3TU4A

Crystal structure of the sir3 bah domain in complex with a nucleosome core particle.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
98
structure length
98
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Structural basis of silencing: Sir3 BAH domain in complex with a nucleosome at 3.0 A resolution.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Signaling protein/structural protein/dna
total genus 32
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3tu4A00
2CV5D 5G49B 3C1BB 1TZYC 5CP6A 3AZID 3LZ0D 3X1VD 2F8NA 5B33B 4CAYA 3REIB 3LZ1D 3UTBD 4YS3A 3WKJD 2HIOB 5CPIB 4XZQC 3AV2B 5F99B 1M18D 3REJC 3WAAB 5AV6D 4Z66B 5B1LC 3VH6W 4J8UA 4XUJD 4H9NB 1P3KB 3UTAC 3X1SC 5GSUD 1P3AC 3B0DC 1B6WA 5BNXB 1HQ3C 4H9QA 3KUYA 1S32A 4KGCD 5AV9B 5B2JB 1M19A 3AV1D 1U35A 5GT0A 1P3FB 4E44A 5B33D 3REID 5AV8C 3MGRA 5CPID 3AZEA 3AV2D 1M1AC 3WA9C 1BFMA 3NQJB 3WAAD 4Z66D 4LD9C 3AZHC 4Z2MH 3REHB 1ZLAC 1KU5A 3W96A 1P3PA 5CPKC 2NQBC 4WV4B 5B0ZC 4KUDA 1P34C 1KX3A 4QLCA 5AV9D 5B2JD 3B0BA 3O62C 3WTPA 3RELB 4UUZB 4ZBJB 4H9OB 4J8XB 3UT9C 4WU8C 1B67A 1P3FD 3AZJC 2FJ7A 4AWLB 4ZUXC 4H9PB 3X1TC 3MNNC 2PYOA 1P3GB 1BH8B 5GXQC 3REHD 1P3OA 3KXBB 3TU4C 5JA4A 2NZDB 3W99B 3AYWA 3KSYA 5GT3B 3LELA 1P3MA 5BS7A 4HGAC 4H9RB 4H9SC 5B0YB 3W97C 3B6GC 5DNNB 3RELD 5B2IC 3KWQA 5B31B 3AZKC 5AVBB 5B1MA 1KX4A 2YFVA 5E5AB 1KX5A 5AY8C 3REKB 2F8NB 3A6NC 1P3GD 4M6BA 4YS3B 4WNNA 2NZDD 3W99D 5B24C 4YM6A 4J8UB 4JJNC 4WU9C 5B0YD 3W98A 3C1CA 5BT1D 5DNND 1AOIA 3AZIC 3X1VC 3LZ0C 4NE3A 3LZ1C 3UTBC 5B31D 2JSSA 3KUYB 1EQZA 4NE5A 5AVBD 1M19B 2F8NK 1U35B 2RVQD 5KDMA 4E45A 4XZQA 5GT0B 5B32G 5CP6D 4XUJC 2F8ND 3AZFB 3LJAC 4YS3D 3VH5W 3MGRB 3AZEB 5BO0B 5CPJA 3AFAA 3UTAA 3AZLA 4J8UD 4KGCC 5AV5A 3WKJB 3AV1C 1P3AA 3W96B 1P3PB 2L5AA 5JRGA 3C1BC 5BNVA 1M18B 4KUDB 5B33C 1P3BA 5AV6B 3REIC 3KUYD 1KX3B 2HIOC 5CPIC 3AV2C 5F99C 3X1UA 1M19D 5B40A 3WAAC 3WTPB 1U35D 4Z66C 5GT0D 1P3KC 1ID3A 3MGRD 2FJ7B 5FUGA 3AZED 2AROA 4LD9A 1ZLAA 2PYOB 4EO5B 1F1EA 2NQBA 1P3OB 5AV9C 5JA4B 5B2JC 3W96D 1P3LA 1P3PD 1P34A 3AYWB 2HUEB 1P3IA 4KUDD 1P3FC 4J8WB 1KX3D 3UT9A 4QLCD 3NQUA 3MGSA 3WTPD 3KWQB 3REHC 4R8PB 1N1JA 4DRBA 1KX4B 2FJ7D 3AZGA 1KX5B 2YFWA 2PYOD 3TU4A 4X23A 4Z5TA 4KHAA 1P3OD 3V9RA 1BH9A 4WNNB 3RELC 3AYWD 4YM6B 4J8XC 4ZBJC 3W97A 3LELD 1P3MD 4J8WD 5DNMA 4AWLC 3W98B 3C1CB 3AZKA 1AOIB 3KWQD 1P3GC 1EQZB 3B0CW 4R8PD 2BYKA 3KXBC 5C3IB 1KX4D 2NZDC 3A6NA 3W99C 4J8VA 1KX5D 2BYMA 5KDMB 4XZQB 5GT3C 5B24A 5B0YC 5BT1C 5CPJB 5DNNC 3AFAB 3AZLB 5B32C 4YM6D 5B31C 1F66C 5AVBC 5AV5B 3MVDA 3LZ0A 3B0DB 3W98D 5E5AC 3C1CD 2RVQC 5JRGB 3REKC 1AOID 3AZNA 1P3BB 4NFTA 4YS3C 1EQZD 1JFIB 5AVCA 3X1UB 5B40B 3LJAA 4J8UC 4XZQD 1ID3B 5FUGB 2AROB 5CPJD 3AFAD 3AZLD 3B6FA 3KUYC 5CP6B 3C1BA 5AV5D 4CAYB 1M19C 1P3AD 4G92B 1P3LB 1U35C 3MGPA 5JRGD 2HIOA 1P3IB 5GT0C 5F99A 1P3BD 3AZFC 3AZEC 3AZMA 3X1UD 3MGSB 1P3KA 5B40D 2CV5C 3AN2A 1ID3D 3VH6T 3MGQA 3VH6A 4NE6A 3W96C 3WKJC 4H9QB 1S32B 1P3PC 3AZGB 2AROD 1TZYA 1ZLAD 1M18C 4X23B 5AV9A 4Z5TB 5AV6C 1WWSA 4KHAB 1KX3C 3V9RB 5B31G 1BH9B 3R45A 3REJA 1P3LD 3WTPC 1P34D 5B1LA 1P3ID 5GSUC 5DNMB 2F8NG 2FJ7C 3MGSD 3AZKB 3X1SA 2PYOC 4EO5C 2CWEA 1HQ3A 1P3OC 1H3OA 1S32D 3A6NB 3AZGD 4J8VB 3AYWC 2HUEC 4QLCB 3TU4D 4X23D 4Z5TD 5BS7C 3B0CT 4J8WC 1HTAA 5AV8A 1M1AA 4UUZA 4J8XA 3WA9A 3KWQC 3AZHA 3W97D 4R8PC 3MVDB 5DNMD 5CPKA 1KX5C 2IO5B 4CSRA 1BH8A 5B0ZA 3AZKD 3KXBA 3AZNB 5AVCB 3LELB 4DRAA 1P3MB 3O62A 5GT3A 3A6ND 4J8VD 4YM6C 4WU8A 4H9RA 3AZJA 5B24D 5B32A 3W98C 4ZUXA 3C1CC 3X1TA 1R4VA 3MNNA 1AOIC 5B1MB 1F66A 3B6FB 2YFVB 4G91B 5GXQA 1EQZC 5E5AA 3REKA 3MVDD 5C3IC 3MGPB 3AZND 4H9SA 5AVCD 3AZMB 3B6GA 5CPJC 3AFAC 5B2IA 3AZLC 3LJAD 3AN2B 3MGQB 5AV5C 5AY8A 4Z2MG 1TZYB 5JRGC 5B1MD 3B6FD 1P3BC 3C1BD 3X1UC 1TAFA 3REJB 3R45B 1Q9CA 5B40C 3MGPD 5B1LB 3AZFA 2HIOD 4JJNA 5BO0A 5F99D 3UTAB 1ID3C 4WU9A 2CV5A 2AROC 3AZMD 3VH5T 4WU9D 3VH5A 3AZIA 3X1SB 3X1VA 1P3KD 1P3AB 3WKJA 3LZ1A 1HQ3B 3UTBA 3AN2D 5BNVB 5CP6C 3MGQD 1H3OB 1M18A 1P3LC 4G92C 5AV6A 1TZYD 4XUJA 1P3IC 5AV8B 1M1AB 3WA9B 3REJD 3MGSC 5GSUA 2LY8A 5B1LD 4LD9B 3AZHB 4KGCA 3UTAD 1ZLAB 3AV1A 1S32C 5G49A 3AZGC 5CPKB 2NQBB 4CSRB 5B0ZB 3X1SD 4X23C 5B33A 1P34B 3REIA 4Z5TC 1HQ3D 5CPIA 3AV2A 3O62B 3WAAA 3MGRC 4Z66A 4J8WA 3UT9B 4WU8B 3NQUB 4H9NA 3AZJB 5AV8D 5DNMC 1M1AD 5B32B 4J8XD 3WA9D 4ZUXB 3X1TB 1N1JB 3MNNB 4R8PA 1F66B 1ULYA 2YFWB 5BNXA 3AZHD 4LD9D 5GXQB 3TU4B 4KUDC 5B2JA 5CPKD 2NQBD 4J8VC 4QLCC 5B0ZD 3KXBD 1P3FA 4HGAB 4WZSB 1WWIA 3W97B 3NQJA 3B6GB 3O62D 5GT3D 5B2IB 3UT9D 4WU8D 3REHA 3AZJD 3MVDC 5B32D 1A7WA 2IO5C 2BYKB 5AY8B 4ZUXD 3X1TD 3MNND 3AZNC 1F66D 2BYMB 5GXQD 5E5AD 5AVCC 3REKD 3LELC 1P3MC 1TAFB 3RELA 5B24B 2F8NH 4H9OA 4JJNB 4WU9B 2CV5B 4H9PA 3B6GD 3WTPE 5B1MC 5B2ID 3LZ0B 5CHLB 3AZIB 3X1VB 1P3GA 1KX4C 3B6FC 3LZ1B 4G91C 3UTBB 2NZDA 3W99A 3MGPC 5AY8D 4XUJB 1JFIA 3LJAB 5B0YA 3AZMC 5DNNA 5GSUB 3AZFD 3AN2C 5B31A 4KGCB 4JJND 3MGQC 5AVBA 3AV1B
chains in the Genus database with same CATH superfamily
2CV5D 5G49B 4DQYB 3C1BB 1TZYC 5CP6A 3AZID 3LZ0D 3X1VD 2F8NA 5B33B 4CAYA 3REIB 3LZ1D 3UTBD 4YS3A 3WKJD 2HIOB 5CPIB 4XZQC 3AV2B 5F99B 3H0RC 3REJC 1M18D 3WAAB 5AV6D 4Z66B 5B1LC 3VH6W 4J8UA 4XUJD 4H9NB 1P3KB 3UTAC 2DF4C 3X1SC 5GSUD 1P3AC 3B0DC 1B6WA 5BNXB 1HQ3C 4H9QA 3KUYA 1S32A 4KGCD 5AV9B 5B2JB 1M19A 3AV1D 2XD5A 1U35A 5GT0A 1P3FB 4E44A 5B33D 3REID 5AV8C 3MGRA 5CPID 3AZEA 3AV2D 1M1AC 3WA9C 1BFMA 2Y2QA 3NQJB 1Z2CB 3WAAD 4Z66D 4LD9C 3AZHC 4Z2MH 3REHB 2BG1A 1ZLAC 1KU5A 3W96A 1P3PA 2F2AC 5CPKC 2NQBC 4WV4B 5B0ZC 4KUDA 1P34C 1KX3A 4QLCA 5AV9D 5B2JD 3B0BA 2ZY3A 2ZY4A 3FDDA 3WTPA 3O62C 3RELB 4UUZB 4ZBJB 4H9OB 4J8XB 3UT9C 2Y2GA 1B67A 4WU8C 1P3FD 3AL0C 3AZJC 2FJ7A 4AWLB 4ZUXC 4H9PB 3X1TC 3KFUG 3MNNC 2PYOA 2DQNC 1P3GB 2J8PA 1BH8B 5GXQC 3REHD 1P3OA 3KXBB 3TU4C 5JA4A 2NZDB 3W99B 3AYWA 3KSYA 5GT3B 3LELA 1P3MA 5BS7A 4HGAC 4H9RB 4H9SC 5B0YB 3W97C 3B6GC 5DNNB 3RELD 5B2IC 3KWQA 1W2EA 5B31B 3AZKC 5AVBB 5B1MA 1KX4A 2YFVA 5E5AB 1KX5A 5AY8C 3REKB 2F8NB 3A6NC 1P3GD 4M6BA 4YS3B 4WNNA 2NZDD 3W99D 5B24C 4YM6A 4J8UB 4JJNC 4WU9C 5B0YD 3W98A 3C1CA 5BT1D 5DNND 1AOIA 3AZIC 3X1VC 3LZ0C 4NE3A 3LZ1C 3UTBC 5B31D 2JSSA 3KUYB 1EQZA 3P5JB 4NE5A 5AVBD 1M19B 2F8NK 1U35B 2Y2HA 2RVQD 5KDMA 4E45A 4XZQA 5GT0B 5B32G 5CP6D 4XUJC 2F8ND 3AZFB 3EPHA 3LJAC 4YS3D 3VH5W 3MGRB 3AZEB 5BO0B 5CPJA 3AFAA 3UTAA 3AZLA 2G5HC 4J8UD 4KGCC 5AV5A 3WKJB 3AV1C 1P3AA 3W96B 1P3PB 2L5AA 5JRGA 3C1BC 5BNVA 1M18B 4KUDB 2Y2PA 5B33C 1P3BA 5AV6B 3REIC 3KUYD 1KX3B 2HIOC 5CPIC 3AV2C 2Y2JA 5F99C 3X1UA 1M19D 5B40A 3WAAC 3WTPB 1U35D 4Z66C 5GT0D 1P3KC 1ID3A 3MGRD 2FJ7B 5FUGA 3AZED 2AROA 4LD9A 1ZLAA 2PYOB 4EO5B 1F1EA 2NQBA 1P3OB 5AV9C 5JA4B 5B2JC 3W96D 1P3LA 1P3PD 1P34A 3AYWB 2HUEB 1P3IA 4KUDD 2Y2OA 1P3FC 4J8WB 1KX3D 2G5IC 3UT9A 4QLCD 3NQUA 3MGSA 3WTPD 3KWQB 1T3UA 3REHC 4R8PB 1N1JA 4DRBA 1KX4B 2FJ7D 3AZGA 1KX5B 2YFWA 2PYOD 3TU4A 2FFFB 4X23A 4Z5TA 2Y2NA 4KHAA 1P3OD 3V9RA 1BH9A 4WNNB 3RELC 3AYWD 4YM6B 4J8XC 4ZBJC 3W97A 3LELD 1P3MD 4J8WD 5DNMA 2ZY5A 4AWLC 3W98B 3C1CB 3AZKA 1AOIB 3KWQD 1P3GC 1EQZB 3B0CW 4R8PD 2BYKA 3KXBC 5C3IB 1KX4D 2NZDC 3A6NA 3W99C 4J8VA 1KX5D 2BYMA 3H0MC 5KDMB 4XZQB 5GT3C 5B24A 5B0YC 5BT1C 5CPJB 5DNNC 3AFAB 3AZLB 5B32C 4YM6D 5B31C 1F66C 5AVBC 5AV5B 3MVDA 3LZ0A 3H0LC 3B0DB 3W98D 3IP4C 5E5AC 3C1CD 2RVQC 5JRGB 3REKC 1AOID 3AZNA 1P3BB 4NFTA 4YS3C 1EQZD 1JFIB 5AVCA 3X1UB 5B40B 3LJAA 4J8UC 4XZQD 1ID3B 4WJ3C 5FUGB 2AROB 2VQRA 5CPJD 3AFAD 3AZLD 3B6FA 3KUYC 5CP6B 3C1BA 5AV5D 4CAYB 1M19C 1P3AD 4G92B 1P3LB 1U35C 3MGPA 5JRGD 2HIOA 1P3IB 5GT0C 5F99A 1P3BD 3AZFC 3AZEC 3AZMA 3X1UD 3MGSB 1P3KA 5B40D 2CV5C 3AN2A 1ID3D 3VH6T 2JCHA 3MGQA 3VH6A 4NE6A 3W96C 3WKJC 4H9QB 1S32B 1P3PC 3AZGB 2AROD 1TZYA 1ZLAD 1M18C 4X23B 5AV9A 4Z5TB 5AV6C 1WWSA 4KHAB 1KX3C 3V9RB 5B31G 1BH9B 3R45A 3REJA 1P3LD 3WTPC 1P34D 5B1LA 1P3ID 5GSUC 5DNMB 2F8NG 2FJ7C 3MGSD 3AZKB 3X1SA 2PYOC 4EO5C 2CWEA 1HQ3A 1P3OC 1H3OA 1S32D 3A6NB 3AZGD 4J8VB 3AYWC 2HUEC 2Y2KA 4QLCB 3TU4D 4X23D 4Z5TD 5BS7C 3B0CT 4J8WC 1HTAA 5AV8A 1M1AA 4UUZA 4J8XA 3WA9A 3KWQC 3AZHA 3W97D 4R8PC 3MVDB 5DNMD 5CPKA 4UPKA 1KX5C 2IO5B 4CSRA 1BH8A 5B0ZA 3AZKD 1PZRA 2ZM5A 3KXBA 3AZNB 5AVCB 3LELB 4DRAA 1P3MB 3O62A 5GT3A 3A6ND 4J8VD 4YM6C 4H9RA 4WU8A 3AZJA 5B24D 5B32A 3W98C 2W8SA 4ZUXA 3C1CC 1R4VA 3MNNA 3X1TA 1AOIC 5B1MB 1F66A 3B6FB 2YFVB 4G91B 5GXQA 1EQZC 5E5AA 3REKA 3MVDD 5C3IC 2Y2MA 3MGPB 3AZND 4H9SA 5AVCD 3AZMB 3B6GA 5CPJC 3AFAC 5B2IA 3AZLC 3LJAD 3AN2B 3MGQB 5AV5C 5AY8A 4Z2MG 1TZYB 5JRGC 5B1MD 3B6FD 1P3BC 3C1BD 3X1UC 1TAFA 3REJB 3R45B 1Q9CA 5B40C 2UWXA 3MGPD 5B1LB 3AZFA 2HIOD 4JJNA 5BO0A 5F99D 3UTAB 1ID3C 4WU9A 2ZY2A 2Y2IA 2CV5A 2AROC 3AZMD 3VH5T 4WU9D 3VH5A 3AZIA 3X1SB 3X1VA 1P3KD 1P3AB 3WKJA 3LZ1A 1HQ3B 3UTBA 3AN2D 5BNVB 5CP6C 3MGQD 1H3OB 1M18A 1P3LC 4G92C 5AV6A 3EPLA 1TZYD 4XUJA 1P3IC 5AV8B 1M1AB 3WA9B 3REJD 3MGSC 5GSUA 2LY8A 5B1LD 4LD9B 3AZHB 4KGCA 3UTAD 1ZLAB 2RIQA 3AV1A 1S32C 5G49A 3AZGC 5CPKB 2NQBB 4CSRB 5B0ZB 3X1SD 3A1KA 4X23C 5B33A 1P34B 3REIA 4Z5TC 1HQ3D 5CPIA 3AV2A 3O62B 3WAAA 3MGRC 4Z66A 4J8WA 3F6TA 3UT9B 4WU8B 3NQUB 4H9NA 3AZJB 5AV8D 5DNMC 1M1AD 5B32B 4J8XD 3WA9D 4ZUXB 3X1TB 1N1JB 3MNNB 4R8PA 1F66B 3A1IA 1ULYA 5BNXA 2YFWB 3AZHD 4LD9D 5GXQB 3TU4B 4KUDC 5B2JA 5CPKD 2NQBD 4J8VC 4QLCC 5B0ZD 3KXBD 1P3FA 4HGAB 4WZSB 1WWIA 3W97B 3NQJA 3B6GB 3O62D 5GT3D 5B2IB 3UT9D 4WU8D 3REHA 3AZJD 3MVDC 5B32D 1A7WA 2IO5C 2BYKB 5AY8B 4ZUXD 3X1TD 3MNND 3AZNC 1F66D 3EPKA 2BYMB 5GXQD 5E5AD 5AVCC 3REKD 3LELC 1P3MC 1TAFB 3RELA 5B24B 2F8NH 4H9OA 4JJNB 4WU9B 2CV5B 3EG5B 4H9PA 3B6GD 3WTPE 5B1MC 5B2ID 3LZ0B 5CHLB 3AZIB 3X1VB 1P3GA 1KX4C 3B6FC 3LZ1B 4G91C 3UTBB 2NZDA 2Y2LA 3W99A 3MGPC 3EPJA 5AY8D 4XUJB 1JFIA 3LJAB 2XD1A 5B0YA 3AZMC 2JE5A 5DNNA 5GSUB 3AZFD 3AN2C 5B31A 4KGCB 4JJND 3MGQC 5AVBA 3AV1B
chains in the Genus database with same CATH topology
2CV5D 5G49B 4DQYB 3C1BB 1TZYC 5CP6A 3AZID 3LZ0D 3X1VD 2F8NA 5B33B 4CAYA 3REIB 3LZ1D 3UTBD 4YS3A 3WKJD 2HIOB 5CPIB 4XZQC 3AV2B 5F99B 3H0RC 3REJC 1M18D 3WAAB 5AV6D 4Z66B 5B1LC 3VH6W 4J8UA 4XUJD 4H9NB 1P3KB 3UTAC 2DF4C 3X1SC 5GSUD 1P3AC 3B0DC 1B6WA 5BNXB 1HQ3C 4H9QA 3KUYA 1S32A 4KGCD 5AV9B 5B2JB 1M19A 3AV1D 2XD5A 1U35A 5GT0A 1P3FB 4E44A 5B33D 3REID 5AV8C 3MGRA 5CPID 3AZEA 3AV2D 1M1AC 3WA9C 1BFMA 2Y2QA 3NQJB 1Z2CB 3WAAD 4Z66D 4LD9C 3AZHC 4Z2MH 3REHB 2BG1A 1ZLAC 1KU5A 3W96A 1P3PA 2F2AC 5CPKC 2NQBC 4WV4B 5B0ZC 4KUDA 1P34C 1KX3A 4QLCA 5AV9D 5B2JD 3B0BA 2ZY3A 2ZY4A 3FDDA 3WTPA 3O62C 3RELB 4UUZB 4ZBJB 4H9OB 4J8XB 3UT9C 2Y2GA 1B67A 4WU8C 1P3FD 3AL0C 3AZJC 2FJ7A 4AWLB 4ZUXC 4H9PB 3X1TC 3KFUG 3MNNC 2PYOA 2DQNC 1P3GB 2J8PA 1BH8B 5GXQC 3REHD 1P3OA 3KXBB 3TU4C 5JA4A 2NZDB 3W99B 3AYWA 3KSYA 5GT3B 3LELA 1P3MA 5BS7A 4HGAC 4H9RB 4H9SC 5B0YB 3W97C 3B6GC 5DNNB 3RELD 5B2IC 3KWQA 1W2EA 5B31B 3AZKC 5AVBB 5B1MA 1KX4A 2YFVA 5E5AB 1KX5A 5AY8C 3REKB 2F8NB 3A6NC 1P3GD 4M6BA 4YS3B 4WNNA 2NZDD 3W99D 5B24C 4YM6A 4J8UB 4JJNC 4WU9C 5B0YD 3W98A 3C1CA 5BT1D 5DNND 1AOIA 3AZIC 3X1VC 3LZ0C 4NE3A 3LZ1C 3UTBC 5B31D 2JSSA 3KUYB 1EQZA 3P5JB 4NE5A 5AVBD 1M19B 2F8NK 1U35B 2Y2HA 2RVQD 5KDMA 4E45A 4XZQA 5GT0B 5B32G 5CP6D 4XUJC 2F8ND 3AZFB 3EPHA 3LJAC 4YS3D 3VH5W 3MGRB 3AZEB 5BO0B 5CPJA 3AFAA 3UTAA 3AZLA 2G5HC 4J8UD 4KGCC 5AV5A 3WKJB 3AV1C 1P3AA 3W96B 1P3PB 2L5AA 5JRGA 3C1BC 5BNVA 1M18B 4KUDB 2Y2PA 5B33C 1P3BA 5AV6B 3REIC 3KUYD 1KX3B 2HIOC 5CPIC 3AV2C 2Y2JA 5F99C 3X1UA 1M19D 5B40A 3WAAC 3WTPB 1U35D 4Z66C 5GT0D 1P3KC 1ID3A 3MGRD 2FJ7B 5FUGA 3AZED 2AROA 4LD9A 1ZLAA 2PYOB 4EO5B 1F1EA 2NQBA 1P3OB 5AV9C 5JA4B 5B2JC 3W96D 1P3LA 1P3PD 1P34A 3AYWB 2HUEB 1P3IA 4KUDD 2Y2OA 1P3FC 4J8WB 1KX3D 2G5IC 3UT9A 4QLCD 3NQUA 3MGSA 3WTPD 3KWQB 1T3UA 3REHC 4R8PB 1N1JA 4DRBA 1KX4B 2FJ7D 3AZGA 1KX5B 2YFWA 2PYOD 3TU4A 2FFFB 4X23A 4Z5TA 2Y2NA 4KHAA 1P3OD 3V9RA 1BH9A 4WNNB 3RELC 3AYWD 4YM6B 4J8XC 4ZBJC 3W97A 3LELD 1P3MD 4J8WD 5DNMA 2ZY5A 4AWLC 3W98B 3C1CB 3AZKA 1AOIB 3KWQD 1P3GC 1EQZB 3B0CW 4R8PD 2BYKA 3KXBC 5C3IB 1KX4D 2NZDC 3A6NA 3W99C 4J8VA 1KX5D 2BYMA 3H0MC 5KDMB 4XZQB 5GT3C 5B24A 5B0YC 5BT1C 5CPJB 5DNNC 3AFAB 3AZLB 5B32C 4YM6D 5B31C 1F66C 5AVBC 5AV5B 3MVDA 3LZ0A 3H0LC 3B0DB 3W98D 3IP4C 5E5AC 3C1CD 2RVQC 5JRGB 3REKC 1AOID 3AZNA 1P3BB 4NFTA 4YS3C 1EQZD 1JFIB 5AVCA 3X1UB 5B40B 3LJAA 4J8UC 4XZQD 1ID3B 4WJ3C 5FUGB 2AROB 2VQRA 5CPJD 3AFAD 3AZLD 3B6FA 3KUYC 5CP6B 3C1BA 5AV5D 4CAYB 1M19C 1P3AD 4G92B 1P3LB 1U35C 3MGPA 5JRGD 2HIOA 1P3IB 5GT0C 5F99A 1P3BD 3AZFC 3AZEC 3AZMA 3X1UD 3MGSB 1P3KA 5B40D 2CV5C 3AN2A 1ID3D 3VH6T 2JCHA 3MGQA 3VH6A 4NE6A 3W96C 3WKJC 4H9QB 1S32B 1P3PC 3AZGB 2AROD 1TZYA 1ZLAD 1M18C 4X23B 5AV9A 4Z5TB 5AV6C 1WWSA 4KHAB 1KX3C 3V9RB 5B31G 1BH9B 3R45A 3REJA 1P3LD 3WTPC 1P34D 5B1LA 1P3ID 5GSUC 5DNMB 2F8NG 2FJ7C 3MGSD 3AZKB 3X1SA 2PYOC 4EO5C 2CWEA 1HQ3A 1P3OC 1H3OA 1S32D 3A6NB 3AZGD 4J8VB 3AYWC 2HUEC 2Y2KA 4QLCB 3TU4D 4X23D 4Z5TD 5BS7C 3B0CT 4J8WC 1HTAA 5AV8A 1M1AA 4UUZA 4J8XA 3WA9A 3KWQC 3AZHA 3W97D 4R8PC 3MVDB 5DNMD 5CPKA 4UPKA 1KX5C 2IO5B 4CSRA 1BH8A 5B0ZA 3AZKD 1PZRA 2ZM5A 3KXBA 3AZNB 5AVCB 3LELB 4DRAA 1P3MB 3O62A 5GT3A 3A6ND 4J8VD 4YM6C 4H9RA 4WU8A 3AZJA 5B24D 5B32A 3W98C 2W8SA 4ZUXA 3C1CC 1R4VA 3MNNA 3X1TA 1AOIC 5B1MB 1F66A 3B6FB 2YFVB 4G91B 5GXQA 1EQZC 5E5AA 3REKA 3MVDD 5C3IC 2Y2MA 3MGPB 3AZND 4H9SA 5AVCD 3AZMB 3B6GA 5CPJC 3AFAC 5B2IA 3AZLC 3LJAD 3AN2B 3MGQB 5AV5C 5AY8A 4Z2MG 1TZYB 5JRGC 5B1MD 3B6FD 1P3BC 3C1BD 3X1UC 1TAFA 3REJB 3R45B 1Q9CA 5B40C 2UWXA 3MGPD 5B1LB 3AZFA 2HIOD 4JJNA 5BO0A 5F99D 3UTAB 1ID3C 4WU9A 2ZY2A 2Y2IA 2CV5A 2AROC 3AZMD 3VH5T 4WU9D 3VH5A 3AZIA 3X1SB 3X1VA 1P3KD 1P3AB 3WKJA 3LZ1A 1HQ3B 3UTBA 3AN2D 5BNVB 5CP6C 3MGQD 1H3OB 1M18A 1P3LC 4G92C 5AV6A 3EPLA 1TZYD 4XUJA 1P3IC 5AV8B 1M1AB 3WA9B 3REJD 3MGSC 5GSUA 2LY8A 5B1LD 4LD9B 3AZHB 4KGCA 3UTAD 1ZLAB 2RIQA 3AV1A 1S32C 5G49A 3AZGC 5CPKB 2NQBB 4CSRB 5B0ZB 3X1SD 3A1KA 4X23C 5B33A 1P34B 3REIA 4Z5TC 1HQ3D 5CPIA 3AV2A 3O62B 3WAAA 3MGRC 4Z66A 4J8WA 3F6TA 3UT9B 4WU8B 3NQUB 4H9NA 3AZJB 5AV8D 5DNMC 1M1AD 5B32B 4J8XD 3WA9D 4ZUXB 3X1TB 1N1JB 3MNNB 4R8PA 1F66B 3A1IA 1ULYA 5BNXA 2YFWB 3AZHD 4LD9D 5GXQB 3TU4B 4KUDC 5B2JA 5CPKD 2NQBD 4J8VC 4QLCC 5B0ZD 3KXBD 1P3FA 4HGAB 4WZSB 1WWIA 3W97B 3NQJA 3B6GB 3O62D 5GT3D 5B2IB 3UT9D 4WU8D 3REHA 3AZJD 3MVDC 5B32D 1A7WA 2IO5C 2BYKB 5AY8B 4ZUXD 3X1TD 3MNND 3AZNC 1F66D 3EPKA 2BYMB 5GXQD 5E5AD 5AVCC 3REKD 3LELC 1P3MC 1TAFB 3RELA 5B24B 2F8NH 4H9OA 4JJNB 4WU9B 2CV5B 3EG5B 4H9PA 3B6GD 3WTPE 5B1MC 5B2ID 3LZ0B 5CHLB 3AZIB 3X1VB 1P3GA 1KX4C 3B6FC 3LZ1B 4G91C 3UTBB 2NZDA 2Y2LA 3W99A 3MGPC 3EPJA 5AY8D 4XUJB 1JFIA 3LJAB 2XD1A 5B0YA 3AZMC 2JE5A 5DNNA 5GSUB 3AZFD 3AN2C 5B31A 4KGCB 4JJND 3MGQC 5AVBA 3AV1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CV5 D;  5G49 B;  3C1B B;  1TZY C;  5CP6 A;  3AZI D;  3LZ0 D;  3X1V D;  2F8N A;  5B33 B;  4CAY A;  3REI B;  3LZ1 D;  3UTB D;  4YS3 A;  3WKJ D;  2HIO B;  5CPI B;  4XZQ C;  3AV2 B;  5F99 B;  1M18 D;  3REJ C;  3WAA B;  5AV6 D;  4Z66 B;  5B1L C;  3VH6 W;  4J8U A;  4XUJ D;  4H9N B;  1P3K B;  3UTA C;  3X1S C;  5GSU D;  1P3A C;  3B0D C;  1B6W A;  5BNX B;  1HQ3 C;  4H9Q A;  3KUY A;  1S32 A;  4KGC D;  5AV9 B;  5B2J B;  1M19 A;  3AV1 D;  1U35 A;  5GT0 A;  1P3F B;  4E44 A;  5B33 D;  3REI D;  5AV8 C;  3MGR A;  5CPI D;  3AZE A;  3AV2 D;  1M1A C;  3WA9 C;  1BFM A;  3NQJ B;  3WAA D;  4Z66 D;  4LD9 C;  3AZH C;  4Z2M H;  3REH B;  1ZLA C;  1KU5 A;  3W96 A;  1P3P A;  5CPK C;  2NQB C;  4WV4 B;  5B0Z C;  4KUD A;  1P34 C;  1KX3 A;  4QLC A;  5AV9 D;  5B2J D;  3B0B A;  3O62 C;  3WTP A;  3REL B;  4UUZ B;  4ZBJ B;  4H9O B;  4J8X B;  3UT9 C;  4WU8 C;  1B67 A;  1P3F D;  3AZJ C;  2FJ7 A;  4AWL B;  4ZUX C;  4H9P B;  3X1T C;  3MNN C;  2PYO A;  1P3G B;  1BH8 B;  5GXQ C;  3REH D;  1P3O A;  3KXB B;  3TU4 C;  5JA4 A;  2NZD B;  3W99 B;  3AYW A;  3KSY A;  5GT3 B;  3LEL A;  1P3M A;  5BS7 A;  4HGA C;  4H9R B;  4H9S C;  5B0Y B;  3W97 C;  3B6G C;  5DNN B;  3REL D;  5B2I C;  3KWQ A;  5B31 B;  3AZK C;  5AVB B;  5B1M A;  1KX4 A;  2YFV A;  5E5A B;  1KX5 A;  5AY8 C;  3REK B;  2F8N B;  3A6N C;  1P3G D;  4M6B A;  4YS3 B;  4WNN A;  2NZD D;  3W99 D;  5B24 C;  4YM6 A;  4J8U B;  4JJN C;  4WU9 C;  5B0Y D;  3W98 A;  3C1C A;  5BT1 D;  5DNN D;  1AOI A;  3AZI C;  3X1V C;  3LZ0 C;  4NE3 A;  3LZ1 C;  3UTB C;  5B31 D;  2JSS A;  3KUY B;  1EQZ A;  4NE5 A;  5AVB D;  1M19 B;  2F8N K;  1U35 B;  2RVQ D;  5KDM A;  4E45 A;  4XZQ A;  5GT0 B;  5B32 G;  5CP6 D;  4XUJ C;  2F8N D;  3AZF B;  3LJA C;  4YS3 D;  3VH5 W;  3MGR B;  3AZE B;  5BO0 B;  5CPJ A;  3AFA A;  3UTA A;  3AZL A;  4J8U D;  4KGC C;  5AV5 A;  3WKJ B;  3AV1 C;  1P3A A;  3W96 B;  1P3P B;  2L5A A;  5JRG A;  3C1B C;  5BNV A;  1M18 B;  4KUD B;  5B33 C;  1P3B A;  5AV6 B;  3REI C;  3KUY D;  1KX3 B;  2HIO C;  5CPI C;  3AV2 C;  5F99 C;  3X1U A;  1M19 D;  5B40 A;  3WAA C;  3WTP B;  1U35 D;  4Z66 C;  5GT0 D;  1P3K C;  1ID3 A;  3MGR D;  2FJ7 B;  5FUG A;  3AZE D;  2ARO A;  4LD9 A;  1ZLA A;  2PYO B;  4EO5 B;  1F1E A;  2NQB A;  1P3O B;  5AV9 C;  5JA4 B;  5B2J C;  3W96 D;  1P3L A;  1P3P D;  1P34 A;  3AYW B;  2HUE B;  1P3I A;  4KUD D;  1P3F C;  4J8W B;  1KX3 D;  3UT9 A;  4QLC D;  3NQU A;  3MGS A;  3WTP D;  3KWQ B;  3REH C;  4R8P B;  1N1J A;  4DRB A;  1KX4 B;  2FJ7 D;  3AZG A;  1KX5 B;  2YFW A;  2PYO D;  3TU4 A;  4X23 A;  4Z5T A;  4KHA A;  1P3O D;  3V9R A;  1BH9 A;  4WNN B;  3REL C;  3AYW D;  4YM6 B;  4J8X C;  4ZBJ C;  3W97 A;  3LEL D;  1P3M D;  4J8W D;  5DNM A;  4AWL C;  3W98 B;  3C1C B;  3AZK A;  1AOI B;  3KWQ D;  1P3G C;  1EQZ B;  3B0C W;  4R8P D;  2BYK A;  3KXB C;  5C3I B;  1KX4 D;  2NZD C;  3A6N A;  3W99 C;  4J8V A;  1KX5 D;  2BYM A;  5KDM B;  4XZQ B;  5GT3 C;  5B24 A;  5B0Y C;  5BT1 C;  5CPJ B;  5DNN C;  3AFA B;  3AZL B;  5B32 C;  4YM6 D;  5B31 C;  1F66 C;  5AVB C;  5AV5 B;  3MVD A;  3LZ0 A;  3B0D B;  3W98 D;  5E5A C;  3C1C D;  2RVQ C;  5JRG B;  3REK C;  1AOI D;  3AZN A;  1P3B B;  4NFT A;  4YS3 C;  1EQZ D;  1JFI B;  5AVC A;  3X1U B;  5B40 B;  3LJA A;  4J8U C;  4XZQ D;  1ID3 B;  5FUG B;  2ARO B;  5CPJ D;  3AFA D;  3AZL D;  3B6F A;  3KUY C;  5CP6 B;  3C1B A;  5AV5 D;  4CAY B;  1M19 C;  1P3A D;  4G92 B;  1P3L B;  1U35 C;  3MGP A;  5JRG D;  2HIO A;  1P3I B;  5GT0 C;  5F99 A;  1P3B D;  3AZF C;  3AZE C;  3AZM A;  3X1U D;  3MGS B;  1P3K A;  5B40 D;  2CV5 C;  3AN2 A;  1ID3 D;  3VH6 T;  3MGQ A;  3VH6 A;  4NE6 A;  3W96 C;  3WKJ C;  4H9Q B;  1S32 B;  1P3P C;  3AZG B;  2ARO D;  1TZY A;  1ZLA D;  1M18 C;  4X23 B;  5AV9 A;  4Z5T B;  5AV6 C;  1WWS A;  4KHA B;  1KX3 C;  3V9R B;  5B31 G;  1BH9 B;  3R45 A;  3REJ A;  1P3L D;  3WTP C;  1P34 D;  5B1L A;  1P3I D;  5GSU C;  5DNM B;  2F8N G;  2FJ7 C;  3MGS D;  3AZK B;  3X1S A;  2PYO C;  4EO5 C;  2CWE A;  1HQ3 A;  1P3O C;  1H3O A;  1S32 D;  3A6N B;  3AZG D;  4J8V B;  3AYW C;  2HUE C;  4QLC B;  3TU4 D;  4X23 D;  4Z5T D;  5BS7 C;  3B0C T;  4J8W C;  1HTA A;  5AV8 A;  1M1A A;  4UUZ A;  4J8X A;  3WA9 A;  3KWQ C;  3AZH A;  3W97 D;  4R8P C;  3MVD B;  5DNM D;  5CPK A;  1KX5 C;  2IO5 B;  4CSR A;  1BH8 A;  5B0Z A;  3AZK D;  3KXB A;  3AZN B;  5AVC B;  3LEL B;  4DRA A;  1P3M B;  3O62 A;  5GT3 A;  3A6N D;  4J8V D;  4YM6 C;  4WU8 A;  4H9R A;  3AZJ A;  5B24 D;  5B32 A;  3W98 C;  4ZUX A;  3C1C C;  3X1T A;  1R4V A;  3MNN A;  1AOI C;  5B1M B;  1F66 A;  3B6F B;  2YFV B;  4G91 B;  5GXQ A;  1EQZ C;  5E5A A;  3REK A;  3MVD D;  5C3I C;  3MGP B;  3AZN D;  4H9S A;  5AVC D;  3AZM B;  3B6G A;  5CPJ C;  3AFA C;  5B2I A;  3AZL C;  3LJA D;  3AN2 B;  3MGQ B;  5AV5 C;  5AY8 A;  4Z2M G;  1TZY B;  5JRG C;  5B1M D;  3B6F D;  1P3B C;  3C1B D;  3X1U C;  1TAF A;  3REJ B;  3R45 B;  1Q9C A;  5B40 C;  3MGP D;  5B1L B;  3AZF A;  2HIO D;  4JJN A;  5BO0 A;  5F99 D;  3UTA B;  1ID3 C;  4WU9 A;  2CV5 A;  2ARO C;  3AZM D;  3VH5 T;  4WU9 D;  3VH5 A;  3AZI A;  3X1S B;  3X1V A;  1P3K D;  1P3A B;  3WKJ A;  3LZ1 A;  1HQ3 B;  3UTB A;  3AN2 D;  5BNV B;  5CP6 C;  3MGQ D;  1H3O B;  1M18 A;  1P3L C;  4G92 C;  5AV6 A;  1TZY D;  4XUJ A;  1P3I C;  5AV8 B;  1M1A B;  3WA9 B;  3REJ D;  3MGS C;  5GSU A;  2LY8 A;  5B1L D;  4LD9 B;  3AZH B;  4KGC A;  3UTA D;  1ZLA B;  3AV1 A;  1S32 C;  5G49 A;  3AZG C;  5CPK B;  2NQB B;  4CSR B;  5B0Z B;  3X1S D;  4X23 C;  5B33 A;  1P34 B;  3REI A;  4Z5T C;  1HQ3 D;  5CPI A;  3AV2 A;  3O62 B;  3WAA A;  3MGR C;  4Z66 A;  4J8W A;  3UT9 B;  4WU8 B;  3NQU B;  4H9N A;  3AZJ B;  5AV8 D;  5DNM C;  1M1A D;  5B32 B;  4J8X D;  3WA9 D;  4ZUX B;  3X1T B;  1N1J B;  3MNN B;  4R8P A;  1F66 B;  1ULY A;  2YFW B;  5BNX A;  3AZH D;  4LD9 D;  5GXQ B;  3TU4 B;  4KUD C;  5B2J A;  5CPK D;  2NQB D;  4J8V C;  4QLC C;  5B0Z D;  3KXB D;  1P3F A;  4HGA B;  4WZS B;  1WWI A;  3W97 B;  3NQJ A;  3B6G B;  3O62 D;  5GT3 D;  5B2I B;  3UT9 D;  4WU8 D;  3REH A;  3AZJ D;  3MVD C;  5B32 D;  1A7W A;  2IO5 C;  2BYK B;  5AY8 B;  4ZUX D;  3X1T D;  3MNN D;  3AZN C;  1F66 D;  2BYM B;  5GXQ D;  5E5A D;  5AVC C;  3REK D;  3LEL C;  1P3M C;  1TAF B;  3REL A;  5B24 B;  2F8N H;  4H9O A;  4JJN B;  4WU9 B;  2CV5 B;  4H9P A;  3B6G D;  3WTP E;  5B1M C;  5B2I D;  3LZ0 B;  5CHL B;  3AZI B;  3X1V B;  1P3G A;  1KX4 C;  3B6F C;  3LZ1 B;  4G91 C;  3UTB B;  2NZD A;  3W99 A;  3MGP C;  5AY8 D;  4XUJ B;  1JFI A;  3LJA B;  5B0Y A;  3AZM C;  5DNN A;  5GSU B;  3AZF D;  3AN2 C;  5B31 A;  4KGC B;  4JJN D;  3MGQ C;  5AVB A;  3AV1 B; 
#chains in the Genus database with same CATH topology
 2CV5 D;  5G49 B;  4DQY B;  3C1B B;  1TZY C;  5CP6 A;  3AZI D;  3LZ0 D;  3X1V D;  2F8N A;  5B33 B;  4CAY A;  3REI B;  3LZ1 D;  3UTB D;  4YS3 A;  3WKJ D;  2HIO B;  5CPI B;  4XZQ C;  3AV2 B;  5F99 B;  3H0R C;  3REJ C;  1M18 D;  3WAA B;  5AV6 D;  4Z66 B;  5B1L C;  3VH6 W;  4J8U A;  4XUJ D;  4H9N B;  1P3K B;  3UTA C;  2DF4 C;  3X1S C;  5GSU D;  1P3A C;  3B0D C;  1B6W A;  5BNX B;  1HQ3 C;  4H9Q A;  3KUY A;  1S32 A;  4KGC D;  5AV9 B;  5B2J B;  1M19 A;  3AV1 D;  2XD5 A;  1U35 A;  5GT0 A;  1P3F B;  4E44 A;  5B33 D;  3REI D;  5AV8 C;  3MGR A;  5CPI D;  3AZE A;  3AV2 D;  1M1A C;  3WA9 C;  1BFM A;  2Y2Q A;  3NQJ B;  1Z2C B;  3WAA D;  4Z66 D;  4LD9 C;  3AZH C;  4Z2M H;  3REH B;  2BG1 A;  1ZLA C;  1KU5 A;  3W96 A;  1P3P A;  2F2A C;  5CPK C;  2NQB C;  4WV4 B;  5B0Z C;  4KUD A;  1P34 C;  1KX3 A;  4QLC A;  5AV9 D;  5B2J D;  3B0B A;  2ZY3 A;  2ZY4 A;  3FDD A;  3WTP A;  3O62 C;  3REL B;  4UUZ B;  4ZBJ B;  4H9O B;  4J8X B;  3UT9 C;  2Y2G A;  1B67 A;  4WU8 C;  1P3F D;  3AL0 C;  3AZJ C;  2FJ7 A;  4AWL B;  4ZUX C;  4H9P B;  3X1T C;  3KFU G;  3MNN C;  2PYO A;  2DQN C;  1P3G B;  2J8P A;  1BH8 B;  5GXQ C;  3REH D;  1P3O A;  3KXB B;  3TU4 C;  5JA4 A;  2NZD B;  3W99 B;  3AYW A;  3KSY A;  5GT3 B;  3LEL A;  1P3M A;  5BS7 A;  4HGA C;  4H9R B;  4H9S C;  5B0Y B;  3W97 C;  3B6G C;  5DNN B;  3REL D;  5B2I C;  3KWQ A;  1W2E A;  5B31 B;  3AZK C;  5AVB B;  5B1M A;  1KX4 A;  2YFV A;  5E5A B;  1KX5 A;  5AY8 C;  3REK B;  2F8N B;  3A6N C;  1P3G D;  4M6B A;  4YS3 B;  4WNN A;  2NZD D;  3W99 D;  5B24 C;  4YM6 A;  4J8U B;  4JJN C;  4WU9 C;  5B0Y D;  3W98 A;  3C1C A;  5BT1 D;  5DNN D;  1AOI A;  3AZI C;  3X1V C;  3LZ0 C;  4NE3 A;  3LZ1 C;  3UTB C;  5B31 D;  2JSS A;  3KUY B;  1EQZ A;  3P5J B;  4NE5 A;  5AVB D;  1M19 B;  2F8N K;  1U35 B;  2Y2H A;  2RVQ D;  5KDM A;  4E45 A;  4XZQ A;  5GT0 B;  5B32 G;  5CP6 D;  4XUJ C;  2F8N D;  3AZF B;  3EPH A;  3LJA C;  4YS3 D;  3VH5 W;  3MGR B;  3AZE B;  5BO0 B;  5CPJ A;  3AFA A;  3UTA A;  3AZL A;  2G5H C;  4J8U D;  4KGC C;  5AV5 A;  3WKJ B;  3AV1 C;  1P3A A;  3W96 B;  1P3P B;  2L5A A;  5JRG A;  3C1B C;  5BNV A;  1M18 B;  4KUD B;  2Y2P A;  5B33 C;  1P3B A;  5AV6 B;  3REI C;  3KUY D;  1KX3 B;  2HIO C;  5CPI C;  3AV2 C;  2Y2J A;  5F99 C;  3X1U A;  1M19 D;  5B40 A;  3WAA C;  3WTP B;  1U35 D;  4Z66 C;  5GT0 D;  1P3K C;  1ID3 A;  3MGR D;  2FJ7 B;  5FUG A;  3AZE D;  2ARO A;  4LD9 A;  1ZLA A;  2PYO B;  4EO5 B;  1F1E A;  2NQB A;  1P3O B;  5AV9 C;  5JA4 B;  5B2J C;  3W96 D;  1P3L A;  1P3P D;  1P34 A;  3AYW B;  2HUE B;  1P3I A;  4KUD D;  2Y2O A;  1P3F C;  4J8W B;  1KX3 D;  2G5I C;  3UT9 A;  4QLC D;  3NQU A;  3MGS A;  3WTP D;  3KWQ B;  1T3U A;  3REH C;  4R8P B;  1N1J A;  4DRB A;  1KX4 B;  2FJ7 D;  3AZG A;  1KX5 B;  2YFW A;  2PYO D;  3TU4 A;  2FFF B;  4X23 A;  4Z5T A;  2Y2N A;  4KHA A;  1P3O D;  3V9R A;  1BH9 A;  4WNN B;  3REL C;  3AYW D;  4YM6 B;  4J8X C;  4ZBJ C;  3W97 A;  3LEL D;  1P3M D;  4J8W D;  5DNM A;  2ZY5 A;  4AWL C;  3W98 B;  3C1C B;  3AZK A;  1AOI B;  3KWQ D;  1P3G C;  1EQZ B;  3B0C W;  4R8P D;  2BYK A;  3KXB C;  5C3I B;  1KX4 D;  2NZD C;  3A6N A;  3W99 C;  4J8V A;  1KX5 D;  2BYM A;  3H0M C;  5KDM B;  4XZQ B;  5GT3 C;  5B24 A;  5B0Y C;  5BT1 C;  5CPJ B;  5DNN C;  3AFA B;  3AZL B;  5B32 C;  4YM6 D;  5B31 C;  1F66 C;  5AVB C;  5AV5 B;  3MVD A;  3LZ0 A;  3H0L C;  3B0D B;  3W98 D;  3IP4 C;  5E5A C;  3C1C D;  2RVQ C;  5JRG B;  3REK C;  1AOI D;  3AZN A;  1P3B B;  4NFT A;  4YS3 C;  1EQZ D;  1JFI B;  5AVC A;  3X1U B;  5B40 B;  3LJA A;  4J8U C;  4XZQ D;  1ID3 B;  4WJ3 C;  5FUG B;  2ARO B;  2VQR A;  5CPJ D;  3AFA D;  3AZL D;  3B6F A;  3KUY C;  5CP6 B;  3C1B A;  5AV5 D;  4CAY B;  1M19 C;  1P3A D;  4G92 B;  1P3L B;  1U35 C;  3MGP A;  5JRG D;  2HIO A;  1P3I B;  5GT0 C;  5F99 A;  1P3B D;  3AZF C;  3AZE C;  3AZM A;  3X1U D;  3MGS B;  1P3K A;  5B40 D;  2CV5 C;  3AN2 A;  1ID3 D;  3VH6 T;  2JCH A;  3MGQ A;  3VH6 A;  4NE6 A;  3W96 C;  3WKJ C;  4H9Q B;  1S32 B;  1P3P C;  3AZG B;  2ARO D;  1TZY A;  1ZLA D;  1M18 C;  4X23 B;  5AV9 A;  4Z5T B;  5AV6 C;  1WWS A;  4KHA B;  1KX3 C;  3V9R B;  5B31 G;  1BH9 B;  3R45 A;  3REJ A;  1P3L D;  3WTP C;  1P34 D;  5B1L A;  1P3I D;  5GSU C;  5DNM B;  2F8N G;  2FJ7 C;  3MGS D;  3AZK B;  3X1S A;  2PYO C;  4EO5 C;  2CWE A;  1HQ3 A;  1P3O C;  1H3O A;  1S32 D;  3A6N B;  3AZG D;  4J8V B;  3AYW C;  2HUE C;  2Y2K A;  4QLC B;  3TU4 D;  4X23 D;  4Z5T D;  5BS7 C;  3B0C T;  4J8W C;  1HTA A;  5AV8 A;  1M1A A;  4UUZ A;  4J8X A;  3WA9 A;  3KWQ C;  3AZH A;  3W97 D;  4R8P C;  3MVD B;  5DNM D;  5CPK A;  4UPK A;  1KX5 C;  2IO5 B;  4CSR A;  1BH8 A;  5B0Z A;  3AZK D;  1PZR A;  2ZM5 A;  3KXB A;  3AZN B;  5AVC B;  3LEL B;  4DRA A;  1P3M B;  3O62 A;  5GT3 A;  3A6N D;  4J8V D;  4YM6 C;  4H9R A;  4WU8 A;  3AZJ A;  5B24 D;  5B32 A;  3W98 C;  2W8S A;  4ZUX A;  3C1C C;  1R4V A;  3MNN A;  3X1T A;  1AOI C;  5B1M B;  1F66 A;  3B6F B;  2YFV B;  4G91 B;  5GXQ A;  1EQZ C;  5E5A A;  3REK A;  3MVD D;  5C3I C;  2Y2M A;  3MGP B;  3AZN D;  4H9S A;  5AVC D;  3AZM B;  3B6G A;  5CPJ C;  3AFA C;  5B2I A;  3AZL C;  3LJA D;  3AN2 B;  3MGQ B;  5AV5 C;  5AY8 A;  4Z2M G;  1TZY B;  5JRG C;  5B1M D;  3B6F D;  1P3B C;  3C1B D;  3X1U C;  1TAF A;  3REJ B;  3R45 B;  1Q9C A;  5B40 C;  2UWX A;  3MGP D;  5B1L B;  3AZF A;  2HIO D;  4JJN A;  5BO0 A;  5F99 D;  3UTA B;  1ID3 C;  4WU9 A;  2ZY2 A;  2Y2I A;  2CV5 A;  2ARO C;  3AZM D;  3VH5 T;  4WU9 D;  3VH5 A;  3AZI A;  3X1S B;  3X1V A;  1P3K D;  1P3A B;  3WKJ A;  3LZ1 A;  1HQ3 B;  3UTB A;  3AN2 D;  5BNV B;  5CP6 C;  3MGQ D;  1H3O B;  1M18 A;  1P3L C;  4G92 C;  5AV6 A;  3EPL A;  1TZY D;  4XUJ A;  1P3I C;  5AV8 B;  1M1A B;  3WA9 B;  3REJ D;  3MGS C;  5GSU A;  2LY8 A;  5B1L D;  4LD9 B;  3AZH B;  4KGC A;  3UTA D;  1ZLA B;  2RIQ A;  3AV1 A;  1S32 C;  5G49 A;  3AZG C;  5CPK B;  2NQB B;  4CSR B;  5B0Z B;  3X1S D;  3A1K A;  4X23 C;  5B33 A;  1P34 B;  3REI A;  4Z5T C;  1HQ3 D;  5CPI A;  3AV2 A;  3O62 B;  3WAA A;  3MGR C;  4Z66 A;  4J8W A;  3F6T A;  3UT9 B;  4WU8 B;  3NQU B;  4H9N A;  3AZJ B;  5AV8 D;  5DNM C;  1M1A D;  5B32 B;  4J8X D;  3WA9 D;  4ZUX B;  3X1T B;  1N1J B;  3MNN B;  4R8P A;  1F66 B;  3A1I A;  1ULY A;  5BNX A;  2YFW B;  3AZH D;  4LD9 D;  5GXQ B;  3TU4 B;  4KUD C;  5B2J A;  5CPK D;  2NQB D;  4J8V C;  4QLC C;  5B0Z D;  3KXB D;  1P3F A;  4HGA B;  4WZS B;  1WWI A;  3W97 B;  3NQJ A;  3B6G B;  3O62 D;  5GT3 D;  5B2I B;  3UT9 D;  4WU8 D;  3REH A;  3AZJ D;  3MVD C;  5B32 D;  1A7W A;  2IO5 C;  2BYK B;  5AY8 B;  4ZUX D;  3X1T D;  3MNN D;  3AZN C;  1F66 D;  3EPK A;  2BYM B;  5GXQ D;  5E5A D;  5AVC C;  3REK D;  3LEL C;  1P3M C;  1TAF B;  3REL A;  5B24 B;  2F8N H;  4H9O A;  4JJN B;  4WU9 B;  2CV5 B;  3EG5 B;  4H9P A;  3B6G D;  3WTP E;  5B1M C;  5B2I D;  3LZ0 B;  5CHL B;  3AZI B;  3X1V B;  1P3G A;  1KX4 C;  3B6F C;  3LZ1 B;  4G91 C;  3UTB B;  2NZD A;  2Y2L A;  3W99 A;  3MGP C;  3EPJ A;  5AY8 D;  4XUJ B;  1JFI A;  3LJA B;  2XD1 A;  5B0Y A;  3AZM C;  2JE5 A;  5DNN A;  5GSU B;  3AZF D;  3AN2 C;  5B31 A;  4KGC B;  4JJN D;  3MGQ C;  5AVB A;  3AV1 B; 
#chains in the Genus database with same CATH homology
 2CV5 D;  5G49 B;  4DQY B;  3C1B B;  1TZY C;  5CP6 A;  3AZI D;  3LZ0 D;  3X1V D;  2F8N A;  5B33 B;  4CAY A;  3REI B;  3LZ1 D;  3UTB D;  4YS3 A;  3WKJ D;  2HIO B;  5CPI B;  4XZQ C;  3AV2 B;  5F99 B;  3H0R C;  3REJ C;  1M18 D;  3WAA B;  5AV6 D;  4Z66 B;  5B1L C;  3VH6 W;  4J8U A;  4XUJ D;  4H9N B;  1P3K B;  3UTA C;  2DF4 C;  3X1S C;  5GSU D;  1P3A C;  3B0D C;  1B6W A;  5BNX B;  1HQ3 C;  4H9Q A;  3KUY A;  1S32 A;  4KGC D;  5AV9 B;  5B2J B;  1M19 A;  3AV1 D;  2XD5 A;  1U35 A;  5GT0 A;  1P3F B;  4E44 A;  5B33 D;  3REI D;  5AV8 C;  3MGR A;  5CPI D;  3AZE A;  3AV2 D;  1M1A C;  3WA9 C;  1BFM A;  2Y2Q A;  3NQJ B;  1Z2C B;  3WAA D;  4Z66 D;  4LD9 C;  3AZH C;  4Z2M H;  3REH B;  2BG1 A;  1ZLA C;  1KU5 A;  3W96 A;  1P3P A;  2F2A C;  5CPK C;  2NQB C;  4WV4 B;  5B0Z C;  4KUD A;  1P34 C;  1KX3 A;  4QLC A;  5AV9 D;  5B2J D;  3B0B A;  2ZY3 A;  2ZY4 A;  3FDD A;  3WTP A;  3O62 C;  3REL B;  4UUZ B;  4ZBJ B;  4H9O B;  4J8X B;  3UT9 C;  2Y2G A;  1B67 A;  4WU8 C;  1P3F D;  3AL0 C;  3AZJ C;  2FJ7 A;  4AWL B;  4ZUX C;  4H9P B;  3X1T C;  3KFU G;  3MNN C;  2PYO A;  2DQN C;  1P3G B;  2J8P A;  1BH8 B;  5GXQ C;  3REH D;  1P3O A;  3KXB B;  3TU4 C;  5JA4 A;  2NZD B;  3W99 B;  3AYW A;  3KSY A;  5GT3 B;  3LEL A;  1P3M A;  5BS7 A;  4HGA C;  4H9R B;  4H9S C;  5B0Y B;  3W97 C;  3B6G C;  5DNN B;  3REL D;  5B2I C;  3KWQ A;  1W2E A;  5B31 B;  3AZK C;  5AVB B;  5B1M A;  1KX4 A;  2YFV A;  5E5A B;  1KX5 A;  5AY8 C;  3REK B;  2F8N B;  3A6N C;  1P3G D;  4M6B A;  4YS3 B;  4WNN A;  2NZD D;  3W99 D;  5B24 C;  4YM6 A;  4J8U B;  4JJN C;  4WU9 C;  5B0Y D;  3W98 A;  3C1C A;  5BT1 D;  5DNN D;  1AOI A;  3AZI C;  3X1V C;  3LZ0 C;  4NE3 A;  3LZ1 C;  3UTB C;  5B31 D;  2JSS A;  3KUY B;  1EQZ A;  3P5J B;  4NE5 A;  5AVB D;  1M19 B;  2F8N K;  1U35 B;  2Y2H A;  2RVQ D;  5KDM A;  4E45 A;  4XZQ A;  5GT0 B;  5B32 G;  5CP6 D;  4XUJ C;  2F8N D;  3AZF B;  3EPH A;  3LJA C;  4YS3 D;  3VH5 W;  3MGR B;  3AZE B;  5BO0 B;  5CPJ A;  3AFA A;  3UTA A;  3AZL A;  2G5H C;  4J8U D;  4KGC C;  5AV5 A;  3WKJ B;  3AV1 C;  1P3A A;  3W96 B;  1P3P B;  2L5A A;  5JRG A;  3C1B C;  5BNV A;  1M18 B;  4KUD B;  2Y2P A;  5B33 C;  1P3B A;  5AV6 B;  3REI C;  3KUY D;  1KX3 B;  2HIO C;  5CPI C;  3AV2 C;  2Y2J A;  5F99 C;  3X1U A;  1M19 D;  5B40 A;  3WAA C;  3WTP B;  1U35 D;  4Z66 C;  5GT0 D;  1P3K C;  1ID3 A;  3MGR D;  2FJ7 B;  5FUG A;  3AZE D;  2ARO A;  4LD9 A;  1ZLA A;  2PYO B;  4EO5 B;  1F1E A;  2NQB A;  1P3O B;  5AV9 C;  5JA4 B;  5B2J C;  3W96 D;  1P3L A;  1P3P D;  1P34 A;  3AYW B;  2HUE B;  1P3I A;  4KUD D;  2Y2O A;  1P3F C;  4J8W B;  1KX3 D;  2G5I C;  3UT9 A;  4QLC D;  3NQU A;  3MGS A;  3WTP D;  3KWQ B;  1T3U A;  3REH C;  4R8P B;  1N1J A;  4DRB A;  1KX4 B;  2FJ7 D;  3AZG A;  1KX5 B;  2YFW A;  2PYO D;  3TU4 A;  2FFF B;  4X23 A;  4Z5T A;  2Y2N A;  4KHA A;  1P3O D;  3V9R A;  1BH9 A;  4WNN B;  3REL C;  3AYW D;  4YM6 B;  4J8X C;  4ZBJ C;  3W97 A;  3LEL D;  1P3M D;  4J8W D;  5DNM A;  2ZY5 A;  4AWL C;  3W98 B;  3C1C B;  3AZK A;  1AOI B;  3KWQ D;  1P3G C;  1EQZ B;  3B0C W;  4R8P D;  2BYK A;  3KXB C;  5C3I B;  1KX4 D;  2NZD C;  3A6N A;  3W99 C;  4J8V A;  1KX5 D;  2BYM A;  3H0M C;  5KDM B;  4XZQ B;  5GT3 C;  5B24 A;  5B0Y C;  5BT1 C;  5CPJ B;  5DNN C;  3AFA B;  3AZL B;  5B32 C;  4YM6 D;  5B31 C;  1F66 C;  5AVB C;  5AV5 B;  3MVD A;  3LZ0 A;  3H0L C;  3B0D B;  3W98 D;  3IP4 C;  5E5A C;  3C1C D;  2RVQ C;  5JRG B;  3REK C;  1AOI D;  3AZN A;  1P3B B;  4NFT A;  4YS3 C;  1EQZ D;  1JFI B;  5AVC A;  3X1U B;  5B40 B;  3LJA A;  4J8U C;  4XZQ D;  1ID3 B;  4WJ3 C;  5FUG B;  2ARO B;  2VQR A;  5CPJ D;  3AFA D;  3AZL D;  3B6F A;  3KUY C;  5CP6 B;  3C1B A;  5AV5 D;  4CAY B;  1M19 C;  1P3A D;  4G92 B;  1P3L B;  1U35 C;  3MGP A;  5JRG D;  2HIO A;  1P3I B;  5GT0 C;  5F99 A;  1P3B D;  3AZF C;  3AZE C;  3AZM A;  3X1U D;  3MGS B;  1P3K A;  5B40 D;  2CV5 C;  3AN2 A;  1ID3 D;  3VH6 T;  2JCH A;  3MGQ A;  3VH6 A;  4NE6 A;  3W96 C;  3WKJ C;  4H9Q B;  1S32 B;  1P3P C;  3AZG B;  2ARO D;  1TZY A;  1ZLA D;  1M18 C;  4X23 B;  5AV9 A;  4Z5T B;  5AV6 C;  1WWS A;  4KHA B;  1KX3 C;  3V9R B;  5B31 G;  1BH9 B;  3R45 A;  3REJ A;  1P3L D;  3WTP C;  1P34 D;  5B1L A;  1P3I D;  5GSU C;  5DNM B;  2F8N G;  2FJ7 C;  3MGS D;  3AZK B;  3X1S A;  2PYO C;  4EO5 C;  2CWE A;  1HQ3 A;  1P3O C;  1H3O A;  1S32 D;  3A6N B;  3AZG D;  4J8V B;  3AYW C;  2HUE C;  2Y2K A;  4QLC B;  3TU4 D;  4X23 D;  4Z5T D;  5BS7 C;  3B0C T;  4J8W C;  1HTA A;  5AV8 A;  1M1A A;  4UUZ A;  4J8X A;  3WA9 A;  3KWQ C;  3AZH A;  3W97 D;  4R8P C;  3MVD B;  5DNM D;  5CPK A;  4UPK A;  1KX5 C;  2IO5 B;  4CSR A;  1BH8 A;  5B0Z A;  3AZK D;  1PZR A;  2ZM5 A;  3KXB A;  3AZN B;  5AVC B;  3LEL B;  4DRA A;  1P3M B;  3O62 A;  5GT3 A;  3A6N D;  4J8V D;  4YM6 C;  4H9R A;  4WU8 A;  3AZJ A;  5B24 D;  5B32 A;  3W98 C;  2W8S A;  4ZUX A;  3C1C C;  1R4V A;  3MNN A;  3X1T A;  1AOI C;  5B1M B;  1F66 A;  3B6F B;  2YFV B;  4G91 B;  5GXQ A;  1EQZ C;  5E5A A;  3REK A;  3MVD D;  5C3I C;  2Y2M A;  3MGP B;  3AZN D;  4H9S A;  5AVC D;  3AZM B;  3B6G A;  5CPJ C;  3AFA C;  5B2I A;  3AZL C;  3LJA D;  3AN2 B;  3MGQ B;  5AV5 C;  5AY8 A;  4Z2M G;  1TZY B;  5JRG C;  5B1M D;  3B6F D;  1P3B C;  3C1B D;  3X1U C;  1TAF A;  3REJ B;  3R45 B;  1Q9C A;  5B40 C;  2UWX A;  3MGP D;  5B1L B;  3AZF A;  2HIO D;  4JJN A;  5BO0 A;  5F99 D;  3UTA B;  1ID3 C;  4WU9 A;  2ZY2 A;  2Y2I A;  2CV5 A;  2ARO C;  3AZM D;  3VH5 T;  4WU9 D;  3VH5 A;  3AZI A;  3X1S B;  3X1V A;  1P3K D;  1P3A B;  3WKJ A;  3LZ1 A;  1HQ3 B;  3UTB A;  3AN2 D;  5BNV B;  5CP6 C;  3MGQ D;  1H3O B;  1M18 A;  1P3L C;  4G92 C;  5AV6 A;  3EPL A;  1TZY D;  4XUJ A;  1P3I C;  5AV8 B;  1M1A B;  3WA9 B;  3REJ D;  3MGS C;  5GSU A;  2LY8 A;  5B1L D;  4LD9 B;  3AZH B;  4KGC A;  3UTA D;  1ZLA B;  2RIQ A;  3AV1 A;  1S32 C;  5G49 A;  3AZG C;  5CPK B;  2NQB B;  4CSR B;  5B0Z B;  3X1S D;  3A1K A;  4X23 C;  5B33 A;  1P34 B;  3REI A;  4Z5T C;  1HQ3 D;  5CPI A;  3AV2 A;  3O62 B;  3WAA A;  3MGR C;  4Z66 A;  4J8W A;  3F6T A;  3UT9 B;  4WU8 B;  3NQU B;  4H9N A;  3AZJ B;  5AV8 D;  5DNM C;  1M1A D;  5B32 B;  4J8X D;  3WA9 D;  4ZUX B;  3X1T B;  1N1J B;  3MNN B;  4R8P A;  1F66 B;  3A1I A;  1ULY A;  5BNX A;  2YFW B;  3AZH D;  4LD9 D;  5GXQ B;  3TU4 B;  4KUD C;  5B2J A;  5CPK D;  2NQB D;  4J8V C;  4QLC C;  5B0Z D;  3KXB D;  1P3F A;  4HGA B;  4WZS B;  1WWI A;  3W97 B;  3NQJ A;  3B6G B;  3O62 D;  5GT3 D;  5B2I B;  3UT9 D;  4WU8 D;  3REH A;  3AZJ D;  3MVD C;  5B32 D;  1A7W A;  2IO5 C;  2BYK B;  5AY8 B;  4ZUX D;  3X1T D;  3MNN D;  3AZN C;  1F66 D;  3EPK A;  2BYM B;  5GXQ D;  5E5A D;  5AVC C;  3REK D;  3LEL C;  1P3M C;  1TAF B;  3REL A;  5B24 B;  2F8N H;  4H9O A;  4JJN B;  4WU9 B;  2CV5 B;  3EG5 B;  4H9P A;  3B6G D;  3WTP E;  5B1M C;  5B2I D;  3LZ0 B;  5CHL B;  3AZI B;  3X1V B;  1P3G A;  1KX4 C;  3B6F C;  3LZ1 B;  4G91 C;  3UTB B;  2NZD A;  2Y2L A;  3W99 A;  3MGP C;  3EPJ A;  5AY8 D;  4XUJ B;  1JFI A;  3LJA B;  2XD1 A;  5B0Y A;  3AZM C;  2JE5 A;  5DNN A;  5GSU B;  3AZF D;  3AN2 C;  5B31 A;  4KGC B;  4JJN D;  3MGQ C;  5AVB A;  3AV1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...