3LELA

Structural insight into the sequence-dependence of nucleosome positioning
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the sequence dependence of nucleosome positioning
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 33
structure length 98
sequence length 98
chains with identical sequence E, K, O
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3lelA00
1U35D 1P3PA 3KWQB 3C1CA 3R45B 2NZDD 3AZFC 4LD9B 5GSUC 3TU4B 5B2JD 1ZLAD 5BO0A 1KX3D 4KUDA 4LD9D 3LJAA 3MGRC 1P3OC 1TZYB 5B2IB 5AVCB 1P3KD 2NZDB 5KDMB 1P34A 4X23D 3W98B 1P3LA 3WTPA 3LZ0D 3REIC 5B40D 5E5AB 4J8XD 4H9OB 5GT3D 4LD9C 5B33B 5AVBB 1WWSA 4JJNA 3AZGA 5AY8C 5B0ZB 1TAFA 1N1JA 3AZKC 5B1LB 3AZMC 3LZ0C 3REID 4NE3A 4EO5B 1BH8B 5CPKA 3X1TA 4KGCD 5E5AC 3UTAB 3UTBB 1S32D 1EQZD 1TAFB 3B6FB 4XUJB 3X1UA 3B6GC 2AROB 4H9NB 4J8VD 3REJA 5E5AA 3REKC 2PYOB 5JRGC 3X1TC 1AOIA 4XZQB 3B6FA 1B67A 3X1SA 4JJND 5CPKC 1ID3D 3AZHD 4G92C 4J8UD 3LZ0A 2YFVA 4JJNC 4WV4B 1P3FD 4X23A 5B32D 3RELD 3REIA 3AZGC 4LD9A 1P34C 3MVDC 4AWLC 3B0CW 3MGRA 3UT9A 1P3GB 1P3LC 1P3AC 1P3MB 5AV6A 3LELB 4CAYA 3AZFA 3C1CC 3AYWB 4NFTA 1P3BC 4CSRB 1M18B 4KUDC 1P3PC 4H9RB 4QLCD 5GXQA 1KX5A 1P3GD 5BT1C 1F66D 3WKJB 3AV2D 3LJAD 4AWLB 5B0ZA 5CP6B 5BT1D 4KHAB 4NE6A 5BNVB 4HGAB 2YFWA 4YM6C 3RELB 1P3PD 4QLCC 3AZKD 5AV5A 3KWQC 2HIOA 3MNND 1KX4A 1ID3B 2FJ7D 5B31C 3AV1C 4ZBJC 4ZUXA 5F99C 3MNNB 3MGSC 3AN2A 1S32C 5GXQB 2CV5C 1P3FC 3WAAC 1P3PB 5JRGB 2AROD 5GT0A 3AV2B 1S32B 5CP6C 4H9QB 5B1LC 3AZMB 4ZBJB 3AZNA 3AZLD 3A6NC 4WU9C 1WWIA 1M18D 5GT3C 5CPIC 3LELD 4J8WA 5DNMA 3KUYA 5B1LD 3VH5W 3NQJB 1P3IC 3W96C 3AV2C 3V9RA 5B1MA 5DNNC 2NQBD 5E5AD 4J8XB 2F8ND 3O62B 1R4VA 3REJD 5GT0B 5BO0B 5CPIA 5B24D 4JJNB 3AZID 4M6BA 1P3KB 1M1AA 5AV8C 4XZQD 4R8PC 4Z5TB 3A6NA 5CPKB 1M19B 1KX3B 3B6GB 5B2JB 1ZLAB 3AZNB 3WTPE 2PYOD 5GT0C 3W97C 3NQUA 3AZGB 3REKB 2PYOC 5B1MB 2HIOB 3C1BB 5AV9A 2BYMB 1P3FA 1EQZB 3AZEA 3MNNC 1BH8A 5GSUD 4J8UA 5B2JC 3MGPA 1ZLAC 5F99A 4ZUXC 4Z66A 5B31A 5F99D 4KGCB 1KX4C 4H9PB 3REHC 3AZED 1P3LD 3AN2B 3REIB 1A7WA 1HQ3D 4E44A 5G49A 1P3GC 2NQBA 5B33D 5AVBD 5B0ZC 1KU5A 1U35A 1HQ3C 3A6ND 1M18C 1F66C 4KUDB 5GXQC 3W99C 3AFAB 3LELC 5B2ID 1TZYD 5CPID 5B31B 4KGCA 3LELA 5AV6C 3TU4D 4H9PA 1M18A 5AY8B 3KWQD 4G91B 1U35B 3LZ1D 5AV5B 3W99D 4DRBA 4WU8C 4X23C 3VH5A 3AV1D 5AV8B 3WAAD 5DNMD 4Z2MH 3MGSB 3B6FC 1P3KA 4ZUXD 4Z66C 5B2JA 3MGPC 5JRGA 1ZLAA 3REKA 3MNNA 5JA4B 3REJC 5AV9B 4YS3B 1BH9A 3B6GA 4Z66B 3W97A 2YFVB 3TU4A 3B0DB 5B0YB 3WA9C 1P3BB 4EO5C 1KX4D 3W97D 4R8PA 1KX3C 1M1AC 4WNNA 5CPJB 4G92B 3MGSD 4H9QA 3AZMA 3AZKA 5AV6D 4H9RA 5BNXB 3MVDB 5AV8D 3UT9D 5JA4A 5DNNA 4YM6B 4UUZA 3VH5T 2AROC 4YS3A 4J8WB 3AV2A 2CWEA 4Z5TC 4R8PB 3X1VD 4XUJA 3X1UB 3LZ1B 5CPJC 1M19C 1KX5D 5B32A 3W96A 5B40C 5AV6B 1P3IA 5BS7C 3UTBA 1P3OB 2NZDC 5DNMC 3AZFD 5CPJD 3MGQA 1JFIB 5B32G 5B31D 3LJAC 1KX4B 3MGRD 3AFAD 1ID3A 3MGPD 4WU9A 3AZLC 5GSUA 4HGAC 2IO5B 5AVCA 3X1SB 1M1AB 2YFWB 3RELA 1EQZC 2F8NK 1AOIB 4J8VA 4H9OA 5B2IA 3REHB 3AZHA 1HQ3B 2CV5A 1P3AB 1P3MC 1P3LB 1S32A 4ZUXB 3AYWC 3LZ1C 2CV5D 5F99B 4H9SA 2RVQD 4H9SC 3X1TD 3B0BA 3AYWA 2F8NA 5B2IC 1JFIA 3WAAB 5AV5C 2FJ7C 1HTAA 1P3MA 3UTAA 5B1MD 1EQZA 5G49B 3RELC 3AZGD 4CSRA 1N1JB 4J8VC 3WKJA 3MGQD 3WTPD 1KX5C 5CPKD 1ID3C 5AVCC 1P3BA 1P3ID 3W96D 5CPIB 3MGQC 2F8NH 3AZLA 1P3AA 5DNNB 3A6NB 4KUDD 3UT9C 3O62A 5GT0D 3REJB 3MVDA 4WU9D 3C1CD 2NZDA 3AFAA 3UTBC 5BS7A 4YS3C 4H9NA 2AROA 1P34B 5B40A 5B32C 4WNNB 5CPJA 4DRAA 4XUJC 4Z5TA 1M19A 3AZJB 1P34D 3AN2D 3C1CB 4WU9B 3AZEB 1KX3A 3X1SC 5DNND 1AOIC 5GSUB 3TU4C 1P3IB 3NQUB 2F8NG 3AZMD 5B24C 3AZIC 3WA9A 3MGQB 3KUYD 3REKD 5JRGD 3X1UC 3VH6A 1BFMA 3KUYB 5GXQD 3AZND 5CHLB 3B6GD 4Z5TD 1M19D 1P3KC 5BNXA 3X1TB 2FJ7B 5B24B 3AZIB 2HUEB 1F1EA 3O62D 2F8NB 2NQBB 5AY8A 4E45A 1P3AD 3KXBA 3AZJD 3W98A 5CP6D 4WU8A 3LJAB 3WTPC 2RVQC 1F66B 3WKJD 4QLCB 5KDMA 3X1SD 1Q9CA 4KGCC 1P3OA 5FUGA 3W99A 1P3MD 3MGRB 3AZLB 3W96B 1U35C 3AZFB 3WTPB 3VH6T 1F66A 5C3IB 1P3GA 1HQ3A 1KX5B 3X1UD 1TZYC 3W98C 3KXBC 2NQBC 4J8UB 3REHA 3UT9B 3AZHB 5B33A 5AVBA 4Z2MG 3MVDD 2LY8A 3C1BC 3KSYA 5B0YA 4NE5A 4KHAA 5BNVA 2CV5B 4G91C 1P3BD 5B0YD 5AV9C 1BH9B 3AZKB 4J8UC 4J8VB 1H3OA 4WZSB 3V9RB 3REHD 3AZEC 4Z66D 2PYOA 3R45A 2BYKB 3B6FD 4XZQA 1AOID 5C3IC 3UTBD 1M1AD 3UTAD 5AV9D 5B24A 3AZIA 2BYMA 4J8XC 3X1VA 3AYWD 4UUZB 3MGPB 5AV8A 2L5AA 1P3OD 3AZJC 5DNMB 5B32B 3X1VB 4R8PD 5GT3B 2BYKA 1P3FB 3B0CT 4J8WD 5B40B 5B1MC 4YM6D 1H3OB 3KUYC 3AFAC 5FUGB 3W99B 3AZJA 3W98D 4J8WC 3O62C 5AY8D 5AVCD 2HUEC 5B1LA 5GT3A 3W97B 3X1VC 3NQJA 4J8XA 4WU8D 3WKJC 3AZNC 5CP6A 4XZQC 5B31G 3KXBD 4XUJD 1ULYA 3VH6W 4YS3D 3UTAC 2FJ7A 1B6WA 3WAAA 3AV1A 3WA9D 2JSSA 3MGSA 3AN2C 2HIOC 2IO5C 3LZ1A 3B0DC 5B0YC 3WA9B 3C1BA 3KWQA 5AVBC 5B0ZD 5B33C 4YM6A 3AZHC 3AV1B 1TZYA 3C1BD 4QLCA 2HIOD 3KXBB 3LZ0B 4CAYB 5AV5D 4WU8B 4X23B
chains in the Genus database with same CATH superfamily
1U35D 1P3PA 3KWQB 3C1CA 3R45B 2NZDD 3AZFC 4LD9B 5GSUC 3TU4B 5B2JD 1ZLAD 5BO0A 1KX3D 4KUDA 4LD9D 3LJAA 3MGRC 1P3OC 1TZYB 5B2IB 5AVCB 1P3KD 2NZDB 5KDMB 1P34A 4X23D 3EPKA 3W98B 1P3LA 3WTPA 3LZ0D 3REIC 5B40D 5E5AB 4J8XD 4H9OB 5GT3D 4LD9C 5B33B 5AVBB 1WWSA 4JJNA 3AZGA 5AY8C 5B0ZB 1TAFA 1N1JA 3AZKC 5B1LB 3IP4C 3LZ0C 3REID 3AZMC 2G5HC 4NE3A 4EO5B 1BH8B 5CPKA 3X1TA 4KGCD 5E5AC 3UTAB 3UTBB 1S32D 1EQZD 1TAFB 3B6FB 4XUJB 3X1UA 3B6GC 2AROB 4H9NB 3H0RC 4J8VD 3REJA 5E5AA 3REKC 2PYOB 5JRGC 3X1TC 1W2EA 1AOIA 4WJ3C 4XZQB 3B6FA 1B67A 3X1SA 4JJND 3H0MC 5CPKC 1ID3D 3AZHD 4G92C 4J8UD 3LZ0A 2YFVA 4JJNC 4WV4B 1P3FD 4X23A 5B32D 3RELD 3REIA 3AZGC 4LD9A 1P34C 3MVDC 3AL0C 4AWLC 3B0CW 3MGRA 3UT9A 1P3GB 1P3LC 1P3AC 1P3MB 5AV6A 3LELB 4CAYA 3AZFA 3C1CC 3AYWB 4NFTA 1P3BC 4CSRB 1M18B 4KUDC 1P3PC 4H9RB 4QLCD 5GXQA 1KX5A 1P3GD 5BT1C 1F66D 3WKJB 3AV2D 3LJAD 4AWLB 5B0ZA 5CP6B 5BT1D 2DQNC 4KHAB 4NE6A 5BNVB 4HGAB 2YFWA 4YM6C 3RELB 1P3PD 4QLCC 3AZKD 5AV5A 3KWQC 2HIOA 3MNND 1KX4A 1ID3B 2FJ7D 5B31C 1Z2CB 3AV1C 4ZBJC 4ZUXA 5F99C 3MNNB 3MGSC 3AN2A 1S32C 5GXQB 2CV5C 1P3FC 3WAAC 1P3PB 5JRGB 2AROD 5GT0A 3AV2B 1S32B 5CP6C 4H9QB 5B1LC 3AZMB 1T3UA 4ZBJB 3AZNA 3AZLD 3A6NC 4WU9C 1WWIA 1M18D 5GT3C 4DQYB 5CPIC 3LELD 4J8WA 5DNMA 3KUYA 5B1LD 3VH5W 3NQJB 1P3IC 3W96C 3AV2C 3V9RA 5B1MA 5DNNC 2NQBD 5E5AD 4J8XB 2F8ND 1R4VA 3O62B 3REJD 5GT0B 5BO0B 5CPIA 5B24D 4JJNB 3AZID 4M6BA 1P3KB 1M1AA 5AV8C 4XZQD 4R8PC 2RIQA 4Z5TB 3A6NA 5CPKB 1M19B 1KX3B 5B2JB 1ZLAB 3B6GB 3AZNB 3WTPE 2PYOD 2ZY2A 5GT0C 3W97C 3NQUA 2W8SA 3AZGB 3REKB 2PYOC 5B1MB 2HIOB 3C1BB 5AV9A 2BYMB 1P3FA 1EQZB 3AZEA 3MNNC 1BH8A 5GSUD 4J8UA 5B2JC 3MGPA 1ZLAC 5F99A 4ZUXC 4Z66A 5B31A 5F99D 4KGCB 3H0LC 1KX4C 4H9PB 3REHC 3AZED 1P3LD 3AN2B 3REIB 1A7WA 1HQ3D 4E44A 5G49A 1P3GC 2NQBA 5B33D 5AVBD 5B0ZC 1KU5A 1U35A 1HQ3C 3A6ND 1M18C 1F66C 4KUDB 5GXQC 3W99C 3AFAB 3LELC 5B2ID 1TZYD 5CPID 5B31B 4KGCA 3LELA 5AV6C 3TU4D 4H9PA 2UWXA 1M18A 5AY8B 3KWQD 4G91B 1U35B 3LZ1D 5AV5B 3W99D 4DRBA 2Y2OA 4WU8C 4X23C 3VH5A 3AV1D 5AV8B 3WAAD 5DNMD 2FFFB 4UPKA 4Z2MH 2Y2MA 3MGSB 3B6FC 1P3KA 4ZUXD 4Z66C 5B2JA 3MGPC 5JRGA 1ZLAA 3REKA 3MNNA 5JA4B 3REJC 5AV9B 4YS3B 1BH9A 3B6GA 4Z66B 3W97A 2YFVB 3TU4A 3A1IA 3B0DB 5B0YB 3WA9C 2Y2PA 1P3BB 4EO5C 1KX4D 3W97D 4R8PA 1KX3C 1M1AC 4WNNA 5CPJB 2DF4C 4G92B 3MGSD 4H9QA 3AZMA 3AZKA 5AV6D 4H9RA 5BNXB 3MVDB 5AV8D 3UT9D 5JA4A 5DNNA 4YM6B 4UUZA 3VH5T 2AROC 4YS3A 4J8WB 3AV2A 2CWEA 4Z5TC 4R8PB 3P5JB 4XUJA 3X1UB 3LZ1B 3X1VD 5CPJC 1M19C 5B32A 3W96A 5B40C 5AV6B 1P3IA 1KX5D 5BS7C 3UTBA 1P3OB 2NZDC 5DNMC 3AZFD 5CPJD 3MGQA 1JFIB 2Y2JA 5B32G 5B31D 3LJAC 1KX4B 3MGRD 3AFAD 1ID3A 3MGPD 4WU9A 3AZLC 5GSUA 4HGAC 2IO5B 5AVCA 3X1SB 1M1AB 2YFWB 3RELA 1EQZC 2F8NK 1AOIB 2VQRA 4J8VA 2Y2HA 4H9OA 2JCHA 5B2IA 3REHB 3AZHA 1HQ3B 2CV5A 1P3AB 1P3MC 1P3LB 1S32A 4ZUXB 3AYWC 3LZ1C 2CV5D 5F99B 4H9SA 2RVQD 4H9SC 3X1TD 3B0BA 3AYWA 2Y2GA 5B2IC 1JFIA 2F8NA 3WAAB 5AV5C 2FJ7C 1HTAA 1P3MA 3UTAA 5B1MD 1EQZA 5G49B 3RELC 3AZGD 4CSRA 1N1JB 4J8VC 3F6TA 3WKJA 3MGQD 3WTPD 2Y2LA 3FDDA 1KX5C 5CPKD 1ID3C 5AVCC 1P3BA 1P3ID 3W96D 5CPIB 3MGQC 2F8NH 3KFUG 3AZLA 1P3AA 5DNNB 3A6NB 4KUDD 3UT9C 3O62A 5GT0D 3REJB 3MVDA 4WU9D 3C1CD 2NZDA 3AFAA 3UTBC 5BS7A 4YS3C 2AROA 4H9NA 2XD5A 1P34B 5B40A 5B32C 4WNNB 5CPJA 4DRAA 4XUJC 2JE5A 4Z5TA 1M19A 3AZJB 1P34D 3AN2D 3C1CB 4WU9B 3AZEB 1KX3A 3X1SC 5DNND 1AOIC 5GSUB 3TU4C 1P3IB 3NQUB 2F8NG 3AZMD 5B24C 3AZIC 3WA9A 3MGQB 3KUYD 3REKD 5JRGD 3X1UC 3VH6A 1BFMA 3KUYB 5GXQD 3AZND 5CHLB 3B6GD 2Y2IA 4Z5TD 1M19D 1P3KC 5BNXA 3X1TB 2FJ7B 5B24B 3AZIB 2HUEB 3A1KA 1F1EA 3O62D 2F8NB 2NQBB 5AY8A 4E45A 1P3AD 3KXBA 3AZJD 3W98A 5CP6D 2ZY3A 4WU8A 3EPLA 3LJAB 3WTPC 2RVQC 1F66B 3WKJD 4QLCB 5KDMA 3X1SD 1Q9CA 4KGCC 1P3OA 5FUGA 3W99A 1P3MD 3MGRB 3EG5B 3AZLB 3W96B 1U35C 3AZFB 3WTPB 3VH6T 1F66A 5C3IB 1P3GA 1HQ3A 1KX5B 3X1UD 2XD1A 1TZYC 3W98C 3KXBC 2NQBC 4J8UB 3REHA 3UT9B 3AZHB 5AVBA 5B33A 4Z2MG 3MVDD 2LY8A 3C1BC 3KSYA 5B0YA 4NE5A 4KHAA 5BNVA 2CV5B 4G91C 1P3BD 5B0YD 5AV9C 1BH9B 3AZKB 4J8UC 4J8VB 1H3OA 4WZSB 3V9RB 3EPJA 3REHD 3AZEC 4Z66D 1PZRA 3R45A 2BYKB 2PYOA 3B6FD 2F2AC 4XZQA 2ZY4A 1AOID 5C3IC 3UTBD 3EPHA 2BG1A 1M1AD 3UTAD 5AV9D 5B24A 3AZIA 2BYMA 2ZM5A 4J8XC 3X1VA 3AYWD 4UUZB 3MGPB 5AV8A 2L5AA 1P3OD 3AZJC 5DNMB 5B32B 3X1VB 4R8PD 5GT3B 2BYKA 1P3FB 3B0CT 4J8WD 5B40B 5B1MC 4YM6D 1H3OB 3KUYC 5FUGB 3AFAC 3W99B 3AZJA 3W98D 4J8WC 3O62C 5AY8D 5AVCD 2ZY5A 2HUEC 5B1LA 5GT3A 3W97B 3X1VC 3NQJA 4J8XA 4WU8D 3WKJC 3AZNC 5CP6A 4XZQC 5B31G 3KXBD 4XUJD 1ULYA 3VH6W 4YS3D 2Y2KA 3UTAC 2FJ7A 1B6WA 3WAAA 3AV1A 3WA9D 2JSSA 3MGSA 3AN2C 2HIOC 2IO5C 3LZ1A 3B0DC 5B0YC 3WA9B 3C1BA 3KWQA 5AVBC 5B0ZD 5B33C 2J8PA 4YM6A 3AZHC 2G5IC 3AV1B 1TZYA 3C1BD 4QLCA 2HIOD 3KXBB 2Y2NA 4CAYB 3LZ0B 2Y2QA 5AV5D 4WU8B 4X23B
chains in the Genus database with same CATH topology
1U35D 1P3PA 3KWQB 3C1CA 3R45B 2NZDD 3AZFC 4LD9B 5GSUC 3TU4B 5B2JD 1ZLAD 5BO0A 1KX3D 4KUDA 4LD9D 3LJAA 3MGRC 1P3OC 1TZYB 5B2IB 5AVCB 1P3KD 2NZDB 5KDMB 1P34A 4X23D 3EPKA 3W98B 1P3LA 3WTPA 3LZ0D 3REIC 5B40D 5E5AB 4J8XD 4H9OB 5GT3D 4LD9C 5B33B 5AVBB 1WWSA 4JJNA 3AZGA 5AY8C 5B0ZB 1TAFA 1N1JA 3AZKC 5B1LB 3IP4C 3LZ0C 3REID 3AZMC 2G5HC 4NE3A 4EO5B 1BH8B 5CPKA 3X1TA 4KGCD 5E5AC 3UTAB 3UTBB 1S32D 1EQZD 1TAFB 3B6FB 4XUJB 3X1UA 3B6GC 2AROB 4H9NB 3H0RC 4J8VD 3REJA 5E5AA 3REKC 2PYOB 5JRGC 3X1TC 1W2EA 1AOIA 4WJ3C 4XZQB 3B6FA 1B67A 3X1SA 4JJND 3H0MC 5CPKC 1ID3D 3AZHD 4G92C 4J8UD 3LZ0A 2YFVA 4JJNC 4WV4B 1P3FD 4X23A 5B32D 3RELD 3REIA 3AZGC 4LD9A 1P34C 3MVDC 3AL0C 4AWLC 3B0CW 3MGRA 3UT9A 1P3GB 1P3LC 1P3AC 1P3MB 5AV6A 3LELB 4CAYA 3AZFA 3C1CC 3AYWB 4NFTA 1P3BC 4CSRB 1M18B 4KUDC 1P3PC 4H9RB 4QLCD 5GXQA 1KX5A 1P3GD 5BT1C 1F66D 3WKJB 3AV2D 3LJAD 4AWLB 5B0ZA 5CP6B 5BT1D 2DQNC 4KHAB 4NE6A 5BNVB 4HGAB 2YFWA 4YM6C 3RELB 1P3PD 4QLCC 3AZKD 5AV5A 3KWQC 2HIOA 3MNND 1KX4A 1ID3B 2FJ7D 5B31C 1Z2CB 3AV1C 4ZBJC 4ZUXA 5F99C 3MNNB 3MGSC 3AN2A 1S32C 5GXQB 2CV5C 1P3FC 3WAAC 1P3PB 5JRGB 2AROD 5GT0A 3AV2B 1S32B 5CP6C 4H9QB 5B1LC 3AZMB 1T3UA 4ZBJB 3AZNA 3AZLD 3A6NC 4WU9C 1WWIA 1M18D 5GT3C 4DQYB 5CPIC 3LELD 4J8WA 5DNMA 3KUYA 5B1LD 3VH5W 3NQJB 1P3IC 3W96C 3AV2C 3V9RA 5B1MA 5DNNC 2NQBD 5E5AD 4J8XB 2F8ND 1R4VA 3O62B 3REJD 5GT0B 5BO0B 5CPIA 5B24D 4JJNB 3AZID 4M6BA 1P3KB 1M1AA 5AV8C 4XZQD 4R8PC 2RIQA 4Z5TB 3A6NA 5CPKB 1M19B 1KX3B 5B2JB 1ZLAB 3B6GB 3AZNB 3WTPE 2PYOD 2ZY2A 5GT0C 3W97C 3NQUA 2W8SA 3AZGB 3REKB 2PYOC 5B1MB 2HIOB 3C1BB 5AV9A 2BYMB 1P3FA 1EQZB 3AZEA 3MNNC 1BH8A 5GSUD 4J8UA 5B2JC 3MGPA 1ZLAC 5F99A 4ZUXC 4Z66A 5B31A 5F99D 4KGCB 3H0LC 1KX4C 4H9PB 3REHC 3AZED 1P3LD 3AN2B 3REIB 1A7WA 1HQ3D 4E44A 5G49A 1P3GC 2NQBA 5B33D 5AVBD 5B0ZC 1KU5A 1U35A 1HQ3C 3A6ND 1M18C 1F66C 4KUDB 5GXQC 3W99C 3AFAB 3LELC 5B2ID 1TZYD 5CPID 5B31B 4KGCA 3LELA 5AV6C 3TU4D 4H9PA 2UWXA 1M18A 5AY8B 3KWQD 4G91B 1U35B 3LZ1D 5AV5B 3W99D 4DRBA 2Y2OA 4WU8C 4X23C 3VH5A 3AV1D 5AV8B 3WAAD 5DNMD 2FFFB 4UPKA 4Z2MH 2Y2MA 3MGSB 3B6FC 1P3KA 4ZUXD 4Z66C 5B2JA 3MGPC 5JRGA 1ZLAA 3REKA 3MNNA 5JA4B 3REJC 5AV9B 4YS3B 1BH9A 3B6GA 4Z66B 3W97A 2YFVB 3TU4A 3A1IA 3B0DB 5B0YB 3WA9C 2Y2PA 1P3BB 4EO5C 1KX4D 3W97D 4R8PA 1KX3C 1M1AC 4WNNA 5CPJB 2DF4C 4G92B 3MGSD 4H9QA 3AZMA 3AZKA 5AV6D 4H9RA 5BNXB 3MVDB 5AV8D 3UT9D 5JA4A 5DNNA 4YM6B 4UUZA 3VH5T 2AROC 4YS3A 4J8WB 3AV2A 2CWEA 4Z5TC 4R8PB 3P5JB 4XUJA 3X1UB 3LZ1B 3X1VD 5CPJC 1M19C 5B32A 3W96A 5B40C 5AV6B 1P3IA 1KX5D 5BS7C 3UTBA 1P3OB 2NZDC 5DNMC 3AZFD 5CPJD 3MGQA 1JFIB 2Y2JA 5B32G 5B31D 3LJAC 1KX4B 3MGRD 3AFAD 1ID3A 3MGPD 4WU9A 3AZLC 5GSUA 4HGAC 2IO5B 5AVCA 3X1SB 1M1AB 2YFWB 3RELA 1EQZC 2F8NK 1AOIB 2VQRA 4J8VA 2Y2HA 4H9OA 2JCHA 5B2IA 3REHB 3AZHA 1HQ3B 2CV5A 1P3AB 1P3MC 1P3LB 1S32A 4ZUXB 3AYWC 3LZ1C 2CV5D 5F99B 4H9SA 2RVQD 4H9SC 3X1TD 3B0BA 3AYWA 2Y2GA 5B2IC 1JFIA 2F8NA 3WAAB 5AV5C 2FJ7C 1HTAA 1P3MA 3UTAA 5B1MD 1EQZA 5G49B 3RELC 3AZGD 4CSRA 1N1JB 4J8VC 3F6TA 3WKJA 3MGQD 3WTPD 2Y2LA 3FDDA 1KX5C 5CPKD 1ID3C 5AVCC 1P3BA 1P3ID 3W96D 5CPIB 3MGQC 2F8NH 3KFUG 3AZLA 1P3AA 5DNNB 3A6NB 4KUDD 3UT9C 3O62A 5GT0D 3REJB 3MVDA 4WU9D 3C1CD 2NZDA 3AFAA 3UTBC 5BS7A 4YS3C 2AROA 4H9NA 2XD5A 1P34B 5B40A 5B32C 4WNNB 5CPJA 4DRAA 4XUJC 2JE5A 4Z5TA 1M19A 3AZJB 1P34D 3AN2D 3C1CB 4WU9B 3AZEB 1KX3A 3X1SC 5DNND 1AOIC 5GSUB 3TU4C 1P3IB 3NQUB 2F8NG 3AZMD 5B24C 3AZIC 3WA9A 3MGQB 3KUYD 3REKD 5JRGD 3X1UC 3VH6A 1BFMA 3KUYB 5GXQD 3AZND 5CHLB 3B6GD 2Y2IA 4Z5TD 1M19D 1P3KC 5BNXA 3X1TB 2FJ7B 5B24B 3AZIB 2HUEB 3A1KA 1F1EA 3O62D 2F8NB 2NQBB 5AY8A 4E45A 1P3AD 3KXBA 3AZJD 3W98A 5CP6D 2ZY3A 4WU8A 3EPLA 3LJAB 3WTPC 2RVQC 1F66B 3WKJD 4QLCB 5KDMA 3X1SD 1Q9CA 4KGCC 1P3OA 5FUGA 3W99A 1P3MD 3MGRB 3EG5B 3AZLB 3W96B 1U35C 3AZFB 3WTPB 3VH6T 1F66A 5C3IB 1P3GA 1HQ3A 1KX5B 3X1UD 2XD1A 1TZYC 3W98C 3KXBC 2NQBC 4J8UB 3REHA 3UT9B 3AZHB 5AVBA 5B33A 4Z2MG 3MVDD 2LY8A 3C1BC 3KSYA 5B0YA 4NE5A 4KHAA 5BNVA 2CV5B 4G91C 1P3BD 5B0YD 5AV9C 1BH9B 3AZKB 4J8UC 4J8VB 1H3OA 4WZSB 3V9RB 3EPJA 3REHD 3AZEC 4Z66D 1PZRA 3R45A 2BYKB 2PYOA 3B6FD 2F2AC 4XZQA 2ZY4A 1AOID 5C3IC 3UTBD 3EPHA 2BG1A 1M1AD 3UTAD 5AV9D 5B24A 3AZIA 2BYMA 2ZM5A 4J8XC 3X1VA 3AYWD 4UUZB 3MGPB 5AV8A 2L5AA 1P3OD 3AZJC 5DNMB 5B32B 3X1VB 4R8PD 5GT3B 2BYKA 1P3FB 3B0CT 4J8WD 5B40B 5B1MC 4YM6D 1H3OB 3KUYC 5FUGB 3AFAC 3W99B 3AZJA 3W98D 4J8WC 3O62C 5AY8D 5AVCD 2ZY5A 2HUEC 5B1LA 5GT3A 3W97B 3X1VC 3NQJA 4J8XA 4WU8D 3WKJC 3AZNC 5CP6A 4XZQC 5B31G 3KXBD 4XUJD 1ULYA 3VH6W 4YS3D 2Y2KA 3UTAC 2FJ7A 1B6WA 3WAAA 3AV1A 3WA9D 2JSSA 3MGSA 3AN2C 2HIOC 2IO5C 3LZ1A 3B0DC 5B0YC 3WA9B 3C1BA 3KWQA 5AVBC 5B0ZD 5B33C 2J8PA 4YM6A 3AZHC 2G5IC 3AV1B 1TZYA 3C1BD 4QLCA 2HIOD 3KXBB 2Y2NA 4CAYB 3LZ0B 2Y2QA 5AV5D 4WU8B 4X23B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U35 D;  1P3P A;  3KWQ B;  3C1C A;  3R45 B;  2NZD D;  3AZF C;  4LD9 B;  5GSU C;  3TU4 B;  5B2J D;  1ZLA D;  5BO0 A;  1KX3 D;  4KUD A;  4LD9 D;  3LJA A;  3MGR C;  1P3O C;  1TZY B;  5B2I B;  5AVC B;  1P3K D;  2NZD B;  5KDM B;  1P34 A;  4X23 D;  3W98 B;  1P3L A;  3WTP A;  3LZ0 D;  3REI C;  5B40 D;  5E5A B;  4J8X D;  4H9O B;  5GT3 D;  4LD9 C;  5B33 B;  5AVB B;  1WWS A;  4JJN A;  3AZG A;  5AY8 C;  5B0Z B;  1TAF A;  1N1J A;  3AZK C;  5B1L B;  3AZM C;  3LZ0 C;  3REI D;  4NE3 A;  4EO5 B;  1BH8 B;  5CPK A;  3X1T A;  4KGC D;  5E5A C;  3UTA B;  3UTB B;  1S32 D;  1EQZ D;  1TAF B;  3B6F B;  4XUJ B;  3X1U A;  3B6G C;  2ARO B;  4H9N B;  4J8V D;  3REJ A;  5E5A A;  3REK C;  2PYO B;  5JRG C;  3X1T C;  1AOI A;  4XZQ B;  3B6F A;  1B67 A;  3X1S A;  4JJN D;  5CPK C;  1ID3 D;  3AZH D;  4G92 C;  4J8U D;  3LZ0 A;  2YFV A;  4JJN C;  4WV4 B;  1P3F D;  4X23 A;  5B32 D;  3REL D;  3REI A;  3AZG C;  4LD9 A;  1P34 C;  3MVD C;  4AWL C;  3B0C W;  3MGR A;  3UT9 A;  1P3G B;  1P3L C;  1P3A C;  1P3M B;  5AV6 A;  3LEL B;  4CAY A;  3AZF A;  3C1C C;  3AYW B;  4NFT A;  1P3B C;  4CSR B;  1M18 B;  4KUD C;  1P3P C;  4H9R B;  4QLC D;  5GXQ A;  1KX5 A;  1P3G D;  5BT1 C;  1F66 D;  3WKJ B;  3AV2 D;  3LJA D;  4AWL B;  5B0Z A;  5CP6 B;  5BT1 D;  4KHA B;  4NE6 A;  5BNV B;  4HGA B;  2YFW A;  4YM6 C;  3REL B;  1P3P D;  4QLC C;  3AZK D;  5AV5 A;  3KWQ C;  2HIO A;  3MNN D;  1KX4 A;  1ID3 B;  2FJ7 D;  5B31 C;  3AV1 C;  4ZBJ C;  4ZUX A;  5F99 C;  3MNN B;  3MGS C;  3AN2 A;  1S32 C;  5GXQ B;  2CV5 C;  1P3F C;  3WAA C;  1P3P B;  5JRG B;  2ARO D;  5GT0 A;  3AV2 B;  1S32 B;  5CP6 C;  4H9Q B;  5B1L C;  3AZM B;  4ZBJ B;  3AZN A;  3AZL D;  3A6N C;  4WU9 C;  1WWI A;  1M18 D;  5GT3 C;  5CPI C;  3LEL D;  4J8W A;  5DNM A;  3KUY A;  5B1L D;  3VH5 W;  3NQJ B;  1P3I C;  3W96 C;  3AV2 C;  3V9R A;  5B1M A;  5DNN C;  2NQB D;  5E5A D;  4J8X B;  2F8N D;  3O62 B;  1R4V A;  3REJ D;  5GT0 B;  5BO0 B;  5CPI A;  5B24 D;  4JJN B;  3AZI D;  4M6B A;  1P3K B;  1M1A A;  5AV8 C;  4XZQ D;  4R8P C;  4Z5T B;  3A6N A;  5CPK B;  1M19 B;  1KX3 B;  3B6G B;  5B2J B;  1ZLA B;  3AZN B;  3WTP E;  2PYO D;  5GT0 C;  3W97 C;  3NQU A;  3AZG B;  3REK B;  2PYO C;  5B1M B;  2HIO B;  3C1B B;  5AV9 A;  2BYM B;  1P3F A;  1EQZ B;  3AZE A;  3MNN C;  1BH8 A;  5GSU D;  4J8U A;  5B2J C;  3MGP A;  1ZLA C;  5F99 A;  4ZUX C;  4Z66 A;  5B31 A;  5F99 D;  4KGC B;  1KX4 C;  4H9P B;  3REH C;  3AZE D;  1P3L D;  3AN2 B;  3REI B;  1A7W A;  1HQ3 D;  4E44 A;  5G49 A;  1P3G C;  2NQB A;  5B33 D;  5AVB D;  5B0Z C;  1KU5 A;  1U35 A;  1HQ3 C;  3A6N D;  1M18 C;  1F66 C;  4KUD B;  5GXQ C;  3W99 C;  3AFA B;  3LEL C;  5B2I D;  1TZY D;  5CPI D;  5B31 B;  4KGC A;  3LEL A;  5AV6 C;  3TU4 D;  4H9P A;  1M18 A;  5AY8 B;  3KWQ D;  4G91 B;  1U35 B;  3LZ1 D;  5AV5 B;  3W99 D;  4DRB A;  4WU8 C;  4X23 C;  3VH5 A;  3AV1 D;  5AV8 B;  3WAA D;  5DNM D;  4Z2M H;  3MGS B;  3B6F C;  1P3K A;  4ZUX D;  4Z66 C;  5B2J A;  3MGP C;  5JRG A;  1ZLA A;  3REK A;  3MNN A;  5JA4 B;  3REJ C;  5AV9 B;  4YS3 B;  1BH9 A;  3B6G A;  4Z66 B;  3W97 A;  2YFV B;  3TU4 A;  3B0D B;  5B0Y B;  3WA9 C;  1P3B B;  4EO5 C;  1KX4 D;  3W97 D;  4R8P A;  1KX3 C;  1M1A C;  4WNN A;  5CPJ B;  4G92 B;  3MGS D;  4H9Q A;  3AZM A;  3AZK A;  5AV6 D;  4H9R A;  5BNX B;  3MVD B;  5AV8 D;  3UT9 D;  5JA4 A;  5DNN A;  4YM6 B;  4UUZ A;  3VH5 T;  2ARO C;  4YS3 A;  4J8W B;  3AV2 A;  2CWE A;  4Z5T C;  4R8P B;  3X1V D;  4XUJ A;  3X1U B;  3LZ1 B;  5CPJ C;  1M19 C;  1KX5 D;  5B32 A;  3W96 A;  5B40 C;  5AV6 B;  1P3I A;  5BS7 C;  3UTB A;  1P3O B;  2NZD C;  5DNM C;  3AZF D;  5CPJ D;  3MGQ A;  1JFI B;  5B32 G;  5B31 D;  3LJA C;  1KX4 B;  3MGR D;  3AFA D;  1ID3 A;  3MGP D;  4WU9 A;  3AZL C;  5GSU A;  4HGA C;  2IO5 B;  5AVC A;  3X1S B;  1M1A B;  2YFW B;  3REL A;  1EQZ C;  2F8N K;  1AOI B;  4J8V A;  4H9O A;  5B2I A;  3REH B;  3AZH A;  1HQ3 B;  2CV5 A;  1P3A B;  1P3M C;  1P3L B;  1S32 A;  4ZUX B;  3AYW C;  3LZ1 C;  2CV5 D;  5F99 B;  4H9S A;  2RVQ D;  4H9S C;  3X1T D;  3B0B A;  3AYW A;  2F8N A;  5B2I C;  1JFI A;  3WAA B;  5AV5 C;  2FJ7 C;  1HTA A;  1P3M A;  3UTA A;  5B1M D;  1EQZ A;  5G49 B;  3REL C;  3AZG D;  4CSR A;  1N1J B;  4J8V C;  3WKJ A;  3MGQ D;  3WTP D;  1KX5 C;  5CPK D;  1ID3 C;  5AVC C;  1P3B A;  1P3I D;  3W96 D;  5CPI B;  3MGQ C;  2F8N H;  3AZL A;  1P3A A;  5DNN B;  3A6N B;  4KUD D;  3UT9 C;  3O62 A;  5GT0 D;  3REJ B;  3MVD A;  4WU9 D;  3C1C D;  2NZD A;  3AFA A;  3UTB C;  5BS7 A;  4YS3 C;  4H9N A;  2ARO A;  1P34 B;  5B40 A;  5B32 C;  4WNN B;  5CPJ A;  4DRA A;  4XUJ C;  4Z5T A;  1M19 A;  3AZJ B;  1P34 D;  3AN2 D;  3C1C B;  4WU9 B;  3AZE B;  1KX3 A;  3X1S C;  5DNN D;  1AOI C;  5GSU B;  3TU4 C;  1P3I B;  3NQU B;  2F8N G;  3AZM D;  5B24 C;  3AZI C;  3WA9 A;  3MGQ B;  3KUY D;  3REK D;  5JRG D;  3X1U C;  3VH6 A;  1BFM A;  3KUY B;  5GXQ D;  3AZN D;  5CHL B;  3B6G D;  4Z5T D;  1M19 D;  1P3K C;  5BNX A;  3X1T B;  2FJ7 B;  5B24 B;  3AZI B;  2HUE B;  1F1E A;  3O62 D;  2F8N B;  2NQB B;  5AY8 A;  4E45 A;  1P3A D;  3KXB A;  3AZJ D;  3W98 A;  5CP6 D;  4WU8 A;  3LJA B;  3WTP C;  2RVQ C;  1F66 B;  3WKJ D;  4QLC B;  5KDM A;  3X1S D;  1Q9C A;  4KGC C;  1P3O A;  5FUG A;  3W99 A;  1P3M D;  3MGR B;  3AZL B;  3W96 B;  1U35 C;  3AZF B;  3WTP B;  3VH6 T;  1F66 A;  5C3I B;  1P3G A;  1HQ3 A;  1KX5 B;  3X1U D;  1TZY C;  3W98 C;  3KXB C;  2NQB C;  4J8U B;  3REH A;  3UT9 B;  3AZH B;  5B33 A;  5AVB A;  4Z2M G;  3MVD D;  2LY8 A;  3C1B C;  3KSY A;  5B0Y A;  4NE5 A;  4KHA A;  5BNV A;  2CV5 B;  4G91 C;  1P3B D;  5B0Y D;  5AV9 C;  1BH9 B;  3AZK B;  4J8U C;  4J8V B;  1H3O A;  4WZS B;  3V9R B;  3REH D;  3AZE C;  4Z66 D;  2PYO A;  3R45 A;  2BYK B;  3B6F D;  4XZQ A;  1AOI D;  5C3I C;  3UTB D;  1M1A D;  3UTA D;  5AV9 D;  5B24 A;  3AZI A;  2BYM A;  4J8X C;  3X1V A;  3AYW D;  4UUZ B;  3MGP B;  5AV8 A;  2L5A A;  1P3O D;  3AZJ C;  5DNM B;  5B32 B;  3X1V B;  4R8P D;  5GT3 B;  2BYK A;  1P3F B;  3B0C T;  4J8W D;  5B40 B;  5B1M C;  4YM6 D;  1H3O B;  3KUY C;  3AFA C;  5FUG B;  3W99 B;  3AZJ A;  3W98 D;  4J8W C;  3O62 C;  5AY8 D;  5AVC D;  2HUE C;  5B1L A;  5GT3 A;  3W97 B;  3X1V C;  3NQJ A;  4J8X A;  4WU8 D;  3WKJ C;  3AZN C;  5CP6 A;  4XZQ C;  5B31 G;  3KXB D;  4XUJ D;  1ULY A;  3VH6 W;  4YS3 D;  3UTA C;  2FJ7 A;  1B6W A;  3WAA A;  3AV1 A;  3WA9 D;  2JSS A;  3MGS A;  3AN2 C;  2HIO C;  2IO5 C;  3LZ1 A;  3B0D C;  5B0Y C;  3WA9 B;  3C1B A;  3KWQ A;  5AVB C;  5B0Z D;  5B33 C;  4YM6 A;  3AZH C;  3AV1 B;  1TZY A;  3C1B D;  4QLC A;  2HIO D;  3KXB B;  3LZ0 B;  4CAY B;  5AV5 D;  4WU8 B;  4X23 B; 
#chains in the Genus database with same CATH topology
 1U35 D;  1P3P A;  3KWQ B;  3C1C A;  3R45 B;  2NZD D;  3AZF C;  4LD9 B;  5GSU C;  3TU4 B;  5B2J D;  1ZLA D;  5BO0 A;  1KX3 D;  4KUD A;  4LD9 D;  3LJA A;  3MGR C;  1P3O C;  1TZY B;  5B2I B;  5AVC B;  1P3K D;  2NZD B;  5KDM B;  1P34 A;  4X23 D;  3EPK A;  3W98 B;  1P3L A;  3WTP A;  3LZ0 D;  3REI C;  5B40 D;  5E5A B;  4J8X D;  4H9O B;  5GT3 D;  4LD9 C;  5B33 B;  5AVB B;  1WWS A;  4JJN A;  3AZG A;  5AY8 C;  5B0Z B;  1TAF A;  1N1J A;  3AZK C;  5B1L B;  3IP4 C;  3LZ0 C;  3REI D;  3AZM C;  2G5H C;  4NE3 A;  4EO5 B;  1BH8 B;  5CPK A;  3X1T A;  4KGC D;  5E5A C;  3UTA B;  3UTB B;  1S32 D;  1EQZ D;  1TAF B;  3B6F B;  4XUJ B;  3X1U A;  3B6G C;  2ARO B;  4H9N B;  3H0R C;  4J8V D;  3REJ A;  5E5A A;  3REK C;  2PYO B;  5JRG C;  3X1T C;  1W2E A;  1AOI A;  4WJ3 C;  4XZQ B;  3B6F A;  1B67 A;  3X1S A;  4JJN D;  3H0M C;  5CPK C;  1ID3 D;  3AZH D;  4G92 C;  4J8U D;  3LZ0 A;  2YFV A;  4JJN C;  4WV4 B;  1P3F D;  4X23 A;  5B32 D;  3REL D;  3REI A;  3AZG C;  4LD9 A;  1P34 C;  3MVD C;  3AL0 C;  4AWL C;  3B0C W;  3MGR A;  3UT9 A;  1P3G B;  1P3L C;  1P3A C;  1P3M B;  5AV6 A;  3LEL B;  4CAY A;  3AZF A;  3C1C C;  3AYW B;  4NFT A;  1P3B C;  4CSR B;  1M18 B;  4KUD C;  1P3P C;  4H9R B;  4QLC D;  5GXQ A;  1KX5 A;  1P3G D;  5BT1 C;  1F66 D;  3WKJ B;  3AV2 D;  3LJA D;  4AWL B;  5B0Z A;  5CP6 B;  5BT1 D;  2DQN C;  4KHA B;  4NE6 A;  5BNV B;  4HGA B;  2YFW A;  4YM6 C;  3REL B;  1P3P D;  4QLC C;  3AZK D;  5AV5 A;  3KWQ C;  2HIO A;  3MNN D;  1KX4 A;  1ID3 B;  2FJ7 D;  5B31 C;  1Z2C B;  3AV1 C;  4ZBJ C;  4ZUX A;  5F99 C;  3MNN B;  3MGS C;  3AN2 A;  1S32 C;  5GXQ B;  2CV5 C;  1P3F C;  3WAA C;  1P3P B;  5JRG B;  2ARO D;  5GT0 A;  3AV2 B;  1S32 B;  5CP6 C;  4H9Q B;  5B1L C;  3AZM B;  1T3U A;  4ZBJ B;  3AZN A;  3AZL D;  3A6N C;  4WU9 C;  1WWI A;  1M18 D;  5GT3 C;  4DQY B;  5CPI C;  3LEL D;  4J8W A;  5DNM A;  3KUY A;  5B1L D;  3VH5 W;  3NQJ B;  1P3I C;  3W96 C;  3AV2 C;  3V9R A;  5B1M A;  5DNN C;  2NQB D;  5E5A D;  4J8X B;  2F8N D;  1R4V A;  3O62 B;  3REJ D;  5GT0 B;  5BO0 B;  5CPI A;  5B24 D;  4JJN B;  3AZI D;  4M6B A;  1P3K B;  1M1A A;  5AV8 C;  4XZQ D;  4R8P C;  2RIQ A;  4Z5T B;  3A6N A;  5CPK B;  1M19 B;  1KX3 B;  5B2J B;  1ZLA B;  3B6G B;  3AZN B;  3WTP E;  2PYO D;  2ZY2 A;  5GT0 C;  3W97 C;  3NQU A;  2W8S A;  3AZG B;  3REK B;  2PYO C;  5B1M B;  2HIO B;  3C1B B;  5AV9 A;  2BYM B;  1P3F A;  1EQZ B;  3AZE A;  3MNN C;  1BH8 A;  5GSU D;  4J8U A;  5B2J C;  3MGP A;  1ZLA C;  5F99 A;  4ZUX C;  4Z66 A;  5B31 A;  5F99 D;  4KGC B;  3H0L C;  1KX4 C;  4H9P B;  3REH C;  3AZE D;  1P3L D;  3AN2 B;  3REI B;  1A7W A;  1HQ3 D;  4E44 A;  5G49 A;  1P3G C;  2NQB A;  5B33 D;  5AVB D;  5B0Z C;  1KU5 A;  1U35 A;  1HQ3 C;  3A6N D;  1M18 C;  1F66 C;  4KUD B;  5GXQ C;  3W99 C;  3AFA B;  3LEL C;  5B2I D;  1TZY D;  5CPI D;  5B31 B;  4KGC A;  3LEL A;  5AV6 C;  3TU4 D;  4H9P A;  2UWX A;  1M18 A;  5AY8 B;  3KWQ D;  4G91 B;  1U35 B;  3LZ1 D;  5AV5 B;  3W99 D;  4DRB A;  2Y2O A;  4WU8 C;  4X23 C;  3VH5 A;  3AV1 D;  5AV8 B;  3WAA D;  5DNM D;  2FFF B;  4UPK A;  4Z2M H;  2Y2M A;  3MGS B;  3B6F C;  1P3K A;  4ZUX D;  4Z66 C;  5B2J A;  3MGP C;  5JRG A;  1ZLA A;  3REK A;  3MNN A;  5JA4 B;  3REJ C;  5AV9 B;  4YS3 B;  1BH9 A;  3B6G A;  4Z66 B;  3W97 A;  2YFV B;  3TU4 A;  3A1I A;  3B0D B;  5B0Y B;  3WA9 C;  2Y2P A;  1P3B B;  4EO5 C;  1KX4 D;  3W97 D;  4R8P A;  1KX3 C;  1M1A C;  4WNN A;  5CPJ B;  2DF4 C;  4G92 B;  3MGS D;  4H9Q A;  3AZM A;  3AZK A;  5AV6 D;  4H9R A;  5BNX B;  3MVD B;  5AV8 D;  3UT9 D;  5JA4 A;  5DNN A;  4YM6 B;  4UUZ A;  3VH5 T;  2ARO C;  4YS3 A;  4J8W B;  3AV2 A;  2CWE A;  4Z5T C;  4R8P B;  3P5J B;  4XUJ A;  3X1U B;  3LZ1 B;  3X1V D;  5CPJ C;  1M19 C;  5B32 A;  3W96 A;  5B40 C;  5AV6 B;  1P3I A;  1KX5 D;  5BS7 C;  3UTB A;  1P3O B;  2NZD C;  5DNM C;  3AZF D;  5CPJ D;  3MGQ A;  1JFI B;  2Y2J A;  5B32 G;  5B31 D;  3LJA C;  1KX4 B;  3MGR D;  3AFA D;  1ID3 A;  3MGP D;  4WU9 A;  3AZL C;  5GSU A;  4HGA C;  2IO5 B;  5AVC A;  3X1S B;  1M1A B;  2YFW B;  3REL A;  1EQZ C;  2F8N K;  1AOI B;  2VQR A;  4J8V A;  2Y2H A;  4H9O A;  2JCH A;  5B2I A;  3REH B;  3AZH A;  1HQ3 B;  2CV5 A;  1P3A B;  1P3M C;  1P3L B;  1S32 A;  4ZUX B;  3AYW C;  3LZ1 C;  2CV5 D;  5F99 B;  4H9S A;  2RVQ D;  4H9S C;  3X1T D;  3B0B A;  3AYW A;  2Y2G A;  5B2I C;  1JFI A;  2F8N A;  3WAA B;  5AV5 C;  2FJ7 C;  1HTA A;  1P3M A;  3UTA A;  5B1M D;  1EQZ A;  5G49 B;  3REL C;  3AZG D;  4CSR A;  1N1J B;  4J8V C;  3F6T A;  3WKJ A;  3MGQ D;  3WTP D;  2Y2L A;  3FDD A;  1KX5 C;  5CPK D;  1ID3 C;  5AVC C;  1P3B A;  1P3I D;  3W96 D;  5CPI B;  3MGQ C;  2F8N H;  3KFU G;  3AZL A;  1P3A A;  5DNN B;  3A6N B;  4KUD D;  3UT9 C;  3O62 A;  5GT0 D;  3REJ B;  3MVD A;  4WU9 D;  3C1C D;  2NZD A;  3AFA A;  3UTB C;  5BS7 A;  4YS3 C;  2ARO A;  4H9N A;  2XD5 A;  1P34 B;  5B40 A;  5B32 C;  4WNN B;  5CPJ A;  4DRA A;  4XUJ C;  2JE5 A;  4Z5T A;  1M19 A;  3AZJ B;  1P34 D;  3AN2 D;  3C1C B;  4WU9 B;  3AZE B;  1KX3 A;  3X1S C;  5DNN D;  1AOI C;  5GSU B;  3TU4 C;  1P3I B;  3NQU B;  2F8N G;  3AZM D;  5B24 C;  3AZI C;  3WA9 A;  3MGQ B;  3KUY D;  3REK D;  5JRG D;  3X1U C;  3VH6 A;  1BFM A;  3KUY B;  5GXQ D;  3AZN D;  5CHL B;  3B6G D;  2Y2I A;  4Z5T D;  1M19 D;  1P3K C;  5BNX A;  3X1T B;  2FJ7 B;  5B24 B;  3AZI B;  2HUE B;  3A1K A;  1F1E A;  3O62 D;  2F8N B;  2NQB B;  5AY8 A;  4E45 A;  1P3A D;  3KXB A;  3AZJ D;  3W98 A;  5CP6 D;  2ZY3 A;  4WU8 A;  3EPL A;  3LJA B;  3WTP C;  2RVQ C;  1F66 B;  3WKJ D;  4QLC B;  5KDM A;  3X1S D;  1Q9C A;  4KGC C;  1P3O A;  5FUG A;  3W99 A;  1P3M D;  3MGR B;  3EG5 B;  3AZL B;  3W96 B;  1U35 C;  3AZF B;  3WTP B;  3VH6 T;  1F66 A;  5C3I B;  1P3G A;  1HQ3 A;  1KX5 B;  3X1U D;  2XD1 A;  1TZY C;  3W98 C;  3KXB C;  2NQB C;  4J8U B;  3REH A;  3UT9 B;  3AZH B;  5AVB A;  5B33 A;  4Z2M G;  3MVD D;  2LY8 A;  3C1B C;  3KSY A;  5B0Y A;  4NE5 A;  4KHA A;  5BNV A;  2CV5 B;  4G91 C;  1P3B D;  5B0Y D;  5AV9 C;  1BH9 B;  3AZK B;  4J8U C;  4J8V B;  1H3O A;  4WZS B;  3V9R B;  3EPJ A;  3REH D;  3AZE C;  4Z66 D;  1PZR A;  3R45 A;  2BYK B;  2PYO A;  3B6F D;  2F2A C;  4XZQ A;  2ZY4 A;  1AOI D;  5C3I C;  3UTB D;  3EPH A;  2BG1 A;  1M1A D;  3UTA D;  5AV9 D;  5B24 A;  3AZI A;  2BYM A;  2ZM5 A;  4J8X C;  3X1V A;  3AYW D;  4UUZ B;  3MGP B;  5AV8 A;  2L5A A;  1P3O D;  3AZJ C;  5DNM B;  5B32 B;  3X1V B;  4R8P D;  5GT3 B;  2BYK A;  1P3F B;  3B0C T;  4J8W D;  5B40 B;  5B1M C;  4YM6 D;  1H3O B;  3KUY C;  5FUG B;  3AFA C;  3W99 B;  3AZJ A;  3W98 D;  4J8W C;  3O62 C;  5AY8 D;  5AVC D;  2ZY5 A;  2HUE C;  5B1L A;  5GT3 A;  3W97 B;  3X1V C;  3NQJ A;  4J8X A;  4WU8 D;  3WKJ C;  3AZN C;  5CP6 A;  4XZQ C;  5B31 G;  3KXB D;  4XUJ D;  1ULY A;  3VH6 W;  4YS3 D;  2Y2K A;  3UTA C;  2FJ7 A;  1B6W A;  3WAA A;  3AV1 A;  3WA9 D;  2JSS A;  3MGS A;  3AN2 C;  2HIO C;  2IO5 C;  3LZ1 A;  3B0D C;  5B0Y C;  3WA9 B;  3C1B A;  3KWQ A;  5AVB C;  5B0Z D;  5B33 C;  2J8P A;  4YM6 A;  3AZH C;  2G5I C;  3AV1 B;  1TZY A;  3C1B D;  4QLC A;  2HIO D;  3KXB B;  2Y2N A;  4CAY B;  3LZ0 B;  2Y2Q A;  5AV5 D;  4WU8 B;  4X23 B; 
#chains in the Genus database with same CATH homology
 1U35 D;  1P3P A;  3KWQ B;  3C1C A;  3R45 B;  2NZD D;  3AZF C;  4LD9 B;  5GSU C;  3TU4 B;  5B2J D;  1ZLA D;  5BO0 A;  1KX3 D;  4KUD A;  4LD9 D;  3LJA A;  3MGR C;  1P3O C;  1TZY B;  5B2I B;  5AVC B;  1P3K D;  2NZD B;  5KDM B;  1P34 A;  4X23 D;  3EPK A;  3W98 B;  1P3L A;  3WTP A;  3LZ0 D;  3REI C;  5B40 D;  5E5A B;  4J8X D;  4H9O B;  5GT3 D;  4LD9 C;  5B33 B;  5AVB B;  1WWS A;  4JJN A;  3AZG A;  5AY8 C;  5B0Z B;  1TAF A;  1N1J A;  3AZK C;  5B1L B;  3IP4 C;  3LZ0 C;  3REI D;  3AZM C;  2G5H C;  4NE3 A;  4EO5 B;  1BH8 B;  5CPK A;  3X1T A;  4KGC D;  5E5A C;  3UTA B;  3UTB B;  1S32 D;  1EQZ D;  1TAF B;  3B6F B;  4XUJ B;  3X1U A;  3B6G C;  2ARO B;  4H9N B;  3H0R C;  4J8V D;  3REJ A;  5E5A A;  3REK C;  2PYO B;  5JRG C;  3X1T C;  1W2E A;  1AOI A;  4WJ3 C;  4XZQ B;  3B6F A;  1B67 A;  3X1S A;  4JJN D;  3H0M C;  5CPK C;  1ID3 D;  3AZH D;  4G92 C;  4J8U D;  3LZ0 A;  2YFV A;  4JJN C;  4WV4 B;  1P3F D;  4X23 A;  5B32 D;  3REL D;  3REI A;  3AZG C;  4LD9 A;  1P34 C;  3MVD C;  3AL0 C;  4AWL C;  3B0C W;  3MGR A;  3UT9 A;  1P3G B;  1P3L C;  1P3A C;  1P3M B;  5AV6 A;  3LEL B;  4CAY A;  3AZF A;  3C1C C;  3AYW B;  4NFT A;  1P3B C;  4CSR B;  1M18 B;  4KUD C;  1P3P C;  4H9R B;  4QLC D;  5GXQ A;  1KX5 A;  1P3G D;  5BT1 C;  1F66 D;  3WKJ B;  3AV2 D;  3LJA D;  4AWL B;  5B0Z A;  5CP6 B;  5BT1 D;  2DQN C;  4KHA B;  4NE6 A;  5BNV B;  4HGA B;  2YFW A;  4YM6 C;  3REL B;  1P3P D;  4QLC C;  3AZK D;  5AV5 A;  3KWQ C;  2HIO A;  3MNN D;  1KX4 A;  1ID3 B;  2FJ7 D;  5B31 C;  1Z2C B;  3AV1 C;  4ZBJ C;  4ZUX A;  5F99 C;  3MNN B;  3MGS C;  3AN2 A;  1S32 C;  5GXQ B;  2CV5 C;  1P3F C;  3WAA C;  1P3P B;  5JRG B;  2ARO D;  5GT0 A;  3AV2 B;  1S32 B;  5CP6 C;  4H9Q B;  5B1L C;  3AZM B;  1T3U A;  4ZBJ B;  3AZN A;  3AZL D;  3A6N C;  4WU9 C;  1WWI A;  1M18 D;  5GT3 C;  4DQY B;  5CPI C;  3LEL D;  4J8W A;  5DNM A;  3KUY A;  5B1L D;  3VH5 W;  3NQJ B;  1P3I C;  3W96 C;  3AV2 C;  3V9R A;  5B1M A;  5DNN C;  2NQB D;  5E5A D;  4J8X B;  2F8N D;  1R4V A;  3O62 B;  3REJ D;  5GT0 B;  5BO0 B;  5CPI A;  5B24 D;  4JJN B;  3AZI D;  4M6B A;  1P3K B;  1M1A A;  5AV8 C;  4XZQ D;  4R8P C;  2RIQ A;  4Z5T B;  3A6N A;  5CPK B;  1M19 B;  1KX3 B;  5B2J B;  1ZLA B;  3B6G B;  3AZN B;  3WTP E;  2PYO D;  2ZY2 A;  5GT0 C;  3W97 C;  3NQU A;  2W8S A;  3AZG B;  3REK B;  2PYO C;  5B1M B;  2HIO B;  3C1B B;  5AV9 A;  2BYM B;  1P3F A;  1EQZ B;  3AZE A;  3MNN C;  1BH8 A;  5GSU D;  4J8U A;  5B2J C;  3MGP A;  1ZLA C;  5F99 A;  4ZUX C;  4Z66 A;  5B31 A;  5F99 D;  4KGC B;  3H0L C;  1KX4 C;  4H9P B;  3REH C;  3AZE D;  1P3L D;  3AN2 B;  3REI B;  1A7W A;  1HQ3 D;  4E44 A;  5G49 A;  1P3G C;  2NQB A;  5B33 D;  5AVB D;  5B0Z C;  1KU5 A;  1U35 A;  1HQ3 C;  3A6N D;  1M18 C;  1F66 C;  4KUD B;  5GXQ C;  3W99 C;  3AFA B;  3LEL C;  5B2I D;  1TZY D;  5CPI D;  5B31 B;  4KGC A;  3LEL A;  5AV6 C;  3TU4 D;  4H9P A;  2UWX A;  1M18 A;  5AY8 B;  3KWQ D;  4G91 B;  1U35 B;  3LZ1 D;  5AV5 B;  3W99 D;  4DRB A;  2Y2O A;  4WU8 C;  4X23 C;  3VH5 A;  3AV1 D;  5AV8 B;  3WAA D;  5DNM D;  2FFF B;  4UPK A;  4Z2M H;  2Y2M A;  3MGS B;  3B6F C;  1P3K A;  4ZUX D;  4Z66 C;  5B2J A;  3MGP C;  5JRG A;  1ZLA A;  3REK A;  3MNN A;  5JA4 B;  3REJ C;  5AV9 B;  4YS3 B;  1BH9 A;  3B6G A;  4Z66 B;  3W97 A;  2YFV B;  3TU4 A;  3A1I A;  3B0D B;  5B0Y B;  3WA9 C;  2Y2P A;  1P3B B;  4EO5 C;  1KX4 D;  3W97 D;  4R8P A;  1KX3 C;  1M1A C;  4WNN A;  5CPJ B;  2DF4 C;  4G92 B;  3MGS D;  4H9Q A;  3AZM A;  3AZK A;  5AV6 D;  4H9R A;  5BNX B;  3MVD B;  5AV8 D;  3UT9 D;  5JA4 A;  5DNN A;  4YM6 B;  4UUZ A;  3VH5 T;  2ARO C;  4YS3 A;  4J8W B;  3AV2 A;  2CWE A;  4Z5T C;  4R8P B;  3P5J B;  4XUJ A;  3X1U B;  3LZ1 B;  3X1V D;  5CPJ C;  1M19 C;  5B32 A;  3W96 A;  5B40 C;  5AV6 B;  1P3I A;  1KX5 D;  5BS7 C;  3UTB A;  1P3O B;  2NZD C;  5DNM C;  3AZF D;  5CPJ D;  3MGQ A;  1JFI B;  2Y2J A;  5B32 G;  5B31 D;  3LJA C;  1KX4 B;  3MGR D;  3AFA D;  1ID3 A;  3MGP D;  4WU9 A;  3AZL C;  5GSU A;  4HGA C;  2IO5 B;  5AVC A;  3X1S B;  1M1A B;  2YFW B;  3REL A;  1EQZ C;  2F8N K;  1AOI B;  2VQR A;  4J8V A;  2Y2H A;  4H9O A;  2JCH A;  5B2I A;  3REH B;  3AZH A;  1HQ3 B;  2CV5 A;  1P3A B;  1P3M C;  1P3L B;  1S32 A;  4ZUX B;  3AYW C;  3LZ1 C;  2CV5 D;  5F99 B;  4H9S A;  2RVQ D;  4H9S C;  3X1T D;  3B0B A;  3AYW A;  2Y2G A;  5B2I C;  1JFI A;  2F8N A;  3WAA B;  5AV5 C;  2FJ7 C;  1HTA A;  1P3M A;  3UTA A;  5B1M D;  1EQZ A;  5G49 B;  3REL C;  3AZG D;  4CSR A;  1N1J B;  4J8V C;  3F6T A;  3WKJ A;  3MGQ D;  3WTP D;  2Y2L A;  3FDD A;  1KX5 C;  5CPK D;  1ID3 C;  5AVC C;  1P3B A;  1P3I D;  3W96 D;  5CPI B;  3MGQ C;  2F8N H;  3KFU G;  3AZL A;  1P3A A;  5DNN B;  3A6N B;  4KUD D;  3UT9 C;  3O62 A;  5GT0 D;  3REJ B;  3MVD A;  4WU9 D;  3C1C D;  2NZD A;  3AFA A;  3UTB C;  5BS7 A;  4YS3 C;  2ARO A;  4H9N A;  2XD5 A;  1P34 B;  5B40 A;  5B32 C;  4WNN B;  5CPJ A;  4DRA A;  4XUJ C;  2JE5 A;  4Z5T A;  1M19 A;  3AZJ B;  1P34 D;  3AN2 D;  3C1C B;  4WU9 B;  3AZE B;  1KX3 A;  3X1S C;  5DNN D;  1AOI C;  5GSU B;  3TU4 C;  1P3I B;  3NQU B;  2F8N G;  3AZM D;  5B24 C;  3AZI C;  3WA9 A;  3MGQ B;  3KUY D;  3REK D;  5JRG D;  3X1U C;  3VH6 A;  1BFM A;  3KUY B;  5GXQ D;  3AZN D;  5CHL B;  3B6G D;  2Y2I A;  4Z5T D;  1M19 D;  1P3K C;  5BNX A;  3X1T B;  2FJ7 B;  5B24 B;  3AZI B;  2HUE B;  3A1K A;  1F1E A;  3O62 D;  2F8N B;  2NQB B;  5AY8 A;  4E45 A;  1P3A D;  3KXB A;  3AZJ D;  3W98 A;  5CP6 D;  2ZY3 A;  4WU8 A;  3EPL A;  3LJA B;  3WTP C;  2RVQ C;  1F66 B;  3WKJ D;  4QLC B;  5KDM A;  3X1S D;  1Q9C A;  4KGC C;  1P3O A;  5FUG A;  3W99 A;  1P3M D;  3MGR B;  3EG5 B;  3AZL B;  3W96 B;  1U35 C;  3AZF B;  3WTP B;  3VH6 T;  1F66 A;  5C3I B;  1P3G A;  1HQ3 A;  1KX5 B;  3X1U D;  2XD1 A;  1TZY C;  3W98 C;  3KXB C;  2NQB C;  4J8U B;  3REH A;  3UT9 B;  3AZH B;  5AVB A;  5B33 A;  4Z2M G;  3MVD D;  2LY8 A;  3C1B C;  3KSY A;  5B0Y A;  4NE5 A;  4KHA A;  5BNV A;  2CV5 B;  4G91 C;  1P3B D;  5B0Y D;  5AV9 C;  1BH9 B;  3AZK B;  4J8U C;  4J8V B;  1H3O A;  4WZS B;  3V9R B;  3EPJ A;  3REH D;  3AZE C;  4Z66 D;  1PZR A;  3R45 A;  2BYK B;  2PYO A;  3B6F D;  2F2A C;  4XZQ A;  2ZY4 A;  1AOI D;  5C3I C;  3UTB D;  3EPH A;  2BG1 A;  1M1A D;  3UTA D;  5AV9 D;  5B24 A;  3AZI A;  2BYM A;  2ZM5 A;  4J8X C;  3X1V A;  3AYW D;  4UUZ B;  3MGP B;  5AV8 A;  2L5A A;  1P3O D;  3AZJ C;  5DNM B;  5B32 B;  3X1V B;  4R8P D;  5GT3 B;  2BYK A;  1P3F B;  3B0C T;  4J8W D;  5B40 B;  5B1M C;  4YM6 D;  1H3O B;  3KUY C;  5FUG B;  3AFA C;  3W99 B;  3AZJ A;  3W98 D;  4J8W C;  3O62 C;  5AY8 D;  5AVC D;  2ZY5 A;  2HUE C;  5B1L A;  5GT3 A;  3W97 B;  3X1V C;  3NQJ A;  4J8X A;  4WU8 D;  3WKJ C;  3AZN C;  5CP6 A;  4XZQ C;  5B31 G;  3KXB D;  4XUJ D;  1ULY A;  3VH6 W;  4YS3 D;  2Y2K A;  3UTA C;  2FJ7 A;  1B6W A;  3WAA A;  3AV1 A;  3WA9 D;  2JSS A;  3MGS A;  3AN2 C;  2HIO C;  2IO5 C;  3LZ1 A;  3B0D C;  5B0Y C;  3WA9 B;  3C1B A;  3KWQ A;  5AVB C;  5B0Z D;  5B33 C;  2J8P A;  4YM6 A;  3AZH C;  2G5I C;  3AV1 B;  1TZY A;  3C1B D;  4QLC A;  2HIO D;  3KXB B;  2Y2N A;  4CAY B;  3LZ0 B;  2Y2Q A;  5AV5 D;  4WU8 B;  4X23 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...