  4HGA B;  5AVC D;  4JJN C;  2Y2K A;  5C3I B;  2HIO A;  4DQY B;  3AZH B;  4KGC A;  5GSU C;  5B33 B;  3V9R A;  1P3K C;  3AZJ C;  5F99 A;  4YM6 A;  5AV9 B;  1P3B A;  3H0M C;  4J8U C;  3AYW D;  4X23 C;  5CPJ D;  4XUJ A;  3VH5 T;  3W98 C;  4YS3 A;  1M18 B;  3REL C;  2PYO B;  1HQ3 D;  1N1J B;  3X1U C;  3MNN A;  5AV8 B;  3MVD D;  4QLC C;  2RIQ A;  1P3I D;  3C1B C;  5B31 A;  3AZH A;  5GXQ D;  4ZBJ C;  1JFI B;  3WKJ C;  2Y2I A;  5DNN C;  3AZL D;  4ZUX D;  5AV5 B;  1EQZ C;  4Z5T C;  3UTB A;  3AZG B;  3MGR A;  5B1M D;  3X1V B;  3KXB D;  5DNM D;  2JCH A;  3EPK A;  5E5A B;  2NQB B;  5B2I A;  5GSU A;  3W99 B;  4WNN B;  2Y2M A;  5B32 G;  3AFA A;  3NQU B;  1N1J A;  1B67 A;  2HUE C;  5BT1 C;  5AV8 A;  3REI C;  3AZI A;  2FJ7 B;  1BH9 A;  2BYM A;  5AY8 D;  1KX4 C;  5GT3 B;  2Y2G A;  5B0Y B;  3MGP B;  3AZK C;  5BS7 C;  5B2J A;  1P3G A;  3AZF B;  5B24 C;  3LEL D;  3B0B A;  5B1L D;  1ZLA C;  1P3L A;  2NQB A;  3C1B A;  4UPK A;  1U35 A;  2Y2Q A;  1EQZ A;  4H9P B;  2CV5 A;  3LJA A;  4CSR B;  2NZD C;  3A6N B;  1ID3 A;  3W97 A;  4J8X A;  4KHA A;  3LZ1 B;  1M1A B;  5BNV A;  5GT0 C;  4WU9 C;  4KUD C;  1M19 B;  3REI A;  2ZY4 A;  4XZQ B;  1P34 D;  3AV2 D;  3WA9 B;  3W96 B;  1KX4 A;  3TU4 C;  3REJ C;  3MGQ A;  1T3U A;  2L5A A;  4JJN D;  4AWL C;  3UTA C;  3KUY C;  2F2A C;  3AZK A;  4WU8 C;  5B40 A;  2CWE A;  5B32 D;  1PZR A;  3LZ0 C;  1P3K D;  3AZJ D;  1P3O D;  5B24 A;  5CPK A;  5CPI C;  1P3F C;  1TZY B;  3AN2 B;  2Y2L A;  3WAA C;  4J8U D;  1H3O A;  1W2E A;  4X23 D;  1HQ3 C;  1M19 A; 
#chains in the Genus database with same CATH homology
 4XZQ A;  3KWQ C;  5CP6 B;  3REL D;  3X1U D;  4Z66 C;  4J8W C;  3AZM B;  4G91 B;  4H9N B;  4ZUX C;  1P3P A;  3B6G A;  3WKJ D;  3WTP B;  3REK D;  3O62 B;  2F8N K;  4Z5T D;  4R8P B;  4H9Q A;  5AVC A;  5G49 A;  3X1T B;  3B6F B;  5AV6 C;  2DF4 C;  3C1C B;  4H9S C;  3B0D C;  3UT9 B;  1KX3 C;  1KX5 C;  2Y2J A;  5DNM B;  2FFF B;  3AYW A;  5BT1 D;  3AV1 C;  5CPJ A;  1B6W A;  3AZE C;  1HQ3 A;  5B1L C;  3KSY A;  3MVD A;  3REH D;  1P3I A;  4EO5 B;  5GXQ A;  2Y2N A;  4G92 B;  3F6T A;  1F66 C;  5BNX A;  1ZLA D;  3AZL A;  4ZUX A;  2HIO B;  4KGC B;  3V9R B;  5B1M A;  3VH6 A;  2ZY3 A;  3KXB A;  5DNM A;  5F99 B;  1S32 C;  3EPL A;  2JSS A;  4YM6 B;  2NZD D;  3NQJ A;  4NE6 A;  1P3B B;  3R45 A;  2Y2P A;  1P3A C;  1P3M B;  5FUG A;  5GT0 D;  4H9O A;  2ARO C;  4WU9 D;  4XUJ B;  4J8V C;  4YS3 B;  3X1S B;  5AY8 A;  3MNN B;  3MGS D;  4LD9 C;  5B31 B;  5KDM A;  3TU4 D;  3REJ D;  5B32 C;  1P3O C;  3UTA D;  3KUY D;  3LEL A;  1AOI D;  5B1L A;  3UTB B;  4WU8 D;  1A7W A;  3LZ0 D;  3MGR B;  5AVB D;  2YFV A;  5CPI D;  3H0R C;  3H0L C;  5B0Z D;  1P3F D;  4HGA C;  1P3M A;  5B2I B;  1HTA A;  5C3I C;  5GSU B;  3WAA D;  5B33 C;  2W8S A;  4WZS B;  3X1S A;  3AFA B;  3AZN D;  3AZI B;  3KWQ D;  1BH9 B;  5AV9 C;  2BYM B;  4Z66 D;  4J8W D;  2J8P A;  5CHL B;  3REK C;  1P3G B;  5B2J B;  1P34 A;  3AV2 A;  3W98 B;  2F8N D;  4E45 A;  3IP4 C;  1M18 C;  5JRG D;  2PYO C;  1KU5 A;  4QLC B;  4JJN A;  1P3L B;  5BO0 A;  3C1B B;  1WWI A;  1U35 B;  1P3K A;  5AV6 D;  1P3O A;  5DNN B;  3AZJ A;  1EQZ B;  5AV5 C;  2CV5 B;  3LJA B;  1KX3 D;  1KX5 D;  3X1V C;  1ID3 B;  3W97 B;  4J8X B;  4KHA B;  2UWX A;  4J8U A;  3AV1 D;  4X23 A;  5BNV B;  5E5A C;  5B31 G;  1Z2C B;  3W99 C;  3REH C;  3W98 A;  3REL A;  3AZE D;  3X1U A;  3REI B;  4QLC A;  2FJ7 C;  1KX4 B;  1F66 D;  3MGQ B;  1F1E A;  3WKJ A;  5GT3 C;  5DNN A;  5B0Y C;  4Z5T A;  3AZK B;  5B40 B;  3AZF C;  4H9R A;  5B24 B;  5CPK B;  1S32 D;  1H3O B;  3VH5 A;  1P3A D;  2ARO D;  2JE5 A;  4NE3 A;  3MGS C;  4J8V D;  4NFT A;  3A6N C;  3LZ1 C;  1M1A C;  4LD9 D;  1P3P B;  1AOI C;  3B6G B;  5BS7 A;  4KUD B;  5AVB C;  5B0Z C;  2XD5 A;  1BH8 B;  4H9Q B;  5AVC B;  1ZLA A;  3B0C W;  3WA9 C;  5G49 B;  3W96 C;  3AZH D;  3AZN C;  5B33 D;  2NZD A;  4E44 A;  2BYK A;  3AYW B;  5CPJ B;  5AV9 D;  2G5H C;  5GT0 A;  3WTP E;  4WU9 A;  4KUD A;  4Z2M H;  1HQ3 B;  5JRG C;  1BH8 A;  3MVD B;  1P3I B;  5GXQ B;  5CP6 C;  3TU4 A;  1M18 D;  3REJ A;  2PYO D;  5BNX B;  2DQN C;  3AZM C;  5AV8 D;  4WJ3 C;  3UTA A;  3AZL B;  4ZUX B;  3KUY A;  1AOI A;  4WU8 A;  3LZ0 A;  5B1M B;  3KXB B;  3WTP C;  5AV5 D;  5CPI A;  3O62 C;  5B0Z A;  4R8P C;  2IO5 C;  3AZG D;  1P3F A;  3AL0 C;  3NQJ B;  3X1V D;  2G5I C;  3WAA A;  3R45 B;  3X1T C;  3B6F C;  5E5A D;  3C1C C;  5FUG B;  2NQB D;  5JA4 A;  2Y2O A;  4H9O B;  3UT9 C;  3W99 D;  3KWQ A;  5AY8 B;  4Z66 A;  4J8W A;  3VH6 W;  2FJ7 D;  5KDM B;  5GT3 D;  5B0Y D;  2F8N A;  3LEL B;  5B1L B;  5JRG A;  3MGP D;  4CAY A;  2Y2H A;  3AZF D;  2YFV B;  4EO5 C;  1F66 B;  5AV6 A;  3EPJ A;  4H9S A;  2HIO C;  4KGC C;  2YFW A;  1KX3 A;  1KX5 A;  5F99 C;  2XD1 A;  1Q9C A;  3AV1 A;  4YM6 C;  3A6N D;  1P3B C;  3LZ1 D;  1M1A D;  3AZE A;  1P34 B;  3AV2 B;  4XUJ C;  4YS3 C;  4UUZ A;  1WWS A;  1F66 A;  1M19 D;  3MNN C;  4JJN B;  5BO0 B;  1TAF B;  3WA9 D;  3AZH C;  5B31 C;  3W96 D;  1P3K B;  5B32 B;  1P3O B;  3AZJ B;  1S32 A;  3UTB C;  3MGR C;  2RVQ D;  4J8U B;  1P3A A;  1TZY D;  4X23 B;  3AN2 D;  4Z2M G;  5B2I C;  2ARO A;  3A1I A;  4J8V A;  3REL B;  3AFA C;  3X1U B;  5AV8 C;  4LD9 A;  3AZI C;  1TAF A;  4ZBJ B;  5CP6 D;  5B32 A;  3AZM D;  3WKJ B;  3REK B;  4Z5T B;  3AZG C;  1P3G C;  5B2J C;  3WTP D;  4H9R B;  3O62 D;  4R8P D;  1P3L C;  2NQB C;  1U35 C;  5B33 A;  3X1T D;  3B6F D;  3C1C D;  2BG1 A;  2CV5 C;  3LJA C;  2HUE B;  3UT9 D;  3KFU G;  5AV9 A;  1ID3 C;  2ZY2 A;  3W97 C;  4J8X C;  2LY8 A;  3EPH A;  3REK A;  3MGP C;  4M6B A;  3REH B;  3B0C T;  1M18 A;  4WV4 B;  2PYO A;  1ZLA B;  3VH5 W;  3P5J B;  4DRB A;  1JFI A;  3MGQ C;  5AV5 A;  2HIO D;  4KGC D;  3AZG A;  2NZD B;  5B40 C;  3X1V A;  2BYK B;  5F99 D;  5CPK C;  4YM6 D;  5E5A A;  1P3B D;  5GT0 B;  4WU9 B;  3W99 A;  3REH A;  1P3M D;  4WNN A;  3NQU A;  2ZM5 A;  3MGS B;  1M19 C;  4XUJ D;  4XZQ C;  2FJ7 A;  4YS3 D;  3X1S D;  3TU4 B;  3REJ B;  2F8N H;  5GT3 A;  5B0Y A;  3MNN D;  2VQR A;  4AWL B;  3UTA B;  3KUY B;  1AOI B;  5B31 D;  1P3P C;  3MGP A;  3B6G C;  4WU8 B;  3LZ0 B;  3AZF A;  2RVQ C;  5AVB B;  5CPI B;  5B0Z B;  3UTB D;  1P3F B;  5AVC C;  1TZY C;  3MGR D;  3AN2 C;  3WAA B;  5B2I D;  5JA4 B;  4H9P A;  3AZN B;  5GSU D;  3MGS A;  4CSR A;  3KWQ B;  3VH6 T;  3A6N A;  3AFA D;  4Z66 B;  1ULY A;  3LZ1 A;  4J8W B;  1M1A A;  3AYW C;  4G91 C;  1R4V A;  3AZI D;  5CPJ C;  3A1K A;  2F8N B;  5AVB A;  5JRG B;  1P3G D;  4CAY B;  5B2J D;  3MVD C;  3WA9 A;  3FDD A;  3W98 D;  1P3I C;  3W96 A;  5GXQ C;  5AV6 B;  4QLC D;  1P3L D;  3C1B D;  3AZL C;  3AZN A;  3B0D B;  1U35 D;  2YFW B;  1KX3 B;  5B1M C;  1KX5 B;  5DNN D;  3KXB C;  5DNM C;  1EQZ D;  2CV5 D;  2IO5 B;  3LJA D;  3AV1 B;  1TZY A;  3AN2 A;  1ID3 D;  3W97 D;  4J8X D;  3AZE B;  5CP6 A;  3EG5 B;  4UUZ B;  5AY8 C;  4G92 C;  3AZM A;  3REI D;  4H9N A;  1KX4 D;  3MGQ D;  4DRA A;  3WTP A;  1S32 B;  3O62 A;  3LEL C;  4R8P A;  2ZY5 A;  3AZK D;  5B40 D;  5B24 D;  5CPK D;  3X1T A;  3B6F A;  1P3A B;  1BFM A;  1P3M C;  3C1C A;  2ARO B;  3UT9 A;  4NE5 A;  4J8V B;  3X1S C;  2F8N G;  4LD9 B;  4XZQ D;  1P3P D;  3B6G D;  4KUD D;  1P34 C;  3AV2 C;  4HGA B;  5AVC D;  4JJN C;  2Y2K A;  5C3I B;  2HIO A;  4DQY B;  3AZH B;  4KGC A;  5GSU C;  5B33 B;  3V9R A;  1P3K C;  3AZJ C;  5F99 A;  4YM6 A;  5AV9 B;  1P3B A;  3H0M C;  4J8U C;  3AYW D;  4X23 C;  5CPJ D;  4XUJ A;  3VH5 T;  3W98 C;  4YS3 A;  1M18 B;  3REL C;  2PYO B;  1HQ3 D;  1N1J B;  3X1U C;  3MNN A;  5AV8 B;  3MVD D;  4QLC C;  2RIQ A;  1P3I D;  3C1B C;  5B31 A;  3AZH A;  5GXQ D;  4ZBJ C;  1JFI B;  3WKJ C;  2Y2I A;  5DNN C;  3AZL D;  4ZUX D;  5AV5 B;  1EQZ C;  4Z5T C;  3UTB A;  3AZG B;  3MGR A;  5B1M D;  3X1V B;  3KXB D;  5DNM D;  2JCH A;  3EPK A;  5E5A B;  2NQB B;  5B2I A;  5GSU A;  3W99 B;  4WNN B;  2Y2M A;  5B32 G;  3AFA A;  3NQU B;  1N1J A;  1B67 A;  2HUE C;  5BT1 C;  5AV8 A;  3REI C;  3AZI A;  2FJ7 B;  1BH9 A;  2BYM A;  5AY8 D;  1KX4 C;  5GT3 B;  2Y2G A;  5B0Y B;  3MGP B;  3AZK C;  5BS7 C;  5B2J A;  1P3G A;  3AZF B;  5B24 C;  3LEL D;  3B0B A;  5B1L D;  1ZLA C;  1P3L A;  2NQB A;  3C1B A;  4UPK A;  1U35 A;  2Y2Q A;  1EQZ A;  4H9P B;  2CV5 A;  3LJA A;  4CSR B;  2NZD C;  3A6N B;  1ID3 A;  3W97 A;  4J8X A;  4KHA A;  3LZ1 B;  1M1A B;  5BNV A;  5GT0 C;  4WU9 C;  4KUD C;  1M19 B;  3REI A;  2ZY4 A;  4XZQ B;  1P34 D;  3AV2 D;  3WA9 B;  3W96 B;  1KX4 A;  3TU4 C;  3REJ C;  3MGQ A;  1T3U A;  2L5A A;  4JJN D;  4AWL C;  3UTA C;  3KUY C;  2F2A C;  3AZK A;  4WU8 C;  5B40 A;  2CWE A;  5B32 D;  1PZR A;  3LZ0 C;  1P3K D;  3AZJ D;  1P3O D;  5B24 A;  5CPK A;  5CPI C;  1P3F C;  1TZY B;  3AN2 B;  2Y2L A;  3WAA C;  4J8U D;  1H3O A;  1W2E A;  4X23 D;  1HQ3 C;  1M19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...