3TU4A

Crystal structure of the sir3 bah domain in complex with a nucleosome core particle.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/structural protein/dna
molecule keywords Histone H3.2
publication title Structural basis of silencing: Sir3 BAH domain in complex with a nucleosome at 3.0 A resolution.
pubmed doi rcsb
source organism Xenopus laevis
total genus 32
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3tu4A00
5G49B 5E5AD 3AZGC 3VH5W 5B32A 5AV9A 2CV5D 4J8VD 1KX5B 5BNXA 5BO0A 1H3OB 3X1UD 1S32D 4WU9A 1F66B 5B1MC 3MNNB 1P3LD 5GXQD 1KX4C 5GSUD 3LELD 2F8NK 5GT3B 1U35A 2NQBC 1P3AA 4AWLB 3LJAA 3WKJA 3A6ND 4H9QB 1BFMA 5E5AC 3W98A 3REHD 1JFIB 4J8VC 3KUYA 1M19B 4ZUXB 4KGCB 3X1UC 1KX3D 4QLCD 4WZSB 3WA9A 3AZFD 3AZNA 1A7WA 5CPIA 5B2IB 1P3LC 5GSUC 5DNMA 3VH6A 2HIOD 4Z2MG 5CPJB 1Q9CA 3A6NC 4JJNA 3WTPE 2NZDA 4G91C 3UTAA 5B33B 1P3MD 3AN2B 3AV1A 1KX3C 4QLCC 2IO5B 3C1BD 3MGSD 1EQZA 1ID3B 5AV5C 4WU8A 5AVCD 3KWQB 5B2JB 4J8WA 4CAYB 5C3IC 3AZIB 3C1CB 1M1AA 3MGRA 2HIOC 3VH5A 5F99B 5AV9D 3MNND 2AROA 3TU4D 1HQ3A 5DNNC 5GT3D 3REIC 3W97A 3AZJD 4R8PA 4X23D 1P3MC 3W99D 5CPKA 3UTBB 3MGSC 1KX5C 5AVCC 4KHAB 3X1SA 4LD9D 5KDMA 2PYOA 1TZYA 3AZMB 1F66C 5B2ID 5B31B 3MNNC 4KUDD 3AYWB 3AZHD 5GT3C 5B1MB 3AZJC 2YFVB 1P3IA 4AWLC 3AFAD 1BH9A 4H9OB 1TAFA 4H9SA 4YM6A 2NQBB 5B33D 4H9RB 5CHLB 1M19C 5E5AB 5DNMD 4ZUXC 4NE3A 3X1VD 2CV5B 1P34B 4XZQD 3X1UB 5B2IC 1S32B 1M18A 4KUDC 3AZKA 3AZHC 1P3OA 3C1CD 3W96A 3AZED 5CPJC 4M6BA 1ULYA 5GXQB 4WU8D 3LELB 3REKA 3LZ0D 5JA4A 2F8NH 2HUEB 1M1AD 5B33C 1HTAA 1P3BD 4Z5TA 1AOIA 5B24B 3X1TB 5GT0B 3X1VC 3REHB 4YS3A 3NQJA 3UTBD 4XZQC 1ID3C 3MGPA 5JRGA 3KWQC 3AZFB 3C1CC 4ZBJC 3AZMD 5AVBA 3V9RA 3AZEC 5CP6A 2FJ7A 3B6GA 3AYWD 1N1JB 3WTPB 3LZ0C 1P3BC 3AV2B 4NE5A 4Z66B 5AV5A 3UTBC 3B0CT 5AV8A 4J8UA 5BS7C 3C1BB 3MGSB 4XUJD 1P34D 1P3KA 1P3GA 3MVDD 3UT9A 3AZMC 5AVCB 3B6FB 4UUZA 5B0ZA 4NFTA 4YM6D 5B31C 3O62A 3AYWC 5DNNA 3REIA 2F8NA 3AZLA 5B32B 5AV9B 5G49A 4H9PB 3TU4B 5BNVA 4DRAA 1KX5A 3AZJB 1BH8B 4WU9B 1H3OA 4X23B 3W99B 5B24D 3X1TD 5GT0D 2CV5C 1F66A 1R4VA 4XUJC 1P34C 3MVDC 4LD9B 1S32C 1U35B 3RELA 4YS3D 4KUDB 2BYMB 3AZHB 5GXQC 5AV6D 3KUYB 1JFIA 3LELC 3WTPD 2L5AA 3WAAA 2HUEC 3KXBD 4ZUXA 3AFAB 5AY8A 3AZNB 1M19A 4KGCA 5B31G 5B24C 3LZ1D 5B40D 3MGQA 3REJD 5GT0C 3REHC 3AV2D 3X1TC 4Z66D 1P3FA 5DNMB 3X1VB 3AZFC 1P3PD 4XZQB 4Z2MH 5CPJA 5B1LA 3UTAB 3B6FD 4ZBJB 2CWEA 3WTPC 3AZEB 5B32D 3AN2A 1P3GD 4WU8B 3AV2C 3LZ0B 4Z66C 1ID3A 1M1AB 1P3BB 4WU9D 3MGRB 5B2JA 5B0YA 4CAYA 4J8XA 3AZIA 3C1BC 2AROB 1P3PC 4E44A 5F99A 3B6FC 1U35D 2YFWB 3W97B 1P3AD 4R8PB 3LJAD 3WKJD 5CPKB 3W98D 4WV4B 2BYKB 2JSSA 5B32C 5AV9C 3B0DB 5FUGA 3TU4C 3KUYD 3NQUB 3X1SB 1ZLAA 2PYOB 3WA9D 4WU9C 4G92B 4X23C 4KHAA 3AZND 3W99C 4CSRB 3AZGA 5CPID 5B31A 4LD9C 4WNNA 1U35C 1P3IB 4XUJB 3MVDB 4JJND 5B1MA 2YFVA 1WWIA 3UTAD 3W98C 4DRBA 4YM6B 1KX4A 2NZDD 3VH6T 3KUYC 3AV1D 2NQBA 4H9RA 3WA9C 5E5AA 3AFAC 3AZNC 1EQZD 1B67A 5CPIC 5B1LD 4J8VA 4J8WD 3X1UA 1S32A 5B32G 5DNMC 3MGRD 3W96B 2AROD 1HQ3D 3REKB 3UTAC 1P3LA 5JA4B 5GXQA 3W97D 5GSUA 3VH5T 4R8PD 3LELA 3R45B 5CPKD 4YS3B 3A6NA 1EQZC 5AV6B 3REHA 5BT1D 3MGPB 5JRGB 4WU8C 3X1SD 4J8WC 2PYOD 3KXBB 1M1AC 1KX3A 1TZYD 4QLCA 3REJB 5AVBB 5B40B 3LZ1B 3MGRC 3AZFA 3B0BA 5CP6B 2FJ7B 2AROC 3B6GB 3W97C 1P3ID 4R8PC 1P3PB 2HIOA 3AZGD 5CPKC 4H9NA 3B0DC 5AV8B 3X1SC 1P3MA 2PYOC 1P3GB 1P3KB 4G92C 3UT9B 5BNXB 5BO0B 4UUZB 5B0ZB 3MGSA 1M18D 4HGAC 3AZKD 1P3OD 5AVCA 2F8NB 3AZLB 3W96D 1P3IC 5BNVB 3MNNA 3REKD 4H9PA 4H9SC 3TU4A 4YM6C 1P3AB 3LJAB 3WKJB 4Z5TD 1AOID 5GT3A 3AZJA 3W98B 1BH8A 4X23A 3W99A 4H9QA 3MGPD 5JRGD 1M18C 3WA9B 3AZKC 1P3OC 4LD9A 3RELB 3B0CW 5CPIB 5AVBD 3W96C 5CP6D 2FJ7D 3B6GD 5B2IA 4KUDA 3REKC 2BYMA 2LY8A 3AZHA 3WAAB 5AY8B 4Z5TC 1AOIC 4JJNB 3MGQB 2NZDB 3AFAA 5AV5D 4YS3C 1P3FB 1KU5A 5AV6C 3AV1B 3MGPC 5JRGC 5AV8D 4J8UD 5B33A 3KXBC 1EQZB 1P3KD 3X1VA 3UT9D 5B1LB 5AVBC 3LZ1C 3REJC 5B40C 5B0ZD 4XZQA 4J8WB 5CP6C 3O62D 2FJ7C 3B6GC 5DNND 3KWQA 3REID 2F8ND 3AZLD 3C1CA 1HQ3B 3AZEA 3KSYA 1KX5D 3LZ0A 5AV8C 5B0YB 4J8XB 4J8UC 1P3BA 1F66D 1P3GC 1P3KC 3UT9C 3UTBA 5B0ZC 5KDMB 3O62C 4E45A 1TZYB 3RELD 5BS7A 2YFWA 3AZLC 4HGAB 3AZMA 4EO5B 5FUGB 2BYKA 1ZLAB 3WAAD 3AYWA 1P3AC 1M19D 3NQUA 4ZUXD 3LJAC 5AY8D 3WKJC 4KGCD 3AZGB 3MGQD 1BH9B 1TAFB 1P3FD 4CSRA 4H9OA 4WNNB 3RELC 5CPJD 2CV5A 4XUJA 1P34A 1KX4B 3MVDA 1M18B 3AZKB 1P3OB 1F1EA 3WAAC 3AN2D 5AY8C 4KGCC 4JJNC 3MGQC 4J8VB 2NZDC 1ID3D 2F8NG 1P3FC 4Z5TB 3KWQD 1AOIB 3AV1C 5B2JD 5B0YD 4J8XD 3AZID 3NQJB 5B24A 3X1TA 5GT0A 5F99D 5B1LC 1P3LB 5GSUB 4NE6A 3V9RB 3A6NB 3AN2C 3R45A 4G91B 1HQ3C 2IO5C 1ZLAD 2RVQD 5AV6A 1KX3B 4QLCB 1N1JA 3VH6W 3WTPA 5B2JC 1WWSA 5B0YC 3KXBA 4J8XC 3AZIC 5AV5B 1B6WA 3AV2A 3REJA 3LZ1A 5B40A 5F99C 5BT1C 5B31D 4Z66A 4J8UB 5C3IB 2HIOB 1TZYC 5B1MD 3C1BA 1P3PA 4H9NB 1KX4D 3O62B 4EO5C 5DNNB 3B6FA 3REIB 2NQBD 1ZLAC 2RVQC 1P3MB
chains in the Genus database with same CATH superfamily
5G49B 5E5AD 3AZGC 3VH5W 5B32A 5AV9A 2W8SA 4J8VD 2CV5D 1KX5B 5BNXA 5BO0A 1H3OB 2J8PA 3X1UD 1S32D 4WU9A 1F66B 5B1MC 3MNNB 1P3LD 5GXQD 1KX4C 5GSUD 2DF4C 3LELD 2F8NK 5GT3B 1U35A 2NQBC 1P3AA 4AWLB 3LJAA 3WKJA 3A6ND 4H9QB 1BFMA 2ZY5A 5E5AC 3W98A 3REHD 1JFIB 4J8VC 3KUYA 1M19B 4ZUXB 4KGCB 3X1UC 1KX3D 4QLCD 4WZSB 3WA9A 2F2AC 3AZFD 3AZNA 1A7WA 5CPIA 5B2IB 1P3LC 2Y2MA 2BG1A 5GSUC 5DNMA 3VH6A 2RIQA 2HIOD 4Z2MG 5CPJB 1Q9CA 3A6NC 4JJNA 3WTPE 3A1IA 2NZDA 4G91C 3UTAA 2Y2GA 5B33B 1P3MD 3AN2B 3AV1A 1KX3C 2Y2NA 4QLCC 2IO5B 3C1BD 3MGSD 2Y2HA 1ID3B 1EQZA 5AV5C 4WU8A 5AVCD 3KWQB 5B2JB 4J8WA 4CAYB 5C3IC 3AZIB 3C1CB 1M1AA 3MGRA 2HIOC 3VH5A 5F99B 5AV9D 3MNND 2AROA 3TU4D 1HQ3A 5DNNC 5GT3D 3REIC 3W97A 3AZJD 4R8PA 4X23D 1P3MC 3W99D 5CPKA 3UTBB 3MGSC 1KX5C 3F6TA 5AVCC 4KHAB 3X1SA 4LD9D 5KDMA 2PYOA 1TZYA 3AZMB 1F66C 5B2ID 5B31B 3MNNC 4KUDD 3AYWB 3AZHD 5GT3C 5B1MB 2FFFB 2JCHA 3EPJA 2YFVB 3AZJC 4AWLC 3AFAD 1P3IA 3EPLA 1BH9A 4H9OB 1TAFA 4H9SA 4YM6A 2NQBB 1W2EA 5B33D 4H9RB 5CHLB 1M19C 5E5AB 5DNMD 2ZY4A 4ZUXC 4NE3A 3X1VD 2CV5B 1P34B 4XZQD 3X1UB 5B2IC 1S32B 1M18A 4KUDC 3AZKA 2VQRA 3AZHC 1P3OA 3C1CD 3W96A 3AZED 5CPJC 4M6BA 1ULYA 5GXQB 4WU8D 3LELB 3REKA 3LZ0D 5JA4A 2F8NH 2HUEB 1M1AD 5B33C 1HTAA 1P3BD 4Z5TA 1AOIA 5B24B 3X1TB 5GT0B 3X1VC 3REHB 4YS3A 3NQJA 3UTBD 4XZQC 1ID3C 3MGPA 5JRGA 2Y2QA 3KWQC 3AZFB 3C1CC 4ZBJC 3AZMD 5AVBA 3V9RA 3AZEC 5CP6A 2FJ7A 3B6GA 3AYWD 1N1JB 3WTPB 3LZ0C 1P3BC 1T3UA 3AV2B 4NE5A 4Z66B 5AV5A 3UTBC 3B0CT 2Y2JA 5AV8A 4J8UA 5BS7C 3C1BB 3MGSB 4XUJD 1P34D 1P3KA 1P3GA 3MVDD 3UT9A 3AZMC 5AVCB 3B6FB 4UUZA 5B0ZA 4NFTA 4YM6D 5B31C 3O62A 3AYWC 5DNNA 3REIA 2F8NA 3AZLA 5B32B 5AV9B 5G49A 4H9PB 3TU4B 5BNVA 4DRAA 2G5IC 1KX5A 3AZJB 1BH8B 4WU9B 1H3OA 4X23B 3W99B 5B24D 3X1TD 5GT0D 2CV5C 1F66A 1R4VA 4XUJC 1P34C 3MVDC 4LD9B 1S32C 1U35B 2DQNC 3RELA 4YS3D 4KUDB 2BYMB 3AZHB 5GXQC 5AV6D 3KUYB 1JFIA 3LELC 3WTPD 2L5AA 3WAAA 2HUEC 3KXBD 4ZUXA 3AFAB 5AY8A 3AZNB 1M19A 4KGCA 5B31G 5B24C 3LZ1D 5B40D 3MGQA 3REJD 5GT0C 3REHC 3AV2D 3X1TC 4Z66D 1P3FA 5DNMB 3X1VB 3AZFC 1P3PD 4XZQB 4Z2MH 5CPJA 5B1LA 3UTAB 3B6FD 4ZBJB 2CWEA 3WTPC 3AZEB 4DQYB 5B32D 2XD5A 3AN2A 1P3GD 2Y2PA 4WU8B 3AV2C 3LZ0B 4Z66C 1ID3A 1M1AB 1P3BB 4WU9D 3MGRB 5B2JA 5B0YA 4CAYA 4J8XA 3AZIA 3C1BC 2AROB 1P3PC 4E44A 5F99A 3B6FC 1U35D 2YFWB 3W97B 1P3AD 4R8PB 3LJAD 3WKJD 3H0LC 5CPKB 3W98D 4WV4B 2BYKB 2JSSA 5B32C 5AV9C 3B0DB 5FUGA 3TU4C 3KUYD 3NQUB 3X1SB 1ZLAA 2PYOB 3WA9D 4WU9C 4G92B 4X23C 4KHAA 3AZND 3W99C 4CSRB 3AZGA 5CPID 5B31A 4LD9C 4WNNA 1U35C 1P3IB 4XUJB 3MVDB 4JJND 5B1MA 2YFVA 1WWIA 3IP4C 3UTAD 4DRBA 4YM6B 1KX4A 3W98C 2NZDD 3VH6T 3KUYC 3AV1D 2NQBA 4H9RA 3WA9C 5E5AA 3AFAC 3AZNC 1EQZD 1B67A 5CPIC 5B1LD 4J8VA 4J8WD 3X1UA 1S32A 5B32G 5DNMC 3MGRD 2Y2IA 3W96B 2AROD 1HQ3D 3REKB 3UTAC 1P3LA 5JA4B 2G5HC 5GXQA 5GSUA 3W97D 2ZY2A 3VH5T 4R8PD 3LELA 3R45B 5CPKD 4YS3B 3A6NA 1EQZC 5AV6B 3REHA 5BT1D 3MGPB 5JRGB 4WU8C 3X1SD 4J8WC 2PYOD 3KXBB 1M1AC 1KX3A 1TZYD 4QLCA 3REJB 5AVBB 5B40B 3LZ1B 3MGRC 3AZFA 3B0BA 5CP6B 2FJ7B 2AROC 3FDDA 3B6GB 3W97C 1P3ID 4R8PC 1P3PB 2HIOA 3H0RC 3AZGD 5CPKC 4H9NA 3B0DC 5AV8B 3X1SC 1P3MA 2PYOC 1P3GB 1P3KB 4G92C 3UT9B 5BNXB 5BO0B 3EPHA 4UUZB 5B0ZB 3MGSA 1M18D 4HGAC 3AZKD 1P3OD 5AVCA 2F8NB 3AZLB 3EG5B 3W96D 1P3IC 5BNVB 3MNNA 3REKD 4H9PA 4H9SC 3TU4A 4YM6C 1P3AB 3LJAB 3WKJB 4Z5TD 1AOID 5GT3A 3AZJA 3W98B 1BH8A 4X23A 3W99A 4H9QA 3MGPD 5JRGD 1M18C 3WA9B 3AZKC 4WJ3C 1P3OC 4LD9A 3RELB 2Y2KA 3B0CW 5CPIB 5AVBD 3W96C 5CP6D 2FJ7D 2XD1A 3B6GD 5B2IA 4KUDA 3REKC 2BYMA 2LY8A 3AZHA 3WAAB 5AY8B 4Z5TC 1AOIC 4JJNB 3MGQB 2NZDB 3AFAA 5AV5D 4YS3C 1P3FB 1KU5A 5AV6C 4UPKA 3AV1B 3MGPC 5JRGC 5AV8D 4J8UD 5B33A 2ZY3A 3KXBC 1EQZB 1P3KD 3X1VA 3UT9D 5B1LB 5AVBC 3LZ1C 3REJC 5B40C 5B0ZD 4XZQA 4J8WB 5CP6C 3O62D 2FJ7C 3B6GC 1PZRA 5DNND 3KWQA 3REID 2F8ND 3AZLD 3C1CA 1HQ3B 3EPKA 3AZEA 3KSYA 1KX5D 3LZ0A 5AV8C 3P5JB 5B0YB 4J8XB 4J8UC 1P3BA 1F66D 1P3GC 1P3KC 3UT9C 3UTBA 5B0ZC 5KDMB 3O62C 4E45A 1TZYB 3RELD 5BS7A 2YFWA 3AZLC 3A1KA 4HGAB 3AZMA 4EO5B 5FUGB 2BYKA 1ZLAB 3WAAD 3AYWA 1P3AC 1M19D 3NQUA 4ZUXD 3LJAC 5AY8D 3WKJC 4KGCD 3AZGB 3MGQD 1BH9B 1TAFB 1P3FD 4CSRA 4H9OA 4WNNB 3RELC 5CPJD 2CV5A 2Y2LA 4XUJA 1P34A 1KX4B 3MVDA 1M18B 3AZKB 1P3OB 1F1EA 3WAAC 2JE5A 3AN2D 5AY8C 4KGCC 4JJNC 3MGQC 4J8VB 2NZDC 1ID3D 3KFUG 2F8NG 1P3FC 4Z5TB 3KWQD 1AOIB 2UWXA 3AV1C 5B2JD 5B0YD 4J8XD 3AZID 3NQJB 5B24A 3X1TA 2ZM5A 5GT0A 5F99D 5B1LC 1P3LB 5GSUB 2Y2OA 4NE6A 3V9RB 3A6NB 3AN2C 3AL0C 3R45A 4G91B 1HQ3C 2IO5C 1ZLAD 2RVQD 5AV6A 1Z2CB 1KX3B 1N1JA 3VH6W 4QLCB 3WTPA 5B2JC 1WWSA 5B0YC 3KXBA 4J8XC 3AZIC 5AV5B 1B6WA 3AV2A 3REJA 3LZ1A 5B40A 5F99C 5BT1C 3H0MC 5B31D 4Z66A 4J8UB 5C3IB 2HIOB 1TZYC 5B1MD 3C1BA 1P3PA 4H9NB 1KX4D 3O62B 4EO5C 5DNNB 3B6FA 3REIB 2NQBD 1ZLAC 2RVQC 1P3MB
chains in the Genus database with same CATH topology
5G49B 5E5AD 3AZGC 3VH5W 5B32A 5AV9A 2W8SA 4J8VD 2CV5D 1KX5B 5BNXA 5BO0A 1H3OB 2J8PA 3X1UD 1S32D 4WU9A 1F66B 5B1MC 3MNNB 1P3LD 5GXQD 1KX4C 5GSUD 2DF4C 3LELD 2F8NK 5GT3B 1U35A 2NQBC 1P3AA 4AWLB 3LJAA 3WKJA 3A6ND 4H9QB 1BFMA 2ZY5A 5E5AC 3W98A 3REHD 1JFIB 4J8VC 3KUYA 1M19B 4ZUXB 4KGCB 3X1UC 1KX3D 4QLCD 4WZSB 3WA9A 2F2AC 3AZFD 3AZNA 1A7WA 5CPIA 5B2IB 1P3LC 2Y2MA 2BG1A 5GSUC 5DNMA 3VH6A 2RIQA 2HIOD 4Z2MG 5CPJB 1Q9CA 3A6NC 4JJNA 3WTPE 3A1IA 2NZDA 4G91C 3UTAA 2Y2GA 5B33B 1P3MD 3AN2B 3AV1A 1KX3C 2Y2NA 4QLCC 2IO5B 3C1BD 3MGSD 2Y2HA 1ID3B 1EQZA 5AV5C 4WU8A 5AVCD 3KWQB 5B2JB 4J8WA 4CAYB 5C3IC 3AZIB 3C1CB 1M1AA 3MGRA 2HIOC 3VH5A 5F99B 5AV9D 3MNND 2AROA 3TU4D 1HQ3A 5DNNC 5GT3D 3REIC 3W97A 3AZJD 4R8PA 4X23D 1P3MC 3W99D 5CPKA 3UTBB 3MGSC 1KX5C 3F6TA 5AVCC 4KHAB 3X1SA 4LD9D 5KDMA 2PYOA 1TZYA 3AZMB 1F66C 5B2ID 5B31B 3MNNC 4KUDD 3AYWB 3AZHD 5GT3C 5B1MB 2FFFB 2JCHA 3EPJA 2YFVB 3AZJC 4AWLC 3AFAD 1P3IA 3EPLA 1BH9A 4H9OB 1TAFA 4H9SA 4YM6A 2NQBB 1W2EA 5B33D 4H9RB 5CHLB 1M19C 5E5AB 5DNMD 2ZY4A 4ZUXC 4NE3A 3X1VD 2CV5B 1P34B 4XZQD 3X1UB 5B2IC 1S32B 1M18A 4KUDC 3AZKA 2VQRA 3AZHC 1P3OA 3C1CD 3W96A 3AZED 5CPJC 4M6BA 1ULYA 5GXQB 4WU8D 3LELB 3REKA 3LZ0D 5JA4A 2F8NH 2HUEB 1M1AD 5B33C 1HTAA 1P3BD 4Z5TA 1AOIA 5B24B 3X1TB 5GT0B 3X1VC 3REHB 4YS3A 3NQJA 3UTBD 4XZQC 1ID3C 3MGPA 5JRGA 2Y2QA 3KWQC 3AZFB 3C1CC 4ZBJC 3AZMD 5AVBA 3V9RA 3AZEC 5CP6A 2FJ7A 3B6GA 3AYWD 1N1JB 3WTPB 3LZ0C 1P3BC 1T3UA 3AV2B 4NE5A 4Z66B 5AV5A 3UTBC 3B0CT 2Y2JA 5AV8A 4J8UA 5BS7C 3C1BB 3MGSB 4XUJD 1P34D 1P3KA 1P3GA 3MVDD 3UT9A 3AZMC 5AVCB 3B6FB 4UUZA 5B0ZA 4NFTA 4YM6D 5B31C 3O62A 3AYWC 5DNNA 3REIA 2F8NA 3AZLA 5B32B 5AV9B 5G49A 4H9PB 3TU4B 5BNVA 4DRAA 2G5IC 1KX5A 3AZJB 1BH8B 4WU9B 1H3OA 4X23B 3W99B 5B24D 3X1TD 5GT0D 2CV5C 1F66A 1R4VA 4XUJC 1P34C 3MVDC 4LD9B 1S32C 1U35B 2DQNC 3RELA 4YS3D 4KUDB 2BYMB 3AZHB 5GXQC 5AV6D 3KUYB 1JFIA 3LELC 3WTPD 2L5AA 3WAAA 2HUEC 3KXBD 4ZUXA 3AFAB 5AY8A 3AZNB 1M19A 4KGCA 5B31G 5B24C 3LZ1D 5B40D 3MGQA 3REJD 5GT0C 3REHC 3AV2D 3X1TC 4Z66D 1P3FA 5DNMB 3X1VB 3AZFC 1P3PD 4XZQB 4Z2MH 5CPJA 5B1LA 3UTAB 3B6FD 4ZBJB 2CWEA 3WTPC 3AZEB 4DQYB 5B32D 2XD5A 3AN2A 1P3GD 2Y2PA 4WU8B 3AV2C 3LZ0B 4Z66C 1ID3A 1M1AB 1P3BB 4WU9D 3MGRB 5B2JA 5B0YA 4CAYA 4J8XA 3AZIA 3C1BC 2AROB 1P3PC 4E44A 5F99A 3B6FC 1U35D 2YFWB 3W97B 1P3AD 4R8PB 3LJAD 3WKJD 3H0LC 5CPKB 3W98D 4WV4B 2BYKB 2JSSA 5B32C 5AV9C 3B0DB 5FUGA 3TU4C 3KUYD 3NQUB 3X1SB 1ZLAA 2PYOB 3WA9D 4WU9C 4G92B 4X23C 4KHAA 3AZND 3W99C 4CSRB 3AZGA 5CPID 5B31A 4LD9C 4WNNA 1U35C 1P3IB 4XUJB 3MVDB 4JJND 5B1MA 2YFVA 1WWIA 3IP4C 3UTAD 4DRBA 4YM6B 1KX4A 3W98C 2NZDD 3VH6T 3KUYC 3AV1D 2NQBA 4H9RA 3WA9C 5E5AA 3AFAC 3AZNC 1EQZD 1B67A 5CPIC 5B1LD 4J8VA 4J8WD 3X1UA 1S32A 5B32G 5DNMC 3MGRD 2Y2IA 3W96B 2AROD 1HQ3D 3REKB 3UTAC 1P3LA 5JA4B 2G5HC 5GXQA 5GSUA 3W97D 2ZY2A 3VH5T 4R8PD 3LELA 3R45B 5CPKD 4YS3B 3A6NA 1EQZC 5AV6B 3REHA 5BT1D 3MGPB 5JRGB 4WU8C 3X1SD 4J8WC 2PYOD 3KXBB 1M1AC 1KX3A 1TZYD 4QLCA 3REJB 5AVBB 5B40B 3LZ1B 3MGRC 3AZFA 3B0BA 5CP6B 2FJ7B 2AROC 3FDDA 3B6GB 3W97C 1P3ID 4R8PC 1P3PB 2HIOA 3H0RC 3AZGD 5CPKC 4H9NA 3B0DC 5AV8B 3X1SC 1P3MA 2PYOC 1P3GB 1P3KB 4G92C 3UT9B 5BNXB 5BO0B 3EPHA 4UUZB 5B0ZB 3MGSA 1M18D 4HGAC 3AZKD 1P3OD 5AVCA 2F8NB 3AZLB 3EG5B 3W96D 1P3IC 5BNVB 3MNNA 3REKD 4H9PA 4H9SC 3TU4A 4YM6C 1P3AB 3LJAB 3WKJB 4Z5TD 1AOID 5GT3A 3AZJA 3W98B 1BH8A 4X23A 3W99A 4H9QA 3MGPD 5JRGD 1M18C 3WA9B 3AZKC 4WJ3C 1P3OC 4LD9A 3RELB 2Y2KA 3B0CW 5CPIB 5AVBD 3W96C 5CP6D 2FJ7D 2XD1A 3B6GD 5B2IA 4KUDA 3REKC 2BYMA 2LY8A 3AZHA 3WAAB 5AY8B 4Z5TC 1AOIC 4JJNB 3MGQB 2NZDB 3AFAA 5AV5D 4YS3C 1P3FB 1KU5A 5AV6C 4UPKA 3AV1B 3MGPC 5JRGC 5AV8D 4J8UD 5B33A 2ZY3A 3KXBC 1EQZB 1P3KD 3X1VA 3UT9D 5B1LB 5AVBC 3LZ1C 3REJC 5B40C 5B0ZD 4XZQA 4J8WB 5CP6C 3O62D 2FJ7C 3B6GC 1PZRA 5DNND 3KWQA 3REID 2F8ND 3AZLD 3C1CA 1HQ3B 3EPKA 3AZEA 3KSYA 1KX5D 3LZ0A 5AV8C 3P5JB 5B0YB 4J8XB 4J8UC 1P3BA 1F66D 1P3GC 1P3KC 3UT9C 3UTBA 5B0ZC 5KDMB 3O62C 4E45A 1TZYB 3RELD 5BS7A 2YFWA 3AZLC 3A1KA 4HGAB 3AZMA 4EO5B 5FUGB 2BYKA 1ZLAB 3WAAD 3AYWA 1P3AC 1M19D 3NQUA 4ZUXD 3LJAC 5AY8D 3WKJC 4KGCD 3AZGB 3MGQD 1BH9B 1TAFB 1P3FD 4CSRA 4H9OA 4WNNB 3RELC 5CPJD 2CV5A 2Y2LA 4XUJA 1P34A 1KX4B 3MVDA 1M18B 3AZKB 1P3OB 1F1EA 3WAAC 2JE5A 3AN2D 5AY8C 4KGCC 4JJNC 3MGQC 4J8VB 2NZDC 1ID3D 3KFUG 2F8NG 1P3FC 4Z5TB 3KWQD 1AOIB 2UWXA 3AV1C 5B2JD 5B0YD 4J8XD 3AZID 3NQJB 5B24A 3X1TA 2ZM5A 5GT0A 5F99D 5B1LC 1P3LB 5GSUB 2Y2OA 4NE6A 3V9RB 3A6NB 3AN2C 3AL0C 3R45A 4G91B 1HQ3C 2IO5C 1ZLAD 2RVQD 5AV6A 1Z2CB 1KX3B 1N1JA 3VH6W 4QLCB 3WTPA 5B2JC 1WWSA 5B0YC 3KXBA 4J8XC 3AZIC 5AV5B 1B6WA 3AV2A 3REJA 3LZ1A 5B40A 5F99C 5BT1C 3H0MC 5B31D 4Z66A 4J8UB 5C3IB 2HIOB 1TZYC 5B1MD 3C1BA 1P3PA 4H9NB 1KX4D 3O62B 4EO5C 5DNNB 3B6FA 3REIB 2NQBD 1ZLAC 2RVQC 1P3MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G49 B;  5E5A D;  3AZG C;  3VH5 W;  5B32 A;  5AV9 A;  2CV5 D;  4J8V D;  1KX5 B;  5BNX A;  5BO0 A;  1H3O B;  3X1U D;  1S32 D;  4WU9 A;  1F66 B;  5B1M C;  3MNN B;  1P3L D;  5GXQ D;  1KX4 C;  5GSU D;  3LEL D;  2F8N K;  5GT3 B;  1U35 A;  2NQB C;  1P3A A;  4AWL B;  3LJA A;  3WKJ A;  3A6N D;  4H9Q B;  1BFM A;  5E5A C;  3W98 A;  3REH D;  1JFI B;  4J8V C;  3KUY A;  1M19 B;  4ZUX B;  4KGC B;  3X1U C;  1KX3 D;  4QLC D;  4WZS B;  3WA9 A;  3AZF D;  3AZN A;  1A7W A;  5CPI A;  5B2I B;  1P3L C;  5GSU C;  5DNM A;  3VH6 A;  2HIO D;  4Z2M G;  5CPJ B;  1Q9C A;  3A6N C;  4JJN A;  3WTP E;  2NZD A;  4G91 C;  3UTA A;  5B33 B;  1P3M D;  3AN2 B;  3AV1 A;  1KX3 C;  4QLC C;  2IO5 B;  3C1B D;  3MGS D;  1EQZ A;  1ID3 B;  5AV5 C;  4WU8 A;  5AVC D;  3KWQ B;  5B2J B;  4J8W A;  4CAY B;  5C3I C;  3AZI B;  3C1C B;  1M1A A;  3MGR A;  2HIO C;  3VH5 A;  5F99 B;  5AV9 D;  3MNN D;  2ARO A;  3TU4 D;  1HQ3 A;  5DNN C;  5GT3 D;  3REI C;  3W97 A;  3AZJ D;  4R8P A;  4X23 D;  1P3M C;  3W99 D;  5CPK A;  3UTB B;  3MGS C;  1KX5 C;  5AVC C;  4KHA B;  3X1S A;  4LD9 D;  5KDM A;  2PYO A;  1TZY A;  3AZM B;  1F66 C;  5B2I D;  5B31 B;  3MNN C;  4KUD D;  3AYW B;  3AZH D;  5GT3 C;  5B1M B;  3AZJ C;  2YFV B;  1P3I A;  4AWL C;  3AFA D;  1BH9 A;  4H9O B;  1TAF A;  4H9S A;  4YM6 A;  2NQB B;  5B33 D;  4H9R B;  5CHL B;  1M19 C;  5E5A B;  5DNM D;  4ZUX C;  4NE3 A;  3X1V D;  2CV5 B;  1P34 B;  4XZQ D;  3X1U B;  5B2I C;  1S32 B;  1M18 A;  4KUD C;  3AZK A;  3AZH C;  1P3O A;  3C1C D;  3W96 A;  3AZE D;  5CPJ C;  4M6B A;  1ULY A;  5GXQ B;  4WU8 D;  3LEL B;  3REK A;  3LZ0 D;  5JA4 A;  2F8N H;  2HUE B;  1M1A D;  5B33 C;  1HTA A;  1P3B D;  4Z5T A;  1AOI A;  5B24 B;  3X1T B;  5GT0 B;  3X1V C;  3REH B;  4YS3 A;  3NQJ A;  3UTB D;  4XZQ C;  1ID3 C;  3MGP A;  5JRG A;  3KWQ C;  3AZF B;  3C1C C;  4ZBJ C;  3AZM D;  5AVB A;  3V9R A;  3AZE C;  5CP6 A;  2FJ7 A;  3B6G A;  3AYW D;  1N1J B;  3WTP B;  3LZ0 C;  1P3B C;  3AV2 B;  4NE5 A;  4Z66 B;  5AV5 A;  3UTB C;  3B0C T;  5AV8 A;  4J8U A;  5BS7 C;  3C1B B;  3MGS B;  4XUJ D;  1P34 D;  1P3K A;  1P3G A;  3MVD D;  3UT9 A;  3AZM C;  5AVC B;  3B6F B;  4UUZ A;  5B0Z A;  4NFT A;  4YM6 D;  5B31 C;  3O62 A;  3AYW C;  5DNN A;  3REI A;  2F8N A;  3AZL A;  5B32 B;  5AV9 B;  5G49 A;  4H9P B;  3TU4 B;  5BNV A;  4DRA A;  1KX5 A;  3AZJ B;  1BH8 B;  4WU9 B;  1H3O A;  4X23 B;  3W99 B;  5B24 D;  3X1T D;  5GT0 D;  2CV5 C;  1F66 A;  1R4V A;  4XUJ C;  1P34 C;  3MVD C;  4LD9 B;  1S32 C;  1U35 B;  3REL A;  4YS3 D;  4KUD B;  2BYM B;  3AZH B;  5GXQ C;  5AV6 D;  3KUY B;  1JFI A;  3LEL C;  3WTP D;  2L5A A;  3WAA A;  2HUE C;  3KXB D;  4ZUX A;  3AFA B;  5AY8 A;  3AZN B;  1M19 A;  4KGC A;  5B31 G;  5B24 C;  3LZ1 D;  5B40 D;  3MGQ A;  3REJ D;  5GT0 C;  3REH C;  3AV2 D;  3X1T C;  4Z66 D;  1P3F A;  5DNM B;  3X1V B;  3AZF C;  1P3P D;  4XZQ B;  4Z2M H;  5CPJ A;  5B1L A;  3UTA B;  3B6F D;  4ZBJ B;  2CWE A;  3WTP C;  3AZE B;  5B32 D;  3AN2 A;  1P3G D;  4WU8 B;  3AV2 C;  3LZ0 B;  4Z66 C;  1ID3 A;  1M1A B;  1P3B B;  4WU9 D;  3MGR B;  5B2J A;  5B0Y A;  4CAY A;  4J8X A;  3AZI A;  3C1B C;  2ARO B;  1P3P C;  4E44 A;  5F99 A;  3B6F C;  1U35 D;  2YFW B;  3W97 B;  1P3A D;  4R8P B;  3LJA D;  3WKJ D;  5CPK B;  3W98 D;  4WV4 B;  2BYK B;  2JSS A;  5B32 C;  5AV9 C;  3B0D B;  5FUG A;  3TU4 C;  3KUY D;  3NQU B;  3X1S B;  1ZLA A;  2PYO B;  3WA9 D;  4WU9 C;  4G92 B;  4X23 C;  4KHA A;  3AZN D;  3W99 C;  4CSR B;  3AZG A;  5CPI D;  5B31 A;  4LD9 C;  4WNN A;  1U35 C;  1P3I B;  4XUJ B;  3MVD B;  4JJN D;  5B1M A;  2YFV A;  1WWI A;  3UTA D;  3W98 C;  4DRB A;  4YM6 B;  1KX4 A;  2NZD D;  3VH6 T;  3KUY C;  3AV1 D;  2NQB A;  4H9R A;  3WA9 C;  5E5A A;  3AFA C;  3AZN C;  1EQZ D;  1B67 A;  5CPI C;  5B1L D;  4J8V A;  4J8W D;  3X1U A;  1S32 A;  5B32 G;  5DNM C;  3MGR D;  3W96 B;  2ARO D;  1HQ3 D;  3REK B;  3UTA C;  1P3L A;  5JA4 B;  5GXQ A;  3W97 D;  5GSU A;  3VH5 T;  4R8P D;  3LEL A;  3R45 B;  5CPK D;  4YS3 B;  3A6N A;  1EQZ C;  5AV6 B;  3REH A;  5BT1 D;  3MGP B;  5JRG B;  4WU8 C;  3X1S D;  4J8W C;  2PYO D;  3KXB B;  1M1A C;  1KX3 A;  1TZY D;  4QLC A;  3REJ B;  5AVB B;  5B40 B;  3LZ1 B;  3MGR C;  3AZF A;  3B0B A;  5CP6 B;  2FJ7 B;  2ARO C;  3B6G B;  3W97 C;  1P3I D;  4R8P C;  1P3P B;  2HIO A;  3AZG D;  5CPK C;  4H9N A;  3B0D C;  5AV8 B;  3X1S C;  1P3M A;  2PYO C;  1P3G B;  1P3K B;  4G92 C;  3UT9 B;  5BNX B;  5BO0 B;  4UUZ B;  5B0Z B;  3MGS A;  1M18 D;  4HGA C;  3AZK D;  1P3O D;  5AVC A;  2F8N B;  3AZL B;  3W96 D;  1P3I C;  5BNV B;  3MNN A;  3REK D;  4H9P A;  4H9S C;  3TU4 A;  4YM6 C;  1P3A B;  3LJA B;  3WKJ B;  4Z5T D;  1AOI D;  5GT3 A;  3AZJ A;  3W98 B;  1BH8 A;  4X23 A;  3W99 A;  4H9Q A;  3MGP D;  5JRG D;  1M18 C;  3WA9 B;  3AZK C;  1P3O C;  4LD9 A;  3REL B;  3B0C W;  5CPI B;  5AVB D;  3W96 C;  5CP6 D;  2FJ7 D;  3B6G D;  5B2I A;  4KUD A;  3REK C;  2BYM A;  2LY8 A;  3AZH A;  3WAA B;  5AY8 B;  4Z5T C;  1AOI C;  4JJN B;  3MGQ B;  2NZD B;  3AFA A;  5AV5 D;  4YS3 C;  1P3F B;  1KU5 A;  5AV6 C;  3AV1 B;  3MGP C;  5JRG C;  5AV8 D;  4J8U D;  5B33 A;  3KXB C;  1EQZ B;  1P3K D;  3X1V A;  3UT9 D;  5B1L B;  5AVB C;  3LZ1 C;  3REJ C;  5B40 C;  5B0Z D;  4XZQ A;  4J8W B;  5CP6 C;  3O62 D;  2FJ7 C;  3B6G C;  5DNN D;  3KWQ A;  3REI D;  2F8N D;  3AZL D;  3C1C A;  1HQ3 B;  3AZE A;  3KSY A;  1KX5 D;  3LZ0 A;  5AV8 C;  5B0Y B;  4J8X B;  4J8U C;  1P3B A;  1F66 D;  1P3G C;  1P3K C;  3UT9 C;  3UTB A;  5B0Z C;  5KDM B;  3O62 C;  4E45 A;  1TZY B;  3REL D;  5BS7 A;  2YFW A;  3AZL C;  4HGA B;  3AZM A;  4EO5 B;  5FUG B;  2BYK A;  1ZLA B;  3WAA D;  3AYW A;  1P3A C;  1M19 D;  3NQU A;  4ZUX D;  3LJA C;  5AY8 D;  3WKJ C;  4KGC D;  3AZG B;  3MGQ D;  1BH9 B;  1TAF B;  1P3F D;  4CSR A;  4H9O A;  4WNN B;  3REL C;  5CPJ D;  2CV5 A;  4XUJ A;  1P34 A;  1KX4 B;  3MVD A;  1M18 B;  3AZK B;  1P3O B;  1F1E A;  3WAA C;  3AN2 D;  5AY8 C;  4KGC C;  4JJN C;  3MGQ C;  4J8V B;  2NZD C;  1ID3 D;  2F8N G;  1P3F C;  4Z5T B;  3KWQ D;  1AOI B;  3AV1 C;  5B2J D;  5B0Y D;  4J8X D;  3AZI D;  3NQJ B;  5B24 A;  3X1T A;  5GT0 A;  5F99 D;  5B1L C;  1P3L B;  5GSU B;  4NE6 A;  3V9R B;  3A6N B;  3AN2 C;  3R45 A;  4G91 B;  1HQ3 C;  2IO5 C;  1ZLA D;  2RVQ D;  5AV6 A;  1KX3 B;  4QLC B;  1N1J A;  3VH6 W;  3WTP A;  5B2J C;  1WWS A;  5B0Y C;  3KXB A;  4J8X C;  3AZI C;  5AV5 B;  1B6W A;  3AV2 A;  3REJ A;  3LZ1 A;  5B40 A;  5F99 C;  5BT1 C;  5B31 D;  4Z66 A;  4J8U B;  5C3I B;  2HIO B;  1TZY C;  5B1M D;  3C1B A;  1P3P A;  4H9N B;  1KX4 D;  3O62 B;  4EO5 C;  5DNN B;  3B6F A;  3REI B;  2NQB D;  1ZLA C;  2RVQ C;  1P3M B; 
#chains in the Genus database with same CATH topology
 5G49 B;  5E5A D;  3AZG C;  3VH5 W;  5B32 A;  5AV9 A;  2W8S A;  4J8V D;  2CV5 D;  1KX5 B;  5BNX A;  5BO0 A;  1H3O B;  2J8P A;  3X1U D;  1S32 D;  4WU9 A;  1F66 B;  5B1M C;  3MNN B;  1P3L D;  5GXQ D;  1KX4 C;  5GSU D;  2DF4 C;  3LEL D;  2F8N K;  5GT3 B;  1U35 A;  2NQB C;  1P3A A;  4AWL B;  3LJA A;  3WKJ A;  3A6N D;  4H9Q B;  1BFM A;  2ZY5 A;  5E5A C;  3W98 A;  3REH D;  1JFI B;  4J8V C;  3KUY A;  1M19 B;  4ZUX B;  4KGC B;  3X1U C;  1KX3 D;  4QLC D;  4WZS B;  3WA9 A;  2F2A C;  3AZF D;  3AZN A;  1A7W A;  5CPI A;  5B2I B;  1P3L C;  2Y2M A;  2BG1 A;  5GSU C;  5DNM A;  3VH6 A;  2RIQ A;  2HIO D;  4Z2M G;  5CPJ B;  1Q9C A;  3A6N C;  4JJN A;  3WTP E;  3A1I A;  2NZD A;  4G91 C;  3UTA A;  2Y2G A;  5B33 B;  1P3M D;  3AN2 B;  3AV1 A;  1KX3 C;  2Y2N A;  4QLC C;  2IO5 B;  3C1B D;  3MGS D;  2Y2H A;  1ID3 B;  1EQZ A;  5AV5 C;  4WU8 A;  5AVC D;  3KWQ B;  5B2J B;  4J8W A;  4CAY B;  5C3I C;  3AZI B;  3C1C B;  1M1A A;  3MGR A;  2HIO C;  3VH5 A;  5F99 B;  5AV9 D;  3MNN D;  2ARO A;  3TU4 D;  1HQ3 A;  5DNN C;  5GT3 D;  3REI C;  3W97 A;  3AZJ D;  4R8P A;  4X23 D;  1P3M C;  3W99 D;  5CPK A;  3UTB B;  3MGS C;  1KX5 C;  3F6T A;  5AVC C;  4KHA B;  3X1S A;  4LD9 D;  5KDM A;  2PYO A;  1TZY A;  3AZM B;  1F66 C;  5B2I D;  5B31 B;  3MNN C;  4KUD D;  3AYW B;  3AZH D;  5GT3 C;  5B1M B;  2FFF B;  2JCH A;  3EPJ A;  2YFV B;  3AZJ C;  4AWL C;  3AFA D;  1P3I A;  3EPL A;  1BH9 A;  4H9O B;  1TAF A;  4H9S A;  4YM6 A;  2NQB B;  1W2E A;  5B33 D;  4H9R B;  5CHL B;  1M19 C;  5E5A B;  5DNM D;  2ZY4 A;  4ZUX C;  4NE3 A;  3X1V D;  2CV5 B;  1P34 B;  4XZQ D;  3X1U B;  5B2I C;  1S32 B;  1M18 A;  4KUD C;  3AZK A;  2VQR A;  3AZH C;  1P3O A;  3C1C D;  3W96 A;  3AZE D;  5CPJ C;  4M6B A;  1ULY A;  5GXQ B;  4WU8 D;  3LEL B;  3REK A;  3LZ0 D;  5JA4 A;  2F8N H;  2HUE B;  1M1A D;  5B33 C;  1HTA A;  1P3B D;  4Z5T A;  1AOI A;  5B24 B;  3X1T B;  5GT0 B;  3X1V C;  3REH B;  4YS3 A;  3NQJ A;  3UTB D;  4XZQ C;  1ID3 C;  3MGP A;  5JRG A;  2Y2Q A;  3KWQ C;  3AZF B;  3C1C C;  4ZBJ C;  3AZM D;  5AVB A;  3V9R A;  3AZE C;  5CP6 A;  2FJ7 A;  3B6G A;  3AYW D;  1N1J B;  3WTP B;  3LZ0 C;  1P3B C;  1T3U A;  3AV2 B;  4NE5 A;  4Z66 B;  5AV5 A;  3UTB C;  3B0C T;  2Y2J A;  5AV8 A;  4J8U A;  5BS7 C;  3C1B B;  3MGS B;  4XUJ D;  1P34 D;  1P3K A;  1P3G A;  3MVD D;  3UT9 A;  3AZM C;  5AVC B;  3B6F B;  4UUZ A;  5B0Z A;  4NFT A;  4YM6 D;  5B31 C;  3O62 A;  3AYW C;  5DNN A;  3REI A;  2F8N A;  3AZL A;  5B32 B;  5AV9 B;  5G49 A;  4H9P B;  3TU4 B;  5BNV A;  4DRA A;  2G5I C;  1KX5 A;  3AZJ B;  1BH8 B;  4WU9 B;  1H3O A;  4X23 B;  3W99 B;  5B24 D;  3X1T D;  5GT0 D;  2CV5 C;  1F66 A;  1R4V A;  4XUJ C;  1P34 C;  3MVD C;  4LD9 B;  1S32 C;  1U35 B;  2DQN C;  3REL A;  4YS3 D;  4KUD B;  2BYM B;  3AZH B;  5GXQ C;  5AV6 D;  3KUY B;  1JFI A;  3LEL C;  3WTP D;  2L5A A;  3WAA A;  2HUE C;  3KXB D;  4ZUX A;  3AFA B;  5AY8 A;  3AZN B;  1M19 A;  4KGC A;  5B31 G;  5B24 C;  3LZ1 D;  5B40 D;  3MGQ A;  3REJ D;  5GT0 C;  3REH C;  3AV2 D;  3X1T C;  4Z66 D;  1P3F A;  5DNM B;  3X1V B;  3AZF C;  1P3P D;  4XZQ B;  4Z2M H;  5CPJ A;  5B1L A;  3UTA B;  3B6F D;  4ZBJ B;  2CWE A;  3WTP C;  3AZE B;  4DQY B;  5B32 D;  2XD5 A;  3AN2 A;  1P3G D;  2Y2P A;  4WU8 B;  3AV2 C;  3LZ0 B;  4Z66 C;  1ID3 A;  1M1A B;  1P3B B;  4WU9 D;  3MGR B;  5B2J A;  5B0Y A;  4CAY A;  4J8X A;  3AZI A;  3C1B C;  2ARO B;  1P3P C;  4E44 A;  5F99 A;  3B6F C;  1U35 D;  2YFW B;  3W97 B;  1P3A D;  4R8P B;  3LJA D;  3WKJ D;  3H0L C;  5CPK B;  3W98 D;  4WV4 B;  2BYK B;  2JSS A;  5B32 C;  5AV9 C;  3B0D B;  5FUG A;  3TU4 C;  3KUY D;  3NQU B;  3X1S B;  1ZLA A;  2PYO B;  3WA9 D;  4WU9 C;  4G92 B;  4X23 C;  4KHA A;  3AZN D;  3W99 C;  4CSR B;  3AZG A;  5CPI D;  5B31 A;  4LD9 C;  4WNN A;  1U35 C;  1P3I B;  4XUJ B;  3MVD B;  4JJN D;  5B1M A;  2YFV A;  1WWI A;  3IP4 C;  3UTA D;  4DRB A;  4YM6 B;  1KX4 A;  3W98 C;  2NZD D;  3VH6 T;  3KUY C;  3AV1 D;  2NQB A;  4H9R A;  3WA9 C;  5E5A A;  3AFA C;  3AZN C;  1EQZ D;  1B67 A;  5CPI C;  5B1L D;  4J8V A;  4J8W D;  3X1U A;  1S32 A;  5B32 G;  5DNM C;  3MGR D;  2Y2I A;  3W96 B;  2ARO D;  1HQ3 D;  3REK B;  3UTA C;  1P3L A;  5JA4 B;  2G5H C;  5GXQ A;  5GSU A;  3W97 D;  2ZY2 A;  3VH5 T;  4R8P D;  3LEL A;  3R45 B;  5CPK D;  4YS3 B;  3A6N A;  1EQZ C;  5AV6 B;  3REH A;  5BT1 D;  3MGP B;  5JRG B;  4WU8 C;  3X1S D;  4J8W C;  2PYO D;  3KXB B;  1M1A C;  1KX3 A;  1TZY D;  4QLC A;  3REJ B;  5AVB B;  5B40 B;  3LZ1 B;  3MGR C;  3AZF A;  3B0B A;  5CP6 B;  2FJ7 B;  2ARO C;  3FDD A;  3B6G B;  3W97 C;  1P3I D;  4R8P C;  1P3P B;  2HIO A;  3H0R C;  3AZG D;  5CPK C;  4H9N A;  3B0D C;  5AV8 B;  3X1S C;  1P3M A;  2PYO C;  1P3G B;  1P3K B;  4G92 C;  3UT9 B;  5BNX B;  5BO0 B;  3EPH A;  4UUZ B;  5B0Z B;  3MGS A;  1M18 D;  4HGA C;  3AZK D;  1P3O D;  5AVC A;  2F8N B;  3AZL B;  3EG5 B;  3W96 D;  1P3I C;  5BNV B;  3MNN A;  3REK D;  4H9P A;  4H9S C;  3TU4 A;  4YM6 C;  1P3A B;  3LJA B;  3WKJ B;  4Z5T D;  1AOI D;  5GT3 A;  3AZJ A;  3W98 B;  1BH8 A;  4X23 A;  3W99 A;  4H9Q A;  3MGP D;  5JRG D;  1M18 C;  3WA9 B;  3AZK C;  4WJ3 C;  1P3O C;  4LD9 A;  3REL B;  2Y2K A;  3B0C W;  5CPI B;  5AVB D;  3W96 C;  5CP6 D;  2FJ7 D;  2XD1 A;  3B6G D;  5B2I A;  4KUD A;  3REK C;  2BYM A;  2LY8 A;  3AZH A;  3WAA B;  5AY8 B;  4Z5T C;  1AOI C;  4JJN B;  3MGQ B;  2NZD B;  3AFA A;  5AV5 D;  4YS3 C;  1P3F B;  1KU5 A;  5AV6 C;  4UPK A;  3AV1 B;  3MGP C;  5JRG C;  5AV8 D;  4J8U D;  5B33 A;  2ZY3 A;  3KXB C;  1EQZ B;  1P3K D;  3X1V A;  3UT9 D;  5B1L B;  5AVB C;  3LZ1 C;  3REJ C;  5B40 C;  5B0Z D;  4XZQ A;  4J8W B;  5CP6 C;  3O62 D;  2FJ7 C;  3B6G C;  1PZR A;  5DNN D;  3KWQ A;  3REI D;  2F8N D;  3AZL D;  3C1C A;  1HQ3 B;  3EPK A;  3AZE A;  3KSY A;  1KX5 D;  3LZ0 A;  5AV8 C;  3P5J B;  5B0Y B;  4J8X B;  4J8U C;  1P3B A;  1F66 D;  1P3G C;  1P3K C;  3UT9 C;  3UTB A;  5B0Z C;  5KDM B;  3O62 C;  4E45 A;  1TZY B;  3REL D;  5BS7 A;  2YFW A;  3AZL C;  3A1K A;  4HGA B;  3AZM A;  4EO5 B;  5FUG B;  2BYK A;  1ZLA B;  3WAA D;  3AYW A;  1P3A C;  1M19 D;  3NQU A;  4ZUX D;  3LJA C;  5AY8 D;  3WKJ C;  4KGC D;  3AZG B;  3MGQ D;  1BH9 B;  1TAF B;  1P3F D;  4CSR A;  4H9O A;  4WNN B;  3REL C;  5CPJ D;  2CV5 A;  2Y2L A;  4XUJ A;  1P34 A;  1KX4 B;  3MVD A;  1M18 B;  3AZK B;  1P3O B;  1F1E A;  3WAA C;  2JE5 A;  3AN2 D;  5AY8 C;  4KGC C;  4JJN C;  3MGQ C;  4J8V B;  2NZD C;  1ID3 D;  3KFU G;  2F8N G;  1P3F C;  4Z5T B;  3KWQ D;  1AOI B;  2UWX A;  3AV1 C;  5B2J D;  5B0Y D;  4J8X D;  3AZI D;  3NQJ B;  5B24 A;  3X1T A;  2ZM5 A;  5GT0 A;  5F99 D;  5B1L C;  1P3L B;  5GSU B;  2Y2O A;  4NE6 A;  3V9R B;  3A6N B;  3AN2 C;  3AL0 C;  3R45 A;  4G91 B;  1HQ3 C;  2IO5 C;  1ZLA D;  2RVQ D;  5AV6 A;  1Z2C B;  1KX3 B;  1N1J A;  3VH6 W;  4QLC B;  3WTP A;  5B2J C;  1WWS A;  5B0Y C;  3KXB A;  4J8X C;  3AZI C;  5AV5 B;  1B6W A;  3AV2 A;  3REJ A;  3LZ1 A;  5B40 A;  5F99 C;  5BT1 C;  3H0M C;  5B31 D;  4Z66 A;  4J8U B;  5C3I B;  2HIO B;  1TZY C;  5B1M D;  3C1B A;  1P3P A;  4H9N B;  1KX4 D;  3O62 B;  4EO5 C;  5DNN B;  3B6F A;  3REI B;  2NQB D;  1ZLA C;  2RVQ C;  1P3M B; 
#chains in the Genus database with same CATH homology
 5G49 B;  5E5A D;  3AZG C;  3VH5 W;  5B32 A;  5AV9 A;  2W8S A;  4J8V D;  2CV5 D;  1KX5 B;  5BNX A;  5BO0 A;  1H3O B;  2J8P A;  3X1U D;  1S32 D;  4WU9 A;  1F66 B;  5B1M C;  3MNN B;  1P3L D;  5GXQ D;  1KX4 C;  5GSU D;  2DF4 C;  3LEL D;  2F8N K;  5GT3 B;  1U35 A;  2NQB C;  1P3A A;  4AWL B;  3LJA A;  3WKJ A;  3A6N D;  4H9Q B;  1BFM A;  2ZY5 A;  5E5A C;  3W98 A;  3REH D;  1JFI B;  4J8V C;  3KUY A;  1M19 B;  4ZUX B;  4KGC B;  3X1U C;  1KX3 D;  4QLC D;  4WZS B;  3WA9 A;  2F2A C;  3AZF D;  3AZN A;  1A7W A;  5CPI A;  5B2I B;  1P3L C;  2Y2M A;  2BG1 A;  5GSU C;  5DNM A;  3VH6 A;  2RIQ A;  2HIO D;  4Z2M G;  5CPJ B;  1Q9C A;  3A6N C;  4JJN A;  3WTP E;  3A1I A;  2NZD A;  4G91 C;  3UTA A;  2Y2G A;  5B33 B;  1P3M D;  3AN2 B;  3AV1 A;  1KX3 C;  2Y2N A;  4QLC C;  2IO5 B;  3C1B D;  3MGS D;  2Y2H A;  1ID3 B;  1EQZ A;  5AV5 C;  4WU8 A;  5AVC D;  3KWQ B;  5B2J B;  4J8W A;  4CAY B;  5C3I C;  3AZI B;  3C1C B;  1M1A A;  3MGR A;  2HIO C;  3VH5 A;  5F99 B;  5AV9 D;  3MNN D;  2ARO A;  3TU4 D;  1HQ3 A;  5DNN C;  5GT3 D;  3REI C;  3W97 A;  3AZJ D;  4R8P A;  4X23 D;  1P3M C;  3W99 D;  5CPK A;  3UTB B;  3MGS C;  1KX5 C;  3F6T A;  5AVC C;  4KHA B;  3X1S A;  4LD9 D;  5KDM A;  2PYO A;  1TZY A;  3AZM B;  1F66 C;  5B2I D;  5B31 B;  3MNN C;  4KUD D;  3AYW B;  3AZH D;  5GT3 C;  5B1M B;  2FFF B;  2JCH A;  3EPJ A;  2YFV B;  3AZJ C;  4AWL C;  3AFA D;  1P3I A;  3EPL A;  1BH9 A;  4H9O B;  1TAF A;  4H9S A;  4YM6 A;  2NQB B;  1W2E A;  5B33 D;  4H9R B;  5CHL B;  1M19 C;  5E5A B;  5DNM D;  2ZY4 A;  4ZUX C;  4NE3 A;  3X1V D;  2CV5 B;  1P34 B;  4XZQ D;  3X1U B;  5B2I C;  1S32 B;  1M18 A;  4KUD C;  3AZK A;  2VQR A;  3AZH C;  1P3O A;  3C1C D;  3W96 A;  3AZE D;  5CPJ C;  4M6B A;  1ULY A;  5GXQ B;  4WU8 D;  3LEL B;  3REK A;  3LZ0 D;  5JA4 A;  2F8N H;  2HUE B;  1M1A D;  5B33 C;  1HTA A;  1P3B D;  4Z5T A;  1AOI A;  5B24 B;  3X1T B;  5GT0 B;  3X1V C;  3REH B;  4YS3 A;  3NQJ A;  3UTB D;  4XZQ C;  1ID3 C;  3MGP A;  5JRG A;  2Y2Q A;  3KWQ C;  3AZF B;  3C1C C;  4ZBJ C;  3AZM D;  5AVB A;  3V9R A;  3AZE C;  5CP6 A;  2FJ7 A;  3B6G A;  3AYW D;  1N1J B;  3WTP B;  3LZ0 C;  1P3B C;  1T3U A;  3AV2 B;  4NE5 A;  4Z66 B;  5AV5 A;  3UTB C;  3B0C T;  2Y2J A;  5AV8 A;  4J8U A;  5BS7 C;  3C1B B;  3MGS B;  4XUJ D;  1P34 D;  1P3K A;  1P3G A;  3MVD D;  3UT9 A;  3AZM C;  5AVC B;  3B6F B;  4UUZ A;  5B0Z A;  4NFT A;  4YM6 D;  5B31 C;  3O62 A;  3AYW C;  5DNN A;  3REI A;  2F8N A;  3AZL A;  5B32 B;  5AV9 B;  5G49 A;  4H9P B;  3TU4 B;  5BNV A;  4DRA A;  2G5I C;  1KX5 A;  3AZJ B;  1BH8 B;  4WU9 B;  1H3O A;  4X23 B;  3W99 B;  5B24 D;  3X1T D;  5GT0 D;  2CV5 C;  1F66 A;  1R4V A;  4XUJ C;  1P34 C;  3MVD C;  4LD9 B;  1S32 C;  1U35 B;  2DQN C;  3REL A;  4YS3 D;  4KUD B;  2BYM B;  3AZH B;  5GXQ C;  5AV6 D;  3KUY B;  1JFI A;  3LEL C;  3WTP D;  2L5A A;  3WAA A;  2HUE C;  3KXB D;  4ZUX A;  3AFA B;  5AY8 A;  3AZN B;  1M19 A;  4KGC A;  5B31 G;  5B24 C;  3LZ1 D;  5B40 D;  3MGQ A;  3REJ D;  5GT0 C;  3REH C;  3AV2 D;  3X1T C;  4Z66 D;  1P3F A;  5DNM B;  3X1V B;  3AZF C;  1P3P D;  4XZQ B;  4Z2M H;  5CPJ A;  5B1L A;  3UTA B;  3B6F D;  4ZBJ B;  2CWE A;  3WTP C;  3AZE B;  4DQY B;  5B32 D;  2XD5 A;  3AN2 A;  1P3G D;  2Y2P A;  4WU8 B;  3AV2 C;  3LZ0 B;  4Z66 C;  1ID3 A;  1M1A B;  1P3B B;  4WU9 D;  3MGR B;  5B2J A;  5B0Y A;  4CAY A;  4J8X A;  3AZI A;  3C1B C;  2ARO B;  1P3P C;  4E44 A;  5F99 A;  3B6F C;  1U35 D;  2YFW B;  3W97 B;  1P3A D;  4R8P B;  3LJA D;  3WKJ D;  3H0L C;  5CPK B;  3W98 D;  4WV4 B;  2BYK B;  2JSS A;  5B32 C;  5AV9 C;  3B0D B;  5FUG A;  3TU4 C;  3KUY D;  3NQU B;  3X1S B;  1ZLA A;  2PYO B;  3WA9 D;  4WU9 C;  4G92 B;  4X23 C;  4KHA A;  3AZN D;  3W99 C;  4CSR B;  3AZG A;  5CPI D;  5B31 A;  4LD9 C;  4WNN A;  1U35 C;  1P3I B;  4XUJ B;  3MVD B;  4JJN D;  5B1M A;  2YFV A;  1WWI A;  3IP4 C;  3UTA D;  4DRB A;  4YM6 B;  1KX4 A;  3W98 C;  2NZD D;  3VH6 T;  3KUY C;  3AV1 D;  2NQB A;  4H9R A;  3WA9 C;  5E5A A;  3AFA C;  3AZN C;  1EQZ D;  1B67 A;  5CPI C;  5B1L D;  4J8V A;  4J8W D;  3X1U A;  1S32 A;  5B32 G;  5DNM C;  3MGR D;  2Y2I A;  3W96 B;  2ARO D;  1HQ3 D;  3REK B;  3UTA C;  1P3L A;  5JA4 B;  2G5H C;  5GXQ A;  5GSU A;  3W97 D;  2ZY2 A;  3VH5 T;  4R8P D;  3LEL A;  3R45 B;  5CPK D;  4YS3 B;  3A6N A;  1EQZ C;  5AV6 B;  3REH A;  5BT1 D;  3MGP B;  5JRG B;  4WU8 C;  3X1S D;  4J8W C;  2PYO D;  3KXB B;  1M1A C;  1KX3 A;  1TZY D;  4QLC A;  3REJ B;  5AVB B;  5B40 B;  3LZ1 B;  3MGR C;  3AZF A;  3B0B A;  5CP6 B;  2FJ7 B;  2ARO C;  3FDD A;  3B6G B;  3W97 C;  1P3I D;  4R8P C;  1P3P B;  2HIO A;  3H0R C;  3AZG D;  5CPK C;  4H9N A;  3B0D C;  5AV8 B;  3X1S C;  1P3M A;  2PYO C;  1P3G B;  1P3K B;  4G92 C;  3UT9 B;  5BNX B;  5BO0 B;  3EPH A;  4UUZ B;  5B0Z B;  3MGS A;  1M18 D;  4HGA C;  3AZK D;  1P3O D;  5AVC A;  2F8N B;  3AZL B;  3EG5 B;  3W96 D;  1P3I C;  5BNV B;  3MNN A;  3REK D;  4H9P A;  4H9S C;  3TU4 A;  4YM6 C;  1P3A B;  3LJA B;  3WKJ B;  4Z5T D;  1AOI D;  5GT3 A;  3AZJ A;  3W98 B;  1BH8 A;  4X23 A;  3W99 A;  4H9Q A;  3MGP D;  5JRG D;  1M18 C;  3WA9 B;  3AZK C;  4WJ3 C;  1P3O C;  4LD9 A;  3REL B;  2Y2K A;  3B0C W;  5CPI B;  5AVB D;  3W96 C;  5CP6 D;  2FJ7 D;  2XD1 A;  3B6G D;  5B2I A;  4KUD A;  3REK C;  2BYM A;  2LY8 A;  3AZH A;  3WAA B;  5AY8 B;  4Z5T C;  1AOI C;  4JJN B;  3MGQ B;  2NZD B;  3AFA A;  5AV5 D;  4YS3 C;  1P3F B;  1KU5 A;  5AV6 C;  4UPK A;  3AV1 B;  3MGP C;  5JRG C;  5AV8 D;  4J8U D;  5B33 A;  2ZY3 A;  3KXB C;  1EQZ B;  1P3K D;  3X1V A;  3UT9 D;  5B1L B;  5AVB C;  3LZ1 C;  3REJ C;  5B40 C;  5B0Z D;  4XZQ A;  4J8W B;  5CP6 C;  3O62 D;  2FJ7 C;  3B6G C;  1PZR A;  5DNN D;  3KWQ A;  3REI D;  2F8N D;  3AZL D;  3C1C A;  1HQ3 B;  3EPK A;  3AZE A;  3KSY A;  1KX5 D;  3LZ0 A;  5AV8 C;  3P5J B;  5B0Y B;  4J8X B;  4J8U C;  1P3B A;  1F66 D;  1P3G C;  1P3K C;  3UT9 C;  3UTB A;  5B0Z C;  5KDM B;  3O62 C;  4E45 A;  1TZY B;  3REL D;  5BS7 A;  2YFW A;  3AZL C;  3A1K A;  4HGA B;  3AZM A;  4EO5 B;  5FUG B;  2BYK A;  1ZLA B;  3WAA D;  3AYW A;  1P3A C;  1M19 D;  3NQU A;  4ZUX D;  3LJA C;  5AY8 D;  3WKJ C;  4KGC D;  3AZG B;  3MGQ D;  1BH9 B;  1TAF B;  1P3F D;  4CSR A;  4H9O A;  4WNN B;  3REL C;  5CPJ D;  2CV5 A;  2Y2L A;  4XUJ A;  1P34 A;  1KX4 B;  3MVD A;  1M18 B;  3AZK B;  1P3O B;  1F1E A;  3WAA C;  2JE5 A;  3AN2 D;  5AY8 C;  4KGC C;  4JJN C;  3MGQ C;  4J8V B;  2NZD C;  1ID3 D;  3KFU G;  2F8N G;  1P3F C;  4Z5T B;  3KWQ D;  1AOI B;  2UWX A;  3AV1 C;  5B2J D;  5B0Y D;  4J8X D;  3AZI D;  3NQJ B;  5B24 A;  3X1T A;  2ZM5 A;  5GT0 A;  5F99 D;  5B1L C;  1P3L B;  5GSU B;  2Y2O A;  4NE6 A;  3V9R B;  3A6N B;  3AN2 C;  3AL0 C;  3R45 A;  4G91 B;  1HQ3 C;  2IO5 C;  1ZLA D;  2RVQ D;  5AV6 A;  1Z2C B;  1KX3 B;  1N1J A;  3VH6 W;  4QLC B;  3WTP A;  5B2J C;  1WWS A;  5B0Y C;  3KXB A;  4J8X C;  3AZI C;  5AV5 B;  1B6W A;  3AV2 A;  3REJ A;  3LZ1 A;  5B40 A;  5F99 C;  5BT1 C;  3H0M C;  5B31 D;  4Z66 A;  4J8U B;  5C3I B;  2HIO B;  1TZY C;  5B1M D;  3C1B A;  1P3P A;  4H9N B;  1KX4 D;  3O62 B;  4EO5 C;  5DNN B;  3B6F A;  3REI B;  2NQB D;  1ZLA C;  2RVQ C;  1P3M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...