3LELA

Structural insight into the sequence-dependence of nucleosome positioning
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural insight into the sequence dependence of nucleosome positioning
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 98
sequence length 98
chains with identical sequence E, K, O
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3lelA00
2JSSA 3WAAC 4XZQC 5BO0B 1P3AC 3B6GC 1P3OB 3LELD 5CHLB 4XUJC 3REJA 3LZ0A 5B24A 3LELB 4CSRB 1BH8A 4JJND 5CPKD 3AN2D 1KX4D 5CPKB 1P3ID 1KX4B 3KUYC 4X23C 1WWSA 3X1VD 4YM6D 5JA4A 1P3IB 1B6WA 3AZJA 5B31C 1TZYD 4AWLC 3MGSC 3X1VB 5F99D 3AZLD 4H9RB 3REIA 2HIOD 5AVCD 3MGPA 3AFAC 4J8UA 2CV5D 3W96B 1HQ3D 2HIOB 3MVDC 5AVCB 2CV5B 5C3IC 4E44A 1HQ3B 4CAYB 4WU9A 4R8PD 5BS7C 4QLCD 4Z66D 4H9OB 3C1CA 5AV6A 2BYKB 4HGAB 4Z5TD 3O62D 1S32A 4Z66B 4QLCB 3B6GD 4XZQD 1P3AD 3WAAD 2AROA 5B40C 4Z5TB 3O62B 4XUJD 4CSRA 4XZQB 1P3AB 4H9NB 4WNNA 5GT3B 4XUJB 3MGQB 3AZKB 3B6FA 3AZIB 3LZ1B 5DNMB 5B2JA 4H9QA 3AYWB 1KX4A 5AVBD 1BH9B 3KUYD 2RVQC 5B1LB 5AVBB 5B31D 3X1VA 3KUYB 3MGSD 3NQJB 3AZJC 5BNXB 4AWLB 3W96A 3MGSB 2F8NH 3AFAD 2HIOA 3REIC 5AV9C 3MVDD 3MGPC 1HQ3A 4J8UC 3AFAB 4CAYA 5C3IB 2BYKA 5B0ZC 2NQBC 5AV6C 1S32C 5B40D 1P3AA 4H9NA 2AROC 5GT3A 1JFIB 2FJ7B 3MGQA 5B0YC 5GSUD 3AZKA 3AZIA 5CP6A 4NE6A 3X1SA 5GSUB 5DNMA 3LZ1A 4H9PA 3AYWA 3B6FC 3A6NC 1ID3C 5B1LA 5B2JC 2RVQD 5AVBA 1M1AB 3VH6T 3W97A 3NQJA 4E45A 1M19C 1EQZB 3UTAC 2YFVA 3WTPC 3AZJD 3O62C 2BYMB 5JA4B 4UUZB 3REID 3W96C 3AFAA 5AV9D 3MGPD 3REIB 3B0CT 5AV9B 1KX3C 5B0ZD 2NQBD 5AV6D 1S32D 1JFIA 2FJ7A 5B0ZB 2NQBB 2AROD 5AV6B 1S32B 5B0YD 1ZLAA 5GT3C 5GSUA 3MGQC 2AROB 1P34A 3AZKC 5B0YB 3AZNA 5CP6C 3AZIC 3B6FD 5GXQA 3A6ND 3X1SC 5DNMC 4WNNB 3LZ1C 3AYWC 1P3FA 1ID3D 3B6FB 5B2JD 1M1AA 3A6NB 1H3OA 1EQZA 5B1LC 1ID3B 3VH6A 5B2JB 4H9QB 5AVBC 5GT0A 3UTAD 1M19D 3WTPD 2BYMA 2NZDA 3W97C 4NE3A 1M19B 3UTAB 4UUZA 3WTPB 3W96D 4WV4B 4ZBJC 5AV9A 4WU8A 3UT9B 1P3GA 3B0DB 1KX3D 5B1MA 5JRGA 1U35C 5B0ZA 1KX5A 2F8NK 1F66C 1KX3B 3B0BA 4NE5A 2NQBA 3V9RA 4G92C 2FJ7C 3AZMD 5GT3D 5B0YA 3MGQD 3WKJC 3AZKD 1ZLAC 3AZID 5CP6D 3AZMB 5B2IA 5GSUC 3NQUA 3MNNB 1P34C 3X1SD 3AZNC 5DNMD 3LZ1D 3AYWD 5CP6B 3A6NA 5GXQC 3WTPE 3X1SB 1P3FC 1ID3A 4H9PB 3KWQA 5B1LD 1M1AC 4J8VB 3REKB 1EQZC 1M19A 3UTAA 3W97D 5GT0C 3WTPA 2NZDC 4M6BA 5AV5A 3REHB 3W97B 4KGCA 5E5AC 3AZHA 2YFVB 4KUDA 5FUGA 3MGRC 3UT9A 2PYOD 1P3MB 4ZBJB 3WA9B 1HTAA 4WU8C 5BT1C 1P3GC 2PYOB 1U35D 1KX3A 4DRAA 5BNVB 1BFMA 5B1MC 4J8XC 5JRGC 3C1BB 1F66D 1U35B 1KX5C 1F66B 2FJ7D 3W98B 2YFWB 3AZMA 4G92B 3WKJD 4Z2MG 1P3PC 1ZLAD 3MNNA 4KHAA 3KXBB 1P34D 3X1UA 3AZND 3WKJB 3LJAD 1ZLAB 5B2IC 1P3LA 5GXQD 3RELA 3AV1C 1P3BB 1P34B 1P3FD 3AZNB 3LJAB 4J8VA 3REKA 5CPIA 3TU4C 1M1AD 5GXQB 1P3FB 3KWQC 1EQZD 5GT0D 2IO5B 3REHA 1H3OB 1TAFB 2NZDD 5E5AD 5GT0B 5AV5C 2NZDB 4KGCC 3AZHC 3MGRD 1P3MA 5E5AB 4KUDC 4ZUXD 3UTBB 1AOIA 3WA9A 3UT9C 2PYOA 3MGRB 3W99A 4WU8D 4ZUXB 3R45A 5BT1D 5B32D 1P3GD 5BNVA 3B0DC 3C1BA 4WU8B 5B1MD 4J8XD 5JRGD 5B32B 1U35A 1P3GB 3VH5T 1F66A 5DNNB 1KX5D 3W98A 2YFWA 4LD9A 5B1MB 4J8XB 5JRGB 3VH6W 4EO5B 1Q9CA 1M18B 1KX5B 3KXBA 1P3PD 5G49A 3V9RB 3WKJA 3AZMC 3MNNC 1P3PB 1P3BA 5B2ID 3AV1D 3X1UC 3LJAA 1P3LC 5B2IB 3RELC 3TU4D 3NQUB 3AV1B 3B0CW 5AV8C 1P3KA 5CPIC 4J8VC 3KWQD 3REKC 3TU4B 4H9SA 1TAFA 3KWQB 1WWIA 3REHC 4WZSB 5AV5D 5E5AA 3UTBA 4KGCD 3AZHD 4KUDD 3MGRA 5AV5B 1P3MC 5B33B 4ZUXA 3UT9D 3AZHB 4KGCB 1AOIC 3AV2A 4KUDB 3X1TA 3WA9C 5FUGB 2PYOC 3W99C 5B32A 2LY8A 4J8WA 5DNNA 3AZFA 3VH5A 3C1BC 4J8XA 4JJNB 4NFTA 3AN2B 1M18A 3W98C 5B32G 2F8NA 4LD9C 3AZGA 1P3PA 3KXBC 3MNND 4YM6B 2CWEA 3AZEA 3X1UD 1B67A 1TZYB 1P3BC 2F8NG 4KHAB 3AV1A 1P3LD 3RELD 5F99B 3LJAC 3AZLB 3X1UB 5AV8D 5CPJA 2HUEC 4J8VD 3REKD 3TU4A 5CPID 4YS3A 1P3LB 3RELB 1P3KC 5AV8B 5KDMB 5CPIB 2IO5C 4H9SC 3REHD 5AY8C 5BO0A 4R8PB 1P3OA 1N1JB 5B33A 3UTBC 1P3MD 3LELA 3B6GB 3WAAB 1AOID 3WA9D 4ZUXC 3LZ0C 3REJC 3W99D 3AV2C 5B24C 3X1TC 1AOIB 4JJNA 5B32C 3C1BD 5CPKA 3AN2A 3W99B 3R45B 4J8WC 5DNNC 3AZFC 3W98D 4X23D 1P3IA 4EO5C 4LD9D 1F1EA 1M18C 4YM6A 4X23B 3KXBD 4LD9B 4H9RA 1TZYA 3AZGC 5B31B 5F99A 5G49B 3AZLA 1P3BD 3AZEC 5AVCA 2L5AA 2CV5A 1A7WA 5AV8A 5KDMA 5CPJC 1P3KD 4G91C 2HUEB 4H9OA 4YS3C 3MVDB 4R8PA 1P3KB 4WU9C 4QLCA 4Z66A 5AY8D 1N1JA 3C1CC 4Z5TA 3O62A 1ULYA 3WAAA 5AY8B 4XZQA 1P3OC 3UTBD 3B6GA 5B33C 1KU5A 4XUJA 5B40B 3REJD 3LZ0D 3LELC 3AV2D 5B24D 3X1TD 4DRBA 3REJB 3LZ0B 3AV2B 5B24B 4J8WD 3X1TB 5DNND 1BH9A 4JJNC 3AZFD 1BH8B 5CPKC 3AN2C 1KX4C 1R4VA 4J8WB 3AZFB 1M18D 3KUYA 4X23A 1P3IC 2F8ND 5B31A 5BNXA 3X1VC 3AZGD 4Z2MH 4YM6C 3MGSA 2F8NB 1TZYC 3AZED 3AZJB 3AZGB 3KSYA 5F99C 3AZLC 4J8UD 5B31G 2HIOC 3AZEB 5AVCC 5CPJD 3MVDA 2CV5C 1HQ3C 4YS3D 4J8UB 3MGPB 3C1CB 4WU9D 5CPJB 5BS7A 4G91B 4YS3B 3VH5W 4HGAC 4R8PC 3C1CD 5AY8A 4QLCC 4Z66C 4WU9B 1P3OD 4Z5TC 5B40A 5B33D
chains in the Genus database with same CATH superfamily
2JSSA 3WAAC 4XZQC 5BO0B 1P3AC 3B6GC 1P3OB 3LELD 5CHLB 4XUJC 3REJA 3LZ0A 2Y2KA 4UPKA 5B24A 3LELB 4CSRB 1BH8A 1T3UA 4JJND 5CPKD 3AN2D 1KX4D 5CPKB 1P3ID 1KX4B 3KUYC 4X23C 1WWSA 3X1VD 4YM6D 5JA4A 1P3IB 1B6WA 3AZJA 5B31C 1TZYD 4AWLC 3MGSC 3X1VB 5F99D 3AZLD 4H9RB 3REIA 2HIOD 2XD5A 5AVCD 3MGPA 3AFAC 4J8UA 2CV5D 3W96B 1HQ3D 2HIOB 3MVDC 5AVCB 2CV5B 5C3IC 4E44A 1HQ3B 4CAYB 4WU9A 4R8PD 5BS7C 4QLCD 4Z66D 4H9OB 3C1CA 2Y2PA 5AV6A 2BYKB 4HGAB 4Z5TD 3O62D 1S32A 4Z66B 4QLCB 3B6GD 4XZQD 1P3AD 3WAAD 2AROA 5B40C 4Z5TB 2ZY2A 3O62B 4XUJD 4CSRA 4XZQB 1P3AB 4H9NB 4WNNA 5GT3B 4XUJB 3MGQB 3AZKB 3B6FA 3AZIB 3LZ1B 5DNMB 5B2JA 4H9QA 3AYWB 1KX4A 2Y2IA 3A1KA 5AVBD 1BH9B 3KUYD 2RVQC 2DF4C 5B1LB 5AVBB 5B31D 3X1VA 3KUYB 3MGSD 3NQJB 3AZJC 3EPHA 2VQRA 5BNXB 4AWLB 3W96A 2Y2HA 3MGSB 2F8NH 3AFAD 2HIOA 3REIC 5AV9C 3MVDD 3MGPC 1HQ3A 4J8UC 3AFAB 4CAYA 5C3IB 2BYKA 5B0ZC 2NQBC 5AV6C 1S32C 5B40D 1P3AA 4H9NA 2AROC 5GT3A 1JFIB 2FJ7B 3MGQA 5B0YC 5GSUD 3AZKA 3AZIA 5CP6A 4NE6A 3X1SA 5GSUB 5DNMA 3LZ1A 4H9PA 3AYWA 3B6FC 3A6NC 1ID3C 5B1LA 5B2JC 2RVQD 3H0LC 5AVBA 1M1AB 3VH6T 3W97A 3NQJA 4E45A 1M19C 1EQZB 3UTAC 3A1IA 2YFVA 3H0MC 3WTPC 3O62C 3AZJD 2JE5A 2BYMB 5JA4B 4UUZB 3REID 3W96C 3AFAA 5AV9D 3MGPD 3H0RC 3REIB 3B0CT 5AV9B 1KX3C 5B0ZD 2NQBD 5AV6D 2ZY4A 1S32D 3KFUG 1JFIA 2FJ7A 5B0ZB 2NQBB 2AROD 5AV6B 1S32B 5B0YD 1ZLAA 5GT3C 5GSUA 3EG5B 2AROB 3MGQC 1P34A 3AZKC 5B0YB 3AZNA 5CP6C 3AZIC 3B6FD 5GXQA 3A6ND 3X1SC 5DNMC 4WNNB 3LZ1C 3AYWC 1P3FA 1ID3D 3B6FB 5B2JD 1M1AA 3A6NB 3AL0C 1H3OA 1EQZA 5B1LC 1ID3B 3VH6A 5B2JB 4H9QB 5AVBC 5GT0A 3UTAD 1M19D 3WTPD 2BYMA 2NZDA 3W97C 4NE3A 1M19B 3UTAB 4UUZA 3WTPB 2BG1A 3W96D 3EPJA 2W8SA 4WV4B 4ZBJC 5AV9A 4WU8A 3UT9B 1P3GA 3B0DB 1KX3D 5B1MA 5JRGA 1U35C 5B0ZA 1KX5A 2F8NK 1F66C 1KX3B 3B0BA 4NE5A 2NQBA 3V9RA 4G92C 2FJ7C 3AZMD 5GT3D 5B0YA 3MGQD 3WKJC 3AZKD 1ZLAC 3AZID 5CP6D 3AZMB 5B2IA 5GSUC 3NQUA 3MNNB 1P34C 3X1SD 3AZNC 5DNMD 3LZ1D 2ZM5A 3AYWD 5CP6B 3A6NA 5GXQC 3WTPE 3X1SB 1P3FC 2Y2MA 1ID3A 4H9PB 3KWQA 5B1LD 1M1AC 4J8VB 3REKB 1EQZC 1M19A 3UTAA 3W97D 5GT0C 3WTPA 2NZDC 3EPLA 4M6BA 5AV5A 3REHB 2JCHA 3W97B 4KGCA 5E5AC 3AZHA 2YFVB 4KUDA 2Y2LA 5FUGA 3MGRC 3UT9A 2PYOD 1P3MB 1Z2CB 4ZBJB 2RIQA 3WA9B 1HTAA 4WU8C 5BT1C 1P3GC 2PYOB 1U35D 1KX3A 4DRAA 5BNVB 2J8PA 1BFMA 5B1MC 4J8XC 5JRGC 3C1BB 1F66D 1U35B 1KX5C 2UWXA 1F66B 2FJ7D 3W98B 2YFWB 3AZMA 4G92B 3WKJD 4Z2MG 1P3PC 1ZLAD 3MNNA 4KHAA 3KXBB 1P34D 3X1UA 3AZND 3WKJB 3LJAD 1ZLAB 5B2IC 1P3LA 5GXQD 3RELA 3AV1C 1P3BB 1P34B 1P3FD 3AZNB 3LJAB 4J8VA 3REKA 5CPIA 3TU4C 1M1AD 5GXQB 1P3FB 3KWQC 1EQZD 2Y2JA 5GT0D 2IO5B 3REHA 1H3OB 1TAFB 2NZDD 5E5AD 5GT0B 5AV5C 2NZDB 4KGCC 3AZHC 3P5JB 3MGRD 1P3MA 5E5AB 4KUDC 4ZUXD 3UTBB 1AOIA 3WA9A 3UT9C 2PYOA 3MGRB 3W99A 4WU8D 4ZUXB 3R45A 3IP4C 5B32D 5BT1D 1P3GD 5BNVA 3B0DC 3C1BA 4WU8B 5B1MD 4J8XD 5JRGD 5B32B 2ZY3A 1U35A 3VH5T 1P3GB 1F66A 5DNNB 1KX5D 3W98A 2YFWA 4LD9A 5B1MB 4J8XB 5JRGB 3VH6W 4EO5B 1Q9CA 1M18B 1KX5B 4DQYB 3KXBA 1P3PD 5G49A 3V9RB 3WKJA 3AZMC 3MNNC 1P3PB 1P3BA 5B2ID 3AV1D 3X1UC 3LJAA 1P3LC 5B2IB 3RELC 3TU4D 3NQUB 3AV1B 3B0CW 5AV8C 1P3KA 1W2EA 5CPIC 4J8VC 3KWQD 3REKC 3TU4B 4H9SA 1TAFA 3KWQB 1WWIA 3REHC 4WZSB 5AV5D 5E5AA 3UTBA 4KGCD 3AZHD 2Y2QA 4KUDD 3MGRA 5AV5B 3F6TA 1P3MC 5B33B 4ZUXA 3UT9D 3AZHB 4KGCB 1AOIC 3AV2A 4KUDB 3X1TA 3WA9C 5FUGB 2PYOC 3W99C 5B32A 2LY8A 4J8WA 5DNNA 3AZFA 3VH5A 3C1BC 4J8XA 4JJNB 4NFTA 3AN2B 1M18A 3W98C 5B32G 2F8NA 4LD9C 3AZGA 1P3PA 3KXBC 3MNND 4YM6B 2CWEA 3AZEA 3X1UD 1B67A 1TZYB 1P3BC 2F8NG 4KHAB 3AV1A 1P3LD 2Y2GA 3RELD 5F99B 3LJAC 3AZLB 3X1UB 5AV8D 5CPJA 2HUEC 4J8VD 3REKD 3TU4A 5CPID 4YS3A 1P3LB 3RELB 1P3KC 5AV8B 1PZRA 5KDMB 2IO5C 5CPIB 4H9SC 3REHD 5AY8C 5BO0A 4R8PB 2XD1A 1P3OA 4WJ3C 1N1JB 2G5IC 5B33A 3UTBC 1P3MD 3LELA 3B6GB 3WAAB 1AOID 3WA9D 4ZUXC 3LZ0C 3REJC 3W99D 3AV2C 5B24C 3X1TC 1AOIB 4JJNA 5B32C 3C1BD 5CPKA 3AN2A 3W99B 3R45B 4J8WC 2DQNC 5DNNC 3AZFC 2F2AC 3W98D 2FFFB 4X23D 1P3IA 4EO5C 4LD9D 1F1EA 1M18C 4YM6A 4X23B 3KXBD 3EPKA 4LD9B 4H9RA 1TZYA 3AZGC 5B31B 2G5HC 5G49B 5F99A 3AZLA 1P3BD 3AZEC 5AVCA 2L5AA 2CV5A 1A7WA 5AV8A 5KDMA 5CPJC 1P3KD 4G91C 2HUEB 4H9OA 4YS3C 3MVDB 4R8PA 1P3KB 4WU9C 4QLCA 4Z66A 5AY8D 3FDDA 1N1JA 3C1CC 4Z5TA 3O62A 1ULYA 3WAAA 5AY8B 4XZQA 1P3OC 3UTBD 3B6GA 5B33C 1KU5A 4XUJA 5B40B 3REJD 3LZ0D 3LELC 3AV2D 5B24D 3X1TD 4DRBA 3REJB 3LZ0B 3AV2B 5B24B 4J8WD 3X1TB 5DNND 1BH9A 4JJNC 3AZFD 1BH8B 5CPKC 3AN2C 1KX4C 1R4VA 4J8WB 3AZFB 1M18D 3KUYA 4X23A 1P3IC 2F8ND 5B31A 2Y2OA 5BNXA 3X1VC 3AZGD 4Z2MH 4YM6C 3MGSA 2F8NB 1TZYC 3AZED 3AZJB 3AZGB 3KSYA 5F99C 2Y2NA 3AZLC 4J8UD 5B31G 2HIOC 3AZEB 5AVCC 5CPJD 3MVDA 2ZY5A 2CV5C 1HQ3C 4YS3D 4J8UB 3MGPB 3C1CB 4WU9D 5CPJB 5BS7A 4G91B 4YS3B 3VH5W 4HGAC 4R8PC 3C1CD 5AY8A 4QLCC 4Z66C 4WU9B 1P3OD 4Z5TC 5B40A 5B33D
chains in the Genus database with same CATH topology
2JSSA 3WAAC 4XZQC 5BO0B 1P3AC 3B6GC 1P3OB 3LELD 5CHLB 4XUJC 3REJA 3LZ0A 2Y2KA 4UPKA 5B24A 3LELB 4CSRB 1BH8A 1T3UA 4JJND 5CPKD 3AN2D 1KX4D 5CPKB 1P3ID 1KX4B 3KUYC 4X23C 1WWSA 3X1VD 4YM6D 5JA4A 1P3IB 1B6WA 3AZJA 5B31C 1TZYD 4AWLC 3MGSC 3X1VB 5F99D 3AZLD 4H9RB 3REIA 2HIOD 2XD5A 5AVCD 3MGPA 3AFAC 4J8UA 2CV5D 3W96B 1HQ3D 2HIOB 3MVDC 5AVCB 2CV5B 5C3IC 4E44A 1HQ3B 4CAYB 4WU9A 4R8PD 5BS7C 4QLCD 4Z66D 4H9OB 3C1CA 2Y2PA 5AV6A 2BYKB 4HGAB 4Z5TD 3O62D 1S32A 4Z66B 4QLCB 3B6GD 4XZQD 1P3AD 3WAAD 2AROA 5B40C 4Z5TB 2ZY2A 3O62B 4XUJD 4CSRA 4XZQB 1P3AB 4H9NB 4WNNA 5GT3B 4XUJB 3MGQB 3AZKB 3B6FA 3AZIB 3LZ1B 5DNMB 5B2JA 4H9QA 3AYWB 1KX4A 2Y2IA 3A1KA 5AVBD 1BH9B 3KUYD 2RVQC 2DF4C 5B1LB 5AVBB 5B31D 3X1VA 3KUYB 3MGSD 3NQJB 3AZJC 3EPHA 2VQRA 5BNXB 4AWLB 3W96A 2Y2HA 3MGSB 2F8NH 3AFAD 2HIOA 3REIC 5AV9C 3MVDD 3MGPC 1HQ3A 4J8UC 3AFAB 4CAYA 5C3IB 2BYKA 5B0ZC 2NQBC 5AV6C 1S32C 5B40D 1P3AA 4H9NA 2AROC 5GT3A 1JFIB 2FJ7B 3MGQA 5B0YC 5GSUD 3AZKA 3AZIA 5CP6A 4NE6A 3X1SA 5GSUB 5DNMA 3LZ1A 4H9PA 3AYWA 3B6FC 3A6NC 1ID3C 5B1LA 5B2JC 2RVQD 3H0LC 5AVBA 1M1AB 3VH6T 3W97A 3NQJA 4E45A 1M19C 1EQZB 3UTAC 3A1IA 2YFVA 3H0MC 3WTPC 3O62C 3AZJD 2JE5A 2BYMB 5JA4B 4UUZB 3REID 3W96C 3AFAA 5AV9D 3MGPD 3H0RC 3REIB 3B0CT 5AV9B 1KX3C 5B0ZD 2NQBD 5AV6D 2ZY4A 1S32D 3KFUG 1JFIA 2FJ7A 5B0ZB 2NQBB 2AROD 5AV6B 1S32B 5B0YD 1ZLAA 5GT3C 5GSUA 3EG5B 2AROB 3MGQC 1P34A 3AZKC 5B0YB 3AZNA 5CP6C 3AZIC 3B6FD 5GXQA 3A6ND 3X1SC 5DNMC 4WNNB 3LZ1C 3AYWC 1P3FA 1ID3D 3B6FB 5B2JD 1M1AA 3A6NB 3AL0C 1H3OA 1EQZA 5B1LC 1ID3B 3VH6A 5B2JB 4H9QB 5AVBC 5GT0A 3UTAD 1M19D 3WTPD 2BYMA 2NZDA 3W97C 4NE3A 1M19B 3UTAB 4UUZA 3WTPB 2BG1A 3W96D 3EPJA 2W8SA 4WV4B 4ZBJC 5AV9A 4WU8A 3UT9B 1P3GA 3B0DB 1KX3D 5B1MA 5JRGA 1U35C 5B0ZA 1KX5A 2F8NK 1F66C 1KX3B 3B0BA 4NE5A 2NQBA 3V9RA 4G92C 2FJ7C 3AZMD 5GT3D 5B0YA 3MGQD 3WKJC 3AZKD 1ZLAC 3AZID 5CP6D 3AZMB 5B2IA 5GSUC 3NQUA 3MNNB 1P34C 3X1SD 3AZNC 5DNMD 3LZ1D 2ZM5A 3AYWD 5CP6B 3A6NA 5GXQC 3WTPE 3X1SB 1P3FC 2Y2MA 1ID3A 4H9PB 3KWQA 5B1LD 1M1AC 4J8VB 3REKB 1EQZC 1M19A 3UTAA 3W97D 5GT0C 3WTPA 2NZDC 3EPLA 4M6BA 5AV5A 3REHB 2JCHA 3W97B 4KGCA 5E5AC 3AZHA 2YFVB 4KUDA 2Y2LA 5FUGA 3MGRC 3UT9A 2PYOD 1P3MB 1Z2CB 4ZBJB 2RIQA 3WA9B 1HTAA 4WU8C 5BT1C 1P3GC 2PYOB 1U35D 1KX3A 4DRAA 5BNVB 2J8PA 1BFMA 5B1MC 4J8XC 5JRGC 3C1BB 1F66D 1U35B 1KX5C 2UWXA 1F66B 2FJ7D 3W98B 2YFWB 3AZMA 4G92B 3WKJD 4Z2MG 1P3PC 1ZLAD 3MNNA 4KHAA 3KXBB 1P34D 3X1UA 3AZND 3WKJB 3LJAD 1ZLAB 5B2IC 1P3LA 5GXQD 3RELA 3AV1C 1P3BB 1P34B 1P3FD 3AZNB 3LJAB 4J8VA 3REKA 5CPIA 3TU4C 1M1AD 5GXQB 1P3FB 3KWQC 1EQZD 2Y2JA 5GT0D 2IO5B 3REHA 1H3OB 1TAFB 2NZDD 5E5AD 5GT0B 5AV5C 2NZDB 4KGCC 3AZHC 3P5JB 3MGRD 1P3MA 5E5AB 4KUDC 4ZUXD 3UTBB 1AOIA 3WA9A 3UT9C 2PYOA 3MGRB 3W99A 4WU8D 4ZUXB 3R45A 3IP4C 5B32D 5BT1D 1P3GD 5BNVA 3B0DC 3C1BA 4WU8B 5B1MD 4J8XD 5JRGD 5B32B 2ZY3A 1U35A 3VH5T 1P3GB 1F66A 5DNNB 1KX5D 3W98A 2YFWA 4LD9A 5B1MB 4J8XB 5JRGB 3VH6W 4EO5B 1Q9CA 1M18B 1KX5B 4DQYB 3KXBA 1P3PD 5G49A 3V9RB 3WKJA 3AZMC 3MNNC 1P3PB 1P3BA 5B2ID 3AV1D 3X1UC 3LJAA 1P3LC 5B2IB 3RELC 3TU4D 3NQUB 3AV1B 3B0CW 5AV8C 1P3KA 1W2EA 5CPIC 4J8VC 3KWQD 3REKC 3TU4B 4H9SA 1TAFA 3KWQB 1WWIA 3REHC 4WZSB 5AV5D 5E5AA 3UTBA 4KGCD 3AZHD 2Y2QA 4KUDD 3MGRA 5AV5B 3F6TA 1P3MC 5B33B 4ZUXA 3UT9D 3AZHB 4KGCB 1AOIC 3AV2A 4KUDB 3X1TA 3WA9C 5FUGB 2PYOC 3W99C 5B32A 2LY8A 4J8WA 5DNNA 3AZFA 3VH5A 3C1BC 4J8XA 4JJNB 4NFTA 3AN2B 1M18A 3W98C 5B32G 2F8NA 4LD9C 3AZGA 1P3PA 3KXBC 3MNND 4YM6B 2CWEA 3AZEA 3X1UD 1B67A 1TZYB 1P3BC 2F8NG 4KHAB 3AV1A 1P3LD 2Y2GA 3RELD 5F99B 3LJAC 3AZLB 3X1UB 5AV8D 5CPJA 2HUEC 4J8VD 3REKD 3TU4A 5CPID 4YS3A 1P3LB 3RELB 1P3KC 5AV8B 1PZRA 5KDMB 2IO5C 5CPIB 4H9SC 3REHD 5AY8C 5BO0A 4R8PB 2XD1A 1P3OA 4WJ3C 1N1JB 2G5IC 5B33A 3UTBC 1P3MD 3LELA 3B6GB 3WAAB 1AOID 3WA9D 4ZUXC 3LZ0C 3REJC 3W99D 3AV2C 5B24C 3X1TC 1AOIB 4JJNA 5B32C 3C1BD 5CPKA 3AN2A 3W99B 3R45B 4J8WC 2DQNC 5DNNC 3AZFC 2F2AC 3W98D 2FFFB 4X23D 1P3IA 4EO5C 4LD9D 1F1EA 1M18C 4YM6A 4X23B 3KXBD 3EPKA 4LD9B 4H9RA 1TZYA 3AZGC 5B31B 2G5HC 5G49B 5F99A 3AZLA 1P3BD 3AZEC 5AVCA 2L5AA 2CV5A 1A7WA 5AV8A 5KDMA 5CPJC 1P3KD 4G91C 2HUEB 4H9OA 4YS3C 3MVDB 4R8PA 1P3KB 4WU9C 4QLCA 4Z66A 5AY8D 3FDDA 1N1JA 3C1CC 4Z5TA 3O62A 1ULYA 3WAAA 5AY8B 4XZQA 1P3OC 3UTBD 3B6GA 5B33C 1KU5A 4XUJA 5B40B 3REJD 3LZ0D 3LELC 3AV2D 5B24D 3X1TD 4DRBA 3REJB 3LZ0B 3AV2B 5B24B 4J8WD 3X1TB 5DNND 1BH9A 4JJNC 3AZFD 1BH8B 5CPKC 3AN2C 1KX4C 1R4VA 4J8WB 3AZFB 1M18D 3KUYA 4X23A 1P3IC 2F8ND 5B31A 2Y2OA 5BNXA 3X1VC 3AZGD 4Z2MH 4YM6C 3MGSA 2F8NB 1TZYC 3AZED 3AZJB 3AZGB 3KSYA 5F99C 2Y2NA 3AZLC 4J8UD 5B31G 2HIOC 3AZEB 5AVCC 5CPJD 3MVDA 2ZY5A 2CV5C 1HQ3C 4YS3D 4J8UB 3MGPB 3C1CB 4WU9D 5CPJB 5BS7A 4G91B 4YS3B 3VH5W 4HGAC 4R8PC 3C1CD 5AY8A 4QLCC 4Z66C 4WU9B 1P3OD 4Z5TC 5B40A 5B33D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JSS A;  3WAA C;  4XZQ C;  5BO0 B;  1P3A C;  3B6G C;  1P3O B;  3LEL D;  5CHL B;  4XUJ C;  3REJ A;  3LZ0 A;  5B24 A;  3LEL B;  4CSR B;  1BH8 A;  4JJN D;  5CPK D;  3AN2 D;  1KX4 D;  5CPK B;  1P3I D;  1KX4 B;  3KUY C;  4X23 C;  1WWS A;  3X1V D;  4YM6 D;  5JA4 A;  1P3I B;  1B6W A;  3AZJ A;  5B31 C;  1TZY D;  4AWL C;  3MGS C;  3X1V B;  5F99 D;  3AZL D;  4H9R B;  3REI A;  2HIO D;  5AVC D;  3MGP A;  3AFA C;  4J8U A;  2CV5 D;  3W96 B;  1HQ3 D;  2HIO B;  3MVD C;  5AVC B;  2CV5 B;  5C3I C;  4E44 A;  1HQ3 B;  4CAY B;  4WU9 A;  4R8P D;  5BS7 C;  4QLC D;  4Z66 D;  4H9O B;  3C1C A;  5AV6 A;  2BYK B;  4HGA B;  4Z5T D;  3O62 D;  1S32 A;  4Z66 B;  4QLC B;  3B6G D;  4XZQ D;  1P3A D;  3WAA D;  2ARO A;  5B40 C;  4Z5T B;  3O62 B;  4XUJ D;  4CSR A;  4XZQ B;  1P3A B;  4H9N B;  4WNN A;  5GT3 B;  4XUJ B;  3MGQ B;  3AZK B;  3B6F A;  3AZI B;  3LZ1 B;  5DNM B;  5B2J A;  4H9Q A;  3AYW B;  1KX4 A;  5AVB D;  1BH9 B;  3KUY D;  2RVQ C;  5B1L B;  5AVB B;  5B31 D;  3X1V A;  3KUY B;  3MGS D;  3NQJ B;  3AZJ C;  5BNX B;  4AWL B;  3W96 A;  3MGS B;  2F8N H;  3AFA D;  2HIO A;  3REI C;  5AV9 C;  3MVD D;  3MGP C;  1HQ3 A;  4J8U C;  3AFA B;  4CAY A;  5C3I B;  2BYK A;  5B0Z C;  2NQB C;  5AV6 C;  1S32 C;  5B40 D;  1P3A A;  4H9N A;  2ARO C;  5GT3 A;  1JFI B;  2FJ7 B;  3MGQ A;  5B0Y C;  5GSU D;  3AZK A;  3AZI A;  5CP6 A;  4NE6 A;  3X1S A;  5GSU B;  5DNM A;  3LZ1 A;  4H9P A;  3AYW A;  3B6F C;  3A6N C;  1ID3 C;  5B1L A;  5B2J C;  2RVQ D;  5AVB A;  1M1A B;  3VH6 T;  3W97 A;  3NQJ A;  4E45 A;  1M19 C;  1EQZ B;  3UTA C;  2YFV A;  3WTP C;  3AZJ D;  3O62 C;  2BYM B;  5JA4 B;  4UUZ B;  3REI D;  3W96 C;  3AFA A;  5AV9 D;  3MGP D;  3REI B;  3B0C T;  5AV9 B;  1KX3 C;  5B0Z D;  2NQB D;  5AV6 D;  1S32 D;  1JFI A;  2FJ7 A;  5B0Z B;  2NQB B;  2ARO D;  5AV6 B;  1S32 B;  5B0Y D;  1ZLA A;  5GT3 C;  5GSU A;  3MGQ C;  2ARO B;  1P34 A;  3AZK C;  5B0Y B;  3AZN A;  5CP6 C;  3AZI C;  3B6F D;  5GXQ A;  3A6N D;  3X1S C;  5DNM C;  4WNN B;  3LZ1 C;  3AYW C;  1P3F A;  1ID3 D;  3B6F B;  5B2J D;  1M1A A;  3A6N B;  1H3O A;  1EQZ A;  5B1L C;  1ID3 B;  3VH6 A;  5B2J B;  4H9Q B;  5AVB C;  5GT0 A;  3UTA D;  1M19 D;  3WTP D;  2BYM A;  2NZD A;  3W97 C;  4NE3 A;  1M19 B;  3UTA B;  4UUZ A;  3WTP B;  3W96 D;  4WV4 B;  4ZBJ C;  5AV9 A;  4WU8 A;  3UT9 B;  1P3G A;  3B0D B;  1KX3 D;  5B1M A;  5JRG A;  1U35 C;  5B0Z A;  1KX5 A;  2F8N K;  1F66 C;  1KX3 B;  3B0B A;  4NE5 A;  2NQB A;  3V9R A;  4G92 C;  2FJ7 C;  3AZM D;  5GT3 D;  5B0Y A;  3MGQ D;  3WKJ C;  3AZK D;  1ZLA C;  3AZI D;  5CP6 D;  3AZM B;  5B2I A;  5GSU C;  3NQU A;  3MNN B;  1P34 C;  3X1S D;  3AZN C;  5DNM D;  3LZ1 D;  3AYW D;  5CP6 B;  3A6N A;  5GXQ C;  3WTP E;  3X1S B;  1P3F C;  1ID3 A;  4H9P B;  3KWQ A;  5B1L D;  1M1A C;  4J8V B;  3REK B;  1EQZ C;  1M19 A;  3UTA A;  3W97 D;  5GT0 C;  3WTP A;  2NZD C;  4M6B A;  5AV5 A;  3REH B;  3W97 B;  4KGC A;  5E5A C;  3AZH A;  2YFV B;  4KUD A;  5FUG A;  3MGR C;  3UT9 A;  2PYO D;  1P3M B;  4ZBJ B;  3WA9 B;  1HTA A;  4WU8 C;  5BT1 C;  1P3G C;  2PYO B;  1U35 D;  1KX3 A;  4DRA A;  5BNV B;  1BFM A;  5B1M C;  4J8X C;  5JRG C;  3C1B B;  1F66 D;  1U35 B;  1KX5 C;  1F66 B;  2FJ7 D;  3W98 B;  2YFW B;  3AZM A;  4G92 B;  3WKJ D;  4Z2M G;  1P3P C;  1ZLA D;  3MNN A;  4KHA A;  3KXB B;  1P34 D;  3X1U A;  3AZN D;  3WKJ B;  3LJA D;  1ZLA B;  5B2I C;  1P3L A;  5GXQ D;  3REL A;  3AV1 C;  1P3B B;  1P34 B;  1P3F D;  3AZN B;  3LJA B;  4J8V A;  3REK A;  5CPI A;  3TU4 C;  1M1A D;  5GXQ B;  1P3F B;  3KWQ C;  1EQZ D;  5GT0 D;  2IO5 B;  3REH A;  1H3O B;  1TAF B;  2NZD D;  5E5A D;  5GT0 B;  5AV5 C;  2NZD B;  4KGC C;  3AZH C;  3MGR D;  1P3M A;  5E5A B;  4KUD C;  4ZUX D;  3UTB B;  1AOI A;  3WA9 A;  3UT9 C;  2PYO A;  3MGR B;  3W99 A;  4WU8 D;  4ZUX B;  3R45 A;  5BT1 D;  5B32 D;  1P3G D;  5BNV A;  3B0D C;  3C1B A;  4WU8 B;  5B1M D;  4J8X D;  5JRG D;  5B32 B;  1U35 A;  1P3G B;  3VH5 T;  1F66 A;  5DNN B;  1KX5 D;  3W98 A;  2YFW A;  4LD9 A;  5B1M B;  4J8X B;  5JRG B;  3VH6 W;  4EO5 B;  1Q9C A;  1M18 B;  1KX5 B;  3KXB A;  1P3P D;  5G49 A;  3V9R B;  3WKJ A;  3AZM C;  3MNN C;  1P3P B;  1P3B A;  5B2I D;  3AV1 D;  3X1U C;  3LJA A;  1P3L C;  5B2I B;  3REL C;  3TU4 D;  3NQU B;  3AV1 B;  3B0C W;  5AV8 C;  1P3K A;  5CPI C;  4J8V C;  3KWQ D;  3REK C;  3TU4 B;  4H9S A;  1TAF A;  3KWQ B;  1WWI A;  3REH C;  4WZS B;  5AV5 D;  5E5A A;  3UTB A;  4KGC D;  3AZH D;  4KUD D;  3MGR A;  5AV5 B;  1P3M C;  5B33 B;  4ZUX A;  3UT9 D;  3AZH B;  4KGC B;  1AOI C;  3AV2 A;  4KUD B;  3X1T A;  3WA9 C;  5FUG B;  2PYO C;  3W99 C;  5B32 A;  2LY8 A;  4J8W A;  5DNN A;  3AZF A;  3VH5 A;  3C1B C;  4J8X A;  4JJN B;  4NFT A;  3AN2 B;  1M18 A;  3W98 C;  5B32 G;  2F8N A;  4LD9 C;  3AZG A;  1P3P A;  3KXB C;  3MNN D;  4YM6 B;  2CWE A;  3AZE A;  3X1U D;  1B67 A;  1TZY B;  1P3B C;  2F8N G;  4KHA B;  3AV1 A;  1P3L D;  3REL D;  5F99 B;  3LJA C;  3AZL B;  3X1U B;  5AV8 D;  5CPJ A;  2HUE C;  4J8V D;  3REK D;  3TU4 A;  5CPI D;  4YS3 A;  1P3L B;  3REL B;  1P3K C;  5AV8 B;  5KDM B;  5CPI B;  2IO5 C;  4H9S C;  3REH D;  5AY8 C;  5BO0 A;  4R8P B;  1P3O A;  1N1J B;  5B33 A;  3UTB C;  1P3M D;  3LEL A;  3B6G B;  3WAA B;  1AOI D;  3WA9 D;  4ZUX C;  3LZ0 C;  3REJ C;  3W99 D;  3AV2 C;  5B24 C;  3X1T C;  1AOI B;  4JJN A;  5B32 C;  3C1B D;  5CPK A;  3AN2 A;  3W99 B;  3R45 B;  4J8W C;  5DNN C;  3AZF C;  3W98 D;  4X23 D;  1P3I A;  4EO5 C;  4LD9 D;  1F1E A;  1M18 C;  4YM6 A;  4X23 B;  3KXB D;  4LD9 B;  4H9R A;  1TZY A;  3AZG C;  5B31 B;  5F99 A;  5G49 B;  3AZL A;  1P3B D;  3AZE C;  5AVC A;  2L5A A;  2CV5 A;  1A7W A;  5AV8 A;  5KDM A;  5CPJ C;  1P3K D;  4G91 C;  2HUE B;  4H9O A;  4YS3 C;  3MVD B;  4R8P A;  1P3K B;  4WU9 C;  4QLC A;  4Z66 A;  5AY8 D;  1N1J A;  3C1C C;  4Z5T A;  3O62 A;  1ULY A;  3WAA A;  5AY8 B;  4XZQ A;  1P3O C;  3UTB D;  3B6G A;  5B33 C;  1KU5 A;  4XUJ A;  5B40 B;  3REJ D;  3LZ0 D;  3LEL C;  3AV2 D;  5B24 D;  3X1T D;  4DRB A;  3REJ B;  3LZ0 B;  3AV2 B;  5B24 B;  4J8W D;  3X1T B;  5DNN D;  1BH9 A;  4JJN C;  3AZF D;  1BH8 B;  5CPK C;  3AN2 C;  1KX4 C;  1R4V A;  4J8W B;  3AZF B;  1M18 D;  3KUY A;  4X23 A;  1P3I C;  2F8N D;  5B31 A;  5BNX A;  3X1V C;  3AZG D;  4Z2M H;  4YM6 C;  3MGS A;  2F8N B;  1TZY C;  3AZE D;  3AZJ B;  3AZG B;  3KSY A;  5F99 C;  3AZL C;  4J8U D;  5B31 G;  2HIO C;  3AZE B;  5AVC C;  5CPJ D;  3MVD A;  2CV5 C;  1HQ3 C;  4YS3 D;  4J8U B;  3MGP B;  3C1C B;  4WU9 D;  5CPJ B;  5BS7 A;  4G91 B;  4YS3 B;  3VH5 W;  4HGA C;  4R8P C;  3C1C D;  5AY8 A;  4QLC C;  4Z66 C;  4WU9 B;  1P3O D;  4Z5T C;  5B40 A;  5B33 D; 
#chains in the Genus database with same CATH topology
 2JSS A;  3WAA C;  4XZQ C;  5BO0 B;  1P3A C;  3B6G C;  1P3O B;  3LEL D;  5CHL B;  4XUJ C;  3REJ A;  3LZ0 A;  2Y2K A;  4UPK A;  5B24 A;  3LEL B;  4CSR B;  1BH8 A;  1T3U A;  4JJN D;  5CPK D;  3AN2 D;  1KX4 D;  5CPK B;  1P3I D;  1KX4 B;  3KUY C;  4X23 C;  1WWS A;  3X1V D;  4YM6 D;  5JA4 A;  1P3I B;  1B6W A;  3AZJ A;  5B31 C;  1TZY D;  4AWL C;  3MGS C;  3X1V B;  5F99 D;  3AZL D;  4H9R B;  3REI A;  2HIO D;  2XD5 A;  5AVC D;  3MGP A;  3AFA C;  4J8U A;  2CV5 D;  3W96 B;  1HQ3 D;  2HIO B;  3MVD C;  5AVC B;  2CV5 B;  5C3I C;  4E44 A;  1HQ3 B;  4CAY B;  4WU9 A;  4R8P D;  5BS7 C;  4QLC D;  4Z66 D;  4H9O B;  3C1C A;  2Y2P A;  5AV6 A;  2BYK B;  4HGA B;  4Z5T D;  3O62 D;  1S32 A;  4Z66 B;  4QLC B;  3B6G D;  4XZQ D;  1P3A D;  3WAA D;  2ARO A;  5B40 C;  4Z5T B;  2ZY2 A;  3O62 B;  4XUJ D;  4CSR A;  4XZQ B;  1P3A B;  4H9N B;  4WNN A;  5GT3 B;  4XUJ B;  3MGQ B;  3AZK B;  3B6F A;  3AZI B;  3LZ1 B;  5DNM B;  5B2J A;  4H9Q A;  3AYW B;  1KX4 A;  2Y2I A;  3A1K A;  5AVB D;  1BH9 B;  3KUY D;  2RVQ C;  2DF4 C;  5B1L B;  5AVB B;  5B31 D;  3X1V A;  3KUY B;  3MGS D;  3NQJ B;  3AZJ C;  3EPH A;  2VQR A;  5BNX B;  4AWL B;  3W96 A;  2Y2H A;  3MGS B;  2F8N H;  3AFA D;  2HIO A;  3REI C;  5AV9 C;  3MVD D;  3MGP C;  1HQ3 A;  4J8U C;  3AFA B;  4CAY A;  5C3I B;  2BYK A;  5B0Z C;  2NQB C;  5AV6 C;  1S32 C;  5B40 D;  1P3A A;  4H9N A;  2ARO C;  5GT3 A;  1JFI B;  2FJ7 B;  3MGQ A;  5B0Y C;  5GSU D;  3AZK A;  3AZI A;  5CP6 A;  4NE6 A;  3X1S A;  5GSU B;  5DNM A;  3LZ1 A;  4H9P A;  3AYW A;  3B6F C;  3A6N C;  1ID3 C;  5B1L A;  5B2J C;  2RVQ D;  3H0L C;  5AVB A;  1M1A B;  3VH6 T;  3W97 A;  3NQJ A;  4E45 A;  1M19 C;  1EQZ B;  3UTA C;  3A1I A;  2YFV A;  3H0M C;  3WTP C;  3O62 C;  3AZJ D;  2JE5 A;  2BYM B;  5JA4 B;  4UUZ B;  3REI D;  3W96 C;  3AFA A;  5AV9 D;  3MGP D;  3H0R C;  3REI B;  3B0C T;  5AV9 B;  1KX3 C;  5B0Z D;  2NQB D;  5AV6 D;  2ZY4 A;  1S32 D;  3KFU G;  1JFI A;  2FJ7 A;  5B0Z B;  2NQB B;  2ARO D;  5AV6 B;  1S32 B;  5B0Y D;  1ZLA A;  5GT3 C;  5GSU A;  3EG5 B;  2ARO B;  3MGQ C;  1P34 A;  3AZK C;  5B0Y B;  3AZN A;  5CP6 C;  3AZI C;  3B6F D;  5GXQ A;  3A6N D;  3X1S C;  5DNM C;  4WNN B;  3LZ1 C;  3AYW C;  1P3F A;  1ID3 D;  3B6F B;  5B2J D;  1M1A A;  3A6N B;  3AL0 C;  1H3O A;  1EQZ A;  5B1L C;  1ID3 B;  3VH6 A;  5B2J B;  4H9Q B;  5AVB C;  5GT0 A;  3UTA D;  1M19 D;  3WTP D;  2BYM A;  2NZD A;  3W97 C;  4NE3 A;  1M19 B;  3UTA B;  4UUZ A;  3WTP B;  2BG1 A;  3W96 D;  3EPJ A;  2W8S A;  4WV4 B;  4ZBJ C;  5AV9 A;  4WU8 A;  3UT9 B;  1P3G A;  3B0D B;  1KX3 D;  5B1M A;  5JRG A;  1U35 C;  5B0Z A;  1KX5 A;  2F8N K;  1F66 C;  1KX3 B;  3B0B A;  4NE5 A;  2NQB A;  3V9R A;  4G92 C;  2FJ7 C;  3AZM D;  5GT3 D;  5B0Y A;  3MGQ D;  3WKJ C;  3AZK D;  1ZLA C;  3AZI D;  5CP6 D;  3AZM B;  5B2I A;  5GSU C;  3NQU A;  3MNN B;  1P34 C;  3X1S D;  3AZN C;  5DNM D;  3LZ1 D;  2ZM5 A;  3AYW D;  5CP6 B;  3A6N A;  5GXQ C;  3WTP E;  3X1S B;  1P3F C;  2Y2M A;  1ID3 A;  4H9P B;  3KWQ A;  5B1L D;  1M1A C;  4J8V B;  3REK B;  1EQZ C;  1M19 A;  3UTA A;  3W97 D;  5GT0 C;  3WTP A;  2NZD C;  3EPL A;  4M6B A;  5AV5 A;  3REH B;  2JCH A;  3W97 B;  4KGC A;  5E5A C;  3AZH A;  2YFV B;  4KUD A;  2Y2L A;  5FUG A;  3MGR C;  3UT9 A;  2PYO D;  1P3M B;  1Z2C B;  4ZBJ B;  2RIQ A;  3WA9 B;  1HTA A;  4WU8 C;  5BT1 C;  1P3G C;  2PYO B;  1U35 D;  1KX3 A;  4DRA A;  5BNV B;  2J8P A;  1BFM A;  5B1M C;  4J8X C;  5JRG C;  3C1B B;  1F66 D;  1U35 B;  1KX5 C;  2UWX A;  1F66 B;  2FJ7 D;  3W98 B;  2YFW B;  3AZM A;  4G92 B;  3WKJ D;  4Z2M G;  1P3P C;  1ZLA D;  3MNN A;  4KHA A;  3KXB B;  1P34 D;  3X1U A;  3AZN D;  3WKJ B;  3LJA D;  1ZLA B;  5B2I C;  1P3L A;  5GXQ D;  3REL A;  3AV1 C;  1P3B B;  1P34 B;  1P3F D;  3AZN B;  3LJA B;  4J8V A;  3REK A;  5CPI A;  3TU4 C;  1M1A D;  5GXQ B;  1P3F B;  3KWQ C;  1EQZ D;  2Y2J A;  5GT0 D;  2IO5 B;  3REH A;  1H3O B;  1TAF B;  2NZD D;  5E5A D;  5GT0 B;  5AV5 C;  2NZD B;  4KGC C;  3AZH C;  3P5J B;  3MGR D;  1P3M A;  5E5A B;  4KUD C;  4ZUX D;  3UTB B;  1AOI A;  3WA9 A;  3UT9 C;  2PYO A;  3MGR B;  3W99 A;  4WU8 D;  4ZUX B;  3R45 A;  3IP4 C;  5B32 D;  5BT1 D;  1P3G D;  5BNV A;  3B0D C;  3C1B A;  4WU8 B;  5B1M D;  4J8X D;  5JRG D;  5B32 B;  2ZY3 A;  1U35 A;  3VH5 T;  1P3G B;  1F66 A;  5DNN B;  1KX5 D;  3W98 A;  2YFW A;  4LD9 A;  5B1M B;  4J8X B;  5JRG B;  3VH6 W;  4EO5 B;  1Q9C A;  1M18 B;  1KX5 B;  4DQY B;  3KXB A;  1P3P D;  5G49 A;  3V9R B;  3WKJ A;  3AZM C;  3MNN C;  1P3P B;  1P3B A;  5B2I D;  3AV1 D;  3X1U C;  3LJA A;  1P3L C;  5B2I B;  3REL C;  3TU4 D;  3NQU B;  3AV1 B;  3B0C W;  5AV8 C;  1P3K A;  1W2E A;  5CPI C;  4J8V C;  3KWQ D;  3REK C;  3TU4 B;  4H9S A;  1TAF A;  3KWQ B;  1WWI A;  3REH C;  4WZS B;  5AV5 D;  5E5A A;  3UTB A;  4KGC D;  3AZH D;  2Y2Q A;  4KUD D;  3MGR A;  5AV5 B;  3F6T A;  1P3M C;  5B33 B;  4ZUX A;  3UT9 D;  3AZH B;  4KGC B;  1AOI C;  3AV2 A;  4KUD B;  3X1T A;  3WA9 C;  5FUG B;  2PYO C;  3W99 C;  5B32 A;  2LY8 A;  4J8W A;  5DNN A;  3AZF A;  3VH5 A;  3C1B C;  4J8X A;  4JJN B;  4NFT A;  3AN2 B;  1M18 A;  3W98 C;  5B32 G;  2F8N A;  4LD9 C;  3AZG A;  1P3P A;  3KXB C;  3MNN D;  4YM6 B;  2CWE A;  3AZE A;  3X1U D;  1B67 A;  1TZY B;  1P3B C;  2F8N G;  4KHA B;  3AV1 A;  1P3L D;  2Y2G A;  3REL D;  5F99 B;  3LJA C;  3AZL B;  3X1U B;  5AV8 D;  5CPJ A;  2HUE C;  4J8V D;  3REK D;  3TU4 A;  5CPI D;  4YS3 A;  1P3L B;  3REL B;  1P3K C;  5AV8 B;  1PZR A;  5KDM B;  2IO5 C;  5CPI B;  4H9S C;  3REH D;  5AY8 C;  5BO0 A;  4R8P B;  2XD1 A;  1P3O A;  4WJ3 C;  1N1J B;  2G5I C;  5B33 A;  3UTB C;  1P3M D;  3LEL A;  3B6G B;  3WAA B;  1AOI D;  3WA9 D;  4ZUX C;  3LZ0 C;  3REJ C;  3W99 D;  3AV2 C;  5B24 C;  3X1T C;  1AOI B;  4JJN A;  5B32 C;  3C1B D;  5CPK A;  3AN2 A;  3W99 B;  3R45 B;  4J8W C;  2DQN C;  5DNN C;  3AZF C;  2F2A C;  3W98 D;  2FFF B;  4X23 D;  1P3I A;  4EO5 C;  4LD9 D;  1F1E A;  1M18 C;  4YM6 A;  4X23 B;  3KXB D;  3EPK A;  4LD9 B;  4H9R A;  1TZY A;  3AZG C;  5B31 B;  2G5H C;  5G49 B;  5F99 A;  3AZL A;  1P3B D;  3AZE C;  5AVC A;  2L5A A;  2CV5 A;  1A7W A;  5AV8 A;  5KDM A;  5CPJ C;  1P3K D;  4G91 C;  2HUE B;  4H9O A;  4YS3 C;  3MVD B;  4R8P A;  1P3K B;  4WU9 C;  4QLC A;  4Z66 A;  5AY8 D;  3FDD A;  1N1J A;  3C1C C;  4Z5T A;  3O62 A;  1ULY A;  3WAA A;  5AY8 B;  4XZQ A;  1P3O C;  3UTB D;  3B6G A;  5B33 C;  1KU5 A;  4XUJ A;  5B40 B;  3REJ D;  3LZ0 D;  3LEL C;  3AV2 D;  5B24 D;  3X1T D;  4DRB A;  3REJ B;  3LZ0 B;  3AV2 B;  5B24 B;  4J8W D;  3X1T B;  5DNN D;  1BH9 A;  4JJN C;  3AZF D;  1BH8 B;  5CPK C;  3AN2 C;  1KX4 C;  1R4V A;  4J8W B;  3AZF B;  1M18 D;  3KUY A;  4X23 A;  1P3I C;  2F8N D;  5B31 A;  2Y2O A;  5BNX A;  3X1V C;  3AZG D;  4Z2M H;  4YM6 C;  3MGS A;  2F8N B;  1TZY C;  3AZE D;  3AZJ B;  3AZG B;  3KSY A;  5F99 C;  2Y2N A;  3AZL C;  4J8U D;  5B31 G;  2HIO C;  3AZE B;  5AVC C;  5CPJ D;  3MVD A;  2ZY5 A;  2CV5 C;  1HQ3 C;  4YS3 D;  4J8U B;  3MGP B;  3C1C B;  4WU9 D;  5CPJ B;  5BS7 A;  4G91 B;  4YS3 B;  3VH5 W;  4HGA C;  4R8P C;  3C1C D;  5AY8 A;  4QLC C;  4Z66 C;  4WU9 B;  1P3O D;  4Z5T C;  5B40 A;  5B33 D; 
#chains in the Genus database with same CATH homology
 2JSS A;  3WAA C;  4XZQ C;  5BO0 B;  1P3A C;  3B6G C;  1P3O B;  3LEL D;  5CHL B;  4XUJ C;  3REJ A;  3LZ0 A;  2Y2K A;  4UPK A;  5B24 A;  3LEL B;  4CSR B;  1BH8 A;  1T3U A;  4JJN D;  5CPK D;  3AN2 D;  1KX4 D;  5CPK B;  1P3I D;  1KX4 B;  3KUY C;  4X23 C;  1WWS A;  3X1V D;  4YM6 D;  5JA4 A;  1P3I B;  1B6W A;  3AZJ A;  5B31 C;  1TZY D;  4AWL C;  3MGS C;  3X1V B;  5F99 D;  3AZL D;  4H9R B;  3REI A;  2HIO D;  2XD5 A;  5AVC D;  3MGP A;  3AFA C;  4J8U A;  2CV5 D;  3W96 B;  1HQ3 D;  2HIO B;  3MVD C;  5AVC B;  2CV5 B;  5C3I C;  4E44 A;  1HQ3 B;  4CAY B;  4WU9 A;  4R8P D;  5BS7 C;  4QLC D;  4Z66 D;  4H9O B;  3C1C A;  2Y2P A;  5AV6 A;  2BYK B;  4HGA B;  4Z5T D;  3O62 D;  1S32 A;  4Z66 B;  4QLC B;  3B6G D;  4XZQ D;  1P3A D;  3WAA D;  2ARO A;  5B40 C;  4Z5T B;  2ZY2 A;  3O62 B;  4XUJ D;  4CSR A;  4XZQ B;  1P3A B;  4H9N B;  4WNN A;  5GT3 B;  4XUJ B;  3MGQ B;  3AZK B;  3B6F A;  3AZI B;  3LZ1 B;  5DNM B;  5B2J A;  4H9Q A;  3AYW B;  1KX4 A;  2Y2I A;  3A1K A;  5AVB D;  1BH9 B;  3KUY D;  2RVQ C;  2DF4 C;  5B1L B;  5AVB B;  5B31 D;  3X1V A;  3KUY B;  3MGS D;  3NQJ B;  3AZJ C;  3EPH A;  2VQR A;  5BNX B;  4AWL B;  3W96 A;  2Y2H A;  3MGS B;  2F8N H;  3AFA D;  2HIO A;  3REI C;  5AV9 C;  3MVD D;  3MGP C;  1HQ3 A;  4J8U C;  3AFA B;  4CAY A;  5C3I B;  2BYK A;  5B0Z C;  2NQB C;  5AV6 C;  1S32 C;  5B40 D;  1P3A A;  4H9N A;  2ARO C;  5GT3 A;  1JFI B;  2FJ7 B;  3MGQ A;  5B0Y C;  5GSU D;  3AZK A;  3AZI A;  5CP6 A;  4NE6 A;  3X1S A;  5GSU B;  5DNM A;  3LZ1 A;  4H9P A;  3AYW A;  3B6F C;  3A6N C;  1ID3 C;  5B1L A;  5B2J C;  2RVQ D;  3H0L C;  5AVB A;  1M1A B;  3VH6 T;  3W97 A;  3NQJ A;  4E45 A;  1M19 C;  1EQZ B;  3UTA C;  3A1I A;  2YFV A;  3H0M C;  3WTP C;  3O62 C;  3AZJ D;  2JE5 A;  2BYM B;  5JA4 B;  4UUZ B;  3REI D;  3W96 C;  3AFA A;  5AV9 D;  3MGP D;  3H0R C;  3REI B;  3B0C T;  5AV9 B;  1KX3 C;  5B0Z D;  2NQB D;  5AV6 D;  2ZY4 A;  1S32 D;  3KFU G;  1JFI A;  2FJ7 A;  5B0Z B;  2NQB B;  2ARO D;  5AV6 B;  1S32 B;  5B0Y D;  1ZLA A;  5GT3 C;  5GSU A;  3EG5 B;  2ARO B;  3MGQ C;  1P34 A;  3AZK C;  5B0Y B;  3AZN A;  5CP6 C;  3AZI C;  3B6F D;  5GXQ A;  3A6N D;  3X1S C;  5DNM C;  4WNN B;  3LZ1 C;  3AYW C;  1P3F A;  1ID3 D;  3B6F B;  5B2J D;  1M1A A;  3A6N B;  3AL0 C;  1H3O A;  1EQZ A;  5B1L C;  1ID3 B;  3VH6 A;  5B2J B;  4H9Q B;  5AVB C;  5GT0 A;  3UTA D;  1M19 D;  3WTP D;  2BYM A;  2NZD A;  3W97 C;  4NE3 A;  1M19 B;  3UTA B;  4UUZ A;  3WTP B;  2BG1 A;  3W96 D;  3EPJ A;  2W8S A;  4WV4 B;  4ZBJ C;  5AV9 A;  4WU8 A;  3UT9 B;  1P3G A;  3B0D B;  1KX3 D;  5B1M A;  5JRG A;  1U35 C;  5B0Z A;  1KX5 A;  2F8N K;  1F66 C;  1KX3 B;  3B0B A;  4NE5 A;  2NQB A;  3V9R A;  4G92 C;  2FJ7 C;  3AZM D;  5GT3 D;  5B0Y A;  3MGQ D;  3WKJ C;  3AZK D;  1ZLA C;  3AZI D;  5CP6 D;  3AZM B;  5B2I A;  5GSU C;  3NQU A;  3MNN B;  1P34 C;  3X1S D;  3AZN C;  5DNM D;  3LZ1 D;  2ZM5 A;  3AYW D;  5CP6 B;  3A6N A;  5GXQ C;  3WTP E;  3X1S B;  1P3F C;  2Y2M A;  1ID3 A;  4H9P B;  3KWQ A;  5B1L D;  1M1A C;  4J8V B;  3REK B;  1EQZ C;  1M19 A;  3UTA A;  3W97 D;  5GT0 C;  3WTP A;  2NZD C;  3EPL A;  4M6B A;  5AV5 A;  3REH B;  2JCH A;  3W97 B;  4KGC A;  5E5A C;  3AZH A;  2YFV B;  4KUD A;  2Y2L A;  5FUG A;  3MGR C;  3UT9 A;  2PYO D;  1P3M B;  1Z2C B;  4ZBJ B;  2RIQ A;  3WA9 B;  1HTA A;  4WU8 C;  5BT1 C;  1P3G C;  2PYO B;  1U35 D;  1KX3 A;  4DRA A;  5BNV B;  2J8P A;  1BFM A;  5B1M C;  4J8X C;  5JRG C;  3C1B B;  1F66 D;  1U35 B;  1KX5 C;  2UWX A;  1F66 B;  2FJ7 D;  3W98 B;  2YFW B;  3AZM A;  4G92 B;  3WKJ D;  4Z2M G;  1P3P C;  1ZLA D;  3MNN A;  4KHA A;  3KXB B;  1P34 D;  3X1U A;  3AZN D;  3WKJ B;  3LJA D;  1ZLA B;  5B2I C;  1P3L A;  5GXQ D;  3REL A;  3AV1 C;  1P3B B;  1P34 B;  1P3F D;  3AZN B;  3LJA B;  4J8V A;  3REK A;  5CPI A;  3TU4 C;  1M1A D;  5GXQ B;  1P3F B;  3KWQ C;  1EQZ D;  2Y2J A;  5GT0 D;  2IO5 B;  3REH A;  1H3O B;  1TAF B;  2NZD D;  5E5A D;  5GT0 B;  5AV5 C;  2NZD B;  4KGC C;  3AZH C;  3P5J B;  3MGR D;  1P3M A;  5E5A B;  4KUD C;  4ZUX D;  3UTB B;  1AOI A;  3WA9 A;  3UT9 C;  2PYO A;  3MGR B;  3W99 A;  4WU8 D;  4ZUX B;  3R45 A;  3IP4 C;  5B32 D;  5BT1 D;  1P3G D;  5BNV A;  3B0D C;  3C1B A;  4WU8 B;  5B1M D;  4J8X D;  5JRG D;  5B32 B;  2ZY3 A;  1U35 A;  3VH5 T;  1P3G B;  1F66 A;  5DNN B;  1KX5 D;  3W98 A;  2YFW A;  4LD9 A;  5B1M B;  4J8X B;  5JRG B;  3VH6 W;  4EO5 B;  1Q9C A;  1M18 B;  1KX5 B;  4DQY B;  3KXB A;  1P3P D;  5G49 A;  3V9R B;  3WKJ A;  3AZM C;  3MNN C;  1P3P B;  1P3B A;  5B2I D;  3AV1 D;  3X1U C;  3LJA A;  1P3L C;  5B2I B;  3REL C;  3TU4 D;  3NQU B;  3AV1 B;  3B0C W;  5AV8 C;  1P3K A;  1W2E A;  5CPI C;  4J8V C;  3KWQ D;  3REK C;  3TU4 B;  4H9S A;  1TAF A;  3KWQ B;  1WWI A;  3REH C;  4WZS B;  5AV5 D;  5E5A A;  3UTB A;  4KGC D;  3AZH D;  2Y2Q A;  4KUD D;  3MGR A;  5AV5 B;  3F6T A;  1P3M C;  5B33 B;  4ZUX A;  3UT9 D;  3AZH B;  4KGC B;  1AOI C;  3AV2 A;  4KUD B;  3X1T A;  3WA9 C;  5FUG B;  2PYO C;  3W99 C;  5B32 A;  2LY8 A;  4J8W A;  5DNN A;  3AZF A;  3VH5 A;  3C1B C;  4J8X A;  4JJN B;  4NFT A;  3AN2 B;  1M18 A;  3W98 C;  5B32 G;  2F8N A;  4LD9 C;  3AZG A;  1P3P A;  3KXB C;  3MNN D;  4YM6 B;  2CWE A;  3AZE A;  3X1U D;  1B67 A;  1TZY B;  1P3B C;  2F8N G;  4KHA B;  3AV1 A;  1P3L D;  2Y2G A;  3REL D;  5F99 B;  3LJA C;  3AZL B;  3X1U B;  5AV8 D;  5CPJ A;  2HUE C;  4J8V D;  3REK D;  3TU4 A;  5CPI D;  4YS3 A;  1P3L B;  3REL B;  1P3K C;  5AV8 B;  1PZR A;  5KDM B;  2IO5 C;  5CPI B;  4H9S C;  3REH D;  5AY8 C;  5BO0 A;  4R8P B;  2XD1 A;  1P3O A;  4WJ3 C;  1N1J B;  2G5I C;  5B33 A;  3UTB C;  1P3M D;  3LEL A;  3B6G B;  3WAA B;  1AOI D;  3WA9 D;  4ZUX C;  3LZ0 C;  3REJ C;  3W99 D;  3AV2 C;  5B24 C;  3X1T C;  1AOI B;  4JJN A;  5B32 C;  3C1B D;  5CPK A;  3AN2 A;  3W99 B;  3R45 B;  4J8W C;  2DQN C;  5DNN C;  3AZF C;  2F2A C;  3W98 D;  2FFF B;  4X23 D;  1P3I A;  4EO5 C;  4LD9 D;  1F1E A;  1M18 C;  4YM6 A;  4X23 B;  3KXB D;  3EPK A;  4LD9 B;  4H9R A;  1TZY A;  3AZG C;  5B31 B;  2G5H C;  5G49 B;  5F99 A;  3AZL A;  1P3B D;  3AZE C;  5AVC A;  2L5A A;  2CV5 A;  1A7W A;  5AV8 A;  5KDM A;  5CPJ C;  1P3K D;  4G91 C;  2HUE B;  4H9O A;  4YS3 C;  3MVD B;  4R8P A;  1P3K B;  4WU9 C;  4QLC A;  4Z66 A;  5AY8 D;  3FDD A;  1N1J A;  3C1C C;  4Z5T A;  3O62 A;  1ULY A;  3WAA A;  5AY8 B;  4XZQ A;  1P3O C;  3UTB D;  3B6G A;  5B33 C;  1KU5 A;  4XUJ A;  5B40 B;  3REJ D;  3LZ0 D;  3LEL C;  3AV2 D;  5B24 D;  3X1T D;  4DRB A;  3REJ B;  3LZ0 B;  3AV2 B;  5B24 B;  4J8W D;  3X1T B;  5DNN D;  1BH9 A;  4JJN C;  3AZF D;  1BH8 B;  5CPK C;  3AN2 C;  1KX4 C;  1R4V A;  4J8W B;  3AZF B;  1M18 D;  3KUY A;  4X23 A;  1P3I C;  2F8N D;  5B31 A;  2Y2O A;  5BNX A;  3X1V C;  3AZG D;  4Z2M H;  4YM6 C;  3MGS A;  2F8N B;  1TZY C;  3AZE D;  3AZJ B;  3AZG B;  3KSY A;  5F99 C;  2Y2N A;  3AZL C;  4J8U D;  5B31 G;  2HIO C;  3AZE B;  5AVC C;  5CPJ D;  3MVD A;  2ZY5 A;  2CV5 C;  1HQ3 C;  4YS3 D;  4J8U B;  3MGP B;  3C1C B;  4WU9 D;  5CPJ B;  5BS7 A;  4G91 B;  4YS3 B;  3VH5 W;  4HGA C;  4R8P C;  3C1C D;  5AY8 A;  4QLC C;  4Z66 C;  4WU9 B;  1P3O D;  4Z5T C;  5B40 A;  5B33 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...