3LELA

Structural insight into the sequence-dependence of nucleosome positioning
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural insight into the sequence dependence of nucleosome positioning
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 33
structure length 98
sequence length 98
chains with identical sequence E, K, O
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3lelA00
5AV6D 3MNNB 3WKJA 2JSSA 4WU8B 3W96A 4AWLC 5B32A 1M18C 3WA9D 2NZDA 1EQZD 3MGPA 3MGQD 5GXQA 3MNNA 5BNVB 5DNMB 4DRBA 3REKC 5C3IB 5E5AC 3X1TC 3AZKD 4JJNC 3AFAD 5DNMA 1N1JB 4XUJA 3MGRC 5AV5D 1N1JA 3UTAD 4J8WB 1KX3B 1BH9B 3O62D 1HQ3D 3W98C 1BH9A 3RELB 2HIOB 1P3MA 1BH8A 5BS7A 4WU9B 1H3OA 4KUDA 1P3GA 1ZLAB 3WTPC 4XZQA 5AVBD 5B0ZC 2BYKB 3X1SB 2HIOA 3RELA 5BO0A 4WU9A 5B32G 1M1AC 3REHA 3AZFD 4H9NB 3AZLB 1KX4B 1P3OB 5B2IC 4J8UB 4H9NA 5B1MB 1KX4A 4X23D 4CSRB 3C1CB 1P3OA 1ULYA 5AV6A 4Z5TC 1P34C 5DNNC 2RVQD 2YFWB 3B6FC 3KXBC 1EQZA 1P3AB 4QLCC 3X1VC 2YFWA 3AFAA 4WV4B 1P3AA 1P3LD 4ZUXC 3TU4D 5AV5A 3UTAA 5B33B 3B0CW 3NQUA 5AV6C 1P3ID 3O62A 5B31C 5CPIB 1HQ3A 3WA9C 5B33A 3KWQC 2AROB 3A6NB 3MGQC 3AZJB 5GT3B 5CPIA 4KGCD 4NFTA 3AZKC 3WAAD 3AZJA 5GT3A 3AZMB 3X1UB 3AZFA 1P3BC 5KDMA 3AZMA 3X1UA 5B2JD 2NQBD 5AVCD 1P3PC 2CWEA 1S32C 1U35B 3AZGB 3AZHC 1WWIA 4YM6B 3V9RB 5AVBC 1U35A 5CP6C 1F66C 1P3KB 3AZED 2PYOC 3AV2A 1P3FD 3KUYB 1P3KA 5CPKD 3NQJB 3AYWB 4X23C 4WNNA 5AV8B 3KUYA 3REIB 3LELC 1P3IA 4LD9B 2NZDD 4ZBJB 4H9QB 5B24B 3MNND 3AZIB 3AZNB 4WU8D 4J8XA 1B6WA 3AV1B 5DNMD 4KGCA 4H9SA 3AZIA 1AOIB 3MGSB 3WAAA 3B6GB 3AV1A 1P3LC 5B0YC 5F99B 3TU4C 3AN2C 5F99A 4Z2MG 5B2JA 4J8WD 3UT9C 1KX3D 2NQBA 3VH5A 5AVCA 4G91B 2YFVA 3RELD 2HIOD 4WU9D 1ZLAD 3X1SD 2LY8A 4Z66B 4YS3B 4CAYB 4R8PB 3C1BB 3AZLD 1KX4D 5AV9C 3REJC 1P3FA 1KX5C 4HGAC 5CPKA 5B40B 5AVCC 1P3OD 1TZYC 4R8PA 3C1BA 5B1LB 4J8UD 5B1MD 5GSUB 5B40A 3C1CD 2FJ7C 5B1LA 4G92C 5GSUA 4WU8A 1HTAA 5E5AB 3AZEC 5BNVA 1P3AD 5BT1C 2F8NB 1P3FC 1M19C 3W99C 4UUZB 1R4VA 3WKJC 2F8NA 3W96C 3VH6A 5BNXB 5B32C 5B33D 2NZDC 4J8WA 3MGPC 1KX3A 5GXQC 1B67A 3MNNC 5CPID 3B0DC 5CHLB 2AROD 3WTPB 5DNMC 3A6ND 5B0ZB 5GT3D 3VH5T 3AZJD 4XUJC 1ZLAA 1M1AB 2BYKA 3X1SA 3AZMD 3X1UD 2BYMB 4H9RB 3AZLA 5B2IB 3MVDB 1P3MC 4KUDC 5BS7C 4J8UA 1P3GC 5B1MA 1ID3B 3MVDA 4XZQC 4Z5TB 3WTPE 4CSRA 5DNNB 3C1CA 3RELC 2HIOC 3AZGD 4WU9C 1U35D 2F8NG 3B6FB 3LZ0B 1ID3A 4YM6D 3REHC 4QLCB 4DRAA 3X1VB 3LZ0A 3AV2D 1P3KD 1KX4C 3LZ1B 3LJAB 1KU5A 4ZUXB 3KUYD 1P3OC 3AYWD 4M6BA 3LZ1A 3LJAA 5B31B 5AV8D 3REID 4J8XD 1EQZC 3KWQB 4LD9D 3UTBB 3VH6T 5B24D 3AZID 2AROA 3A6NA 3AFAC 3AV1D 1P3AC 3UTBA 1AOID 5JA4B 3MGSD 5AV5C 3B6GD 3UTAC 1P3BB 5JA4A 5F99D 3O62C 1HQ3C 4E45A 5B33C 1P3PB 1S32B 5CPIC 4Z2MH 3AZHB 3AZJC 5GT3C 3AZGA 5CP6B 1F66B 4YM6A 3V9RA 3W97B 3AZFC 2PYOB 3AZMC 3X1UC 4J8VB 3W97A 4Z66D 2IO5C 5JRGB 4YS3D 4H9PB 4R8PD 3C1BD 4J8VA 5GT0B 5B40D 5JRGA 3NQJA 4H9PA 3AYWA 5B1LD 3LELB 5GSUD 2RVQC 4NE3A 5AV8A 1U35C 3REIA 5GT0A 4LD9A 4H9QA 5B24A 5AY8B 3AZNA 2L5AA 3AV2C 5E5AD 1P3KC 1AOIA 5AY8A 5B0YB 3MGSA 3B6GA 3TU4B 3AN2B 3KUYC 2F8ND 5CPJB 1P3IC 2HUEB 3UT9B 4J8XC 4NE6A 5CPJA 3VH5W 4KHAB 4ZBJC 4KGCC 4H9SC 3AZIC 3WAAC 3AV1C 2CV5B 1JFIB 5B0ZD 1F1EA 5FUGB 1M1AD 2CV5A 5G49B 5F99C 5B2JC 5AV9B 4Z66A 4EO5B 3REJB 1KX5B 4YS3A 2NQBC 4CAYA 1TZYB 5B2ID 3MVDD 4AWLB 2FJ7B 1M18B 4G92B 1ID3D 4Z5TD 5DNND 3REKB 3X1TB 1M18A 3B6FD 3LZ0D 4JJNB 2F8NH 4QLCD 3X1VD 3REKA 5E5AA 3MGRB 4JJNA 5CPKC 1M19B 4H9OB 4R8PC 3C1BC 3W99B 3LZ1D 3LJAD 3MGRA 3WKJB 4ZUXD 3W96B 5B40C 4H9OA 4NE5A 4UUZA 5B1LC 3VH6W 5B32B 3W98B 5GSUC 3MGPB 4WU8C 5GXQB 5BNXA 5B31D 3B0DB 3W98A 3KWQD 3UTBD 5C3IC 4XUJB 3WTPA 5B0ZA 1M1AA 1P3BD 4J8WC 1KX3C 2BYMA 1P3MB 1BH8B 4H9RA 4KUDB 1H3OB 5B2IA 1P3GB 1P3PD 1S32D 1P34B 4XZQB 5BO0B 3KXBB 1ZLAC 3AZHD 4Z5TA 3REHB 5DNNA 1P34A 3X1SC 3B6FA 1A7WA 5CP6D 3KXBA 1F66D 3W97D 4QLCA 3X1VA 2PYOD 3AZLC 4J8VD 5JRGD 4J8UC 5B1MC 5AV6B 3MVDC 1BFMA 4ZUXA 3C1CC 3WA9B 5GT0D 1EQZB 3MGQB 1ID3C 3LELD 5B31A 3AZND 3WA9A 3R45B 3LZ0C 3KWQA 3AZKB 3AFAB 3MGQA 5AY8D 3R45A 3AZKA 5AV5B 1WWSA 3UTAB 5B0YD 3NQUB 3LZ1C 3LJAC 3O62B 1HQ3B 3AN2D 1P3BA 5CPJD 4WZSB 3B0BA 3UT9D 1P3PA 2AROC 3A6NC 5AVBB 1S32A 3UTBC 3AZHA 5AVBA 2CV5D 5B31G 3AZFB 5CP6A 5KDMB 1F66A 1TAFB 1Q9CA 2PYOA 2IO5B 1TAFA 2F8NK 4X23B 5AV9D 3REJD 1KX5D 1TZYD 4X23A 3AZGC 2FJ7D 1M18D 4YM6C 3LELA 3REKD 3X1TD 3AV2B 3W97C 4JJND 1P3LB 4J8VC 3MGRD 4WNNB 5BT1D 5JRGC 1M19D 3AYWC 1P3LA 5B0YA 3W99D 1P3IB 3TU4A 3AN2A 5AV8C 3WKJD 3REIC 5GT0C 3W96D 4J8XB 4LD9C 5B32D 3W98D 5B24C 3B0CT 3MGPD 3UT9A 5GXQD 3AZNC 4KGCB 4KHAA 3WAAB 3WTPD 1AOIC 5AY8C 3MGSC 3B6GC 4XUJD 1JFIA 5FUGA 4HGAB 5B2JB 4E44A 2NQBB 5G49A 5AVCB 5CPJC 5AV9A 3REJA 2HUEC 1KX5A 3KSYA 2YFVB 1TZYA 1P3MD 4KUDD 1P3GD 4G91C 4XZQD 1P34D 2FJ7A 3KXBD 3AZEB 2CV5C 3REHD 3X1TA 4Z66C 1P3FB 3AZEA 4YS3C 5CPKB 4EO5C 1M19A 3W99A 2NZDB
chains in the Genus database with same CATH superfamily
5AV6D 3MNNB 3WKJA 2JSSA 4WU8B 2DF4C 3W96A 4AWLC 5B32A 1M18C 3WA9D 2NZDA 1EQZD 3MGPA 3MGQD 5GXQA 3MNNA 5BNVB 5DNMB 4DRBA 3REKC 5C3IB 5E5AC 3X1TC 3AZKD 4JJNC 3AFAD 5DNMA 1N1JB 4WJ3C 4XUJA 3MGRC 5AV5D 1N1JA 3UTAD 4J8WB 1KX3B 1BH9B 3O62D 1HQ3D 3W98C 1BH9A 3RELB 2HIOB 1P3MA 1BH8A 5BS7A 4WU9B 1H3OA 4KUDA 1P3GA 1ZLAB 3WTPC 4XZQA 5AVBD 5B0ZC 2BYKB 3X1SB 2HIOA 3RELA 5BO0A 4WU9A 5B32G 1M1AC 3REHA 3A1KA 3AZFD 4H9NB 3AZLB 4DQYB 1KX4B 1P3OB 5B2IC 4J8UB 4H9NA 5B1MB 1KX4A 4X23D 4CSRB 3C1CB 1P3OA 1ULYA 5AV6A 2BG1A 4Z5TC 1P34C 5DNNC 2RVQD 2YFWB 3B6FC 3KXBC 1EQZA 1P3AB 4QLCC 3X1VC 2ZY3A 2YFWA 3AFAA 3H0MC 4WV4B 1P3AA 1P3LD 4ZUXC 3TU4D 2W8SA 5AV5A 3UTAA 5B33B 3B0CW 3NQUA 5AV6C 1P3ID 3O62A 5B31C 5CPIB 1HQ3A 3WA9C 5B33A 3KWQC 2AROB 3A6NB 3MGQC 3AZJB 5GT3B 5CPIA 4KGCD 4NFTA 3AZKC 3WAAD 3AZJA 5GT3A 3AZMB 3X1UB 3FDDA 1Z2CB 3AZFA 1P3BC 5KDMA 3AZMA 3X1UA 3F6TA 5B2JD 2NQBD 5AVCD 2Y2JA 1P3PC 2CWEA 1S32C 1U35B 3AZGB 3AZHC 1WWIA 4YM6B 3V9RB 5AVBC 1U35A 5CP6C 1F66C 1P3KB 3AZED 2PYOC 3AV2A 1P3FD 3KUYB 1P3KA 5CPKD 3NQJB 3AYWB 4X23C 4WNNA 5AV8B 3KUYA 3REIB 3LELC 1P3IA 4LD9B 2NZDD 4ZBJB 4H9QB 5B24B 3MNND 3AZIB 3AZNB 4WU8D 4J8XA 1B6WA 3AV1B 5DNMD 4KGCA 4H9SA 3AZIA 1AOIB 3MGSB 3WAAA 3B6GB 3AV1A 1P3LC 5B0YC 5F99B 3TU4C 3AN2C 5F99A 4Z2MG 5B2JA 4J8WD 3UT9C 1KX3D 2NQBA 3VH5A 5AVCA 2JE5A 4G91B 2YFVA 3RELD 2HIOD 4WU9D 1ZLAD 2ZM5A 2Y2QA 3X1SD 2LY8A 4Z66B 4YS3B 4CAYB 4R8PB 3C1BB 3AZLD 1KX4D 5AV9C 3REJC 1P3FA 1KX5C 4HGAC 5CPKA 5B40B 5AVCC 1P3OD 1TZYC 4R8PA 3C1BA 5B1LB 4J8UD 5B1MD 5GSUB 2Y2GA 2J8PA 1T3UA 2UWXA 5B40A 3C1CD 2FJ7C 5B1LA 3EG5B 4G92C 5GSUA 4WU8A 1HTAA 5E5AB 3AZEC 5BNVA 1P3AD 5BT1C 2F2AC 1P3FC 2F8NB 1M19C 3W99C 4UUZB 1R4VA 3WKJC 2F8NA 3W96C 3VH6A 5BNXB 5B32C 5B33D 2NZDC 4J8WA 3MGPC 1KX3A 5GXQC 1B67A 3MNNC 5CPID 3B0DC 5CHLB 2Y2OA 2AROD 3WTPB 5DNMC 3A6ND 5B0ZB 5GT3D 3VH5T 3AZJD 4XUJC 1ZLAA 2VQRA 1M1AB 2BYKA 3X1SA 3EPLA 3AZMD 3X1UD 2BYMB 4H9RB 3AZLA 5B2IB 3MVDB 1P3MC 4KUDC 5BS7C 4J8UA 1P3GC 5B1MA 1ID3B 3MVDA 4XZQC 4Z5TB 3WTPE 4CSRA 3P5JB 5DNNB 3C1CA 2HIOC 3RELC 3AZGD 4WU9C 1U35D 2F8NG 3B6FB 3LZ0B 3IP4C 1ID3A 4YM6D 3REHC 4QLCB 4DRAA 3X1VB 3LZ0A 3AV2D 1P3KD 1KX4C 3LZ1B 3LJAB 1KU5A 4ZUXB 3KUYD 1P3OC 3AYWD 2FFFB 4M6BA 3LZ1A 3LJAA 5B31B 5AV8D 3REID 4J8XD 1EQZC 3KWQB 4LD9D 3UTBB 3VH6T 5B24D 3AZID 2AROA 3A6NA 3AFAC 3AV1D 1P3AC 3UTBA 1AOID 2Y2MA 5JA4B 2RIQA 3MGSD 5AV5C 3B6GD 3UTAC 1P3BB 5JA4A 5F99D 3O62C 1HQ3C 4E45A 5B33C 1P3PB 1S32B 5CPIC 4Z2MH 3AZHB 3AZJC 5GT3C 3AZGA 5CP6B 1F66B 4YM6A 3V9RA 3W97B 3AZFC 2PYOB 1W2EA 3AZMC 3X1UC 4J8VB 3W97A 4Z66D 2IO5C 5JRGB 4YS3D 4H9PB 4R8PD 3C1BD 1PZRA 4J8VA 2Y2PA 5GT0B 5B40D 5JRGA 3NQJA 4H9PA 3AYWA 5B1LD 3LELB 5GSUD 2RVQC 2Y2KA 5AV8A 4NE3A 3REIA 1U35C 5GT0A 4LD9A 4H9QA 5B24A 5AY8B 3AZNA 2L5AA 3AV2C 5E5AD 1P3KC 3KFUG 1AOIA 5AY8A 5B0YB 3MGSA 3A1IA 3B6GA 3TU4B 3AN2B 3KUYC 2F8ND 5CPJB 1P3IC 2HUEB 3EPKA 3UT9B 4J8XC 4NE6A 5CPJA 3VH5W 4KHAB 4ZBJC 4KGCC 2XD5A 4H9SC 3AZIC 3WAAC 3AV1C 2CV5B 1JFIB 5B0ZD 3AL0C 1F1EA 5FUGB 2XD1A 1M1AD 2CV5A 5G49B 5F99C 5B2JC 5AV9B 4Z66A 4EO5B 3REJB 1KX5B 4YS3A 2NQBC 4CAYA 1TZYB 5B2ID 3MVDD 4AWLB 2FJ7B 1M18B 4G92B 1ID3D 4Z5TD 5DNND 3REKB 3X1TB 1M18A 3B6FD 3LZ0D 4JJNB 2F8NH 4QLCD 3X1VD 3REKA 5E5AA 3MGRB 2DQNC 4JJNA 5CPKC 1M19B 4H9OB 4R8PC 3C1BC 3W99B 3EPHA 2JCHA 3LZ1D 3LJAD 3MGRA 3WKJB 4ZUXD 3W96B 5B40C 4H9OA 4NE5A 4UUZA 5B1LC 3VH6W 5B32B 3W98B 5GSUC 3MGPB 4WU8C 5GXQB 5BNXA 5B31D 3B0DB 3W98A 3KWQD 3UTBD 5C3IC 4XUJB 3WTPA 5B0ZA 1M1AA 1P3BD 4J8WC 1KX3C 2BYMA 1P3MB 1BH8B 4H9RA 4KUDB 1H3OB 5B2IA 1P3GB 1P3PD 1S32D 1P34B 4XZQB 4UPKA 5BO0B 3KXBB 1ZLAC 3AZHD 4Z5TA 3REHB 5DNNA 1P34A 3X1SC 3B6FA 1A7WA 5CP6D 3KXBA 1F66D 3W97D 4QLCA 2ZY5A 3X1VA 2PYOD 3AZLC 4J8VD 5JRGD 4J8UC 5B1MC 5AV6B 3MVDC 2Y2IA 1BFMA 4ZUXA 3C1CC 3WA9B 5GT0D 2G5HC 2Y2LA 1EQZB 3MGQB 1ID3C 3LELD 5B31A 3AZND 3WA9A 2Y2NA 3R45B 3LZ0C 3KWQA 3AZKB 3AFAB 3MGQA 5AY8D 3R45A 3AZKA 5AV5B 1WWSA 3UTAB 5B0YD 3NQUB 3LZ1C 3LJAC 3O62B 1HQ3B 3AN2D 1P3BA 5CPJD 4WZSB 3B0BA 3H0LC 3UT9D 1P3PA 2AROC 3A6NC 5AVBB 1S32A 3UTBC 3AZHA 5AVBA 2CV5D 5B31G 3AZFB 5CP6A 5KDMB 1F66A 1TAFB 1Q9CA 2G5IC 2IO5B 2PYOA 1TAFA 2F8NK 4X23B 5AV9D 3REJD 1KX5D 1TZYD 4X23A 3AZGC 2FJ7D 1M18D 4YM6C 3LELA 3REKD 3X1TD 3AV2B 3W97C 4JJND 1P3LB 4J8VC 3MGRD 4WNNB 5BT1D 5JRGC 1M19D 3AYWC 1P3LA 5B0YA 3W99D 1P3IB 3TU4A 3AN2A 5AV8C 3WKJD 3REIC 5GT0C 3W96D 4J8XB 4LD9C 5B32D 3W98D 2Y2HA 5B24C 3B0CT 3MGPD 3UT9A 5GXQD 3AZNC 4KGCB 2ZY4A 4KHAA 3WAAB 3WTPD 1AOIC 5AY8C 3EPJA 3MGSC 3B6GC 4XUJD 1JFIA 2ZY2A 5FUGA 4HGAB 5B2JB 4E44A 2NQBB 5G49A 5AVCB 5CPJC 5AV9A 3REJA 2HUEC 1KX5A 3KSYA 2YFVB 3H0RC 1TZYA 1P3MD 4KUDD 1P3GD 4G91C 4XZQD 1P34D 2FJ7A 3KXBD 3AZEB 2CV5C 3REHD 3X1TA 4Z66C 1P3FB 3AZEA 4YS3C 5CPKB 4EO5C 1M19A 3W99A 2NZDB
chains in the Genus database with same CATH topology
5AV6D 3MNNB 3WKJA 2JSSA 4WU8B 2DF4C 3W96A 4AWLC 5B32A 1M18C 3WA9D 2NZDA 1EQZD 3MGPA 3MGQD 5GXQA 3MNNA 5BNVB 5DNMB 4DRBA 3REKC 5C3IB 5E5AC 3X1TC 3AZKD 4JJNC 3AFAD 5DNMA 1N1JB 4WJ3C 4XUJA 3MGRC 5AV5D 1N1JA 3UTAD 4J8WB 1KX3B 1BH9B 3O62D 1HQ3D 3W98C 1BH9A 3RELB 2HIOB 1P3MA 1BH8A 5BS7A 4WU9B 1H3OA 4KUDA 1P3GA 1ZLAB 3WTPC 4XZQA 5AVBD 5B0ZC 2BYKB 3X1SB 2HIOA 3RELA 5BO0A 4WU9A 5B32G 1M1AC 3REHA 3A1KA 3AZFD 4H9NB 3AZLB 4DQYB 1KX4B 1P3OB 5B2IC 4J8UB 4H9NA 5B1MB 1KX4A 4X23D 4CSRB 3C1CB 1P3OA 1ULYA 5AV6A 2BG1A 4Z5TC 1P34C 5DNNC 2RVQD 2YFWB 3B6FC 3KXBC 1EQZA 1P3AB 4QLCC 3X1VC 2ZY3A 2YFWA 3AFAA 3H0MC 4WV4B 1P3AA 1P3LD 4ZUXC 3TU4D 2W8SA 5AV5A 3UTAA 5B33B 3B0CW 3NQUA 5AV6C 1P3ID 3O62A 5B31C 5CPIB 1HQ3A 3WA9C 5B33A 3KWQC 2AROB 3A6NB 3MGQC 3AZJB 5GT3B 5CPIA 4KGCD 4NFTA 3AZKC 3WAAD 3AZJA 5GT3A 3AZMB 3X1UB 3FDDA 1Z2CB 3AZFA 1P3BC 5KDMA 3AZMA 3X1UA 3F6TA 5B2JD 2NQBD 5AVCD 2Y2JA 1P3PC 2CWEA 1S32C 1U35B 3AZGB 3AZHC 1WWIA 4YM6B 3V9RB 5AVBC 1U35A 5CP6C 1F66C 1P3KB 3AZED 2PYOC 3AV2A 1P3FD 3KUYB 1P3KA 5CPKD 3NQJB 3AYWB 4X23C 4WNNA 5AV8B 3KUYA 3REIB 3LELC 1P3IA 4LD9B 2NZDD 4ZBJB 4H9QB 5B24B 3MNND 3AZIB 3AZNB 4WU8D 4J8XA 1B6WA 3AV1B 5DNMD 4KGCA 4H9SA 3AZIA 1AOIB 3MGSB 3WAAA 3B6GB 3AV1A 1P3LC 5B0YC 5F99B 3TU4C 3AN2C 5F99A 4Z2MG 5B2JA 4J8WD 3UT9C 1KX3D 2NQBA 3VH5A 5AVCA 2JE5A 4G91B 2YFVA 3RELD 2HIOD 4WU9D 1ZLAD 2ZM5A 2Y2QA 3X1SD 2LY8A 4Z66B 4YS3B 4CAYB 4R8PB 3C1BB 3AZLD 1KX4D 5AV9C 3REJC 1P3FA 1KX5C 4HGAC 5CPKA 5B40B 5AVCC 1P3OD 1TZYC 4R8PA 3C1BA 5B1LB 4J8UD 5B1MD 5GSUB 2Y2GA 2J8PA 1T3UA 2UWXA 5B40A 3C1CD 2FJ7C 5B1LA 3EG5B 4G92C 5GSUA 4WU8A 1HTAA 5E5AB 3AZEC 5BNVA 1P3AD 5BT1C 2F2AC 1P3FC 2F8NB 1M19C 3W99C 4UUZB 1R4VA 3WKJC 2F8NA 3W96C 3VH6A 5BNXB 5B32C 5B33D 2NZDC 4J8WA 3MGPC 1KX3A 5GXQC 1B67A 3MNNC 5CPID 3B0DC 5CHLB 2Y2OA 2AROD 3WTPB 5DNMC 3A6ND 5B0ZB 5GT3D 3VH5T 3AZJD 4XUJC 1ZLAA 2VQRA 1M1AB 2BYKA 3X1SA 3EPLA 3AZMD 3X1UD 2BYMB 4H9RB 3AZLA 5B2IB 3MVDB 1P3MC 4KUDC 5BS7C 4J8UA 1P3GC 5B1MA 1ID3B 3MVDA 4XZQC 4Z5TB 3WTPE 4CSRA 3P5JB 5DNNB 3C1CA 2HIOC 3RELC 3AZGD 4WU9C 1U35D 2F8NG 3B6FB 3LZ0B 3IP4C 1ID3A 4YM6D 3REHC 4QLCB 4DRAA 3X1VB 3LZ0A 3AV2D 1P3KD 1KX4C 3LZ1B 3LJAB 1KU5A 4ZUXB 3KUYD 1P3OC 3AYWD 2FFFB 4M6BA 3LZ1A 3LJAA 5B31B 5AV8D 3REID 4J8XD 1EQZC 3KWQB 4LD9D 3UTBB 3VH6T 5B24D 3AZID 2AROA 3A6NA 3AFAC 3AV1D 1P3AC 3UTBA 1AOID 2Y2MA 5JA4B 2RIQA 3MGSD 5AV5C 3B6GD 3UTAC 1P3BB 5JA4A 5F99D 3O62C 1HQ3C 4E45A 5B33C 1P3PB 1S32B 5CPIC 4Z2MH 3AZHB 3AZJC 5GT3C 3AZGA 5CP6B 1F66B 4YM6A 3V9RA 3W97B 3AZFC 2PYOB 1W2EA 3AZMC 3X1UC 4J8VB 3W97A 4Z66D 2IO5C 5JRGB 4YS3D 4H9PB 4R8PD 3C1BD 1PZRA 4J8VA 2Y2PA 5GT0B 5B40D 5JRGA 3NQJA 4H9PA 3AYWA 5B1LD 3LELB 5GSUD 2RVQC 2Y2KA 5AV8A 4NE3A 3REIA 1U35C 5GT0A 4LD9A 4H9QA 5B24A 5AY8B 3AZNA 2L5AA 3AV2C 5E5AD 1P3KC 3KFUG 1AOIA 5AY8A 5B0YB 3MGSA 3A1IA 3B6GA 3TU4B 3AN2B 3KUYC 2F8ND 5CPJB 1P3IC 2HUEB 3EPKA 3UT9B 4J8XC 4NE6A 5CPJA 3VH5W 4KHAB 4ZBJC 4KGCC 2XD5A 4H9SC 3AZIC 3WAAC 3AV1C 2CV5B 1JFIB 5B0ZD 3AL0C 1F1EA 5FUGB 2XD1A 1M1AD 2CV5A 5G49B 5F99C 5B2JC 5AV9B 4Z66A 4EO5B 3REJB 1KX5B 4YS3A 2NQBC 4CAYA 1TZYB 5B2ID 3MVDD 4AWLB 2FJ7B 1M18B 4G92B 1ID3D 4Z5TD 5DNND 3REKB 3X1TB 1M18A 3B6FD 3LZ0D 4JJNB 2F8NH 4QLCD 3X1VD 3REKA 5E5AA 3MGRB 2DQNC 4JJNA 5CPKC 1M19B 4H9OB 4R8PC 3C1BC 3W99B 3EPHA 2JCHA 3LZ1D 3LJAD 3MGRA 3WKJB 4ZUXD 3W96B 5B40C 4H9OA 4NE5A 4UUZA 5B1LC 3VH6W 5B32B 3W98B 5GSUC 3MGPB 4WU8C 5GXQB 5BNXA 5B31D 3B0DB 3W98A 3KWQD 3UTBD 5C3IC 4XUJB 3WTPA 5B0ZA 1M1AA 1P3BD 4J8WC 1KX3C 2BYMA 1P3MB 1BH8B 4H9RA 4KUDB 1H3OB 5B2IA 1P3GB 1P3PD 1S32D 1P34B 4XZQB 4UPKA 5BO0B 3KXBB 1ZLAC 3AZHD 4Z5TA 3REHB 5DNNA 1P34A 3X1SC 3B6FA 1A7WA 5CP6D 3KXBA 1F66D 3W97D 4QLCA 2ZY5A 3X1VA 2PYOD 3AZLC 4J8VD 5JRGD 4J8UC 5B1MC 5AV6B 3MVDC 2Y2IA 1BFMA 4ZUXA 3C1CC 3WA9B 5GT0D 2G5HC 2Y2LA 1EQZB 3MGQB 1ID3C 3LELD 5B31A 3AZND 3WA9A 2Y2NA 3R45B 3LZ0C 3KWQA 3AZKB 3AFAB 3MGQA 5AY8D 3R45A 3AZKA 5AV5B 1WWSA 3UTAB 5B0YD 3NQUB 3LZ1C 3LJAC 3O62B 1HQ3B 3AN2D 1P3BA 5CPJD 4WZSB 3B0BA 3H0LC 3UT9D 1P3PA 2AROC 3A6NC 5AVBB 1S32A 3UTBC 3AZHA 5AVBA 2CV5D 5B31G 3AZFB 5CP6A 5KDMB 1F66A 1TAFB 1Q9CA 2G5IC 2IO5B 2PYOA 1TAFA 2F8NK 4X23B 5AV9D 3REJD 1KX5D 1TZYD 4X23A 3AZGC 2FJ7D 1M18D 4YM6C 3LELA 3REKD 3X1TD 3AV2B 3W97C 4JJND 1P3LB 4J8VC 3MGRD 4WNNB 5BT1D 5JRGC 1M19D 3AYWC 1P3LA 5B0YA 3W99D 1P3IB 3TU4A 3AN2A 5AV8C 3WKJD 3REIC 5GT0C 3W96D 4J8XB 4LD9C 5B32D 3W98D 2Y2HA 5B24C 3B0CT 3MGPD 3UT9A 5GXQD 3AZNC 4KGCB 2ZY4A 4KHAA 3WAAB 3WTPD 1AOIC 5AY8C 3EPJA 3MGSC 3B6GC 4XUJD 1JFIA 2ZY2A 5FUGA 4HGAB 5B2JB 4E44A 2NQBB 5G49A 5AVCB 5CPJC 5AV9A 3REJA 2HUEC 1KX5A 3KSYA 2YFVB 3H0RC 1TZYA 1P3MD 4KUDD 1P3GD 4G91C 4XZQD 1P34D 2FJ7A 3KXBD 3AZEB 2CV5C 3REHD 3X1TA 4Z66C 1P3FB 3AZEA 4YS3C 5CPKB 4EO5C 1M19A 3W99A 2NZDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV6 D;  3MNN B;  3WKJ A;  2JSS A;  4WU8 B;  3W96 A;  4AWL C;  5B32 A;  1M18 C;  3WA9 D;  2NZD A;  1EQZ D;  3MGP A;  3MGQ D;  5GXQ A;  3MNN A;  5BNV B;  5DNM B;  4DRB A;  3REK C;  5C3I B;  5E5A C;  3X1T C;  3AZK D;  4JJN C;  3AFA D;  5DNM A;  1N1J B;  4XUJ A;  3MGR C;  5AV5 D;  1N1J A;  3UTA D;  4J8W B;  1KX3 B;  1BH9 B;  3O62 D;  1HQ3 D;  3W98 C;  1BH9 A;  3REL B;  2HIO B;  1P3M A;  1BH8 A;  5BS7 A;  4WU9 B;  1H3O A;  4KUD A;  1P3G A;  1ZLA B;  3WTP C;  4XZQ A;  5AVB D;  5B0Z C;  2BYK B;  3X1S B;  2HIO A;  3REL A;  5BO0 A;  4WU9 A;  5B32 G;  1M1A C;  3REH A;  3AZF D;  4H9N B;  3AZL B;  1KX4 B;  1P3O B;  5B2I C;  4J8U B;  4H9N A;  5B1M B;  1KX4 A;  4X23 D;  4CSR B;  3C1C B;  1P3O A;  1ULY A;  5AV6 A;  4Z5T C;  1P34 C;  5DNN C;  2RVQ D;  2YFW B;  3B6F C;  3KXB C;  1EQZ A;  1P3A B;  4QLC C;  3X1V C;  2YFW A;  3AFA A;  4WV4 B;  1P3A A;  1P3L D;  4ZUX C;  3TU4 D;  5AV5 A;  3UTA A;  5B33 B;  3B0C W;  3NQU A;  5AV6 C;  1P3I D;  3O62 A;  5B31 C;  5CPI B;  1HQ3 A;  3WA9 C;  5B33 A;  3KWQ C;  2ARO B;  3A6N B;  3MGQ C;  3AZJ B;  5GT3 B;  5CPI A;  4KGC D;  4NFT A;  3AZK C;  3WAA D;  3AZJ A;  5GT3 A;  3AZM B;  3X1U B;  3AZF A;  1P3B C;  5KDM A;  3AZM A;  3X1U A;  5B2J D;  2NQB D;  5AVC D;  1P3P C;  2CWE A;  1S32 C;  1U35 B;  3AZG B;  3AZH C;  1WWI A;  4YM6 B;  3V9R B;  5AVB C;  1U35 A;  5CP6 C;  1F66 C;  1P3K B;  3AZE D;  2PYO C;  3AV2 A;  1P3F D;  3KUY B;  1P3K A;  5CPK D;  3NQJ B;  3AYW B;  4X23 C;  4WNN A;  5AV8 B;  3KUY A;  3REI B;  3LEL C;  1P3I A;  4LD9 B;  2NZD D;  4ZBJ B;  4H9Q B;  5B24 B;  3MNN D;  3AZI B;  3AZN B;  4WU8 D;  4J8X A;  1B6W A;  3AV1 B;  5DNM D;  4KGC A;  4H9S A;  3AZI A;  1AOI B;  3MGS B;  3WAA A;  3B6G B;  3AV1 A;  1P3L C;  5B0Y C;  5F99 B;  3TU4 C;  3AN2 C;  5F99 A;  4Z2M G;  5B2J A;  4J8W D;  3UT9 C;  1KX3 D;  2NQB A;  3VH5 A;  5AVC A;  4G91 B;  2YFV A;  3REL D;  2HIO D;  4WU9 D;  1ZLA D;  3X1S D;  2LY8 A;  4Z66 B;  4YS3 B;  4CAY B;  4R8P B;  3C1B B;  3AZL D;  1KX4 D;  5AV9 C;  3REJ C;  1P3F A;  1KX5 C;  4HGA C;  5CPK A;  5B40 B;  5AVC C;  1P3O D;  1TZY C;  4R8P A;  3C1B A;  5B1L B;  4J8U D;  5B1M D;  5GSU B;  5B40 A;  3C1C D;  2FJ7 C;  5B1L A;  4G92 C;  5GSU A;  4WU8 A;  1HTA A;  5E5A B;  3AZE C;  5BNV A;  1P3A D;  5BT1 C;  2F8N B;  1P3F C;  1M19 C;  3W99 C;  4UUZ B;  1R4V A;  3WKJ C;  2F8N A;  3W96 C;  3VH6 A;  5BNX B;  5B32 C;  5B33 D;  2NZD C;  4J8W A;  3MGP C;  1KX3 A;  5GXQ C;  1B67 A;  3MNN C;  5CPI D;  3B0D C;  5CHL B;  2ARO D;  3WTP B;  5DNM C;  3A6N D;  5B0Z B;  5GT3 D;  3VH5 T;  3AZJ D;  4XUJ C;  1ZLA A;  1M1A B;  2BYK A;  3X1S A;  3AZM D;  3X1U D;  2BYM B;  4H9R B;  3AZL A;  5B2I B;  3MVD B;  1P3M C;  4KUD C;  5BS7 C;  4J8U A;  1P3G C;  5B1M A;  1ID3 B;  3MVD A;  4XZQ C;  4Z5T B;  3WTP E;  4CSR A;  5DNN B;  3C1C A;  3REL C;  2HIO C;  3AZG D;  4WU9 C;  1U35 D;  2F8N G;  3B6F B;  3LZ0 B;  1ID3 A;  4YM6 D;  3REH C;  4QLC B;  4DRA A;  3X1V B;  3LZ0 A;  3AV2 D;  1P3K D;  1KX4 C;  3LZ1 B;  3LJA B;  1KU5 A;  4ZUX B;  3KUY D;  1P3O C;  3AYW D;  4M6B A;  3LZ1 A;  3LJA A;  5B31 B;  5AV8 D;  3REI D;  4J8X D;  1EQZ C;  3KWQ B;  4LD9 D;  3UTB B;  3VH6 T;  5B24 D;  3AZI D;  2ARO A;  3A6N A;  3AFA C;  3AV1 D;  1P3A C;  3UTB A;  1AOI D;  5JA4 B;  3MGS D;  5AV5 C;  3B6G D;  3UTA C;  1P3B B;  5JA4 A;  5F99 D;  3O62 C;  1HQ3 C;  4E45 A;  5B33 C;  1P3P B;  1S32 B;  5CPI C;  4Z2M H;  3AZH B;  3AZJ C;  5GT3 C;  3AZG A;  5CP6 B;  1F66 B;  4YM6 A;  3V9R A;  3W97 B;  3AZF C;  2PYO B;  3AZM C;  3X1U C;  4J8V B;  3W97 A;  4Z66 D;  2IO5 C;  5JRG B;  4YS3 D;  4H9P B;  4R8P D;  3C1B D;  4J8V A;  5GT0 B;  5B40 D;  5JRG A;  3NQJ A;  4H9P A;  3AYW A;  5B1L D;  3LEL B;  5GSU D;  2RVQ C;  4NE3 A;  5AV8 A;  1U35 C;  3REI A;  5GT0 A;  4LD9 A;  4H9Q A;  5B24 A;  5AY8 B;  3AZN A;  2L5A A;  3AV2 C;  5E5A D;  1P3K C;  1AOI A;  5AY8 A;  5B0Y B;  3MGS A;  3B6G A;  3TU4 B;  3AN2 B;  3KUY C;  2F8N D;  5CPJ B;  1P3I C;  2HUE B;  3UT9 B;  4J8X C;  4NE6 A;  5CPJ A;  3VH5 W;  4KHA B;  4ZBJ C;  4KGC C;  4H9S C;  3AZI C;  3WAA C;  3AV1 C;  2CV5 B;  1JFI B;  5B0Z D;  1F1E A;  5FUG B;  1M1A D;  2CV5 A;  5G49 B;  5F99 C;  5B2J C;  5AV9 B;  4Z66 A;  4EO5 B;  3REJ B;  1KX5 B;  4YS3 A;  2NQB C;  4CAY A;  1TZY B;  5B2I D;  3MVD D;  4AWL B;  2FJ7 B;  1M18 B;  4G92 B;  1ID3 D;  4Z5T D;  5DNN D;  3REK B;  3X1T B;  1M18 A;  3B6F D;  3LZ0 D;  4JJN B;  2F8N H;  4QLC D;  3X1V D;  3REK A;  5E5A A;  3MGR B;  4JJN A;  5CPK C;  1M19 B;  4H9O B;  4R8P C;  3C1B C;  3W99 B;  3LZ1 D;  3LJA D;  3MGR A;  3WKJ B;  4ZUX D;  3W96 B;  5B40 C;  4H9O A;  4NE5 A;  4UUZ A;  5B1L C;  3VH6 W;  5B32 B;  3W98 B;  5GSU C;  3MGP B;  4WU8 C;  5GXQ B;  5BNX A;  5B31 D;  3B0D B;  3W98 A;  3KWQ D;  3UTB D;  5C3I C;  4XUJ B;  3WTP A;  5B0Z A;  1M1A A;  1P3B D;  4J8W C;  1KX3 C;  2BYM A;  1P3M B;  1BH8 B;  4H9R A;  4KUD B;  1H3O B;  5B2I A;  1P3G B;  1P3P D;  1S32 D;  1P34 B;  4XZQ B;  5BO0 B;  3KXB B;  1ZLA C;  3AZH D;  4Z5T A;  3REH B;  5DNN A;  1P34 A;  3X1S C;  3B6F A;  1A7W A;  5CP6 D;  3KXB A;  1F66 D;  3W97 D;  4QLC A;  3X1V A;  2PYO D;  3AZL C;  4J8V D;  5JRG D;  4J8U C;  5B1M C;  5AV6 B;  3MVD C;  1BFM A;  4ZUX A;  3C1C C;  3WA9 B;  5GT0 D;  1EQZ B;  3MGQ B;  1ID3 C;  3LEL D;  5B31 A;  3AZN D;  3WA9 A;  3R45 B;  3LZ0 C;  3KWQ A;  3AZK B;  3AFA B;  3MGQ A;  5AY8 D;  3R45 A;  3AZK A;  5AV5 B;  1WWS A;  3UTA B;  5B0Y D;  3NQU B;  3LZ1 C;  3LJA C;  3O62 B;  1HQ3 B;  3AN2 D;  1P3B A;  5CPJ D;  4WZS B;  3B0B A;  3UT9 D;  1P3P A;  2ARO C;  3A6N C;  5AVB B;  1S32 A;  3UTB C;  3AZH A;  5AVB A;  2CV5 D;  5B31 G;  3AZF B;  5CP6 A;  5KDM B;  1F66 A;  1TAF B;  1Q9C A;  2PYO A;  2IO5 B;  1TAF A;  2F8N K;  4X23 B;  5AV9 D;  3REJ D;  1KX5 D;  1TZY D;  4X23 A;  3AZG C;  2FJ7 D;  1M18 D;  4YM6 C;  3LEL A;  3REK D;  3X1T D;  3AV2 B;  3W97 C;  4JJN D;  1P3L B;  4J8V C;  3MGR D;  4WNN B;  5BT1 D;  5JRG C;  1M19 D;  3AYW C;  1P3L A;  5B0Y A;  3W99 D;  1P3I B;  3TU4 A;  3AN2 A;  5AV8 C;  3WKJ D;  3REI C;  5GT0 C;  3W96 D;  4J8X B;  4LD9 C;  5B32 D;  3W98 D;  5B24 C;  3B0C T;  3MGP D;  3UT9 A;  5GXQ D;  3AZN C;  4KGC B;  4KHA A;  3WAA B;  3WTP D;  1AOI C;  5AY8 C;  3MGS C;  3B6G C;  4XUJ D;  1JFI A;  5FUG A;  4HGA B;  5B2J B;  4E44 A;  2NQB B;  5G49 A;  5AVC B;  5CPJ C;  5AV9 A;  3REJ A;  2HUE C;  1KX5 A;  3KSY A;  2YFV B;  1TZY A;  1P3M D;  4KUD D;  1P3G D;  4G91 C;  4XZQ D;  1P34 D;  2FJ7 A;  3KXB D;  3AZE B;  2CV5 C;  3REH D;  3X1T A;  4Z66 C;  1P3F B;  3AZE A;  4YS3 C;  5CPK B;  4EO5 C;  1M19 A;  3W99 A;  2NZD B; 
#chains in the Genus database with same CATH topology
 5AV6 D;  3MNN B;  3WKJ A;  2JSS A;  4WU8 B;  2DF4 C;  3W96 A;  4AWL C;  5B32 A;  1M18 C;  3WA9 D;  2NZD A;  1EQZ D;  3MGP A;  3MGQ D;  5GXQ A;  3MNN A;  5BNV B;  5DNM B;  4DRB A;  3REK C;  5C3I B;  5E5A C;  3X1T C;  3AZK D;  4JJN C;  3AFA D;  5DNM A;  1N1J B;  4WJ3 C;  4XUJ A;  3MGR C;  5AV5 D;  1N1J A;  3UTA D;  4J8W B;  1KX3 B;  1BH9 B;  3O62 D;  1HQ3 D;  3W98 C;  1BH9 A;  3REL B;  2HIO B;  1P3M A;  1BH8 A;  5BS7 A;  4WU9 B;  1H3O A;  4KUD A;  1P3G A;  1ZLA B;  3WTP C;  4XZQ A;  5AVB D;  5B0Z C;  2BYK B;  3X1S B;  2HIO A;  3REL A;  5BO0 A;  4WU9 A;  5B32 G;  1M1A C;  3REH A;  3A1K A;  3AZF D;  4H9N B;  3AZL B;  4DQY B;  1KX4 B;  1P3O B;  5B2I C;  4J8U B;  4H9N A;  5B1M B;  1KX4 A;  4X23 D;  4CSR B;  3C1C B;  1P3O A;  1ULY A;  5AV6 A;  2BG1 A;  4Z5T C;  1P34 C;  5DNN C;  2RVQ D;  2YFW B;  3B6F C;  3KXB C;  1EQZ A;  1P3A B;  4QLC C;  3X1V C;  2ZY3 A;  2YFW A;  3AFA A;  3H0M C;  4WV4 B;  1P3A A;  1P3L D;  4ZUX C;  3TU4 D;  2W8S A;  5AV5 A;  3UTA A;  5B33 B;  3B0C W;  3NQU A;  5AV6 C;  1P3I D;  3O62 A;  5B31 C;  5CPI B;  1HQ3 A;  3WA9 C;  5B33 A;  3KWQ C;  2ARO B;  3A6N B;  3MGQ C;  3AZJ B;  5GT3 B;  5CPI A;  4KGC D;  4NFT A;  3AZK C;  3WAA D;  3AZJ A;  5GT3 A;  3AZM B;  3X1U B;  3FDD A;  1Z2C B;  3AZF A;  1P3B C;  5KDM A;  3AZM A;  3X1U A;  3F6T A;  5B2J D;  2NQB D;  5AVC D;  2Y2J A;  1P3P C;  2CWE A;  1S32 C;  1U35 B;  3AZG B;  3AZH C;  1WWI A;  4YM6 B;  3V9R B;  5AVB C;  1U35 A;  5CP6 C;  1F66 C;  1P3K B;  3AZE D;  2PYO C;  3AV2 A;  1P3F D;  3KUY B;  1P3K A;  5CPK D;  3NQJ B;  3AYW B;  4X23 C;  4WNN A;  5AV8 B;  3KUY A;  3REI B;  3LEL C;  1P3I A;  4LD9 B;  2NZD D;  4ZBJ B;  4H9Q B;  5B24 B;  3MNN D;  3AZI B;  3AZN B;  4WU8 D;  4J8X A;  1B6W A;  3AV1 B;  5DNM D;  4KGC A;  4H9S A;  3AZI A;  1AOI B;  3MGS B;  3WAA A;  3B6G B;  3AV1 A;  1P3L C;  5B0Y C;  5F99 B;  3TU4 C;  3AN2 C;  5F99 A;  4Z2M G;  5B2J A;  4J8W D;  3UT9 C;  1KX3 D;  2NQB A;  3VH5 A;  5AVC A;  2JE5 A;  4G91 B;  2YFV A;  3REL D;  2HIO D;  4WU9 D;  1ZLA D;  2ZM5 A;  2Y2Q A;  3X1S D;  2LY8 A;  4Z66 B;  4YS3 B;  4CAY B;  4R8P B;  3C1B B;  3AZL D;  1KX4 D;  5AV9 C;  3REJ C;  1P3F A;  1KX5 C;  4HGA C;  5CPK A;  5B40 B;  5AVC C;  1P3O D;  1TZY C;  4R8P A;  3C1B A;  5B1L B;  4J8U D;  5B1M D;  5GSU B;  2Y2G A;  2J8P A;  1T3U A;  2UWX A;  5B40 A;  3C1C D;  2FJ7 C;  5B1L A;  3EG5 B;  4G92 C;  5GSU A;  4WU8 A;  1HTA A;  5E5A B;  3AZE C;  5BNV A;  1P3A D;  5BT1 C;  2F2A C;  1P3F C;  2F8N B;  1M19 C;  3W99 C;  4UUZ B;  1R4V A;  3WKJ C;  2F8N A;  3W96 C;  3VH6 A;  5BNX B;  5B32 C;  5B33 D;  2NZD C;  4J8W A;  3MGP C;  1KX3 A;  5GXQ C;  1B67 A;  3MNN C;  5CPI D;  3B0D C;  5CHL B;  2Y2O A;  2ARO D;  3WTP B;  5DNM C;  3A6N D;  5B0Z B;  5GT3 D;  3VH5 T;  3AZJ D;  4XUJ C;  1ZLA A;  2VQR A;  1M1A B;  2BYK A;  3X1S A;  3EPL A;  3AZM D;  3X1U D;  2BYM B;  4H9R B;  3AZL A;  5B2I B;  3MVD B;  1P3M C;  4KUD C;  5BS7 C;  4J8U A;  1P3G C;  5B1M A;  1ID3 B;  3MVD A;  4XZQ C;  4Z5T B;  3WTP E;  4CSR A;  3P5J B;  5DNN B;  3C1C A;  2HIO C;  3REL C;  3AZG D;  4WU9 C;  1U35 D;  2F8N G;  3B6F B;  3LZ0 B;  3IP4 C;  1ID3 A;  4YM6 D;  3REH C;  4QLC B;  4DRA A;  3X1V B;  3LZ0 A;  3AV2 D;  1P3K D;  1KX4 C;  3LZ1 B;  3LJA B;  1KU5 A;  4ZUX B;  3KUY D;  1P3O C;  3AYW D;  2FFF B;  4M6B A;  3LZ1 A;  3LJA A;  5B31 B;  5AV8 D;  3REI D;  4J8X D;  1EQZ C;  3KWQ B;  4LD9 D;  3UTB B;  3VH6 T;  5B24 D;  3AZI D;  2ARO A;  3A6N A;  3AFA C;  3AV1 D;  1P3A C;  3UTB A;  1AOI D;  2Y2M A;  5JA4 B;  2RIQ A;  3MGS D;  5AV5 C;  3B6G D;  3UTA C;  1P3B B;  5JA4 A;  5F99 D;  3O62 C;  1HQ3 C;  4E45 A;  5B33 C;  1P3P B;  1S32 B;  5CPI C;  4Z2M H;  3AZH B;  3AZJ C;  5GT3 C;  3AZG A;  5CP6 B;  1F66 B;  4YM6 A;  3V9R A;  3W97 B;  3AZF C;  2PYO B;  1W2E A;  3AZM C;  3X1U C;  4J8V B;  3W97 A;  4Z66 D;  2IO5 C;  5JRG B;  4YS3 D;  4H9P B;  4R8P D;  3C1B D;  1PZR A;  4J8V A;  2Y2P A;  5GT0 B;  5B40 D;  5JRG A;  3NQJ A;  4H9P A;  3AYW A;  5B1L D;  3LEL B;  5GSU D;  2RVQ C;  2Y2K A;  5AV8 A;  4NE3 A;  3REI A;  1U35 C;  5GT0 A;  4LD9 A;  4H9Q A;  5B24 A;  5AY8 B;  3AZN A;  2L5A A;  3AV2 C;  5E5A D;  1P3K C;  3KFU G;  1AOI A;  5AY8 A;  5B0Y B;  3MGS A;  3A1I A;  3B6G A;  3TU4 B;  3AN2 B;  3KUY C;  2F8N D;  5CPJ B;  1P3I C;  2HUE B;  3EPK A;  3UT9 B;  4J8X C;  4NE6 A;  5CPJ A;  3VH5 W;  4KHA B;  4ZBJ C;  4KGC C;  2XD5 A;  4H9S C;  3AZI C;  3WAA C;  3AV1 C;  2CV5 B;  1JFI B;  5B0Z D;  3AL0 C;  1F1E A;  5FUG B;  2XD1 A;  1M1A D;  2CV5 A;  5G49 B;  5F99 C;  5B2J C;  5AV9 B;  4Z66 A;  4EO5 B;  3REJ B;  1KX5 B;  4YS3 A;  2NQB C;  4CAY A;  1TZY B;  5B2I D;  3MVD D;  4AWL B;  2FJ7 B;  1M18 B;  4G92 B;  1ID3 D;  4Z5T D;  5DNN D;  3REK B;  3X1T B;  1M18 A;  3B6F D;  3LZ0 D;  4JJN B;  2F8N H;  4QLC D;  3X1V D;  3REK A;  5E5A A;  3MGR B;  2DQN C;  4JJN A;  5CPK C;  1M19 B;  4H9O B;  4R8P C;  3C1B C;  3W99 B;  3EPH A;  2JCH A;  3LZ1 D;  3LJA D;  3MGR A;  3WKJ B;  4ZUX D;  3W96 B;  5B40 C;  4H9O A;  4NE5 A;  4UUZ A;  5B1L C;  3VH6 W;  5B32 B;  3W98 B;  5GSU C;  3MGP B;  4WU8 C;  5GXQ B;  5BNX A;  5B31 D;  3B0D B;  3W98 A;  3KWQ D;  3UTB D;  5C3I C;  4XUJ B;  3WTP A;  5B0Z A;  1M1A A;  1P3B D;  4J8W C;  1KX3 C;  2BYM A;  1P3M B;  1BH8 B;  4H9R A;  4KUD B;  1H3O B;  5B2I A;  1P3G B;  1P3P D;  1S32 D;  1P34 B;  4XZQ B;  4UPK A;  5BO0 B;  3KXB B;  1ZLA C;  3AZH D;  4Z5T A;  3REH B;  5DNN A;  1P34 A;  3X1S C;  3B6F A;  1A7W A;  5CP6 D;  3KXB A;  1F66 D;  3W97 D;  4QLC A;  2ZY5 A;  3X1V A;  2PYO D;  3AZL C;  4J8V D;  5JRG D;  4J8U C;  5B1M C;  5AV6 B;  3MVD C;  2Y2I A;  1BFM A;  4ZUX A;  3C1C C;  3WA9 B;  5GT0 D;  2G5H C;  2Y2L A;  1EQZ B;  3MGQ B;  1ID3 C;  3LEL D;  5B31 A;  3AZN D;  3WA9 A;  2Y2N A;  3R45 B;  3LZ0 C;  3KWQ A;  3AZK B;  3AFA B;  3MGQ A;  5AY8 D;  3R45 A;  3AZK A;  5AV5 B;  1WWS A;  3UTA B;  5B0Y D;  3NQU B;  3LZ1 C;  3LJA C;  3O62 B;  1HQ3 B;  3AN2 D;  1P3B A;  5CPJ D;  4WZS B;  3B0B A;  3H0L C;  3UT9 D;  1P3P A;  2ARO C;  3A6N C;  5AVB B;  1S32 A;  3UTB C;  3AZH A;  5AVB A;  2CV5 D;  5B31 G;  3AZF B;  5CP6 A;  5KDM B;  1F66 A;  1TAF B;  1Q9C A;  2G5I C;  2IO5 B;  2PYO A;  1TAF A;  2F8N K;  4X23 B;  5AV9 D;  3REJ D;  1KX5 D;  1TZY D;  4X23 A;  3AZG C;  2FJ7 D;  1M18 D;  4YM6 C;  3LEL A;  3REK D;  3X1T D;  3AV2 B;  3W97 C;  4JJN D;  1P3L B;  4J8V C;  3MGR D;  4WNN B;  5BT1 D;  5JRG C;  1M19 D;  3AYW C;  1P3L A;  5B0Y A;  3W99 D;  1P3I B;  3TU4 A;  3AN2 A;  5AV8 C;  3WKJ D;  3REI C;  5GT0 C;  3W96 D;  4J8X B;  4LD9 C;  5B32 D;  3W98 D;  2Y2H A;  5B24 C;  3B0C T;  3MGP D;  3UT9 A;  5GXQ D;  3AZN C;  4KGC B;  2ZY4 A;  4KHA A;  3WAA B;  3WTP D;  1AOI C;  5AY8 C;  3EPJ A;  3MGS C;  3B6G C;  4XUJ D;  1JFI A;  2ZY2 A;  5FUG A;  4HGA B;  5B2J B;  4E44 A;  2NQB B;  5G49 A;  5AVC B;  5CPJ C;  5AV9 A;  3REJ A;  2HUE C;  1KX5 A;  3KSY A;  2YFV B;  3H0R C;  1TZY A;  1P3M D;  4KUD D;  1P3G D;  4G91 C;  4XZQ D;  1P34 D;  2FJ7 A;  3KXB D;  3AZE B;  2CV5 C;  3REH D;  3X1T A;  4Z66 C;  1P3F B;  3AZE A;  4YS3 C;  5CPK B;  4EO5 C;  1M19 A;  3W99 A;  2NZD B; 
#chains in the Genus database with same CATH homology
 5AV6 D;  3MNN B;  3WKJ A;  2JSS A;  4WU8 B;  2DF4 C;  3W96 A;  4AWL C;  5B32 A;  1M18 C;  3WA9 D;  2NZD A;  1EQZ D;  3MGP A;  3MGQ D;  5GXQ A;  3MNN A;  5BNV B;  5DNM B;  4DRB A;  3REK C;  5C3I B;  5E5A C;  3X1T C;  3AZK D;  4JJN C;  3AFA D;  5DNM A;  1N1J B;  4WJ3 C;  4XUJ A;  3MGR C;  5AV5 D;  1N1J A;  3UTA D;  4J8W B;  1KX3 B;  1BH9 B;  3O62 D;  1HQ3 D;  3W98 C;  1BH9 A;  3REL B;  2HIO B;  1P3M A;  1BH8 A;  5BS7 A;  4WU9 B;  1H3O A;  4KUD A;  1P3G A;  1ZLA B;  3WTP C;  4XZQ A;  5AVB D;  5B0Z C;  2BYK B;  3X1S B;  2HIO A;  3REL A;  5BO0 A;  4WU9 A;  5B32 G;  1M1A C;  3REH A;  3A1K A;  3AZF D;  4H9N B;  3AZL B;  4DQY B;  1KX4 B;  1P3O B;  5B2I C;  4J8U B;  4H9N A;  5B1M B;  1KX4 A;  4X23 D;  4CSR B;  3C1C B;  1P3O A;  1ULY A;  5AV6 A;  2BG1 A;  4Z5T C;  1P34 C;  5DNN C;  2RVQ D;  2YFW B;  3B6F C;  3KXB C;  1EQZ A;  1P3A B;  4QLC C;  3X1V C;  2ZY3 A;  2YFW A;  3AFA A;  3H0M C;  4WV4 B;  1P3A A;  1P3L D;  4ZUX C;  3TU4 D;  2W8S A;  5AV5 A;  3UTA A;  5B33 B;  3B0C W;  3NQU A;  5AV6 C;  1P3I D;  3O62 A;  5B31 C;  5CPI B;  1HQ3 A;  3WA9 C;  5B33 A;  3KWQ C;  2ARO B;  3A6N B;  3MGQ C;  3AZJ B;  5GT3 B;  5CPI A;  4KGC D;  4NFT A;  3AZK C;  3WAA D;  3AZJ A;  5GT3 A;  3AZM B;  3X1U B;  3FDD A;  1Z2C B;  3AZF A;  1P3B C;  5KDM A;  3AZM A;  3X1U A;  3F6T A;  5B2J D;  2NQB D;  5AVC D;  2Y2J A;  1P3P C;  2CWE A;  1S32 C;  1U35 B;  3AZG B;  3AZH C;  1WWI A;  4YM6 B;  3V9R B;  5AVB C;  1U35 A;  5CP6 C;  1F66 C;  1P3K B;  3AZE D;  2PYO C;  3AV2 A;  1P3F D;  3KUY B;  1P3K A;  5CPK D;  3NQJ B;  3AYW B;  4X23 C;  4WNN A;  5AV8 B;  3KUY A;  3REI B;  3LEL C;  1P3I A;  4LD9 B;  2NZD D;  4ZBJ B;  4H9Q B;  5B24 B;  3MNN D;  3AZI B;  3AZN B;  4WU8 D;  4J8X A;  1B6W A;  3AV1 B;  5DNM D;  4KGC A;  4H9S A;  3AZI A;  1AOI B;  3MGS B;  3WAA A;  3B6G B;  3AV1 A;  1P3L C;  5B0Y C;  5F99 B;  3TU4 C;  3AN2 C;  5F99 A;  4Z2M G;  5B2J A;  4J8W D;  3UT9 C;  1KX3 D;  2NQB A;  3VH5 A;  5AVC A;  2JE5 A;  4G91 B;  2YFV A;  3REL D;  2HIO D;  4WU9 D;  1ZLA D;  2ZM5 A;  2Y2Q A;  3X1S D;  2LY8 A;  4Z66 B;  4YS3 B;  4CAY B;  4R8P B;  3C1B B;  3AZL D;  1KX4 D;  5AV9 C;  3REJ C;  1P3F A;  1KX5 C;  4HGA C;  5CPK A;  5B40 B;  5AVC C;  1P3O D;  1TZY C;  4R8P A;  3C1B A;  5B1L B;  4J8U D;  5B1M D;  5GSU B;  2Y2G A;  2J8P A;  1T3U A;  2UWX A;  5B40 A;  3C1C D;  2FJ7 C;  5B1L A;  3EG5 B;  4G92 C;  5GSU A;  4WU8 A;  1HTA A;  5E5A B;  3AZE C;  5BNV A;  1P3A D;  5BT1 C;  2F2A C;  1P3F C;  2F8N B;  1M19 C;  3W99 C;  4UUZ B;  1R4V A;  3WKJ C;  2F8N A;  3W96 C;  3VH6 A;  5BNX B;  5B32 C;  5B33 D;  2NZD C;  4J8W A;  3MGP C;  1KX3 A;  5GXQ C;  1B67 A;  3MNN C;  5CPI D;  3B0D C;  5CHL B;  2Y2O A;  2ARO D;  3WTP B;  5DNM C;  3A6N D;  5B0Z B;  5GT3 D;  3VH5 T;  3AZJ D;  4XUJ C;  1ZLA A;  2VQR A;  1M1A B;  2BYK A;  3X1S A;  3EPL A;  3AZM D;  3X1U D;  2BYM B;  4H9R B;  3AZL A;  5B2I B;  3MVD B;  1P3M C;  4KUD C;  5BS7 C;  4J8U A;  1P3G C;  5B1M A;  1ID3 B;  3MVD A;  4XZQ C;  4Z5T B;  3WTP E;  4CSR A;  3P5J B;  5DNN B;  3C1C A;  2HIO C;  3REL C;  3AZG D;  4WU9 C;  1U35 D;  2F8N G;  3B6F B;  3LZ0 B;  3IP4 C;  1ID3 A;  4YM6 D;  3REH C;  4QLC B;  4DRA A;  3X1V B;  3LZ0 A;  3AV2 D;  1P3K D;  1KX4 C;  3LZ1 B;  3LJA B;  1KU5 A;  4ZUX B;  3KUY D;  1P3O C;  3AYW D;  2FFF B;  4M6B A;  3LZ1 A;  3LJA A;  5B31 B;  5AV8 D;  3REI D;  4J8X D;  1EQZ C;  3KWQ B;  4LD9 D;  3UTB B;  3VH6 T;  5B24 D;  3AZI D;  2ARO A;  3A6N A;  3AFA C;  3AV1 D;  1P3A C;  3UTB A;  1AOI D;  2Y2M A;  5JA4 B;  2RIQ A;  3MGS D;  5AV5 C;  3B6G D;  3UTA C;  1P3B B;  5JA4 A;  5F99 D;  3O62 C;  1HQ3 C;  4E45 A;  5B33 C;  1P3P B;  1S32 B;  5CPI C;  4Z2M H;  3AZH B;  3AZJ C;  5GT3 C;  3AZG A;  5CP6 B;  1F66 B;  4YM6 A;  3V9R A;  3W97 B;  3AZF C;  2PYO B;  1W2E A;  3AZM C;  3X1U C;  4J8V B;  3W97 A;  4Z66 D;  2IO5 C;  5JRG B;  4YS3 D;  4H9P B;  4R8P D;  3C1B D;  1PZR A;  4J8V A;  2Y2P A;  5GT0 B;  5B40 D;  5JRG A;  3NQJ A;  4H9P A;  3AYW A;  5B1L D;  3LEL B;  5GSU D;  2RVQ C;  2Y2K A;  5AV8 A;  4NE3 A;  3REI A;  1U35 C;  5GT0 A;  4LD9 A;  4H9Q A;  5B24 A;  5AY8 B;  3AZN A;  2L5A A;  3AV2 C;  5E5A D;  1P3K C;  3KFU G;  1AOI A;  5AY8 A;  5B0Y B;  3MGS A;  3A1I A;  3B6G A;  3TU4 B;  3AN2 B;  3KUY C;  2F8N D;  5CPJ B;  1P3I C;  2HUE B;  3EPK A;  3UT9 B;  4J8X C;  4NE6 A;  5CPJ A;  3VH5 W;  4KHA B;  4ZBJ C;  4KGC C;  2XD5 A;  4H9S C;  3AZI C;  3WAA C;  3AV1 C;  2CV5 B;  1JFI B;  5B0Z D;  3AL0 C;  1F1E A;  5FUG B;  2XD1 A;  1M1A D;  2CV5 A;  5G49 B;  5F99 C;  5B2J C;  5AV9 B;  4Z66 A;  4EO5 B;  3REJ B;  1KX5 B;  4YS3 A;  2NQB C;  4CAY A;  1TZY B;  5B2I D;  3MVD D;  4AWL B;  2FJ7 B;  1M18 B;  4G92 B;  1ID3 D;  4Z5T D;  5DNN D;  3REK B;  3X1T B;  1M18 A;  3B6F D;  3LZ0 D;  4JJN B;  2F8N H;  4QLC D;  3X1V D;  3REK A;  5E5A A;  3MGR B;  2DQN C;  4JJN A;  5CPK C;  1M19 B;  4H9O B;  4R8P C;  3C1B C;  3W99 B;  3EPH A;  2JCH A;  3LZ1 D;  3LJA D;  3MGR A;  3WKJ B;  4ZUX D;  3W96 B;  5B40 C;  4H9O A;  4NE5 A;  4UUZ A;  5B1L C;  3VH6 W;  5B32 B;  3W98 B;  5GSU C;  3MGP B;  4WU8 C;  5GXQ B;  5BNX A;  5B31 D;  3B0D B;  3W98 A;  3KWQ D;  3UTB D;  5C3I C;  4XUJ B;  3WTP A;  5B0Z A;  1M1A A;  1P3B D;  4J8W C;  1KX3 C;  2BYM A;  1P3M B;  1BH8 B;  4H9R A;  4KUD B;  1H3O B;  5B2I A;  1P3G B;  1P3P D;  1S32 D;  1P34 B;  4XZQ B;  4UPK A;  5BO0 B;  3KXB B;  1ZLA C;  3AZH D;  4Z5T A;  3REH B;  5DNN A;  1P34 A;  3X1S C;  3B6F A;  1A7W A;  5CP6 D;  3KXB A;  1F66 D;  3W97 D;  4QLC A;  2ZY5 A;  3X1V A;  2PYO D;  3AZL C;  4J8V D;  5JRG D;  4J8U C;  5B1M C;  5AV6 B;  3MVD C;  2Y2I A;  1BFM A;  4ZUX A;  3C1C C;  3WA9 B;  5GT0 D;  2G5H C;  2Y2L A;  1EQZ B;  3MGQ B;  1ID3 C;  3LEL D;  5B31 A;  3AZN D;  3WA9 A;  2Y2N A;  3R45 B;  3LZ0 C;  3KWQ A;  3AZK B;  3AFA B;  3MGQ A;  5AY8 D;  3R45 A;  3AZK A;  5AV5 B;  1WWS A;  3UTA B;  5B0Y D;  3NQU B;  3LZ1 C;  3LJA C;  3O62 B;  1HQ3 B;  3AN2 D;  1P3B A;  5CPJ D;  4WZS B;  3B0B A;  3H0L C;  3UT9 D;  1P3P A;  2ARO C;  3A6N C;  5AVB B;  1S32 A;  3UTB C;  3AZH A;  5AVB A;  2CV5 D;  5B31 G;  3AZF B;  5CP6 A;  5KDM B;  1F66 A;  1TAF B;  1Q9C A;  2G5I C;  2IO5 B;  2PYO A;  1TAF A;  2F8N K;  4X23 B;  5AV9 D;  3REJ D;  1KX5 D;  1TZY D;  4X23 A;  3AZG C;  2FJ7 D;  1M18 D;  4YM6 C;  3LEL A;  3REK D;  3X1T D;  3AV2 B;  3W97 C;  4JJN D;  1P3L B;  4J8V C;  3MGR D;  4WNN B;  5BT1 D;  5JRG C;  1M19 D;  3AYW C;  1P3L A;  5B0Y A;  3W99 D;  1P3I B;  3TU4 A;  3AN2 A;  5AV8 C;  3WKJ D;  3REI C;  5GT0 C;  3W96 D;  4J8X B;  4LD9 C;  5B32 D;  3W98 D;  2Y2H A;  5B24 C;  3B0C T;  3MGP D;  3UT9 A;  5GXQ D;  3AZN C;  4KGC B;  2ZY4 A;  4KHA A;  3WAA B;  3WTP D;  1AOI C;  5AY8 C;  3EPJ A;  3MGS C;  3B6G C;  4XUJ D;  1JFI A;  2ZY2 A;  5FUG A;  4HGA B;  5B2J B;  4E44 A;  2NQB B;  5G49 A;  5AVC B;  5CPJ C;  5AV9 A;  3REJ A;  2HUE C;  1KX5 A;  3KSY A;  2YFV B;  3H0R C;  1TZY A;  1P3M D;  4KUD D;  1P3G D;  4G91 C;  4XZQ D;  1P34 D;  2FJ7 A;  3KXB D;  3AZE B;  2CV5 C;  3REH D;  3X1T A;  4Z66 C;  1P3F B;  3AZE A;  4YS3 C;  5CPK B;  4EO5 C;  1M19 A;  3W99 A;  2NZD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...