3LELA

Structural insight into the sequence-dependence of nucleosome positioning
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords Histone H3.2
publication title Structural insight into the sequence dependence of nucleosome positioning
pubmed doi rcsb
source organism Xenopus laevis
total genus 33
structure length 98
sequence length 98
chains with identical sequence E, K, O
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3lelA00
1M18D 4XUJA 3B6GA 1P34D 5AV8C 1B6WA 3C1BB 3C1CB 5GT3A 4EO5C 5CP6B 3LZ1C 1P3MC 3W97B 4KHAB 3LJAB 3AN2D 1ZLAA 2FJ7C 3B0DC 4Z5TC 5AY8C 5B2JD 4WU8B 4J8WD 5GT0D 5GXQC 2AROC 1P3IA 5B31D 3AZFB 3WAAB 4WU9B 2CV5C 3V9RB 5AV6A 3W99A 4KGCC 3X1TB 2F8NA 4LD9D 3AYWB 1M19B 5BO0A 3C1BD 3REJB 3C1CD 1F66D 4XUJC 3MVDA 2F8NG 4X23B 3KUYA 3B6FA 3UT9A 5B24A 4H9NA 3X1SD 3WA9B 5DNMB 3UTBA 3MGRB 3WAAD 2BYKA 3LZ0B 4WU9D 4E45A 4R8PB 3WKJA 5CPJD 2CWEA 1P3FC 5BT1C 5B2JA 5AV6C 4J8WA 3W99C 5BNXB 1KX4D 3AZLB 3R45B 4XZQD 4WNNA 5B33A 4H9PA 3W98B 4Z66A 3WTPA 5CPIA 3REIB 5B1MD 4X23D 3AZKA 5E5AD 5AV9D 3NQUA 3MGSD 3REKA 4J8XA 5BNVA 4G92C 4YM6D 1AOIB 3AZMD 5B0ZA 3A6NA 3KUYC 3B6FC 3UT9C 4G91C 3AZJC 5G49A 4QLCD 1M18C 4XUJB 1F1EA 3B6GB 3RELB 1KX5D 4YS3D 5FUGA 3MGQD 5AVBB 5GT3B 3O62A 3AN2C 4JJNB 3NQJA 1ZLAB 3AFAA 2NZDD 2HIOD 5C3IB 5B2JC 4J8VB 4J8WC 5GT0C 5AV5D 3VH6W 1WWIA 5CPJA 3LELD 1P3IB 1P3LA 5AVCD 4H9QB 3W96A 5B33C 3AZND 3AZED 5AV8A 3MNND 5JA4A 5AV6B 1AOID 5CPIC 1P3KA 1KX4A 3VH5T 5B40D 4XZQA 4LD9C 1B67A 3TU4D 2FJ7A 4Z5TA 3AZID 1U35B 3VH5W 5B2ID 4NE5A 5GXQA 3UTAD 3AZGB 1P3BD 1S32B 5B1MA 1JFIA 4H9OA 5AVBD 2CV5A 4NE6A 1F66C 5DNNA 4YM6A 4AWLB 3MVDB 3KWQD 4KUDA 1HQ3A 4CAYA 4J8VD 1P3OB 3KUYB 3UT9B 3B0CW 5B24B 3O62C 4J8UB 2YFVA 3MGPA 1KX3D 4QLCA 3UTBB 2BYKB 5GSUD 3AV2A 3B0BA 4Z2MG 4ZBJB 4YS3A 5CPJC 3WKJB 4H9RA 1M1AB 1P3LC 3W96C 2L5AA 1P3AB 2NQBD 2HIOA 3X1VD 3X1UB 1HTAA 3REHB 5CPKD 1EQZA 5AV5A 5B1LD 1P3KC 1KX4C 1A7WA 3AZHD 4XZQC 5AVCA 3KXBD 5B33B 4Z66B 3WTPB 1TZYB 5B0YD 5JRGA 3AV1D 5B1MC 1P3FA 2IO5C 1P3PB 3TU4A 3MGSC 3AZKB 3NQUB 3REKB 4J8UD 4J8XB 5BNVB 5DNNC 5B32B 5B2IA 4YM6C 1P3GB 3AZMC 4KUDC 1HQ3C 5B0ZB 3A6NB 1ULYA 3MGPC 4QLCC 5F99B 2PYOB 1P3AD 3KWQA 3X1UD 3AV2C 4YS3C 5CP6D 4ZUXA 3W97D 3LJAD 3O62B 1ID3B 3NQJB 4WV4B 2NZDC 4E44A 2HIOC 3AFAB 4WU8D 4UUZA 1EQZC 5AV5C 3AZFD 3AZJA 5AVCC 1M18A 3AZEC 2YFWA 1P34A 1P3PD 5AV8B 3MNNC 5JA4B 5B32D 5JRGC 4EO5B 3LZ1B 1P3MB 3AN2A 5B40C 5KDMA 3X1TD 3TU4C 3AYWD 4HGAC 2FJ7B 3AZIC 3B0DB 4Z5TB 5AY8B 1M19D 1BH8B 5B2IC 5GT0A 5GXQB 2AROB 2PYOD 5B31A 5B0YA 1JFIB 3REJD 4H9OB 2CV5B 2RVQD 4NE3A 5DNNB 4KGCB 3KWQC 1HQ3B 4LD9A 4ZUXC 2BYMB 3WA9D 5DNMD 5B31G 3MGRD 3LZ0D 5GSUC 3C1BA 4R8PD 3C1CA 5CP6A 4H9RB 3LJAA 1F66A 1P34C 3X1VC 5CPKC 1EQZB 3X1SA 5BS7C 3AZLD 3VH6T 3KXBC 3WAAA 5CHLB 4WU9A 3V9RA 3W98D 5B31C 5B0YC 3REID 5JRGB 2JSSA 2LY8A 3AYWA 1P3FB 4HGAB 1M19A 3W99B 2F8NB 4XUJD 3B6GD 1BH9A 4H9SC 5BO0B 3RELD 3C1BC 4X23A 3C1CC 5CP6C 5E5AA 5GT3D 5AV9A 3MGSA 3W97C 3LJAC 4JJND 3WA9A 1ZLAD 4G92B 3B0CT 3AZMA 4WU8C 4UUZB 3B6FB 1WWSA 4R8PA 4M6BA 3X1SC 4H9NB 3AZFC 4G91B 1P3ID 3AZJB 3WAAC 1M18B 2YFWB 4WU9C 1P34B 1KX5A 5AV6D 5BNXA 3W99D 3MGQA 3AZLA 3AN2B 3AYWC 2NZDA 5B2JB 1M19C 1U35D 4J8WB 3AZGD 5GT0B 3LELA 5B31B 3REIA 2HUEC 1S32D 4WNNB 3AZEA 3AZNA 3MNNA 4H9PB 1AOIA 3MVDD 5CPIB 5B40A 1P3OD 4X23C 3KUYD 3B6FD 5E5AC 1N1JA 5AV9C 4LD9B 3UT9D 3AZIA 5B24D 3WA9C 5DNMC 1H3OA 3MGRC 3UTBD 3UTAA 1P3BA 3LZ0C 1R4VA 3RELA 4R8PC 3WKJD 5AVBA 1M1AD 5G49B 4JJNA 1F66B 4J8VA 3REHD 1KX5C 3MGQC 5FUGB 3AZLC 3X1SB 1KX3A 4H9QA 5B33D 5GSUA 3W98C 4Z66D 3WTPD 3LELC 5CPJB 1TZYD 3REIC 1TAFA 5CPID 1P3LB 2F8NH 3AZNC 3W96B 2NQBA 2F8NK 3AZKD 3X1VA 3REKD 5CPKA 1U35A 4J8XD 3AZGA 5B1LA 1P3GD 1AOIC 5BS7A 3AZHA 1P3KB 1KX4B 4XZQB 5B0ZD 1S32A 3A6ND 3KXBA 2HUEB 4NFTA 3UTAC 1P3BC 5F99D 3B6GC 3AV1A 3RELC 1BH9B 5B1MB 1P3OA 2IO5B 5AVBC 5GT3C 5E5AB 5AV9B 3MGSB 4J8UA 4CSRA 3O62D 4JJNC 1ID3D 1ZLAC 4YM6B 5C3IC 3AFAD 3AZMB 4J8VC 4KUDB 4CAYB 1P3IC 1M1AA 1KX3C 2YFVB 3MGPB 1P3LD 4QLCB 3W96D 1P3AA 5AV8D 4H9SA 3X1UA 3VH6A 3REHA 1Q9CA 3AV2B 1KX5B 4YS3B 3MGQB 3W97A 3LZ1D 1P3MD 4KHAA 1P3KD 2NQBC 2FJ7D 2NZDB 2HIOB 4Z5TD 4WU8A 5AY8D 1U35C 3AZGC 5B1LC 5AV5B 5GXQD 2AROD 3AZHC 3AZFA 1TZYA 3LELB 1S32C 5AVCB 1P3PA 3AZEB 3AZNB 2CV5D 3VH5A 3MNNB 5B32A 5DNND 4AWLC 3AV1C 3MVDC 1P3GA 4KGCD 4KUDD 1HQ3D 5B40B 3X1TA 1P3OC 3TU4B 1N1JB 5B24C 4J8UC 3AZIB 3KSYA 3MGPD 5B2IB 3UTBC 1H3OB 3UTAB 5F99A 1P3BB 2PYOA 3AV2D 3REJA 4ZBJC 3WKJC 1M1AC 5B32G 1ID3A 1P3AC 3X1UC 3KWQB 3REHC 4WZSB 1EQZD 4DRAA 4ZUXB 5DNMA 1KX3B 3MGRA 3LZ0A 3WTPE 5GSUB 4Z66C 3WTPC 1TZYC 5JRGD 3LZ1A 1P3MA 1TAFB 1P3PC 1P3FD 3AZKC 2NQBB 5BT1D 3REKC 3X1VB 5AY8A 4J8XC 1BH8A 5B32C 5CPKB 1P3GC 2AROA 5B1LB 3R45A 3AZHB 5B0ZC 5KDMB 3A6NC 3X1TC 2F8ND 3KXBB 4Z2MH 4DRBA 3W98A 5F99C 2PYOC 4KGCA 5B0YB 3AV1B 3REJC 1KU5A 2RVQC 4ZUXD 2BYMA 1ID3C 4CSRB 3AFAC 3AZJD 1BFMA
chains in the Genus database with same CATH superfamily
1M18D 4XUJA 3B6GA 1P34D 5AV8C 1B6WA 3A1KA 3C1BB 3C1CB 5GT3A 4EO5C 5CP6B 3LZ1C 1P3MC 3W97B 4KHAB 3LJAB 3AN2D 1ZLAA 2FJ7C 3B0DC 4Z5TC 5AY8C 5B2JD 4WU8B 2G5IC 4J8WD 5GT0D 5GXQC 2AROC 1P3IA 5B31D 3AZFB 3WAAB 4WU9B 2CV5C 3V9RB 5AV6A 3W99A 4KGCC 2ZY2A 3X1TB 2F8NA 4LD9D 3AYWB 1M19B 5BO0A 3C1BD 3REJB 3C1CD 2G5HC 1F66D 4XUJC 3MVDA 2F8NG 4X23B 3KUYA 3B6FA 3UT9A 5B24A 4H9NA 3X1SD 3WA9B 5DNMB 3UTBA 3MGRB 3WAAD 2BYKA 3LZ0B 4WU9D 4E45A 4R8PB 3WKJA 5CPJD 2CWEA 3EPKA 1P3FC 5BT1C 5B2JA 5AV6C 4J8WA 3W99C 5BNXB 1KX4D 3AZLB 3R45B 4XZQD 4WNNA 5B33A 4DQYB 2Y2MA 4H9PA 2BG1A 3H0MC 4Z66A 3W98B 3WTPA 5CPIA 3REIB 3A1IA 2ZM5A 5B1MD 4X23D 3AZKA 5E5AD 5AV9D 3NQUA 3MGSD 3REKA 4J8XA 5BNVA 4G92C 4YM6D 1AOIB 3AZMD 5B0ZA 3A6NA 3KUYC 3B6FC 3UT9C 4G91C 3AZJC 5G49A 4QLCD 1M18C 4XUJB 1F1EA 3B6GB 3RELB 1KX5D 4YS3D 5FUGA 3MGQD 5AVBB 5GT3B 3O62A 3AN2C 4JJNB 3NQJA 1ZLAB 3AFAA 2NZDD 2HIOD 5C3IB 5B2JC 4J8VB 4J8WC 5GT0C 5AV5D 2Y2HA 3VH6W 1WWIA 5CPJA 2Y2JA 3LELD 1P3IB 1P3LA 5AVCD 4H9QB 3W96A 5B33C 3AZND 3AZED 5AV8A 3MNND 5JA4A 5AV6B 2Y2KA 1AOID 5CPIC 1P3KA 1KX4A 3VH5T 5B40D 4XZQA 4LD9C 1B67A 3TU4D 2FJ7A 4Z5TA 3AZID 2Y2QA 1U35B 3VH5W 5B2ID 4NE5A 5GXQA 3UTAD 3AZGB 1P3BD 1S32B 5B1MA 1JFIA 4H9OA 5AVBD 2CV5A 4NE6A 1F66C 5DNNA 2UWXA 4YM6A 4AWLB 3MVDB 3KWQD 4KUDA 1HQ3A 4CAYA 4J8VD 1P3OB 3KUYB 3UT9B 3B0CW 5B24B 3O62C 4J8UB 2YFVA 3MGPA 3H0LC 1KX3D 4QLCA 3UTBB 2BYKB 2W8SA 5GSUD 3AV2A 3B0BA 4Z2MG 4ZBJB 4YS3A 5CPJC 3WKJB 4H9RA 1M1AB 1P3LC 3W96C 2L5AA 1P3AB 2NQBD 2JE5A 2HIOA 3X1VD 3X1UB 1HTAA 3REHB 5CPKD 1EQZA 5AV5A 2J8PA 5B1LD 1P3KC 1KX4C 1A7WA 3AZHD 4XZQC 5AVCA 3KXBD 5B33B 2JCHA 2F2AC 2Y2OA 4Z66B 3WTPB 1TZYB 5B0YD 5JRGA 3AV1D 5B1MC 1P3FA 2IO5C 1P3PB 3TU4A 4WJ3C 3MGSC 3AZKB 3NQUB 3REKB 4J8UD 4J8XB 5BNVB 5DNNC 5B32B 5B2IA 4YM6C 1P3GB 3AZMC 4KUDC 1HQ3C 5B0ZB 3A6NB 1ULYA 3MGPC 4QLCC 5F99B 2PYOB 1P3AD 3KWQA 3X1UD 3AV2C 4YS3C 5CP6D 4ZUXA 3W97D 3P5JB 3LJAD 3O62B 1ID3B 3NQJB 2ZY4A 4WV4B 2NZDC 4E44A 2HIOC 3AFAB 4WU8D 4UUZA 1EQZC 5AV5C 3AZFD 3AZJA 5AVCC 1M18A 3AZEC 2YFWA 1P34A 1P3PD 5AV8B 3MNNC 5JA4B 5B32D 5JRGC 4EO5B 3LZ1B 1P3MB 3AN2A 5B40C 5KDMA 3X1TD 3TU4C 3AYWD 4HGAC 2FJ7B 3AZIC 3B0DB 4Z5TB 5AY8B 1M19D 1BH8B 5B2IC 5GT0A 2ZY3A 2AROB 5GXQB 2PYOD 5B31A 5B0YA 1JFIB 3REJD 4H9OB 2CV5B 1PZRA 2RVQD 4NE3A 5DNNB 4KGCB 3KWQC 1HQ3B 4LD9A 4ZUXC 2BYMB 2VQRA 3WA9D 3AL0C 5DNMD 5B31G 3MGRD 3LZ0D 5GSUC 3C1BA 4R8PD 3C1CA 5CP6A 4H9RB 3LJAA 1F66A 1Z2CB 1P34C 3X1VC 5CPKC 1EQZB 1W2EA 3X1SA 5BS7C 3AZLD 3VH6T 3KXBC 3WAAA 5CHLB 2XD1A 4WU9A 3V9RA 3W98D 5B31C 5B0YC 3REID 5JRGB 2JSSA 2LY8A 3AYWA 1P3FB 4HGAB 2Y2LA 1M19A 3W99B 2F8NB 3H0RC 2Y2PA 4XUJD 3B6GD 1BH9A 4H9SC 5BO0B 3RELD 3C1BC 2Y2NA 4X23A 3C1CC 5CP6C 5E5AA 5GT3D 5AV9A 3MGSA 3W97C 3LJAC 4JJND 3WA9A 1ZLAD 4G92B 3B0CT 3AZMA 2XD5A 4WU8C 4UUZB 3B6FB 1WWSA 4R8PA 4M6BA 3X1SC 4H9NB 3AZFC 4G91B 1P3ID 3AZJB 3WAAC 3FDDA 1M18B 2YFWB 4WU9C 1P34B 1KX5A 5AV6D 5BNXA 3EPLA 3W99D 3MGQA 3AZLA 3AN2B 3AYWC 2NZDA 5B2JB 1M19C 1U35D 4J8WB 3AZGD 5GT0B 3LELA 5B31B 3REIA 2HUEC 1S32D 4WNNB 3AZEA 3AZNA 3MNNA 4H9PB 2FFFB 1AOIA 3MVDD 5CPIB 5B40A 1P3OD 4X23C 3KUYD 3B6FD 5E5AC 1N1JA 5AV9C 4LD9B 3UT9D 3AZIA 5B24D 3WA9C 5DNMC 1H3OA 3MGRC 3UTBD 3UTAA 1P3BA 3LZ0C 1R4VA 3RELA 4R8PC 3WKJD 5AVBA 2DF4C 1M1AD 5G49B 4JJNA 1F66B 4J8VA 3REHD 1KX5C 3MGQC 5FUGB 3AZLC 3X1SB 1KX3A 4H9QA 5B33D 5GSUA 3W98C 4Z66D 3WTPD 3LELC 5CPJB 1TZYD 3REIC 1TAFA 5CPID 1P3LB 1T3UA 2F8NH 3AZNC 3W96B 2NQBA 2F8NK 3AZKD 3X1VA 3REKD 5CPKA 1U35A 4J8XD 3AZGA 3EG5B 5B1LA 1P3GD 1AOIC 5BS7A 3AZHA 1P3KB 1KX4B 4XZQB 5B0ZD 1S32A 3A6ND 3KXBA 2HUEB 2Y2IA 4NFTA 3UTAC 1P3BC 5F99D 3B6GC 3AV1A 3RELC 1BH9B 5B1MB 1P3OA 2IO5B 5AVBC 5GT3C 5E5AB 5AV9B 3MGSB 4J8UA 4CSRA 3O62D 4JJNC 1ID3D 1ZLAC 4YM6B 5C3IC 3AFAD 3AZMB 3F6TA 3IP4C 4J8VC 4KUDB 4CAYB 1P3IC 1M1AA 1KX3C 2YFVB 3MGPB 1P3LD 4QLCB 3W96D 1P3AA 5AV8D 4H9SA 3X1UA 3VH6A 3REHA 1Q9CA 3AV2B 1KX5B 4YS3B 3MGQB 3W97A 3LZ1D 1P3MD 4KHAA 1P3KD 2NQBC 2FJ7D 2NZDB 2HIOB 4Z5TD 4WU8A 5AY8D 1U35C 3AZGC 5B1LC 5AV5B 5GXQD 2AROD 3AZHC 3AZFA 1TZYA 3LELB 1S32C 2Y2GA 5AVCB 1P3PA 3AZEB 3AZNB 2CV5D 3VH5A 3MNNB 2RIQA 5B32A 5DNND 4AWLC 3AV1C 3MVDC 1P3GA 4KGCD 4KUDD 1HQ3D 5B40B 3X1TA 1P3OC 3TU4B 1N1JB 5B24C 4J8UC 3AZIB 3KSYA 3MGPD 5B2IB 2ZY5A 3UTBC 1H3OB 3UTAB 5F99A 1P3BB 2PYOA 3AV2D 3REJA 4ZBJC 3WKJC 1M1AC 2DQNC 5B32G 1ID3A 1P3AC 3X1UC 3KWQB 3REHC 4WZSB 1EQZD 4DRAA 4ZUXB 5DNMA 1KX3B 3MGRA 3LZ0A 3WTPE 5GSUB 4Z66C 3WTPC 1TZYC 5JRGD 3LZ1A 1P3MA 1TAFB 1P3PC 1P3FD 3AZKC 2NQBB 5BT1D 3REKC 3X1VB 5AY8A 4J8XC 1BH8A 5B32C 5CPKB 1P3GC 2AROA 5B1LB 3R45A 3AZHB 5B0ZC 5KDMB 3A6NC 3X1TC 2F8ND 3KXBB 4Z2MH 4DRBA 3W98A 5F99C 2PYOC 4KGCA 5B0YB 3AV1B 3REJC 1KU5A 2RVQC 4ZUXD 2BYMA 1ID3C 4CSRB 3AFAC 4UPKA 3KFUG 3EPJA 3EPHA 3AZJD 1BFMA
chains in the Genus database with same CATH topology
1M18D 4XUJA 3B6GA 1P34D 5AV8C 1B6WA 3A1KA 3C1BB 3C1CB 5GT3A 4EO5C 5CP6B 3LZ1C 1P3MC 3W97B 4KHAB 3LJAB 3AN2D 1ZLAA 2FJ7C 3B0DC 4Z5TC 5AY8C 5B2JD 4WU8B 2G5IC 4J8WD 5GT0D 5GXQC 2AROC 1P3IA 5B31D 3AZFB 3WAAB 4WU9B 2CV5C 3V9RB 5AV6A 3W99A 4KGCC 2ZY2A 3X1TB 2F8NA 4LD9D 3AYWB 1M19B 5BO0A 3C1BD 3REJB 3C1CD 2G5HC 1F66D 4XUJC 3MVDA 2F8NG 4X23B 3KUYA 3B6FA 3UT9A 5B24A 4H9NA 3X1SD 3WA9B 5DNMB 3UTBA 3MGRB 3WAAD 2BYKA 3LZ0B 4WU9D 4E45A 4R8PB 3WKJA 5CPJD 2CWEA 3EPKA 1P3FC 5BT1C 5B2JA 5AV6C 4J8WA 3W99C 5BNXB 1KX4D 3AZLB 3R45B 4XZQD 4WNNA 5B33A 4DQYB 2Y2MA 4H9PA 2BG1A 3H0MC 4Z66A 3W98B 3WTPA 5CPIA 3REIB 3A1IA 2ZM5A 5B1MD 4X23D 3AZKA 5E5AD 5AV9D 3NQUA 3MGSD 3REKA 4J8XA 5BNVA 4G92C 4YM6D 1AOIB 3AZMD 5B0ZA 3A6NA 3KUYC 3B6FC 3UT9C 4G91C 3AZJC 5G49A 4QLCD 1M18C 4XUJB 1F1EA 3B6GB 3RELB 1KX5D 4YS3D 5FUGA 3MGQD 5AVBB 5GT3B 3O62A 3AN2C 4JJNB 3NQJA 1ZLAB 3AFAA 2NZDD 2HIOD 5C3IB 5B2JC 4J8VB 4J8WC 5GT0C 5AV5D 2Y2HA 3VH6W 1WWIA 5CPJA 2Y2JA 3LELD 1P3IB 1P3LA 5AVCD 4H9QB 3W96A 5B33C 3AZND 3AZED 5AV8A 3MNND 5JA4A 5AV6B 2Y2KA 1AOID 5CPIC 1P3KA 1KX4A 3VH5T 5B40D 4XZQA 4LD9C 1B67A 3TU4D 2FJ7A 4Z5TA 3AZID 2Y2QA 1U35B 3VH5W 5B2ID 4NE5A 5GXQA 3UTAD 3AZGB 1P3BD 1S32B 5B1MA 1JFIA 4H9OA 5AVBD 2CV5A 4NE6A 1F66C 5DNNA 2UWXA 4YM6A 4AWLB 3MVDB 3KWQD 4KUDA 1HQ3A 4CAYA 4J8VD 1P3OB 3KUYB 3UT9B 3B0CW 5B24B 3O62C 4J8UB 2YFVA 3MGPA 3H0LC 1KX3D 4QLCA 3UTBB 2BYKB 2W8SA 5GSUD 3AV2A 3B0BA 4Z2MG 4ZBJB 4YS3A 5CPJC 3WKJB 4H9RA 1M1AB 1P3LC 3W96C 2L5AA 1P3AB 2NQBD 2JE5A 2HIOA 3X1VD 3X1UB 1HTAA 3REHB 5CPKD 1EQZA 5AV5A 2J8PA 5B1LD 1P3KC 1KX4C 1A7WA 3AZHD 4XZQC 5AVCA 3KXBD 5B33B 2JCHA 2F2AC 2Y2OA 4Z66B 3WTPB 1TZYB 5B0YD 5JRGA 3AV1D 5B1MC 1P3FA 2IO5C 1P3PB 3TU4A 4WJ3C 3MGSC 3AZKB 3NQUB 3REKB 4J8UD 4J8XB 5BNVB 5DNNC 5B32B 5B2IA 4YM6C 1P3GB 3AZMC 4KUDC 1HQ3C 5B0ZB 3A6NB 1ULYA 3MGPC 4QLCC 5F99B 2PYOB 1P3AD 3KWQA 3X1UD 3AV2C 4YS3C 5CP6D 4ZUXA 3W97D 3P5JB 3LJAD 3O62B 1ID3B 3NQJB 2ZY4A 4WV4B 2NZDC 4E44A 2HIOC 3AFAB 4WU8D 4UUZA 1EQZC 5AV5C 3AZFD 3AZJA 5AVCC 1M18A 3AZEC 2YFWA 1P34A 1P3PD 5AV8B 3MNNC 5JA4B 5B32D 5JRGC 4EO5B 3LZ1B 1P3MB 3AN2A 5B40C 5KDMA 3X1TD 3TU4C 3AYWD 4HGAC 2FJ7B 3AZIC 3B0DB 4Z5TB 5AY8B 1M19D 1BH8B 5B2IC 5GT0A 2ZY3A 2AROB 5GXQB 2PYOD 5B31A 5B0YA 1JFIB 3REJD 4H9OB 2CV5B 1PZRA 2RVQD 4NE3A 5DNNB 4KGCB 3KWQC 1HQ3B 4LD9A 4ZUXC 2BYMB 2VQRA 3WA9D 3AL0C 5DNMD 5B31G 3MGRD 3LZ0D 5GSUC 3C1BA 4R8PD 3C1CA 5CP6A 4H9RB 3LJAA 1F66A 1Z2CB 1P34C 3X1VC 5CPKC 1EQZB 1W2EA 3X1SA 5BS7C 3AZLD 3VH6T 3KXBC 3WAAA 5CHLB 2XD1A 4WU9A 3V9RA 3W98D 5B31C 5B0YC 3REID 5JRGB 2JSSA 2LY8A 3AYWA 1P3FB 4HGAB 2Y2LA 1M19A 3W99B 2F8NB 3H0RC 2Y2PA 4XUJD 3B6GD 1BH9A 4H9SC 5BO0B 3RELD 3C1BC 2Y2NA 4X23A 3C1CC 5CP6C 5E5AA 5GT3D 5AV9A 3MGSA 3W97C 3LJAC 4JJND 3WA9A 1ZLAD 4G92B 3B0CT 3AZMA 2XD5A 4WU8C 4UUZB 3B6FB 1WWSA 4R8PA 4M6BA 3X1SC 4H9NB 3AZFC 4G91B 1P3ID 3AZJB 3WAAC 3FDDA 1M18B 2YFWB 4WU9C 1P34B 1KX5A 5AV6D 5BNXA 3EPLA 3W99D 3MGQA 3AZLA 3AN2B 3AYWC 2NZDA 5B2JB 1M19C 1U35D 4J8WB 3AZGD 5GT0B 3LELA 5B31B 3REIA 2HUEC 1S32D 4WNNB 3AZEA 3AZNA 3MNNA 4H9PB 2FFFB 1AOIA 3MVDD 5CPIB 5B40A 1P3OD 4X23C 3KUYD 3B6FD 5E5AC 1N1JA 5AV9C 4LD9B 3UT9D 3AZIA 5B24D 3WA9C 5DNMC 1H3OA 3MGRC 3UTBD 3UTAA 1P3BA 3LZ0C 1R4VA 3RELA 4R8PC 3WKJD 5AVBA 2DF4C 1M1AD 5G49B 4JJNA 1F66B 4J8VA 3REHD 1KX5C 3MGQC 5FUGB 3AZLC 3X1SB 1KX3A 4H9QA 5B33D 5GSUA 3W98C 4Z66D 3WTPD 3LELC 5CPJB 1TZYD 3REIC 1TAFA 5CPID 1P3LB 1T3UA 2F8NH 3AZNC 3W96B 2NQBA 2F8NK 3AZKD 3X1VA 3REKD 5CPKA 1U35A 4J8XD 3AZGA 3EG5B 5B1LA 1P3GD 1AOIC 5BS7A 3AZHA 1P3KB 1KX4B 4XZQB 5B0ZD 1S32A 3A6ND 3KXBA 2HUEB 2Y2IA 4NFTA 3UTAC 1P3BC 5F99D 3B6GC 3AV1A 3RELC 1BH9B 5B1MB 1P3OA 2IO5B 5AVBC 5GT3C 5E5AB 5AV9B 3MGSB 4J8UA 4CSRA 3O62D 4JJNC 1ID3D 1ZLAC 4YM6B 5C3IC 3AFAD 3AZMB 3F6TA 3IP4C 4J8VC 4KUDB 4CAYB 1P3IC 1M1AA 1KX3C 2YFVB 3MGPB 1P3LD 4QLCB 3W96D 1P3AA 5AV8D 4H9SA 3X1UA 3VH6A 3REHA 1Q9CA 3AV2B 1KX5B 4YS3B 3MGQB 3W97A 3LZ1D 1P3MD 4KHAA 1P3KD 2NQBC 2FJ7D 2NZDB 2HIOB 4Z5TD 4WU8A 5AY8D 1U35C 3AZGC 5B1LC 5AV5B 5GXQD 2AROD 3AZHC 3AZFA 1TZYA 3LELB 1S32C 2Y2GA 5AVCB 1P3PA 3AZEB 3AZNB 2CV5D 3VH5A 3MNNB 2RIQA 5B32A 5DNND 4AWLC 3AV1C 3MVDC 1P3GA 4KGCD 4KUDD 1HQ3D 5B40B 3X1TA 1P3OC 3TU4B 1N1JB 5B24C 4J8UC 3AZIB 3KSYA 3MGPD 5B2IB 2ZY5A 3UTBC 1H3OB 3UTAB 5F99A 1P3BB 2PYOA 3AV2D 3REJA 4ZBJC 3WKJC 1M1AC 2DQNC 5B32G 1ID3A 1P3AC 3X1UC 3KWQB 3REHC 4WZSB 1EQZD 4DRAA 4ZUXB 5DNMA 1KX3B 3MGRA 3LZ0A 3WTPE 5GSUB 4Z66C 3WTPC 1TZYC 5JRGD 3LZ1A 1P3MA 1TAFB 1P3PC 1P3FD 3AZKC 2NQBB 5BT1D 3REKC 3X1VB 5AY8A 4J8XC 1BH8A 5B32C 5CPKB 1P3GC 2AROA 5B1LB 3R45A 3AZHB 5B0ZC 5KDMB 3A6NC 3X1TC 2F8ND 3KXBB 4Z2MH 4DRBA 3W98A 5F99C 2PYOC 4KGCA 5B0YB 3AV1B 3REJC 1KU5A 2RVQC 4ZUXD 2BYMA 1ID3C 4CSRB 3AFAC 4UPKA 3KFUG 3EPJA 3EPHA 3AZJD 1BFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M18 D;  4XUJ A;  3B6G A;  1P34 D;  5AV8 C;  1B6W A;  3C1B B;  3C1C B;  5GT3 A;  4EO5 C;  5CP6 B;  3LZ1 C;  1P3M C;  3W97 B;  4KHA B;  3LJA B;  3AN2 D;  1ZLA A;  2FJ7 C;  3B0D C;  4Z5T C;  5AY8 C;  5B2J D;  4WU8 B;  4J8W D;  5GT0 D;  5GXQ C;  2ARO C;  1P3I A;  5B31 D;  3AZF B;  3WAA B;  4WU9 B;  2CV5 C;  3V9R B;  5AV6 A;  3W99 A;  4KGC C;  3X1T B;  2F8N A;  4LD9 D;  3AYW B;  1M19 B;  5BO0 A;  3C1B D;  3REJ B;  3C1C D;  1F66 D;  4XUJ C;  3MVD A;  2F8N G;  4X23 B;  3KUY A;  3B6F A;  3UT9 A;  5B24 A;  4H9N A;  3X1S D;  3WA9 B;  5DNM B;  3UTB A;  3MGR B;  3WAA D;  2BYK A;  3LZ0 B;  4WU9 D;  4E45 A;  4R8P B;  3WKJ A;  5CPJ D;  2CWE A;  1P3F C;  5BT1 C;  5B2J A;  5AV6 C;  4J8W A;  3W99 C;  5BNX B;  1KX4 D;  3AZL B;  3R45 B;  4XZQ D;  4WNN A;  5B33 A;  4H9P A;  3W98 B;  4Z66 A;  3WTP A;  5CPI A;  3REI B;  5B1M D;  4X23 D;  3AZK A;  5E5A D;  5AV9 D;  3NQU A;  3MGS D;  3REK A;  4J8X A;  5BNV A;  4G92 C;  4YM6 D;  1AOI B;  3AZM D;  5B0Z A;  3A6N A;  3KUY C;  3B6F C;  3UT9 C;  4G91 C;  3AZJ C;  5G49 A;  4QLC D;  1M18 C;  4XUJ B;  1F1E A;  3B6G B;  3REL B;  1KX5 D;  4YS3 D;  5FUG A;  3MGQ D;  5AVB B;  5GT3 B;  3O62 A;  3AN2 C;  4JJN B;  3NQJ A;  1ZLA B;  3AFA A;  2NZD D;  2HIO D;  5C3I B;  5B2J C;  4J8V B;  4J8W C;  5GT0 C;  5AV5 D;  3VH6 W;  1WWI A;  5CPJ A;  3LEL D;  1P3I B;  1P3L A;  5AVC D;  4H9Q B;  3W96 A;  5B33 C;  3AZN D;  3AZE D;  5AV8 A;  3MNN D;  5JA4 A;  5AV6 B;  1AOI D;  5CPI C;  1P3K A;  1KX4 A;  3VH5 T;  5B40 D;  4XZQ A;  4LD9 C;  1B67 A;  3TU4 D;  2FJ7 A;  4Z5T A;  3AZI D;  1U35 B;  3VH5 W;  5B2I D;  4NE5 A;  5GXQ A;  3UTA D;  3AZG B;  1P3B D;  1S32 B;  5B1M A;  1JFI A;  4H9O A;  5AVB D;  2CV5 A;  4NE6 A;  1F66 C;  5DNN A;  4YM6 A;  4AWL B;  3MVD B;  3KWQ D;  4KUD A;  1HQ3 A;  4CAY A;  4J8V D;  1P3O B;  3KUY B;  3UT9 B;  3B0C W;  5B24 B;  3O62 C;  4J8U B;  2YFV A;  3MGP A;  1KX3 D;  4QLC A;  3UTB B;  2BYK B;  5GSU D;  3AV2 A;  3B0B A;  4Z2M G;  4ZBJ B;  4YS3 A;  5CPJ C;  3WKJ B;  4H9R A;  1M1A B;  1P3L C;  3W96 C;  2L5A A;  1P3A B;  2NQB D;  2HIO A;  3X1V D;  3X1U B;  1HTA A;  3REH B;  5CPK D;  1EQZ A;  5AV5 A;  5B1L D;  1P3K C;  1KX4 C;  1A7W A;  3AZH D;  4XZQ C;  5AVC A;  3KXB D;  5B33 B;  4Z66 B;  3WTP B;  1TZY B;  5B0Y D;  5JRG A;  3AV1 D;  5B1M C;  1P3F A;  2IO5 C;  1P3P B;  3TU4 A;  3MGS C;  3AZK B;  3NQU B;  3REK B;  4J8U D;  4J8X B;  5BNV B;  5DNN C;  5B32 B;  5B2I A;  4YM6 C;  1P3G B;  3AZM C;  4KUD C;  1HQ3 C;  5B0Z B;  3A6N B;  1ULY A;  3MGP C;  4QLC C;  5F99 B;  2PYO B;  1P3A D;  3KWQ A;  3X1U D;  3AV2 C;  4YS3 C;  5CP6 D;  4ZUX A;  3W97 D;  3LJA D;  3O62 B;  1ID3 B;  3NQJ B;  4WV4 B;  2NZD C;  4E44 A;  2HIO C;  3AFA B;  4WU8 D;  4UUZ A;  1EQZ C;  5AV5 C;  3AZF D;  3AZJ A;  5AVC C;  1M18 A;  3AZE C;  2YFW A;  1P34 A;  1P3P D;  5AV8 B;  3MNN C;  5JA4 B;  5B32 D;  5JRG C;  4EO5 B;  3LZ1 B;  1P3M B;  3AN2 A;  5B40 C;  5KDM A;  3X1T D;  3TU4 C;  3AYW D;  4HGA C;  2FJ7 B;  3AZI C;  3B0D B;  4Z5T B;  5AY8 B;  1M19 D;  1BH8 B;  5B2I C;  5GT0 A;  5GXQ B;  2ARO B;  2PYO D;  5B31 A;  5B0Y A;  1JFI B;  3REJ D;  4H9O B;  2CV5 B;  2RVQ D;  4NE3 A;  5DNN B;  4KGC B;  3KWQ C;  1HQ3 B;  4LD9 A;  4ZUX C;  2BYM B;  3WA9 D;  5DNM D;  5B31 G;  3MGR D;  3LZ0 D;  5GSU C;  3C1B A;  4R8P D;  3C1C A;  5CP6 A;  4H9R B;  3LJA A;  1F66 A;  1P34 C;  3X1V C;  5CPK C;  1EQZ B;  3X1S A;  5BS7 C;  3AZL D;  3VH6 T;  3KXB C;  3WAA A;  5CHL B;  4WU9 A;  3V9R A;  3W98 D;  5B31 C;  5B0Y C;  3REI D;  5JRG B;  2JSS A;  2LY8 A;  3AYW A;  1P3F B;  4HGA B;  1M19 A;  3W99 B;  2F8N B;  4XUJ D;  3B6G D;  1BH9 A;  4H9S C;  5BO0 B;  3REL D;  3C1B C;  4X23 A;  3C1C C;  5CP6 C;  5E5A A;  5GT3 D;  5AV9 A;  3MGS A;  3W97 C;  3LJA C;  4JJN D;  3WA9 A;  1ZLA D;  4G92 B;  3B0C T;  3AZM A;  4WU8 C;  4UUZ B;  3B6F B;  1WWS A;  4R8P A;  4M6B A;  3X1S C;  4H9N B;  3AZF C;  4G91 B;  1P3I D;  3AZJ B;  3WAA C;  1M18 B;  2YFW B;  4WU9 C;  1P34 B;  1KX5 A;  5AV6 D;  5BNX A;  3W99 D;  3MGQ A;  3AZL A;  3AN2 B;  3AYW C;  2NZD A;  5B2J B;  1M19 C;  1U35 D;  4J8W B;  3AZG D;  5GT0 B;  3LEL A;  5B31 B;  3REI A;  2HUE C;  1S32 D;  4WNN B;  3AZE A;  3AZN A;  3MNN A;  4H9P B;  1AOI A;  3MVD D;  5CPI B;  5B40 A;  1P3O D;  4X23 C;  3KUY D;  3B6F D;  5E5A C;  1N1J A;  5AV9 C;  4LD9 B;  3UT9 D;  3AZI A;  5B24 D;  3WA9 C;  5DNM C;  1H3O A;  3MGR C;  3UTB D;  3UTA A;  1P3B A;  3LZ0 C;  1R4V A;  3REL A;  4R8P C;  3WKJ D;  5AVB A;  1M1A D;  5G49 B;  4JJN A;  1F66 B;  4J8V A;  3REH D;  1KX5 C;  3MGQ C;  5FUG B;  3AZL C;  3X1S B;  1KX3 A;  4H9Q A;  5B33 D;  5GSU A;  3W98 C;  4Z66 D;  3WTP D;  3LEL C;  5CPJ B;  1TZY D;  3REI C;  1TAF A;  5CPI D;  1P3L B;  2F8N H;  3AZN C;  3W96 B;  2NQB A;  2F8N K;  3AZK D;  3X1V A;  3REK D;  5CPK A;  1U35 A;  4J8X D;  3AZG A;  5B1L A;  1P3G D;  1AOI C;  5BS7 A;  3AZH A;  1P3K B;  1KX4 B;  4XZQ B;  5B0Z D;  1S32 A;  3A6N D;  3KXB A;  2HUE B;  4NFT A;  3UTA C;  1P3B C;  5F99 D;  3B6G C;  3AV1 A;  3REL C;  1BH9 B;  5B1M B;  1P3O A;  2IO5 B;  5AVB C;  5GT3 C;  5E5A B;  5AV9 B;  3MGS B;  4J8U A;  4CSR A;  3O62 D;  4JJN C;  1ID3 D;  1ZLA C;  4YM6 B;  5C3I C;  3AFA D;  3AZM B;  4J8V C;  4KUD B;  4CAY B;  1P3I C;  1M1A A;  1KX3 C;  2YFV B;  3MGP B;  1P3L D;  4QLC B;  3W96 D;  1P3A A;  5AV8 D;  4H9S A;  3X1U A;  3VH6 A;  3REH A;  1Q9C A;  3AV2 B;  1KX5 B;  4YS3 B;  3MGQ B;  3W97 A;  3LZ1 D;  1P3M D;  4KHA A;  1P3K D;  2NQB C;  2FJ7 D;  2NZD B;  2HIO B;  4Z5T D;  4WU8 A;  5AY8 D;  1U35 C;  3AZG C;  5B1L C;  5AV5 B;  5GXQ D;  2ARO D;  3AZH C;  3AZF A;  1TZY A;  3LEL B;  1S32 C;  5AVC B;  1P3P A;  3AZE B;  3AZN B;  2CV5 D;  3VH5 A;  3MNN B;  5B32 A;  5DNN D;  4AWL C;  3AV1 C;  3MVD C;  1P3G A;  4KGC D;  4KUD D;  1HQ3 D;  5B40 B;  3X1T A;  1P3O C;  3TU4 B;  1N1J B;  5B24 C;  4J8U C;  3AZI B;  3KSY A;  3MGP D;  5B2I B;  3UTB C;  1H3O B;  3UTA B;  5F99 A;  1P3B B;  2PYO A;  3AV2 D;  3REJ A;  4ZBJ C;  3WKJ C;  1M1A C;  5B32 G;  1ID3 A;  1P3A C;  3X1U C;  3KWQ B;  3REH C;  4WZS B;  1EQZ D;  4DRA A;  4ZUX B;  5DNM A;  1KX3 B;  3MGR A;  3LZ0 A;  3WTP E;  5GSU B;  4Z66 C;  3WTP C;  1TZY C;  5JRG D;  3LZ1 A;  1P3M A;  1TAF B;  1P3P C;  1P3F D;  3AZK C;  2NQB B;  5BT1 D;  3REK C;  3X1V B;  5AY8 A;  4J8X C;  1BH8 A;  5B32 C;  5CPK B;  1P3G C;  2ARO A;  5B1L B;  3R45 A;  3AZH B;  5B0Z C;  5KDM B;  3A6N C;  3X1T C;  2F8N D;  3KXB B;  4Z2M H;  4DRB A;  3W98 A;  5F99 C;  2PYO C;  4KGC A;  5B0Y B;  3AV1 B;  3REJ C;  1KU5 A;  2RVQ C;  4ZUX D;  2BYM A;  1ID3 C;  4CSR B;  3AFA C;  3AZJ D;  1BFM A; 
#chains in the Genus database with same CATH topology
 1M18 D;  4XUJ A;  3B6G A;  1P34 D;  5AV8 C;  1B6W A;  3A1K A;  3C1B B;  3C1C B;  5GT3 A;  4EO5 C;  5CP6 B;  3LZ1 C;  1P3M C;  3W97 B;  4KHA B;  3LJA B;  3AN2 D;  1ZLA A;  2FJ7 C;  3B0D C;  4Z5T C;  5AY8 C;  5B2J D;  4WU8 B;  2G5I C;  4J8W D;  5GT0 D;  5GXQ C;  2ARO C;  1P3I A;  5B31 D;  3AZF B;  3WAA B;  4WU9 B;  2CV5 C;  3V9R B;  5AV6 A;  3W99 A;  4KGC C;  2ZY2 A;  3X1T B;  2F8N A;  4LD9 D;  3AYW B;  1M19 B;  5BO0 A;  3C1B D;  3REJ B;  3C1C D;  2G5H C;  1F66 D;  4XUJ C;  3MVD A;  2F8N G;  4X23 B;  3KUY A;  3B6F A;  3UT9 A;  5B24 A;  4H9N A;  3X1S D;  3WA9 B;  5DNM B;  3UTB A;  3MGR B;  3WAA D;  2BYK A;  3LZ0 B;  4WU9 D;  4E45 A;  4R8P B;  3WKJ A;  5CPJ D;  2CWE A;  3EPK A;  1P3F C;  5BT1 C;  5B2J A;  5AV6 C;  4J8W A;  3W99 C;  5BNX B;  1KX4 D;  3AZL B;  3R45 B;  4XZQ D;  4WNN A;  5B33 A;  4DQY B;  2Y2M A;  4H9P A;  2BG1 A;  3H0M C;  4Z66 A;  3W98 B;  3WTP A;  5CPI A;  3REI B;  3A1I A;  2ZM5 A;  5B1M D;  4X23 D;  3AZK A;  5E5A D;  5AV9 D;  3NQU A;  3MGS D;  3REK A;  4J8X A;  5BNV A;  4G92 C;  4YM6 D;  1AOI B;  3AZM D;  5B0Z A;  3A6N A;  3KUY C;  3B6F C;  3UT9 C;  4G91 C;  3AZJ C;  5G49 A;  4QLC D;  1M18 C;  4XUJ B;  1F1E A;  3B6G B;  3REL B;  1KX5 D;  4YS3 D;  5FUG A;  3MGQ D;  5AVB B;  5GT3 B;  3O62 A;  3AN2 C;  4JJN B;  3NQJ A;  1ZLA B;  3AFA A;  2NZD D;  2HIO D;  5C3I B;  5B2J C;  4J8V B;  4J8W C;  5GT0 C;  5AV5 D;  2Y2H A;  3VH6 W;  1WWI A;  5CPJ A;  2Y2J A;  3LEL D;  1P3I B;  1P3L A;  5AVC D;  4H9Q B;  3W96 A;  5B33 C;  3AZN D;  3AZE D;  5AV8 A;  3MNN D;  5JA4 A;  5AV6 B;  2Y2K A;  1AOI D;  5CPI C;  1P3K A;  1KX4 A;  3VH5 T;  5B40 D;  4XZQ A;  4LD9 C;  1B67 A;  3TU4 D;  2FJ7 A;  4Z5T A;  3AZI D;  2Y2Q A;  1U35 B;  3VH5 W;  5B2I D;  4NE5 A;  5GXQ A;  3UTA D;  3AZG B;  1P3B D;  1S32 B;  5B1M A;  1JFI A;  4H9O A;  5AVB D;  2CV5 A;  4NE6 A;  1F66 C;  5DNN A;  2UWX A;  4YM6 A;  4AWL B;  3MVD B;  3KWQ D;  4KUD A;  1HQ3 A;  4CAY A;  4J8V D;  1P3O B;  3KUY B;  3UT9 B;  3B0C W;  5B24 B;  3O62 C;  4J8U B;  2YFV A;  3MGP A;  3H0L C;  1KX3 D;  4QLC A;  3UTB B;  2BYK B;  2W8S A;  5GSU D;  3AV2 A;  3B0B A;  4Z2M G;  4ZBJ B;  4YS3 A;  5CPJ C;  3WKJ B;  4H9R A;  1M1A B;  1P3L C;  3W96 C;  2L5A A;  1P3A B;  2NQB D;  2JE5 A;  2HIO A;  3X1V D;  3X1U B;  1HTA A;  3REH B;  5CPK D;  1EQZ A;  5AV5 A;  2J8P A;  5B1L D;  1P3K C;  1KX4 C;  1A7W A;  3AZH D;  4XZQ C;  5AVC A;  3KXB D;  5B33 B;  2JCH A;  2F2A C;  2Y2O A;  4Z66 B;  3WTP B;  1TZY B;  5B0Y D;  5JRG A;  3AV1 D;  5B1M C;  1P3F A;  2IO5 C;  1P3P B;  3TU4 A;  4WJ3 C;  3MGS C;  3AZK B;  3NQU B;  3REK B;  4J8U D;  4J8X B;  5BNV B;  5DNN C;  5B32 B;  5B2I A;  4YM6 C;  1P3G B;  3AZM C;  4KUD C;  1HQ3 C;  5B0Z B;  3A6N B;  1ULY A;  3MGP C;  4QLC C;  5F99 B;  2PYO B;  1P3A D;  3KWQ A;  3X1U D;  3AV2 C;  4YS3 C;  5CP6 D;  4ZUX A;  3W97 D;  3P5J B;  3LJA D;  3O62 B;  1ID3 B;  3NQJ B;  2ZY4 A;  4WV4 B;  2NZD C;  4E44 A;  2HIO C;  3AFA B;  4WU8 D;  4UUZ A;  1EQZ C;  5AV5 C;  3AZF D;  3AZJ A;  5AVC C;  1M18 A;  3AZE C;  2YFW A;  1P34 A;  1P3P D;  5AV8 B;  3MNN C;  5JA4 B;  5B32 D;  5JRG C;  4EO5 B;  3LZ1 B;  1P3M B;  3AN2 A;  5B40 C;  5KDM A;  3X1T D;  3TU4 C;  3AYW D;  4HGA C;  2FJ7 B;  3AZI C;  3B0D B;  4Z5T B;  5AY8 B;  1M19 D;  1BH8 B;  5B2I C;  5GT0 A;  2ZY3 A;  2ARO B;  5GXQ B;  2PYO D;  5B31 A;  5B0Y A;  1JFI B;  3REJ D;  4H9O B;  2CV5 B;  1PZR A;  2RVQ D;  4NE3 A;  5DNN B;  4KGC B;  3KWQ C;  1HQ3 B;  4LD9 A;  4ZUX C;  2BYM B;  2VQR A;  3WA9 D;  3AL0 C;  5DNM D;  5B31 G;  3MGR D;  3LZ0 D;  5GSU C;  3C1B A;  4R8P D;  3C1C A;  5CP6 A;  4H9R B;  3LJA A;  1F66 A;  1Z2C B;  1P34 C;  3X1V C;  5CPK C;  1EQZ B;  1W2E A;  3X1S A;  5BS7 C;  3AZL D;  3VH6 T;  3KXB C;  3WAA A;  5CHL B;  2XD1 A;  4WU9 A;  3V9R A;  3W98 D;  5B31 C;  5B0Y C;  3REI D;  5JRG B;  2JSS A;  2LY8 A;  3AYW A;  1P3F B;  4HGA B;  2Y2L A;  1M19 A;  3W99 B;  2F8N B;  3H0R C;  2Y2P A;  4XUJ D;  3B6G D;  1BH9 A;  4H9S C;  5BO0 B;  3REL D;  3C1B C;  2Y2N A;  4X23 A;  3C1C C;  5CP6 C;  5E5A A;  5GT3 D;  5AV9 A;  3MGS A;  3W97 C;  3LJA C;  4JJN D;  3WA9 A;  1ZLA D;  4G92 B;  3B0C T;  3AZM A;  2XD5 A;  4WU8 C;  4UUZ B;  3B6F B;  1WWS A;  4R8P A;  4M6B A;  3X1S C;  4H9N B;  3AZF C;  4G91 B;  1P3I D;  3AZJ B;  3WAA C;  3FDD A;  1M18 B;  2YFW B;  4WU9 C;  1P34 B;  1KX5 A;  5AV6 D;  5BNX A;  3EPL A;  3W99 D;  3MGQ A;  3AZL A;  3AN2 B;  3AYW C;  2NZD A;  5B2J B;  1M19 C;  1U35 D;  4J8W B;  3AZG D;  5GT0 B;  3LEL A;  5B31 B;  3REI A;  2HUE C;  1S32 D;  4WNN B;  3AZE A;  3AZN A;  3MNN A;  4H9P B;  2FFF B;  1AOI A;  3MVD D;  5CPI B;  5B40 A;  1P3O D;  4X23 C;  3KUY D;  3B6F D;  5E5A C;  1N1J A;  5AV9 C;  4LD9 B;  3UT9 D;  3AZI A;  5B24 D;  3WA9 C;  5DNM C;  1H3O A;  3MGR C;  3UTB D;  3UTA A;  1P3B A;  3LZ0 C;  1R4V A;  3REL A;  4R8P C;  3WKJ D;  5AVB A;  2DF4 C;  1M1A D;  5G49 B;  4JJN A;  1F66 B;  4J8V A;  3REH D;  1KX5 C;  3MGQ C;  5FUG B;  3AZL C;  3X1S B;  1KX3 A;  4H9Q A;  5B33 D;  5GSU A;  3W98 C;  4Z66 D;  3WTP D;  3LEL C;  5CPJ B;  1TZY D;  3REI C;  1TAF A;  5CPI D;  1P3L B;  1T3U A;  2F8N H;  3AZN C;  3W96 B;  2NQB A;  2F8N K;  3AZK D;  3X1V A;  3REK D;  5CPK A;  1U35 A;  4J8X D;  3AZG A;  3EG5 B;  5B1L A;  1P3G D;  1AOI C;  5BS7 A;  3AZH A;  1P3K B;  1KX4 B;  4XZQ B;  5B0Z D;  1S32 A;  3A6N D;  3KXB A;  2HUE B;  2Y2I A;  4NFT A;  3UTA C;  1P3B C;  5F99 D;  3B6G C;  3AV1 A;  3REL C;  1BH9 B;  5B1M B;  1P3O A;  2IO5 B;  5AVB C;  5GT3 C;  5E5A B;  5AV9 B;  3MGS B;  4J8U A;  4CSR A;  3O62 D;  4JJN C;  1ID3 D;  1ZLA C;  4YM6 B;  5C3I C;  3AFA D;  3AZM B;  3F6T A;  3IP4 C;  4J8V C;  4KUD B;  4CAY B;  1P3I C;  1M1A A;  1KX3 C;  2YFV B;  3MGP B;  1P3L D;  4QLC B;  3W96 D;  1P3A A;  5AV8 D;  4H9S A;  3X1U A;  3VH6 A;  3REH A;  1Q9C A;  3AV2 B;  1KX5 B;  4YS3 B;  3MGQ B;  3W97 A;  3LZ1 D;  1P3M D;  4KHA A;  1P3K D;  2NQB C;  2FJ7 D;  2NZD B;  2HIO B;  4Z5T D;  4WU8 A;  5AY8 D;  1U35 C;  3AZG C;  5B1L C;  5AV5 B;  5GXQ D;  2ARO D;  3AZH C;  3AZF A;  1TZY A;  3LEL B;  1S32 C;  2Y2G A;  5AVC B;  1P3P A;  3AZE B;  3AZN B;  2CV5 D;  3VH5 A;  3MNN B;  2RIQ A;  5B32 A;  5DNN D;  4AWL C;  3AV1 C;  3MVD C;  1P3G A;  4KGC D;  4KUD D;  1HQ3 D;  5B40 B;  3X1T A;  1P3O C;  3TU4 B;  1N1J B;  5B24 C;  4J8U C;  3AZI B;  3KSY A;  3MGP D;  5B2I B;  2ZY5 A;  3UTB C;  1H3O B;  3UTA B;  5F99 A;  1P3B B;  2PYO A;  3AV2 D;  3REJ A;  4ZBJ C;  3WKJ C;  1M1A C;  2DQN C;  5B32 G;  1ID3 A;  1P3A C;  3X1U C;  3KWQ B;  3REH C;  4WZS B;  1EQZ D;  4DRA A;  4ZUX B;  5DNM A;  1KX3 B;  3MGR A;  3LZ0 A;  3WTP E;  5GSU B;  4Z66 C;  3WTP C;  1TZY C;  5JRG D;  3LZ1 A;  1P3M A;  1TAF B;  1P3P C;  1P3F D;  3AZK C;  2NQB B;  5BT1 D;  3REK C;  3X1V B;  5AY8 A;  4J8X C;  1BH8 A;  5B32 C;  5CPK B;  1P3G C;  2ARO A;  5B1L B;  3R45 A;  3AZH B;  5B0Z C;  5KDM B;  3A6N C;  3X1T C;  2F8N D;  3KXB B;  4Z2M H;  4DRB A;  3W98 A;  5F99 C;  2PYO C;  4KGC A;  5B0Y B;  3AV1 B;  3REJ C;  1KU5 A;  2RVQ C;  4ZUX D;  2BYM A;  1ID3 C;  4CSR B;  3AFA C;  4UPK A;  3KFU G;  3EPJ A;  3EPH A;  3AZJ D;  1BFM A; 
#chains in the Genus database with same CATH homology
 1M18 D;  4XUJ A;  3B6G A;  1P34 D;  5AV8 C;  1B6W A;  3A1K A;  3C1B B;  3C1C B;  5GT3 A;  4EO5 C;  5CP6 B;  3LZ1 C;  1P3M C;  3W97 B;  4KHA B;  3LJA B;  3AN2 D;  1ZLA A;  2FJ7 C;  3B0D C;  4Z5T C;  5AY8 C;  5B2J D;  4WU8 B;  2G5I C;  4J8W D;  5GT0 D;  5GXQ C;  2ARO C;  1P3I A;  5B31 D;  3AZF B;  3WAA B;  4WU9 B;  2CV5 C;  3V9R B;  5AV6 A;  3W99 A;  4KGC C;  2ZY2 A;  3X1T B;  2F8N A;  4LD9 D;  3AYW B;  1M19 B;  5BO0 A;  3C1B D;  3REJ B;  3C1C D;  2G5H C;  1F66 D;  4XUJ C;  3MVD A;  2F8N G;  4X23 B;  3KUY A;  3B6F A;  3UT9 A;  5B24 A;  4H9N A;  3X1S D;  3WA9 B;  5DNM B;  3UTB A;  3MGR B;  3WAA D;  2BYK A;  3LZ0 B;  4WU9 D;  4E45 A;  4R8P B;  3WKJ A;  5CPJ D;  2CWE A;  3EPK A;  1P3F C;  5BT1 C;  5B2J A;  5AV6 C;  4J8W A;  3W99 C;  5BNX B;  1KX4 D;  3AZL B;  3R45 B;  4XZQ D;  4WNN A;  5B33 A;  4DQY B;  2Y2M A;  4H9P A;  2BG1 A;  3H0M C;  4Z66 A;  3W98 B;  3WTP A;  5CPI A;  3REI B;  3A1I A;  2ZM5 A;  5B1M D;  4X23 D;  3AZK A;  5E5A D;  5AV9 D;  3NQU A;  3MGS D;  3REK A;  4J8X A;  5BNV A;  4G92 C;  4YM6 D;  1AOI B;  3AZM D;  5B0Z A;  3A6N A;  3KUY C;  3B6F C;  3UT9 C;  4G91 C;  3AZJ C;  5G49 A;  4QLC D;  1M18 C;  4XUJ B;  1F1E A;  3B6G B;  3REL B;  1KX5 D;  4YS3 D;  5FUG A;  3MGQ D;  5AVB B;  5GT3 B;  3O62 A;  3AN2 C;  4JJN B;  3NQJ A;  1ZLA B;  3AFA A;  2NZD D;  2HIO D;  5C3I B;  5B2J C;  4J8V B;  4J8W C;  5GT0 C;  5AV5 D;  2Y2H A;  3VH6 W;  1WWI A;  5CPJ A;  2Y2J A;  3LEL D;  1P3I B;  1P3L A;  5AVC D;  4H9Q B;  3W96 A;  5B33 C;  3AZN D;  3AZE D;  5AV8 A;  3MNN D;  5JA4 A;  5AV6 B;  2Y2K A;  1AOI D;  5CPI C;  1P3K A;  1KX4 A;  3VH5 T;  5B40 D;  4XZQ A;  4LD9 C;  1B67 A;  3TU4 D;  2FJ7 A;  4Z5T A;  3AZI D;  2Y2Q A;  1U35 B;  3VH5 W;  5B2I D;  4NE5 A;  5GXQ A;  3UTA D;  3AZG B;  1P3B D;  1S32 B;  5B1M A;  1JFI A;  4H9O A;  5AVB D;  2CV5 A;  4NE6 A;  1F66 C;  5DNN A;  2UWX A;  4YM6 A;  4AWL B;  3MVD B;  3KWQ D;  4KUD A;  1HQ3 A;  4CAY A;  4J8V D;  1P3O B;  3KUY B;  3UT9 B;  3B0C W;  5B24 B;  3O62 C;  4J8U B;  2YFV A;  3MGP A;  3H0L C;  1KX3 D;  4QLC A;  3UTB B;  2BYK B;  2W8S A;  5GSU D;  3AV2 A;  3B0B A;  4Z2M G;  4ZBJ B;  4YS3 A;  5CPJ C;  3WKJ B;  4H9R A;  1M1A B;  1P3L C;  3W96 C;  2L5A A;  1P3A B;  2NQB D;  2JE5 A;  2HIO A;  3X1V D;  3X1U B;  1HTA A;  3REH B;  5CPK D;  1EQZ A;  5AV5 A;  2J8P A;  5B1L D;  1P3K C;  1KX4 C;  1A7W A;  3AZH D;  4XZQ C;  5AVC A;  3KXB D;  5B33 B;  2JCH A;  2F2A C;  2Y2O A;  4Z66 B;  3WTP B;  1TZY B;  5B0Y D;  5JRG A;  3AV1 D;  5B1M C;  1P3F A;  2IO5 C;  1P3P B;  3TU4 A;  4WJ3 C;  3MGS C;  3AZK B;  3NQU B;  3REK B;  4J8U D;  4J8X B;  5BNV B;  5DNN C;  5B32 B;  5B2I A;  4YM6 C;  1P3G B;  3AZM C;  4KUD C;  1HQ3 C;  5B0Z B;  3A6N B;  1ULY A;  3MGP C;  4QLC C;  5F99 B;  2PYO B;  1P3A D;  3KWQ A;  3X1U D;  3AV2 C;  4YS3 C;  5CP6 D;  4ZUX A;  3W97 D;  3P5J B;  3LJA D;  3O62 B;  1ID3 B;  3NQJ B;  2ZY4 A;  4WV4 B;  2NZD C;  4E44 A;  2HIO C;  3AFA B;  4WU8 D;  4UUZ A;  1EQZ C;  5AV5 C;  3AZF D;  3AZJ A;  5AVC C;  1M18 A;  3AZE C;  2YFW A;  1P34 A;  1P3P D;  5AV8 B;  3MNN C;  5JA4 B;  5B32 D;  5JRG C;  4EO5 B;  3LZ1 B;  1P3M B;  3AN2 A;  5B40 C;  5KDM A;  3X1T D;  3TU4 C;  3AYW D;  4HGA C;  2FJ7 B;  3AZI C;  3B0D B;  4Z5T B;  5AY8 B;  1M19 D;  1BH8 B;  5B2I C;  5GT0 A;  2ZY3 A;  2ARO B;  5GXQ B;  2PYO D;  5B31 A;  5B0Y A;  1JFI B;  3REJ D;  4H9O B;  2CV5 B;  1PZR A;  2RVQ D;  4NE3 A;  5DNN B;  4KGC B;  3KWQ C;  1HQ3 B;  4LD9 A;  4ZUX C;  2BYM B;  2VQR A;  3WA9 D;  3AL0 C;  5DNM D;  5B31 G;  3MGR D;  3LZ0 D;  5GSU C;  3C1B A;  4R8P D;  3C1C A;  5CP6 A;  4H9R B;  3LJA A;  1F66 A;  1Z2C B;  1P34 C;  3X1V C;  5CPK C;  1EQZ B;  1W2E A;  3X1S A;  5BS7 C;  3AZL D;  3VH6 T;  3KXB C;  3WAA A;  5CHL B;  2XD1 A;  4WU9 A;  3V9R A;  3W98 D;  5B31 C;  5B0Y C;  3REI D;  5JRG B;  2JSS A;  2LY8 A;  3AYW A;  1P3F B;  4HGA B;  2Y2L A;  1M19 A;  3W99 B;  2F8N B;  3H0R C;  2Y2P A;  4XUJ D;  3B6G D;  1BH9 A;  4H9S C;  5BO0 B;  3REL D;  3C1B C;  2Y2N A;  4X23 A;  3C1C C;  5CP6 C;  5E5A A;  5GT3 D;  5AV9 A;  3MGS A;  3W97 C;  3LJA C;  4JJN D;  3WA9 A;  1ZLA D;  4G92 B;  3B0C T;  3AZM A;  2XD5 A;  4WU8 C;  4UUZ B;  3B6F B;  1WWS A;  4R8P A;  4M6B A;  3X1S C;  4H9N B;  3AZF C;  4G91 B;  1P3I D;  3AZJ B;  3WAA C;  3FDD A;  1M18 B;  2YFW B;  4WU9 C;  1P34 B;  1KX5 A;  5AV6 D;  5BNX A;  3EPL A;  3W99 D;  3MGQ A;  3AZL A;  3AN2 B;  3AYW C;  2NZD A;  5B2J B;  1M19 C;  1U35 D;  4J8W B;  3AZG D;  5GT0 B;  3LEL A;  5B31 B;  3REI A;  2HUE C;  1S32 D;  4WNN B;  3AZE A;  3AZN A;  3MNN A;  4H9P B;  2FFF B;  1AOI A;  3MVD D;  5CPI B;  5B40 A;  1P3O D;  4X23 C;  3KUY D;  3B6F D;  5E5A C;  1N1J A;  5AV9 C;  4LD9 B;  3UT9 D;  3AZI A;  5B24 D;  3WA9 C;  5DNM C;  1H3O A;  3MGR C;  3UTB D;  3UTA A;  1P3B A;  3LZ0 C;  1R4V A;  3REL A;  4R8P C;  3WKJ D;  5AVB A;  2DF4 C;  1M1A D;  5G49 B;  4JJN A;  1F66 B;  4J8V A;  3REH D;  1KX5 C;  3MGQ C;  5FUG B;  3AZL C;  3X1S B;  1KX3 A;  4H9Q A;  5B33 D;  5GSU A;  3W98 C;  4Z66 D;  3WTP D;  3LEL C;  5CPJ B;  1TZY D;  3REI C;  1TAF A;  5CPI D;  1P3L B;  1T3U A;  2F8N H;  3AZN C;  3W96 B;  2NQB A;  2F8N K;  3AZK D;  3X1V A;  3REK D;  5CPK A;  1U35 A;  4J8X D;  3AZG A;  3EG5 B;  5B1L A;  1P3G D;  1AOI C;  5BS7 A;  3AZH A;  1P3K B;  1KX4 B;  4XZQ B;  5B0Z D;  1S32 A;  3A6N D;  3KXB A;  2HUE B;  2Y2I A;  4NFT A;  3UTA C;  1P3B C;  5F99 D;  3B6G C;  3AV1 A;  3REL C;  1BH9 B;  5B1M B;  1P3O A;  2IO5 B;  5AVB C;  5GT3 C;  5E5A B;  5AV9 B;  3MGS B;  4J8U A;  4CSR A;  3O62 D;  4JJN C;  1ID3 D;  1ZLA C;  4YM6 B;  5C3I C;  3AFA D;  3AZM B;  3F6T A;  3IP4 C;  4J8V C;  4KUD B;  4CAY B;  1P3I C;  1M1A A;  1KX3 C;  2YFV B;  3MGP B;  1P3L D;  4QLC B;  3W96 D;  1P3A A;  5AV8 D;  4H9S A;  3X1U A;  3VH6 A;  3REH A;  1Q9C A;  3AV2 B;  1KX5 B;  4YS3 B;  3MGQ B;  3W97 A;  3LZ1 D;  1P3M D;  4KHA A;  1P3K D;  2NQB C;  2FJ7 D;  2NZD B;  2HIO B;  4Z5T D;  4WU8 A;  5AY8 D;  1U35 C;  3AZG C;  5B1L C;  5AV5 B;  5GXQ D;  2ARO D;  3AZH C;  3AZF A;  1TZY A;  3LEL B;  1S32 C;  2Y2G A;  5AVC B;  1P3P A;  3AZE B;  3AZN B;  2CV5 D;  3VH5 A;  3MNN B;  2RIQ A;  5B32 A;  5DNN D;  4AWL C;  3AV1 C;  3MVD C;  1P3G A;  4KGC D;  4KUD D;  1HQ3 D;  5B40 B;  3X1T A;  1P3O C;  3TU4 B;  1N1J B;  5B24 C;  4J8U C;  3AZI B;  3KSY A;  3MGP D;  5B2I B;  2ZY5 A;  3UTB C;  1H3O B;  3UTA B;  5F99 A;  1P3B B;  2PYO A;  3AV2 D;  3REJ A;  4ZBJ C;  3WKJ C;  1M1A C;  2DQN C;  5B32 G;  1ID3 A;  1P3A C;  3X1U C;  3KWQ B;  3REH C;  4WZS B;  1EQZ D;  4DRA A;  4ZUX B;  5DNM A;  1KX3 B;  3MGR A;  3LZ0 A;  3WTP E;  5GSU B;  4Z66 C;  3WTP C;  1TZY C;  5JRG D;  3LZ1 A;  1P3M A;  1TAF B;  1P3P C;  1P3F D;  3AZK C;  2NQB B;  5BT1 D;  3REK C;  3X1V B;  5AY8 A;  4J8X C;  1BH8 A;  5B32 C;  5CPK B;  1P3G C;  2ARO A;  5B1L B;  3R45 A;  3AZH B;  5B0Z C;  5KDM B;  3A6N C;  3X1T C;  2F8N D;  3KXB B;  4Z2M H;  4DRB A;  3W98 A;  5F99 C;  2PYO C;  4KGC A;  5B0Y B;  3AV1 B;  3REJ C;  1KU5 A;  2RVQ C;  4ZUX D;  2BYM A;  1ID3 C;  4CSR B;  3AFA C;  4UPK A;  3KFU G;  3EPJ A;  3EPH A;  3AZJ D;  1BFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...