3TU4A

Crystal structure of the sir3 bah domain in complex with a nucleosome core particle.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
b'KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural basis of silencing: Sir3 BAH domain in complex with a nucleosome at 3.0 A resolution.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Signaling protein/structural protein/dna
total genus 32
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3tu4A00
4R8PA 2CWEA 4NE6A 1P3KC 3MNNA 2F8NK 3UT9B 1S32B 5CP6C 3MGRB 1S32A 4AWLC 5B31A 4J8UB 1N1JA 3RELC 3AV1B 4J8VC 5GT0B 3AV1A 4R8PD 4LD9D 5GT3C 1BH8B 1BH8A 4YM6C 1EQZB 3REKB 3UT9D 2NZDC 1S32D 3AFAA 3W99A 3MGRD 4J8UD 3KUYC 3W97A 3REJC 1ZLAC 3AV1D 4XZQB 4J8WC 5GT0D 4YS3D 4XZQA 2BYMB 2BYMA 3A6NC 5B0ZD 2NQBB 5CPKC 1EQZD 3REKD 1TZYA 5AY8C 5B40C 4H9QB 3MGQC 3B0CW 4XZQD 1P3GB 4H9PB 3O62C 4H9PA 1P3AD 3W96B 4Z66A 3TU4A 3W96A 4Z2MH 2NQBD 1KU5A 3V9RB 5B32G 2CV5C 1P3GD 4G92C 5BNVB 2FJ7C 5BNVA 4KHAB 5AV5B 3B0DB 3KXBA 3W96D 2IO5B 3AZHB 5AVCC 3AZHA 5AV9A 5DNMB 2YFVA 1P3KA 5AV5D 5CP6A 2F8NB 3RELB 3AZHD 3RELA 4J8VA 3X1UC 5GT3B 3AV2B 5F99B 3KWQB 5GT3A 5DNMD 5FUGA 3WAAC 4YM6B 3X1VB 1KX5C 1ID3B 4YM6A 3X1VA 1ID3A 3B6FC 1HTAA 3KUYB 2F8ND 1ZLAB 3KUYA 3REJA 1ZLAA 3WTPC 4J8WA 3MVDC 4WV4B 3AV2D 5F99D 3KWQD 3A6NA 4H9SA 3X1VD 3AZIC 1ID3D 4DRAA 4X23C 4J8XC 5CPJB 5B40B 2JSSA 3AZJC 4WU9C 5CPJA 5B40A 3MGQA 1KX4C 5JRGD 3O62A 3NQJB 5B33B 3NQJA 1P3FB 5B33A 4KGCB 1P3FA 5G49B 4KGCA 4WNNB 1P3BD 1P3IC 5CPJD 5E5AB 3X1SD 4XUJC 2CV5A 1WWSA 5CPIC 5B33D 3LJAC 1P3FD 3AZLC 5AV8C 4KGCD 5E5AD 3UTAC 5B2JC 3LZ1B 3LELC 3AZNC 5B24B 5DNNB 3R45B 3X1UB 1M19C 4WZSB 3AZMB 5B1LB 3W98B 3X1UA 4JJNC 3AYWC 3W98A 3WAAB 5GXQB 4ZBJC 4KUDD 3WAAA 4WU8B 3LZ1D 1KX5A 4WU8A 3B6FB 3C1CC 3B6FA 3WKJB 3REHB 1M1AB 5B24D 3WKJA 4NFTA 5DNND 3W98D 3MVDB 3AZMD 5B1LD 3MVDA 5GXQD 2AROC 1F1EA 4WU8D 3AZFD 3MNNB 5B32C 4X23A 3B6GC 3AN2D 1P34C 3AZJA 5B31B 3REHD 4WU9A 3C1BC 1M1AD 1N1JB 3WKJD 3UTBD 1KX4A 3AZKC 3VH5W 1F66C 4ZUXB 4QLCC 3B0BA 3LZ0B 3MNND 4ZUXA 3LZ0A 4UUZB 2BYKA 3AFAB 1BH9B 4UUZA 3W99B 5B31D 1BH9A 3W97B 3WTPE 5CPIB 5CPIA 5AV8B 3AZLA 5AV8A 4ZUXD 3LZ0D 2RVQD 1TZYB 4M6BA 3AFAD 5BS7C 3W99D 3UTAB 3W97D 3UTAA 5BT1D 4Z66B 5B2IC 3TU4B 5B0YC 3REIB 1P3MC 1TZYD 3REIA 3AZEC 3AYWB 1P3PB 1KX3B 4JJNA 3AYWA 1P3PA 1KX3A 3WA9C 4CAYB 4CAYA 3MGSC 3C1CB 3KXBB 4Z66D 3C1CA 3TU4D 1U35C 3REID 4Z5TC 1M18C 4Z2MG 3AYWD 1P3PD 4HGAC 1KX3D 5AV9B 5KDMA 2AROA 2YFVB 1P3KB 3VH6T 3KXBD 3B6GB 3B6GA 2HUEC 5CP6B 5GSUC 3X1TC 4AWLB 1P34A 3C1BA 3KSYA 4E44A 1HQ3C 4J8VB 5AV9D 5FUGB 1F66A 1P3KD 5B1MC 4QLCA 1AOIC 1P3OC 3VH5T 2F8NG 2NZDB 5CP6D 2NZDA 3REJB 3RELD 4J8WB 4J8VD 5GT3D 3A6NB 2PYOC 1P3LC 5CPKB 4YM6D 5CPKA 1BFMA 2NZDD 2HIOC 5AY8B 3MGPC 5AY8A 3MGQB 3KUYD 3REJD 4LD9B 1ZLAD 5AVBC 4J8WD 5C3IC 3O62B 5B2IA 3A6ND 3B0CT 3VH6A 5B0YB 5CPKD 5B0YA 5BNXA 5AY8D 5B40D 3MGQD 2CV5B 2YFWB 3MGSA 3O62D 4G92B 2FJ7B 2YFWA 4G91C 4R8PC 2FJ7A 4LD9C 2L5AA 4Z5TA 5AVCB 3VH5A 1M18A 5AVCA 3UT9C 1S32C 3MGRC 4J8UC 2CV5D 3AV1C 3NQUB 2FJ7D 5GT0C 4YS3C 3NQUA 3X1TA 5B0ZC 5AVCD 1HQ3A 1TAFA 1EQZC 3REKC 5B1MB 5B1MA 1KX5B 4XZQC 1AOIA 1P3AC 2NQBC 3WTPB 3X1UD 1R4VA 3WTPA 2PYOB 3WAAD 1P3LB 2PYOA 1KX5D 1P3GC 1P3LA 3AZIB 4J8XB 4X23B 3MGPB 3AZIA 3B6FD 4J8XA 3W96C 3MGPA 3AZJB 4WU9B 1KX4B 5AVBA 5C3IB 3WTPD 3MVDD 4H9OB 4H9OA 1P3IB 3AZID 5B31G 4J8XD 4X23D 2BYKB 4XUJB 1P3IA 4NE3A 4WU9D 4XUJA 5AV5C 3B0DC 3AZJD 2IO5C 1KX4D 3AZHC 4H9NB 4G91B 4H9NA 3LJAB 4LD9A 3AZLB 3LJAA 5DNMC 1P3ID 4XUJD 3UT9A 3MGRA 5B2JB 4J8UA 5B2JA 3LELB 4YS3B 5BO0B 5CPID 3AZNB 5GT0A 3LELA 3LJAD 5BO0A 4YS3A 3AZNA 3AZLD 3AV2C 5AV8D 5F99C 5B0ZB 3KWQC 5B0ZA 1Q9CA 3X1VC 1M19B 1ID3C 1EQZA 3REKA 4JJNB 1M19A 1H3OB 3UTAD 1H3OA 5B2JD 4ZBJB 3LELD 1A7WA 3AZND 5JRGC 1P3AB 4H9SC 1P3AA 4E45A 2NQBA 1P3BC 1M19D 5CPJC 1JFIB 3X1SC 4JJND 1JFIA 5CHLB 2LY8A 5KDMB 2AROB 4H9QA 1P3GA 3C1CD 5B32B 5B33C 1P34B 5B32A 1P3FC 3C1BB 4KGCC 4CSRB 5E5AC 4CSRA 3AZKB 5AV6C 3AZKA 2AROD 1F66B 3V9RA 5JA4B 4QLCB 5JA4A 5B32D 3B6GD 1P34D 4KHAA 5AV5A 3C1BD 3AZKD 1F66D 5DNMA 2F8NH 4QLCD 4KUDC 3LZ1C 5BS7A 1ULYA 3AZGC 5B24C 2F8NA 5DNNC 3W98C 3AZMC 5B1LC 5B2IB 3AV2A 5F99A 5GXQC 3KWQA 4WU8C 1P3MB 3AZFC 3AZEB 1P3MA 5BNXB 3AZEA 4NE5A 3AN2C 3WA9B 3WKJC 3REHC 1M1AC 3WA9A 3MGSB 3UTBC 5JRGB 4EO5C 5B2ID 5JRGA 1B67A 1WWIA 5B0YD 1U35B 1P3MD 4Z5TB 1P3BB 3AZED 1U35A 1M18B 3MNNC 3X1SB 1P3BA 4HGAB 3X1SA 3WA9D 5B31C 3MGSD 2HUEB 3X1TB 5GSUB 1U35D 5GSUA 4Z5TD 5G49A 4ZUXC 1HQ3B 1TAFB 1B6WA 2RVQC 4WNNA 3LZ0C 1M18D 5E5AA 3AFAC 3W99C 5AV6B 5AV6A 3W97C 5BT1C 4H9RB 1AOIB 1P3OB 4H9RA 1P3OA 4DRBA 3X1TD 5GSUD 1HQ3D 1TZYC 5AV6D 4KUDB 5B1MD 4KUDA 1AOID 1P3OD 3LZ1A 2HIOB 4Z66C 3TU4C 2HIOA 3AZGB 3AZGA 3REIC 5AVBB 5B24A 5DNNA 3R45A 1P3PC 3AZMA 5B1LA 1KX3C 2PYOD 5GXQA 3AZFB 1P3LD 3AZFA 2HIOD 3KXBC 3MGPD 3AN2B 3AZGD 3AN2A 3REHA 1M1AA 5AVBD 3UTBB 4EO5B 3UTBA 3VH6W 4R8PB 5AV9C
chains in the Genus database with same CATH superfamily
4R8PA 2CWEA 4NE6A 1P3KC 3MNNA 2F8NK 3UT9B 2ZM5A 1S32B 1Z2CB 5CP6C 3MGRB 1S32A 4AWLC 5B31A 4J8UB 1N1JA 3RELC 4DQYB 4J8VC 3AV1B 5GT0B 3AV1A 4R8PD 4LD9D 5GT3C 1BH8B 1BH8A 4YM6C 1EQZB 3REKB 3UT9D 2NZDC 1S32D 3AFAA 3W99A 3MGRD 4J8UD 3KUYC 3W97A 3REJC 1ZLAC 3AV1D 4XZQB 4J8WC 5GT0D 4YS3D 4XZQA 2BYMB 2BYMA 3A6NC 2BG1A 3EPLA 5B0ZD 3EPJA 2NQBB 5CPKC 1EQZD 3REKD 1TZYA 5AY8C 5B40C 4H9QB 3MGQC 3B0CW 4XZQD 1P3GB 4H9PB 3O62C 4H9PA 1P3AD 3W96B 4Z66A 3TU4A 3W96A 4Z2MH 2NQBD 1KU5A 3V9RB 5B32G 2CV5C 1P3GD 4G92C 5BNVB 2FJ7C 5BNVA 4KHAB 5AV5B 3B0DB 3KXBA 2Y2PA 3W96D 2IO5B 3AZHB 5AVCC 3AZHA 2ZY5A 5AV9A 5DNMB 2YFVA 1P3KA 3F6TA 5AV5D 5CP6A 2F8NB 3RELB 3AZHD 3RELA 4J8VA 3X1UC 5GT3B 3AV2B 5F99B 3KWQB 5GT3A 5DNMD 5FUGA 3WAAC 4YM6B 3X1VB 1KX5C 1ID3B 4YM6A 3X1VA 2JE5A 1ID3A 3B6FC 1HTAA 3KUYB 2F8ND 1ZLAB 3KUYA 3REJA 1ZLAA 3WTPC 4J8WA 3MVDC 3A1KA 4WV4B 3AV2D 5F99D 3KWQD 3A6NA 4H9SA 3X1VD 3AZIC 1ID3D 4DRAA 4X23C 4J8XC 5CPJB 5B40B 2JSSA 3AZJC 4WU9C 5CPJA 5B40A 3MGQA 3P5JB 1KX4C 5JRGD 3O62A 3NQJB 5B33B 3NQJA 1P3FB 5B33A 4KGCB 1P3FA 5G49B 4KGCA 4WNNB 1P3BD 1P3IC 5CPJD 2Y2KA 5E5AB 4XUJC 3X1SD 2CV5A 1WWSA 5CPIC 5B33D 3LJAC 1P3FD 3AZLC 5AV8C 4KGCD 2Y2QA 5E5AD 2ZY2A 3IP4C 3UTAC 3H0MC 5B2JC 2XD1A 3LZ1B 3LELC 3AZNC 3FDDA 5B24B 5DNNB 3R45B 3X1UB 1M19C 4WZSB 3AZMB 5B1LB 3W98B 3X1UA 4JJNC 3AYWC 3W98A 3WAAB 5GXQB 4ZBJC 4KUDD 3WAAA 4WU8B 3EPHA 3LZ1D 1KX5A 4WU8A 3B6FB 2Y2OA 3C1CC 3B6FA 3WKJB 3REHB 1M1AB 5B24D 3WKJA 4NFTA 5DNND 3W98D 3MVDB 3AZMD 5B1LD 3MVDA 1T3UA 5GXQD 2AROC 2Y2LA 1F1EA 4WU8D 3AZFD 3MNNB 5B32C 4X23A 3B6GC 3AN2D 1P34C 3AZJA 5B31B 3REHD 4WU9A 3C1BC 1M1AD 1N1JB 3WKJD 3UTBD 1KX4A 3AZKC 2Y2GA 3VH5W 1F66C 4ZUXB 4QLCC 3B0BA 3LZ0B 3MNND 2JCHA 4ZUXA 3LZ0A 4UUZB 2BYKA 3AFAB 1BH9B 4UUZA 3W99B 5B31D 1BH9A 3W97B 3WTPE 5CPIB 5CPIA 5AV8B 3AZLA 5AV8A 4ZUXD 3LZ0D 2RVQD 1TZYB 4M6BA 3AFAD 5BS7C 3W99D 3UTAB 3W97D 3UTAA 5BT1D 2ZY4A 4Z66B 5B2IC 3TU4B 5B0YC 3REIB 1P3MC 1TZYD 3REIA 3AZEC 3AYWB 1P3PB 1KX3B 4JJNA 3AYWA 1P3PA 1KX3A 3WA9C 4CAYB 3KFUG 4CAYA 3MGSC 3C1CB 3KXBB 1W2EA 4Z66D 3C1CA 3TU4D 1U35C 3REID 4Z5TC 1M18C 4Z2MG 3AYWD 1P3PD 4HGAC 1KX3D 5AV9B 5KDMA 2AROA 2YFVB 1P3KB 3VH6T 3KXBD 3B6GB 3B6GA 5CP6B 2HUEC 3H0RC 5GSUC 4AWLB 3X1TC 1P34A 3C1BA 3KSYA 4E44A 1HQ3C 4J8VB 5AV9D 5FUGB 1F66A 1P3KD 5B1MC 4QLCA 1AOIC 1P3OC 3VH5T 2F8NG 2NZDB 5CP6D 2NZDA 3REJB 3RELD 4J8WB 4J8VD 3EPKA 5GT3D 3A6NB 2PYOC 1P3LC 5CPKB 4YM6D 5CPKA 1BFMA 2NZDD 2HIOC 5AY8B 3MGPC 5AY8A 3MGQB 3KUYD 3REJD 4LD9B 1ZLAD 5AVBC 4UPKA 4J8WD 5C3IC 3O62B 5B2IA 3A6ND 3B0CT 3VH6A 5B0YB 5CPKD 5B0YA 5BNXA 5AY8D 5B40D 3MGQD 2CV5B 2YFWB 3MGSA 3O62D 4G92B 2FJ7B 2YFWA 4G91C 4R8PC 2FJ7A 4LD9C 2L5AA 4Z5TA 5AVCB 3VH5A 1M18A 5AVCA 3UT9C 1S32C 3MGRC 4J8UC 2CV5D 3AV1C 3NQUB 2FJ7D 5GT0C 4YS3C 3NQUA 2G5IC 2ZY3A 3X1TA 5B0ZC 5AVCD 1HQ3A 1TAFA 1EQZC 3REKC 2FFFB 5B1MB 5B1MA 1KX5B 4XZQC 1AOIA 1P3AC 2F2AC 2NQBC 2VQRA 3WTPB 3X1UD 1R4VA 3WTPA 2Y2JA 2PYOB 3WAAD 1P3LB 2PYOA 1KX5D 1P3GC 1P3LA 3AZIB 4J8XB 4X23B 3MGPB 3AZIA 3B6FD 4J8XA 3W96C 3MGPA 3AZJB 4WU9B 1KX4B 5AVBA 5C3IB 3WTPD 3MVDD 1PZRA 4H9OB 3EG5B 4H9OA 1P3IB 3AZID 5B31G 4J8XD 4X23D 2BYKB 4XUJB 1P3IA 4NE3A 4WU9D 4XUJA 5AV5C 3B0DC 3AZJD 2IO5C 2J8PA 1KX4D 3AZHC 4H9NB 4G91B 4H9NA 3LJAB 4LD9A 3AZLB 3LJAA 5DNMC 1P3ID 4XUJD 3UT9A 3MGRA 5B2JB 4J8UA 5B2JA 3LELB 2Y2HA 5BO0B 4YS3B 3AZNB 5GT0A 3LELA 3LJAD 5BO0A 4YS3A 3AZNA 3AZLD 3AV2C 5AV8D 5F99C 2DQNC 5B0ZB 3KWQC 5B0ZA 1Q9CA 3X1VC 1M19B 1ID3C 1EQZA 3REKA 4JJNB 1M19A 1H3OB 3UTAD 1H3OA 5B2JD 4ZBJB 3LELD 1A7WA 3AZND 5JRGC 1P3AB 4H9SC 1P3AA 4E45A 2NQBA 1P3BC 1M19D 5CPJC 1JFIB 3X1SC 4JJND 1JFIA 5CHLB 2LY8A 5CPID 5KDMB 2AROB 4H9QA 2Y2IA 1P3GA 3C1CD 5B32B 5B33C 1P34B 5B32A 2Y2NA 1P3FC 3C1BB 4KGCC 4CSRB 5E5AC 4CSRA 3AZKB 5AV6C 3AZKA 2AROD 1F66B 3V9RA 5JA4B 4QLCB 5JA4A 5B32D 3B6GD 2W8SA 1P34D 4KHAA 5AV5A 3C1BD 3AZKD 1F66D 5DNMA 2F8NH 4QLCD 2XD5A 4KUDC 3LZ1C 2G5HC 5BS7A 1ULYA 3AZGC 5B24C 2F8NA 5DNNC 3W98C 3AZMC 5B1LC 5B2IB 3AV2A 5F99A 5GXQC 3KWQA 4WU8C 1P3MB 3AZFC 3AZEB 1P3MA 5BNXB 3AZEA 4NE5A 3AN2C 3WA9B 3WKJC 3REHC 1M1AC 3WA9A 3MGSB 3UTBC 5JRGB 4EO5C 5B2ID 5JRGA 1B67A 1WWIA 5B0YD 1U35B 1P3MD 4Z5TB 3H0LC 3AZED 1U35A 1P3BB 3MNNC 3X1SB 1P3BA 1M18B 4HGAB 3X1SA 3WA9D 5B31C 3MGSD 2HUEB 3X1TB 5GSUB 1U35D 5GSUA 4Z5TD 4ZUXC 5G49A 1HQ3B 1TAFB 1B6WA 2RVQC 4WNNA 3LZ0C 1M18D 5E5AA 3AFAC 3W99C 5AV6B 5AV6A 3W97C 5BT1C 2RIQA 4H9RB 1AOIB 1P3OB 4H9RA 1P3OA 4DRBA 3X1TD 5GSUD 4WJ3C 1HQ3D 3AL0C 1TZYC 3A1IA 5AV6D 2UWXA 4KUDB 5B1MD 4KUDA 1AOID 1P3OD 3LZ1A 2HIOB 4Z66C 3TU4C 2HIOA 3AZGB 2Y2MA 3AZGA 3REIC 5AVBB 5B24A 5DNNA 3R45A 1P3PC 3AZMA 5B1LA 1KX3C 2PYOD 5GXQA 3AZFB 1P3LD 3AZFA 2HIOD 3KXBC 3MGPD 3AN2B 3AZGD 3AN2A 2DF4C 3REHA 1M1AA 5AVBD 3UTBB 4EO5B 3UTBA 3VH6W 4R8PB 5AV9C
chains in the Genus database with same CATH topology
4R8PA 2CWEA 4NE6A 1P3KC 3MNNA 2F8NK 3UT9B 2ZM5A 1S32B 1Z2CB 5CP6C 3MGRB 1S32A 4AWLC 5B31A 4J8UB 1N1JA 3RELC 4DQYB 4J8VC 3AV1B 5GT0B 3AV1A 4R8PD 4LD9D 5GT3C 1BH8B 1BH8A 4YM6C 1EQZB 3REKB 3UT9D 2NZDC 1S32D 3AFAA 3W99A 3MGRD 4J8UD 3KUYC 3W97A 3REJC 1ZLAC 3AV1D 4XZQB 4J8WC 5GT0D 4YS3D 4XZQA 2BYMB 2BYMA 3A6NC 2BG1A 3EPLA 5B0ZD 3EPJA 2NQBB 5CPKC 1EQZD 3REKD 1TZYA 5AY8C 5B40C 4H9QB 3MGQC 3B0CW 4XZQD 1P3GB 4H9PB 3O62C 4H9PA 1P3AD 3W96B 4Z66A 3TU4A 3W96A 4Z2MH 2NQBD 1KU5A 3V9RB 5B32G 2CV5C 1P3GD 4G92C 5BNVB 2FJ7C 5BNVA 4KHAB 5AV5B 3B0DB 3KXBA 2Y2PA 3W96D 2IO5B 3AZHB 5AVCC 3AZHA 2ZY5A 5AV9A 5DNMB 2YFVA 1P3KA 3F6TA 5AV5D 5CP6A 2F8NB 3RELB 3AZHD 3RELA 4J8VA 3X1UC 5GT3B 3AV2B 5F99B 3KWQB 5GT3A 5DNMD 5FUGA 3WAAC 4YM6B 3X1VB 1KX5C 1ID3B 4YM6A 3X1VA 2JE5A 1ID3A 3B6FC 1HTAA 3KUYB 2F8ND 1ZLAB 3KUYA 3REJA 1ZLAA 3WTPC 4J8WA 3MVDC 3A1KA 4WV4B 3AV2D 5F99D 3KWQD 3A6NA 4H9SA 3X1VD 3AZIC 1ID3D 4DRAA 4X23C 4J8XC 5CPJB 5B40B 2JSSA 3AZJC 4WU9C 5CPJA 5B40A 3MGQA 3P5JB 1KX4C 5JRGD 3O62A 3NQJB 5B33B 3NQJA 1P3FB 5B33A 4KGCB 1P3FA 5G49B 4KGCA 4WNNB 1P3BD 1P3IC 5CPJD 2Y2KA 5E5AB 4XUJC 3X1SD 2CV5A 1WWSA 5CPIC 5B33D 3LJAC 1P3FD 3AZLC 5AV8C 4KGCD 2Y2QA 5E5AD 2ZY2A 3IP4C 3UTAC 3H0MC 5B2JC 2XD1A 3LZ1B 3LELC 3AZNC 3FDDA 5B24B 5DNNB 3R45B 3X1UB 1M19C 4WZSB 3AZMB 5B1LB 3W98B 3X1UA 4JJNC 3AYWC 3W98A 3WAAB 5GXQB 4ZBJC 4KUDD 3WAAA 4WU8B 3EPHA 3LZ1D 1KX5A 4WU8A 3B6FB 2Y2OA 3C1CC 3B6FA 3WKJB 3REHB 1M1AB 5B24D 3WKJA 4NFTA 5DNND 3W98D 3MVDB 3AZMD 5B1LD 3MVDA 1T3UA 5GXQD 2AROC 2Y2LA 1F1EA 4WU8D 3AZFD 3MNNB 5B32C 4X23A 3B6GC 3AN2D 1P34C 3AZJA 5B31B 3REHD 4WU9A 3C1BC 1M1AD 1N1JB 3WKJD 3UTBD 1KX4A 3AZKC 2Y2GA 3VH5W 1F66C 4ZUXB 4QLCC 3B0BA 3LZ0B 3MNND 2JCHA 4ZUXA 3LZ0A 4UUZB 2BYKA 3AFAB 1BH9B 4UUZA 3W99B 5B31D 1BH9A 3W97B 3WTPE 5CPIB 5CPIA 5AV8B 3AZLA 5AV8A 4ZUXD 3LZ0D 2RVQD 1TZYB 4M6BA 3AFAD 5BS7C 3W99D 3UTAB 3W97D 3UTAA 5BT1D 2ZY4A 4Z66B 5B2IC 3TU4B 5B0YC 3REIB 1P3MC 1TZYD 3REIA 3AZEC 3AYWB 1P3PB 1KX3B 4JJNA 3AYWA 1P3PA 1KX3A 3WA9C 4CAYB 3KFUG 4CAYA 3MGSC 3C1CB 3KXBB 1W2EA 4Z66D 3C1CA 3TU4D 1U35C 3REID 4Z5TC 1M18C 4Z2MG 3AYWD 1P3PD 4HGAC 1KX3D 5AV9B 5KDMA 2AROA 2YFVB 1P3KB 3VH6T 3KXBD 3B6GB 3B6GA 5CP6B 2HUEC 3H0RC 5GSUC 4AWLB 3X1TC 1P34A 3C1BA 3KSYA 4E44A 1HQ3C 4J8VB 5AV9D 5FUGB 1F66A 1P3KD 5B1MC 4QLCA 1AOIC 1P3OC 3VH5T 2F8NG 2NZDB 5CP6D 2NZDA 3REJB 3RELD 4J8WB 4J8VD 3EPKA 5GT3D 3A6NB 2PYOC 1P3LC 5CPKB 4YM6D 5CPKA 1BFMA 2NZDD 2HIOC 5AY8B 3MGPC 5AY8A 3MGQB 3KUYD 3REJD 4LD9B 1ZLAD 5AVBC 4UPKA 4J8WD 5C3IC 3O62B 5B2IA 3A6ND 3B0CT 3VH6A 5B0YB 5CPKD 5B0YA 5BNXA 5AY8D 5B40D 3MGQD 2CV5B 2YFWB 3MGSA 3O62D 4G92B 2FJ7B 2YFWA 4G91C 4R8PC 2FJ7A 4LD9C 2L5AA 4Z5TA 5AVCB 3VH5A 1M18A 5AVCA 3UT9C 1S32C 3MGRC 4J8UC 2CV5D 3AV1C 3NQUB 2FJ7D 5GT0C 4YS3C 3NQUA 2G5IC 2ZY3A 3X1TA 5B0ZC 5AVCD 1HQ3A 1TAFA 1EQZC 3REKC 2FFFB 5B1MB 5B1MA 1KX5B 4XZQC 1AOIA 1P3AC 2F2AC 2NQBC 2VQRA 3WTPB 3X1UD 1R4VA 3WTPA 2Y2JA 2PYOB 3WAAD 1P3LB 2PYOA 1KX5D 1P3GC 1P3LA 3AZIB 4J8XB 4X23B 3MGPB 3AZIA 3B6FD 4J8XA 3W96C 3MGPA 3AZJB 4WU9B 1KX4B 5AVBA 5C3IB 3WTPD 3MVDD 1PZRA 4H9OB 3EG5B 4H9OA 1P3IB 3AZID 5B31G 4J8XD 4X23D 2BYKB 4XUJB 1P3IA 4NE3A 4WU9D 4XUJA 5AV5C 3B0DC 3AZJD 2IO5C 2J8PA 1KX4D 3AZHC 4H9NB 4G91B 4H9NA 3LJAB 4LD9A 3AZLB 3LJAA 5DNMC 1P3ID 4XUJD 3UT9A 3MGRA 5B2JB 4J8UA 5B2JA 3LELB 2Y2HA 5BO0B 4YS3B 3AZNB 5GT0A 3LELA 3LJAD 5BO0A 4YS3A 3AZNA 3AZLD 3AV2C 5AV8D 5F99C 2DQNC 5B0ZB 3KWQC 5B0ZA 1Q9CA 3X1VC 1M19B 1ID3C 1EQZA 3REKA 4JJNB 1M19A 1H3OB 3UTAD 1H3OA 5B2JD 4ZBJB 3LELD 1A7WA 3AZND 5JRGC 1P3AB 4H9SC 1P3AA 4E45A 2NQBA 1P3BC 1M19D 5CPJC 1JFIB 3X1SC 4JJND 1JFIA 5CHLB 2LY8A 5CPID 5KDMB 2AROB 4H9QA 2Y2IA 1P3GA 3C1CD 5B32B 5B33C 1P34B 5B32A 2Y2NA 1P3FC 3C1BB 4KGCC 4CSRB 5E5AC 4CSRA 3AZKB 5AV6C 3AZKA 2AROD 1F66B 3V9RA 5JA4B 4QLCB 5JA4A 5B32D 3B6GD 2W8SA 1P34D 4KHAA 5AV5A 3C1BD 3AZKD 1F66D 5DNMA 2F8NH 4QLCD 2XD5A 4KUDC 3LZ1C 2G5HC 5BS7A 1ULYA 3AZGC 5B24C 2F8NA 5DNNC 3W98C 3AZMC 5B1LC 5B2IB 3AV2A 5F99A 5GXQC 3KWQA 4WU8C 1P3MB 3AZFC 3AZEB 1P3MA 5BNXB 3AZEA 4NE5A 3AN2C 3WA9B 3WKJC 3REHC 1M1AC 3WA9A 3MGSB 3UTBC 5JRGB 4EO5C 5B2ID 5JRGA 1B67A 1WWIA 5B0YD 1U35B 1P3MD 4Z5TB 3H0LC 3AZED 1U35A 1P3BB 3MNNC 3X1SB 1P3BA 1M18B 4HGAB 3X1SA 3WA9D 5B31C 3MGSD 2HUEB 3X1TB 5GSUB 1U35D 5GSUA 4Z5TD 4ZUXC 5G49A 1HQ3B 1TAFB 1B6WA 2RVQC 4WNNA 3LZ0C 1M18D 5E5AA 3AFAC 3W99C 5AV6B 5AV6A 3W97C 5BT1C 2RIQA 4H9RB 1AOIB 1P3OB 4H9RA 1P3OA 4DRBA 3X1TD 5GSUD 4WJ3C 1HQ3D 3AL0C 1TZYC 3A1IA 5AV6D 2UWXA 4KUDB 5B1MD 4KUDA 1AOID 1P3OD 3LZ1A 2HIOB 4Z66C 3TU4C 2HIOA 3AZGB 2Y2MA 3AZGA 3REIC 5AVBB 5B24A 5DNNA 3R45A 1P3PC 3AZMA 5B1LA 1KX3C 2PYOD 5GXQA 3AZFB 1P3LD 3AZFA 2HIOD 3KXBC 3MGPD 3AN2B 3AZGD 3AN2A 2DF4C 3REHA 1M1AA 5AVBD 3UTBB 4EO5B 3UTBA 3VH6W 4R8PB 5AV9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R8P A;  2CWE A;  4NE6 A;  1P3K C;  3MNN A;  2F8N K;  3UT9 B;  1S32 B;  5CP6 C;  3MGR B;  1S32 A;  4AWL C;  5B31 A;  4J8U B;  1N1J A;  3REL C;  3AV1 B;  4J8V C;  5GT0 B;  3AV1 A;  4R8P D;  4LD9 D;  5GT3 C;  1BH8 B;  1BH8 A;  4YM6 C;  1EQZ B;  3REK B;  3UT9 D;  2NZD C;  1S32 D;  3AFA A;  3W99 A;  3MGR D;  4J8U D;  3KUY C;  3W97 A;  3REJ C;  1ZLA C;  3AV1 D;  4XZQ B;  4J8W C;  5GT0 D;  4YS3 D;  4XZQ A;  2BYM B;  2BYM A;  3A6N C;  5B0Z D;  2NQB B;  5CPK C;  1EQZ D;  3REK D;  1TZY A;  5AY8 C;  5B40 C;  4H9Q B;  3MGQ C;  3B0C W;  4XZQ D;  1P3G B;  4H9P B;  3O62 C;  4H9P A;  1P3A D;  3W96 B;  4Z66 A;  3TU4 A;  3W96 A;  4Z2M H;  2NQB D;  1KU5 A;  3V9R B;  5B32 G;  2CV5 C;  1P3G D;  4G92 C;  5BNV B;  2FJ7 C;  5BNV A;  4KHA B;  5AV5 B;  3B0D B;  3KXB A;  3W96 D;  2IO5 B;  3AZH B;  5AVC C;  3AZH A;  5AV9 A;  5DNM B;  2YFV A;  1P3K A;  5AV5 D;  5CP6 A;  2F8N B;  3REL B;  3AZH D;  3REL A;  4J8V A;  3X1U C;  5GT3 B;  3AV2 B;  5F99 B;  3KWQ B;  5GT3 A;  5DNM D;  5FUG A;  3WAA C;  4YM6 B;  3X1V B;  1KX5 C;  1ID3 B;  4YM6 A;  3X1V A;  1ID3 A;  3B6F C;  1HTA A;  3KUY B;  2F8N D;  1ZLA B;  3KUY A;  3REJ A;  1ZLA A;  3WTP C;  4J8W A;  3MVD C;  4WV4 B;  3AV2 D;  5F99 D;  3KWQ D;  3A6N A;  4H9S A;  3X1V D;  3AZI C;  1ID3 D;  4DRA A;  4X23 C;  4J8X C;  5CPJ B;  5B40 B;  2JSS A;  3AZJ C;  4WU9 C;  5CPJ A;  5B40 A;  3MGQ A;  1KX4 C;  5JRG D;  3O62 A;  3NQJ B;  5B33 B;  3NQJ A;  1P3F B;  5B33 A;  4KGC B;  1P3F A;  5G49 B;  4KGC A;  4WNN B;  1P3B D;  1P3I C;  5CPJ D;  5E5A B;  3X1S D;  4XUJ C;  2CV5 A;  1WWS A;  5CPI C;  5B33 D;  3LJA C;  1P3F D;  3AZL C;  5AV8 C;  4KGC D;  5E5A D;  3UTA C;  5B2J C;  3LZ1 B;  3LEL C;  3AZN C;  5B24 B;  5DNN B;  3R45 B;  3X1U B;  1M19 C;  4WZS B;  3AZM B;  5B1L B;  3W98 B;  3X1U A;  4JJN C;  3AYW C;  3W98 A;  3WAA B;  5GXQ B;  4ZBJ C;  4KUD D;  3WAA A;  4WU8 B;  3LZ1 D;  1KX5 A;  4WU8 A;  3B6F B;  3C1C C;  3B6F A;  3WKJ B;  3REH B;  1M1A B;  5B24 D;  3WKJ A;  4NFT A;  5DNN D;  3W98 D;  3MVD B;  3AZM D;  5B1L D;  3MVD A;  5GXQ D;  2ARO C;  1F1E A;  4WU8 D;  3AZF D;  3MNN B;  5B32 C;  4X23 A;  3B6G C;  3AN2 D;  1P34 C;  3AZJ A;  5B31 B;  3REH D;  4WU9 A;  3C1B C;  1M1A D;  1N1J B;  3WKJ D;  3UTB D;  1KX4 A;  3AZK C;  3VH5 W;  1F66 C;  4ZUX B;  4QLC C;  3B0B A;  3LZ0 B;  3MNN D;  4ZUX A;  3LZ0 A;  4UUZ B;  2BYK A;  3AFA B;  1BH9 B;  4UUZ A;  3W99 B;  5B31 D;  1BH9 A;  3W97 B;  3WTP E;  5CPI B;  5CPI A;  5AV8 B;  3AZL A;  5AV8 A;  4ZUX D;  3LZ0 D;  2RVQ D;  1TZY B;  4M6B A;  3AFA D;  5BS7 C;  3W99 D;  3UTA B;  3W97 D;  3UTA A;  5BT1 D;  4Z66 B;  5B2I C;  3TU4 B;  5B0Y C;  3REI B;  1P3M C;  1TZY D;  3REI A;  3AZE C;  3AYW B;  1P3P B;  1KX3 B;  4JJN A;  3AYW A;  1P3P A;  1KX3 A;  3WA9 C;  4CAY B;  4CAY A;  3MGS C;  3C1C B;  3KXB B;  4Z66 D;  3C1C A;  3TU4 D;  1U35 C;  3REI D;  4Z5T C;  1M18 C;  4Z2M G;  3AYW D;  1P3P D;  4HGA C;  1KX3 D;  5AV9 B;  5KDM A;  2ARO A;  2YFV B;  1P3K B;  3VH6 T;  3KXB D;  3B6G B;  3B6G A;  2HUE C;  5CP6 B;  5GSU C;  3X1T C;  4AWL B;  1P34 A;  3C1B A;  3KSY A;  4E44 A;  1HQ3 C;  4J8V B;  5AV9 D;  5FUG B;  1F66 A;  1P3K D;  5B1M C;  4QLC A;  1AOI C;  1P3O C;  3VH5 T;  2F8N G;  2NZD B;  5CP6 D;  2NZD A;  3REJ B;  3REL D;  4J8W B;  4J8V D;  5GT3 D;  3A6N B;  2PYO C;  1P3L C;  5CPK B;  4YM6 D;  5CPK A;  1BFM A;  2NZD D;  2HIO C;  5AY8 B;  3MGP C;  5AY8 A;  3MGQ B;  3KUY D;  3REJ D;  4LD9 B;  1ZLA D;  5AVB C;  4J8W D;  5C3I C;  3O62 B;  5B2I A;  3A6N D;  3B0C T;  3VH6 A;  5B0Y B;  5CPK D;  5B0Y A;  5BNX A;  5AY8 D;  5B40 D;  3MGQ D;  2CV5 B;  2YFW B;  3MGS A;  3O62 D;  4G92 B;  2FJ7 B;  2YFW A;  4G91 C;  4R8P C;  2FJ7 A;  4LD9 C;  2L5A A;  4Z5T A;  5AVC B;  3VH5 A;  1M18 A;  5AVC A;  3UT9 C;  1S32 C;  3MGR C;  4J8U C;  2CV5 D;  3AV1 C;  3NQU B;  2FJ7 D;  5GT0 C;  4YS3 C;  3NQU A;  3X1T A;  5B0Z C;  5AVC D;  1HQ3 A;  1TAF A;  1EQZ C;  3REK C;  5B1M B;  5B1M A;  1KX5 B;  4XZQ C;  1AOI A;  1P3A C;  2NQB C;  3WTP B;  3X1U D;  1R4V A;  3WTP A;  2PYO B;  3WAA D;  1P3L B;  2PYO A;  1KX5 D;  1P3G C;  1P3L A;  3AZI B;  4J8X B;  4X23 B;  3MGP B;  3AZI A;  3B6F D;  4J8X A;  3W96 C;  3MGP A;  3AZJ B;  4WU9 B;  1KX4 B;  5AVB A;  5C3I B;  3WTP D;  3MVD D;  4H9O B;  4H9O A;  1P3I B;  3AZI D;  5B31 G;  4J8X D;  4X23 D;  2BYK B;  4XUJ B;  1P3I A;  4NE3 A;  4WU9 D;  4XUJ A;  5AV5 C;  3B0D C;  3AZJ D;  2IO5 C;  1KX4 D;  3AZH C;  4H9N B;  4G91 B;  4H9N A;  3LJA B;  4LD9 A;  3AZL B;  3LJA A;  5DNM C;  1P3I D;  4XUJ D;  3UT9 A;  3MGR A;  5B2J B;  4J8U A;  5B2J A;  3LEL B;  4YS3 B;  5BO0 B;  5CPI D;  3AZN B;  5GT0 A;  3LEL A;  3LJA D;  5BO0 A;  4YS3 A;  3AZN A;  3AZL D;  3AV2 C;  5AV8 D;  5F99 C;  5B0Z B;  3KWQ C;  5B0Z A;  1Q9C A;  3X1V C;  1M19 B;  1ID3 C;  1EQZ A;  3REK A;  4JJN B;  1M19 A;  1H3O B;  3UTA D;  1H3O A;  5B2J D;  4ZBJ B;  3LEL D;  1A7W A;  3AZN D;  5JRG C;  1P3A B;  4H9S C;  1P3A A;  4E45 A;  2NQB A;  1P3B C;  1M19 D;  5CPJ C;  1JFI B;  3X1S C;  4JJN D;  1JFI A;  5CHL B;  2LY8 A;  5KDM B;  2ARO B;  4H9Q A;  1P3G A;  3C1C D;  5B32 B;  5B33 C;  1P34 B;  5B32 A;  1P3F C;  3C1B B;  4KGC C;  4CSR B;  5E5A C;  4CSR A;  3AZK B;  5AV6 C;  3AZK A;  2ARO D;  1F66 B;  3V9R A;  5JA4 B;  4QLC B;  5JA4 A;  5B32 D;  3B6G D;  1P34 D;  4KHA A;  5AV5 A;  3C1B D;  3AZK D;  1F66 D;  5DNM A;  2F8N H;  4QLC D;  4KUD C;  3LZ1 C;  5BS7 A;  1ULY A;  3AZG C;  5B24 C;  2F8N A;  5DNN C;  3W98 C;  3AZM C;  5B1L C;  5B2I B;  3AV2 A;  5F99 A;  5GXQ C;  3KWQ A;  4WU8 C;  1P3M B;  3AZF C;  3AZE B;  1P3M A;  5BNX B;  3AZE A;  4NE5 A;  3AN2 C;  3WA9 B;  3WKJ C;  3REH C;  1M1A C;  3WA9 A;  3MGS B;  3UTB C;  5JRG B;  4EO5 C;  5B2I D;  5JRG A;  1B67 A;  1WWI A;  5B0Y D;  1U35 B;  1P3M D;  4Z5T B;  1P3B B;  3AZE D;  1U35 A;  1M18 B;  3MNN C;  3X1S B;  1P3B A;  4HGA B;  3X1S A;  3WA9 D;  5B31 C;  3MGS D;  2HUE B;  3X1T B;  5GSU B;  1U35 D;  5GSU A;  4Z5T D;  5G49 A;  4ZUX C;  1HQ3 B;  1TAF B;  1B6W A;  2RVQ C;  4WNN A;  3LZ0 C;  1M18 D;  5E5A A;  3AFA C;  3W99 C;  5AV6 B;  5AV6 A;  3W97 C;  5BT1 C;  4H9R B;  1AOI B;  1P3O B;  4H9R A;  1P3O A;  4DRB A;  3X1T D;  5GSU D;  1HQ3 D;  1TZY C;  5AV6 D;  4KUD B;  5B1M D;  4KUD A;  1AOI D;  1P3O D;  3LZ1 A;  2HIO B;  4Z66 C;  3TU4 C;  2HIO A;  3AZG B;  3AZG A;  3REI C;  5AVB B;  5B24 A;  5DNN A;  3R45 A;  1P3P C;  3AZM A;  5B1L A;  1KX3 C;  2PYO D;  5GXQ A;  3AZF B;  1P3L D;  3AZF A;  2HIO D;  3KXB C;  3MGP D;  3AN2 B;  3AZG D;  3AN2 A;  3REH A;  1M1A A;  5AVB D;  3UTB B;  4EO5 B;  3UTB A;  3VH6 W;  4R8P B;  5AV9 C; 
#chains in the Genus database with same CATH topology
 4R8P A;  2CWE A;  4NE6 A;  1P3K C;  3MNN A;  2F8N K;  3UT9 B;  2ZM5 A;  1S32 B;  1Z2C B;  5CP6 C;  3MGR B;  1S32 A;  4AWL C;  5B31 A;  4J8U B;  1N1J A;  3REL C;  4DQY B;  4J8V C;  3AV1 B;  5GT0 B;  3AV1 A;  4R8P D;  4LD9 D;  5GT3 C;  1BH8 B;  1BH8 A;  4YM6 C;  1EQZ B;  3REK B;  3UT9 D;  2NZD C;  1S32 D;  3AFA A;  3W99 A;  3MGR D;  4J8U D;  3KUY C;  3W97 A;  3REJ C;  1ZLA C;  3AV1 D;  4XZQ B;  4J8W C;  5GT0 D;  4YS3 D;  4XZQ A;  2BYM B;  2BYM A;  3A6N C;  2BG1 A;  3EPL A;  5B0Z D;  3EPJ A;  2NQB B;  5CPK C;  1EQZ D;  3REK D;  1TZY A;  5AY8 C;  5B40 C;  4H9Q B;  3MGQ C;  3B0C W;  4XZQ D;  1P3G B;  4H9P B;  3O62 C;  4H9P A;  1P3A D;  3W96 B;  4Z66 A;  3TU4 A;  3W96 A;  4Z2M H;  2NQB D;  1KU5 A;  3V9R B;  5B32 G;  2CV5 C;  1P3G D;  4G92 C;  5BNV B;  2FJ7 C;  5BNV A;  4KHA B;  5AV5 B;  3B0D B;  3KXB A;  2Y2P A;  3W96 D;  2IO5 B;  3AZH B;  5AVC C;  3AZH A;  2ZY5 A;  5AV9 A;  5DNM B;  2YFV A;  1P3K A;  3F6T A;  5AV5 D;  5CP6 A;  2F8N B;  3REL B;  3AZH D;  3REL A;  4J8V A;  3X1U C;  5GT3 B;  3AV2 B;  5F99 B;  3KWQ B;  5GT3 A;  5DNM D;  5FUG A;  3WAA C;  4YM6 B;  3X1V B;  1KX5 C;  1ID3 B;  4YM6 A;  3X1V A;  2JE5 A;  1ID3 A;  3B6F C;  1HTA A;  3KUY B;  2F8N D;  1ZLA B;  3KUY A;  3REJ A;  1ZLA A;  3WTP C;  4J8W A;  3MVD C;  3A1K A;  4WV4 B;  3AV2 D;  5F99 D;  3KWQ D;  3A6N A;  4H9S A;  3X1V D;  3AZI C;  1ID3 D;  4DRA A;  4X23 C;  4J8X C;  5CPJ B;  5B40 B;  2JSS A;  3AZJ C;  4WU9 C;  5CPJ A;  5B40 A;  3MGQ A;  3P5J B;  1KX4 C;  5JRG D;  3O62 A;  3NQJ B;  5B33 B;  3NQJ A;  1P3F B;  5B33 A;  4KGC B;  1P3F A;  5G49 B;  4KGC A;  4WNN B;  1P3B D;  1P3I C;  5CPJ D;  2Y2K A;  5E5A B;  4XUJ C;  3X1S D;  2CV5 A;  1WWS A;  5CPI C;  5B33 D;  3LJA C;  1P3F D;  3AZL C;  5AV8 C;  4KGC D;  2Y2Q A;  5E5A D;  2ZY2 A;  3IP4 C;  3UTA C;  3H0M C;  5B2J C;  2XD1 A;  3LZ1 B;  3LEL C;  3AZN C;  3FDD A;  5B24 B;  5DNN B;  3R45 B;  3X1U B;  1M19 C;  4WZS B;  3AZM B;  5B1L B;  3W98 B;  3X1U A;  4JJN C;  3AYW C;  3W98 A;  3WAA B;  5GXQ B;  4ZBJ C;  4KUD D;  3WAA A;  4WU8 B;  3EPH A;  3LZ1 D;  1KX5 A;  4WU8 A;  3B6F B;  2Y2O A;  3C1C C;  3B6F A;  3WKJ B;  3REH B;  1M1A B;  5B24 D;  3WKJ A;  4NFT A;  5DNN D;  3W98 D;  3MVD B;  3AZM D;  5B1L D;  3MVD A;  1T3U A;  5GXQ D;  2ARO C;  2Y2L A;  1F1E A;  4WU8 D;  3AZF D;  3MNN B;  5B32 C;  4X23 A;  3B6G C;  3AN2 D;  1P34 C;  3AZJ A;  5B31 B;  3REH D;  4WU9 A;  3C1B C;  1M1A D;  1N1J B;  3WKJ D;  3UTB D;  1KX4 A;  3AZK C;  2Y2G A;  3VH5 W;  1F66 C;  4ZUX B;  4QLC C;  3B0B A;  3LZ0 B;  3MNN D;  2JCH A;  4ZUX A;  3LZ0 A;  4UUZ B;  2BYK A;  3AFA B;  1BH9 B;  4UUZ A;  3W99 B;  5B31 D;  1BH9 A;  3W97 B;  3WTP E;  5CPI B;  5CPI A;  5AV8 B;  3AZL A;  5AV8 A;  4ZUX D;  3LZ0 D;  2RVQ D;  1TZY B;  4M6B A;  3AFA D;  5BS7 C;  3W99 D;  3UTA B;  3W97 D;  3UTA A;  5BT1 D;  2ZY4 A;  4Z66 B;  5B2I C;  3TU4 B;  5B0Y C;  3REI B;  1P3M C;  1TZY D;  3REI A;  3AZE C;  3AYW B;  1P3P B;  1KX3 B;  4JJN A;  3AYW A;  1P3P A;  1KX3 A;  3WA9 C;  4CAY B;  3KFU G;  4CAY A;  3MGS C;  3C1C B;  3KXB B;  1W2E A;  4Z66 D;  3C1C A;  3TU4 D;  1U35 C;  3REI D;  4Z5T C;  1M18 C;  4Z2M G;  3AYW D;  1P3P D;  4HGA C;  1KX3 D;  5AV9 B;  5KDM A;  2ARO A;  2YFV B;  1P3K B;  3VH6 T;  3KXB D;  3B6G B;  3B6G A;  5CP6 B;  2HUE C;  3H0R C;  5GSU C;  4AWL B;  3X1T C;  1P34 A;  3C1B A;  3KSY A;  4E44 A;  1HQ3 C;  4J8V B;  5AV9 D;  5FUG B;  1F66 A;  1P3K D;  5B1M C;  4QLC A;  1AOI C;  1P3O C;  3VH5 T;  2F8N G;  2NZD B;  5CP6 D;  2NZD A;  3REJ B;  3REL D;  4J8W B;  4J8V D;  3EPK A;  5GT3 D;  3A6N B;  2PYO C;  1P3L C;  5CPK B;  4YM6 D;  5CPK A;  1BFM A;  2NZD D;  2HIO C;  5AY8 B;  3MGP C;  5AY8 A;  3MGQ B;  3KUY D;  3REJ D;  4LD9 B;  1ZLA D;  5AVB C;  4UPK A;  4J8W D;  5C3I C;  3O62 B;  5B2I A;  3A6N D;  3B0C T;  3VH6 A;  5B0Y B;  5CPK D;  5B0Y A;  5BNX A;  5AY8 D;  5B40 D;  3MGQ D;  2CV5 B;  2YFW B;  3MGS A;  3O62 D;  4G92 B;  2FJ7 B;  2YFW A;  4G91 C;  4R8P C;  2FJ7 A;  4LD9 C;  2L5A A;  4Z5T A;  5AVC B;  3VH5 A;  1M18 A;  5AVC A;  3UT9 C;  1S32 C;  3MGR C;  4J8U C;  2CV5 D;  3AV1 C;  3NQU B;  2FJ7 D;  5GT0 C;  4YS3 C;  3NQU A;  2G5I C;  2ZY3 A;  3X1T A;  5B0Z C;  5AVC D;  1HQ3 A;  1TAF A;  1EQZ C;  3REK C;  2FFF B;  5B1M B;  5B1M A;  1KX5 B;  4XZQ C;  1AOI A;  1P3A C;  2F2A C;  2NQB C;  2VQR A;  3WTP B;  3X1U D;  1R4V A;  3WTP A;  2Y2J A;  2PYO B;  3WAA D;  1P3L B;  2PYO A;  1KX5 D;  1P3G C;  1P3L A;  3AZI B;  4J8X B;  4X23 B;  3MGP B;  3AZI A;  3B6F D;  4J8X A;  3W96 C;  3MGP A;  3AZJ B;  4WU9 B;  1KX4 B;  5AVB A;  5C3I B;  3WTP D;  3MVD D;  1PZR A;  4H9O B;  3EG5 B;  4H9O A;  1P3I B;  3AZI D;  5B31 G;  4J8X D;  4X23 D;  2BYK B;  4XUJ B;  1P3I A;  4NE3 A;  4WU9 D;  4XUJ A;  5AV5 C;  3B0D C;  3AZJ D;  2IO5 C;  2J8P A;  1KX4 D;  3AZH C;  4H9N B;  4G91 B;  4H9N A;  3LJA B;  4LD9 A;  3AZL B;  3LJA A;  5DNM C;  1P3I D;  4XUJ D;  3UT9 A;  3MGR A;  5B2J B;  4J8U A;  5B2J A;  3LEL B;  2Y2H A;  5BO0 B;  4YS3 B;  3AZN B;  5GT0 A;  3LEL A;  3LJA D;  5BO0 A;  4YS3 A;  3AZN A;  3AZL D;  3AV2 C;  5AV8 D;  5F99 C;  2DQN C;  5B0Z B;  3KWQ C;  5B0Z A;  1Q9C A;  3X1V C;  1M19 B;  1ID3 C;  1EQZ A;  3REK A;  4JJN B;  1M19 A;  1H3O B;  3UTA D;  1H3O A;  5B2J D;  4ZBJ B;  3LEL D;  1A7W A;  3AZN D;  5JRG C;  1P3A B;  4H9S C;  1P3A A;  4E45 A;  2NQB A;  1P3B C;  1M19 D;  5CPJ C;  1JFI B;  3X1S C;  4JJN D;  1JFI A;  5CHL B;  2LY8 A;  5CPI D;  5KDM B;  2ARO B;  4H9Q A;  2Y2I A;  1P3G A;  3C1C D;  5B32 B;  5B33 C;  1P34 B;  5B32 A;  2Y2N A;  1P3F C;  3C1B B;  4KGC C;  4CSR B;  5E5A C;  4CSR A;  3AZK B;  5AV6 C;  3AZK A;  2ARO D;  1F66 B;  3V9R A;  5JA4 B;  4QLC B;  5JA4 A;  5B32 D;  3B6G D;  2W8S A;  1P34 D;  4KHA A;  5AV5 A;  3C1B D;  3AZK D;  1F66 D;  5DNM A;  2F8N H;  4QLC D;  2XD5 A;  4KUD C;  3LZ1 C;  2G5H C;  5BS7 A;  1ULY A;  3AZG C;  5B24 C;  2F8N A;  5DNN C;  3W98 C;  3AZM C;  5B1L C;  5B2I B;  3AV2 A;  5F99 A;  5GXQ C;  3KWQ A;  4WU8 C;  1P3M B;  3AZF C;  3AZE B;  1P3M A;  5BNX B;  3AZE A;  4NE5 A;  3AN2 C;  3WA9 B;  3WKJ C;  3REH C;  1M1A C;  3WA9 A;  3MGS B;  3UTB C;  5JRG B;  4EO5 C;  5B2I D;  5JRG A;  1B67 A;  1WWI A;  5B0Y D;  1U35 B;  1P3M D;  4Z5T B;  3H0L C;  3AZE D;  1U35 A;  1P3B B;  3MNN C;  3X1S B;  1P3B A;  1M18 B;  4HGA B;  3X1S A;  3WA9 D;  5B31 C;  3MGS D;  2HUE B;  3X1T B;  5GSU B;  1U35 D;  5GSU A;  4Z5T D;  4ZUX C;  5G49 A;  1HQ3 B;  1TAF B;  1B6W A;  2RVQ C;  4WNN A;  3LZ0 C;  1M18 D;  5E5A A;  3AFA C;  3W99 C;  5AV6 B;  5AV6 A;  3W97 C;  5BT1 C;  2RIQ A;  4H9R B;  1AOI B;  1P3O B;  4H9R A;  1P3O A;  4DRB A;  3X1T D;  5GSU D;  4WJ3 C;  1HQ3 D;  3AL0 C;  1TZY C;  3A1I A;  5AV6 D;  2UWX A;  4KUD B;  5B1M D;  4KUD A;  1AOI D;  1P3O D;  3LZ1 A;  2HIO B;  4Z66 C;  3TU4 C;  2HIO A;  3AZG B;  2Y2M A;  3AZG A;  3REI C;  5AVB B;  5B24 A;  5DNN A;  3R45 A;  1P3P C;  3AZM A;  5B1L A;  1KX3 C;  2PYO D;  5GXQ A;  3AZF B;  1P3L D;  3AZF A;  2HIO D;  3KXB C;  3MGP D;  3AN2 B;  3AZG D;  3AN2 A;  2DF4 C;  3REH A;  1M1A A;  5AVB D;  3UTB B;  4EO5 B;  3UTB A;  3VH6 W;  4R8P B;  5AV9 C; 
#chains in the Genus database with same CATH homology
 4R8P A;  2CWE A;  4NE6 A;  1P3K C;  3MNN A;  2F8N K;  3UT9 B;  2ZM5 A;  1S32 B;  1Z2C B;  5CP6 C;  3MGR B;  1S32 A;  4AWL C;  5B31 A;  4J8U B;  1N1J A;  3REL C;  4DQY B;  4J8V C;  3AV1 B;  5GT0 B;  3AV1 A;  4R8P D;  4LD9 D;  5GT3 C;  1BH8 B;  1BH8 A;  4YM6 C;  1EQZ B;  3REK B;  3UT9 D;  2NZD C;  1S32 D;  3AFA A;  3W99 A;  3MGR D;  4J8U D;  3KUY C;  3W97 A;  3REJ C;  1ZLA C;  3AV1 D;  4XZQ B;  4J8W C;  5GT0 D;  4YS3 D;  4XZQ A;  2BYM B;  2BYM A;  3A6N C;  2BG1 A;  3EPL A;  5B0Z D;  3EPJ A;  2NQB B;  5CPK C;  1EQZ D;  3REK D;  1TZY A;  5AY8 C;  5B40 C;  4H9Q B;  3MGQ C;  3B0C W;  4XZQ D;  1P3G B;  4H9P B;  3O62 C;  4H9P A;  1P3A D;  3W96 B;  4Z66 A;  3TU4 A;  3W96 A;  4Z2M H;  2NQB D;  1KU5 A;  3V9R B;  5B32 G;  2CV5 C;  1P3G D;  4G92 C;  5BNV B;  2FJ7 C;  5BNV A;  4KHA B;  5AV5 B;  3B0D B;  3KXB A;  2Y2P A;  3W96 D;  2IO5 B;  3AZH B;  5AVC C;  3AZH A;  2ZY5 A;  5AV9 A;  5DNM B;  2YFV A;  1P3K A;  3F6T A;  5AV5 D;  5CP6 A;  2F8N B;  3REL B;  3AZH D;  3REL A;  4J8V A;  3X1U C;  5GT3 B;  3AV2 B;  5F99 B;  3KWQ B;  5GT3 A;  5DNM D;  5FUG A;  3WAA C;  4YM6 B;  3X1V B;  1KX5 C;  1ID3 B;  4YM6 A;  3X1V A;  2JE5 A;  1ID3 A;  3B6F C;  1HTA A;  3KUY B;  2F8N D;  1ZLA B;  3KUY A;  3REJ A;  1ZLA A;  3WTP C;  4J8W A;  3MVD C;  3A1K A;  4WV4 B;  3AV2 D;  5F99 D;  3KWQ D;  3A6N A;  4H9S A;  3X1V D;  3AZI C;  1ID3 D;  4DRA A;  4X23 C;  4J8X C;  5CPJ B;  5B40 B;  2JSS A;  3AZJ C;  4WU9 C;  5CPJ A;  5B40 A;  3MGQ A;  3P5J B;  1KX4 C;  5JRG D;  3O62 A;  3NQJ B;  5B33 B;  3NQJ A;  1P3F B;  5B33 A;  4KGC B;  1P3F A;  5G49 B;  4KGC A;  4WNN B;  1P3B D;  1P3I C;  5CPJ D;  2Y2K A;  5E5A B;  4XUJ C;  3X1S D;  2CV5 A;  1WWS A;  5CPI C;  5B33 D;  3LJA C;  1P3F D;  3AZL C;  5AV8 C;  4KGC D;  2Y2Q A;  5E5A D;  2ZY2 A;  3IP4 C;  3UTA C;  3H0M C;  5B2J C;  2XD1 A;  3LZ1 B;  3LEL C;  3AZN C;  3FDD A;  5B24 B;  5DNN B;  3R45 B;  3X1U B;  1M19 C;  4WZS B;  3AZM B;  5B1L B;  3W98 B;  3X1U A;  4JJN C;  3AYW C;  3W98 A;  3WAA B;  5GXQ B;  4ZBJ C;  4KUD D;  3WAA A;  4WU8 B;  3EPH A;  3LZ1 D;  1KX5 A;  4WU8 A;  3B6F B;  2Y2O A;  3C1C C;  3B6F A;  3WKJ B;  3REH B;  1M1A B;  5B24 D;  3WKJ A;  4NFT A;  5DNN D;  3W98 D;  3MVD B;  3AZM D;  5B1L D;  3MVD A;  1T3U A;  5GXQ D;  2ARO C;  2Y2L A;  1F1E A;  4WU8 D;  3AZF D;  3MNN B;  5B32 C;  4X23 A;  3B6G C;  3AN2 D;  1P34 C;  3AZJ A;  5B31 B;  3REH D;  4WU9 A;  3C1B C;  1M1A D;  1N1J B;  3WKJ D;  3UTB D;  1KX4 A;  3AZK C;  2Y2G A;  3VH5 W;  1F66 C;  4ZUX B;  4QLC C;  3B0B A;  3LZ0 B;  3MNN D;  2JCH A;  4ZUX A;  3LZ0 A;  4UUZ B;  2BYK A;  3AFA B;  1BH9 B;  4UUZ A;  3W99 B;  5B31 D;  1BH9 A;  3W97 B;  3WTP E;  5CPI B;  5CPI A;  5AV8 B;  3AZL A;  5AV8 A;  4ZUX D;  3LZ0 D;  2RVQ D;  1TZY B;  4M6B A;  3AFA D;  5BS7 C;  3W99 D;  3UTA B;  3W97 D;  3UTA A;  5BT1 D;  2ZY4 A;  4Z66 B;  5B2I C;  3TU4 B;  5B0Y C;  3REI B;  1P3M C;  1TZY D;  3REI A;  3AZE C;  3AYW B;  1P3P B;  1KX3 B;  4JJN A;  3AYW A;  1P3P A;  1KX3 A;  3WA9 C;  4CAY B;  3KFU G;  4CAY A;  3MGS C;  3C1C B;  3KXB B;  1W2E A;  4Z66 D;  3C1C A;  3TU4 D;  1U35 C;  3REI D;  4Z5T C;  1M18 C;  4Z2M G;  3AYW D;  1P3P D;  4HGA C;  1KX3 D;  5AV9 B;  5KDM A;  2ARO A;  2YFV B;  1P3K B;  3VH6 T;  3KXB D;  3B6G B;  3B6G A;  5CP6 B;  2HUE C;  3H0R C;  5GSU C;  4AWL B;  3X1T C;  1P34 A;  3C1B A;  3KSY A;  4E44 A;  1HQ3 C;  4J8V B;  5AV9 D;  5FUG B;  1F66 A;  1P3K D;  5B1M C;  4QLC A;  1AOI C;  1P3O C;  3VH5 T;  2F8N G;  2NZD B;  5CP6 D;  2NZD A;  3REJ B;  3REL D;  4J8W B;  4J8V D;  3EPK A;  5GT3 D;  3A6N B;  2PYO C;  1P3L C;  5CPK B;  4YM6 D;  5CPK A;  1BFM A;  2NZD D;  2HIO C;  5AY8 B;  3MGP C;  5AY8 A;  3MGQ B;  3KUY D;  3REJ D;  4LD9 B;  1ZLA D;  5AVB C;  4UPK A;  4J8W D;  5C3I C;  3O62 B;  5B2I A;  3A6N D;  3B0C T;  3VH6 A;  5B0Y B;  5CPK D;  5B0Y A;  5BNX A;  5AY8 D;  5B40 D;  3MGQ D;  2CV5 B;  2YFW B;  3MGS A;  3O62 D;  4G92 B;  2FJ7 B;  2YFW A;  4G91 C;  4R8P C;  2FJ7 A;  4LD9 C;  2L5A A;  4Z5T A;  5AVC B;  3VH5 A;  1M18 A;  5AVC A;  3UT9 C;  1S32 C;  3MGR C;  4J8U C;  2CV5 D;  3AV1 C;  3NQU B;  2FJ7 D;  5GT0 C;  4YS3 C;  3NQU A;  2G5I C;  2ZY3 A;  3X1T A;  5B0Z C;  5AVC D;  1HQ3 A;  1TAF A;  1EQZ C;  3REK C;  2FFF B;  5B1M B;  5B1M A;  1KX5 B;  4XZQ C;  1AOI A;  1P3A C;  2F2A C;  2NQB C;  2VQR A;  3WTP B;  3X1U D;  1R4V A;  3WTP A;  2Y2J A;  2PYO B;  3WAA D;  1P3L B;  2PYO A;  1KX5 D;  1P3G C;  1P3L A;  3AZI B;  4J8X B;  4X23 B;  3MGP B;  3AZI A;  3B6F D;  4J8X A;  3W96 C;  3MGP A;  3AZJ B;  4WU9 B;  1KX4 B;  5AVB A;  5C3I B;  3WTP D;  3MVD D;  1PZR A;  4H9O B;  3EG5 B;  4H9O A;  1P3I B;  3AZI D;  5B31 G;  4J8X D;  4X23 D;  2BYK B;  4XUJ B;  1P3I A;  4NE3 A;  4WU9 D;  4XUJ A;  5AV5 C;  3B0D C;  3AZJ D;  2IO5 C;  2J8P A;  1KX4 D;  3AZH C;  4H9N B;  4G91 B;  4H9N A;  3LJA B;  4LD9 A;  3AZL B;  3LJA A;  5DNM C;  1P3I D;  4XUJ D;  3UT9 A;  3MGR A;  5B2J B;  4J8U A;  5B2J A;  3LEL B;  2Y2H A;  5BO0 B;  4YS3 B;  3AZN B;  5GT0 A;  3LEL A;  3LJA D;  5BO0 A;  4YS3 A;  3AZN A;  3AZL D;  3AV2 C;  5AV8 D;  5F99 C;  2DQN C;  5B0Z B;  3KWQ C;  5B0Z A;  1Q9C A;  3X1V C;  1M19 B;  1ID3 C;  1EQZ A;  3REK A;  4JJN B;  1M19 A;  1H3O B;  3UTA D;  1H3O A;  5B2J D;  4ZBJ B;  3LEL D;  1A7W A;  3AZN D;  5JRG C;  1P3A B;  4H9S C;  1P3A A;  4E45 A;  2NQB A;  1P3B C;  1M19 D;  5CPJ C;  1JFI B;  3X1S C;  4JJN D;  1JFI A;  5CHL B;  2LY8 A;  5CPI D;  5KDM B;  2ARO B;  4H9Q A;  2Y2I A;  1P3G A;  3C1C D;  5B32 B;  5B33 C;  1P34 B;  5B32 A;  2Y2N A;  1P3F C;  3C1B B;  4KGC C;  4CSR B;  5E5A C;  4CSR A;  3AZK B;  5AV6 C;  3AZK A;  2ARO D;  1F66 B;  3V9R A;  5JA4 B;  4QLC B;  5JA4 A;  5B32 D;  3B6G D;  2W8S A;  1P34 D;  4KHA A;  5AV5 A;  3C1B D;  3AZK D;  1F66 D;  5DNM A;  2F8N H;  4QLC D;  2XD5 A;  4KUD C;  3LZ1 C;  2G5H C;  5BS7 A;  1ULY A;  3AZG C;  5B24 C;  2F8N A;  5DNN C;  3W98 C;  3AZM C;  5B1L C;  5B2I B;  3AV2 A;  5F99 A;  5GXQ C;  3KWQ A;  4WU8 C;  1P3M B;  3AZF C;  3AZE B;  1P3M A;  5BNX B;  3AZE A;  4NE5 A;  3AN2 C;  3WA9 B;  3WKJ C;  3REH C;  1M1A C;  3WA9 A;  3MGS B;  3UTB C;  5JRG B;  4EO5 C;  5B2I D;  5JRG A;  1B67 A;  1WWI A;  5B0Y D;  1U35 B;  1P3M D;  4Z5T B;  3H0L C;  3AZE D;  1U35 A;  1P3B B;  3MNN C;  3X1S B;  1P3B A;  1M18 B;  4HGA B;  3X1S A;  3WA9 D;  5B31 C;  3MGS D;  2HUE B;  3X1T B;  5GSU B;  1U35 D;  5GSU A;  4Z5T D;  4ZUX C;  5G49 A;  1HQ3 B;  1TAF B;  1B6W A;  2RVQ C;  4WNN A;  3LZ0 C;  1M18 D;  5E5A A;  3AFA C;  3W99 C;  5AV6 B;  5AV6 A;  3W97 C;  5BT1 C;  2RIQ A;  4H9R B;  1AOI B;  1P3O B;  4H9R A;  1P3O A;  4DRB A;  3X1T D;  5GSU D;  4WJ3 C;  1HQ3 D;  3AL0 C;  1TZY C;  3A1I A;  5AV6 D;  2UWX A;  4KUD B;  5B1M D;  4KUD A;  1AOI D;  1P3O D;  3LZ1 A;  2HIO B;  4Z66 C;  3TU4 C;  2HIO A;  3AZG B;  2Y2M A;  3AZG A;  3REI C;  5AVB B;  5B24 A;  5DNN A;  3R45 A;  1P3P C;  3AZM A;  5B1L A;  1KX3 C;  2PYO D;  5GXQ A;  3AZF B;  1P3L D;  3AZF A;  2HIO D;  3KXB C;  3MGP D;  3AN2 B;  3AZG D;  3AN2 A;  2DF4 C;  3REH A;  1M1A A;  5AVB D;  3UTB B;  4EO5 B;  3UTB A;  3VH6 W;  4R8P B;  5AV9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...