5CP6A

Nucleosome core particle with adducts from the anticancer compound, [(eta6-5,8,9,10-tetrahydroanthracene)ru(ethylenediamine)cl][pf6]
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
96
structure length
96
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (145-MER)
publication title An Organometallic Compound which Exhibits a DNA Topology-Dependent One-Stranded Intercalation Mode.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 30
structure length 96
sequence length 96
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cp6A00
2RVQC 4ZUXB 1KX4D 2NQBA 4H9RB 5CPKC 3AZND 1P3MC 5B31A 4KGCC 3WKJA 3MGRC 2F8ND 5B2JD 1EQZC 3AFAA 3REID 3X1VC 3AZMD 4X23B 1A7WA 3KXBA 1KX4C 5JRGB 3A6ND 3AZNC 1P34A 5B2IA 1B67A 3AZGD 3AV2D 4YM6D 4J8WB 2FJ7B 3WA9D 5B2JC 3VH6A 2F8NG 1H3OA 3REIC 4ZBJC 3AZMC 2NZDB 3MGRA 3A6NC 1N1JA 3AYWD 3RELB 3AV2C 5GT0B 4YS3D 1KX4A 4YM6C 1F66B 5B1LB 4XUJB 3WA9C 3AZID 1ID3B 3LELB 1P3GB 1KX3D 3AZED 2AROA 5B32D 2F8NA 5B2JA 3AYWC 1HQ3D 2PYOA 3REIA 3AZMA 4YS3C 3O62D 3A6NA 3W99B 5B0ZB 1P3PB 3AZIC 3X1UA 4H9QB 3AZGA 3AV2A 1KX3C 4KUDD 4YM6A 3AZEC 4Z5TB 2IO5B 1S32B 1AOIA 3WA9A 5B32C 4WU9B 1HQ3C 5B32G 4LD9D 5CP6B 5FUGB 1ZLAB 3O62C 4XZQD 2LY8A 3UTBD 1P3KD 1KX5D 4G92B 4YS3A 4KUDC 4NE3A 5DNMD 3VH5W 3REJB 4JJNB 3AZIA 5CPJB 4LD9C 3MGPD 1KX3A 3W97D 1ULYA 3WAAB 4XZQC 5AV9D 5GXQA 5B32A 3UTBC 1P3KC 3WTPD 1HQ3A 4Z2MH 2F8NK 4J8UB 3REHC 1KX5C 1P3BD 5B33D 3O62A 5AV5D 3AZFB 1P3FB 5DNMC 5F99D 4QLCD 3MGPC 4KUDA 3R45B 3V9RA 1P3ID 1M1AB 3W97C 5AV9C 1B6WA 5G49B 3WTPC 4LD9A 2BYKA 3B6FD 3MGSB 1P3BC 5B33C 4XZQA 5AV5C 5DNNB 3KSYA 5AV8D 3UTBA 5F99C 5C3IB 5AY8B 4QLCC 3KWQD 3X1TB 3VH6T 1P3IC 1P3OD 3MGQD 5DNMA 1P3LD 4J8XB 3TU4A 5AVCD 3KUYD 3AN2D 3B6FC 3W97A 2NQBB 4G91C 5CHLB 5AV9A 5B31B 5AV8C 5B0YD 3WTPA 3KWQC 3MVDD 3UT9A 1P3BA 5B33A 3WKJB 5CPIB 1P3OC 5AV5A 3MGQC 3B6GD 3AFAB 1P3LC 1EQZD 5GT3D 4QLCA 3X1VD 3B0DC 5AVCC 3KUYC 3AN2C 3AV1B 1P3IA 1JFIA 4H9NA 1P3AB 1P34B 4J8VB 4KHAA 5B0YC 4CSRA 4AWLB 3B6FA 3MVDC 1KU5A 5AVBD 5AV8A 3B6GC 5BT1D 1H3OB 5GT3C 2HUEC 3KWQA 3MGRB 1P3OA 3MGQA 1N1JB 5JRGD 1BH9B 1KX4B 5AVCA 3KUYA 3AN2A 1M19B 1TZYD 4J8WD 5CPKA 5AVBC 2YFWB 1P3MA 5B0YA 5BT1C 4KGCA 3AZLB 2JSSA 4UUZA 3MVDA 5AV6B 2AROB 1M18D 2NZDD 1Q9CA 3MNNB 2F8NB 5B2JB 3W96D 5JRGC 3B6GA 4NE5A 1EQZA 3UTAD 5JA4B 2PYOB 4ZBJB 3AZMB 3X1VA 4H9SC 3RELD 4HGAC 1TZYC 4J8WC 3AZNA 1BFMA 2L5AA 4WU8B 3X1UB 3B0BA 4Z66D 3AZGB 3AV2B 4YM6B 3LELD 1AOIB 2NZDC 3WTPE 1M18C 3W96C 5AVBA 3UTAC 5B40B 3RELC 5BS7C 1F66C 5JRGA 5B1LC 4XUJC 3W99D 3AZJB 4H9SA 5KDMA 5B0ZD 4Z66C 4YS3B 3X1SB 3LELC 1TZYA 3C1CD 2F8NH 2HIOD 3NQJA 1TAFA 1S32D 3AZIB 4EO5B 1KX3B 3LZ1D 5CP6D 1BH8B 4NFTA 1M18A 4CAYB 5GXQB 3W96A 5B32B 2NZDA 1HQ3B 3AYWA 3UTAA 3W98B 3REHD 3W99C 5B0ZC 3O62B 5BS7A 3C1CC 2IO5C 2CV5D 2HIOC 1S32C 4Z66A 3REJD 4KUDB 4JJND 3LELA 3AZEA 3LZ1C 2BYMA 5CP6C 3NQUB 3C1BD 4LD9B 2BYKB 2YFVA 4DRAA 4XZQB 4G92C 3LJAB 5B24B 2CV5C 3AZFD 3W99A 5B0ZA 5E5AD 3REKD 3REJC 4JJNC 4WNNA 3C1CA 4H9PA 5DNMB 2HIOA 3C1BC 3TU4B 5BNVA 3W97B 3LZ1A 5CP6A 3MGSD 5AV9B 3WTPB 3AZFC 5B1MD 1P3KA 1U35B 3REHA 3UT9B 1KX5A 5E5AC 3REKC 5BO0B 3X1TD 3LZ0D 2CV5A 3AZKD 4E44A 5GSUD 3MGPA 4JJNA 1P3IB 1JFIB 4H9NB 3MGSC 4DRBA 3VH6W 3C1BA 4KHAB 4CSRB 5B1MC 3AZHD 3B6FB 5C3IC 4G91B 3X1TC 3LZ0C 5CPID 5AV8B 3AZKC 3AZFA 5F99A 3KWQB 4R8PD 5E5AA 3REKA 5GSUC 3KXBB 1P3OB 3MGQB 4ZUXD 3AV1D 1P3AD 5B2IB 3AZHC 5AVCB 3KUYB 4J8VD 3AN2B 3VH5A 5CPKB 3MGSA 3WKJC 5CPIC 1P3MB 4KGCB 5B1MA 3AFAC 3MVDB 4R8PC 3X1TA 3LZ0A 4X23D 4ZUXC 3AV1C 3B6GB 3AZKA 1EQZB 1P3AC 2HUEB 1P3LA 5BNXA 3X1VB 5GSUA 4J8VC 1F1EA 4AWLC 3AZNB 1M19D 2FJ7D 4H9OA 3AZHA 3AZLD 5AVBB 5AV6D 4X23C 2AROD 5CPIA 3MNND 3REIB 5GT3A 2PYOD 4R8PA 4ZUXA 5GT0D 3A6NB 3AV1A 1M19C 1F66D 4WV4B 4E45A 5B1LD 4H9RA 1P3AA 2FJ7C 4XUJD 5KDMB 4WU8D 4J8VA 3X1UD 4HGAB 3AZLC 1ID3D 1TZYB 1P3GD 3NQJB 5AV6C 1TAFB 2AROC 1AOID 3WA9B 3MNNC 2PYOC 5B40D 1R4VA 1M18B 3W96B 4X23A 5GT0C 3AYWB 3UTAB 4WU8C 3AZJD 3X1UC 1P3PD 1BH9A 3B0CT 3AZGC 1ID3C 3X1SD 1P3GC 4J8WA 4Z5TD 1HTAA 1M19A 1AOIC 2FJ7A 4Z66B 2YFWA 4WU9D 3AZEB 3AZLA 2BYMB 5B40C 3B0CW 5AV6A 1ZLAD 5GXQD 3MNNA 2YFVB 5JA4A 3W98D 3RELA 3AZJC 1P3PC 4Z2MG 3X1SC 5GT0A 4Z5TC 1F66A 5B1LA 4XUJA 4WU8A 4WU9C 4EO5C 3V9RB 5CPJD 1ID3A 4WNNB 1P3GA 3C1CB 4H9PB 2HIOB 1ZLAC 3WAAD 4M6BA 5GXQC 5BNVB 1WWIA 3LZ1B 3W98C 4J8UD 5B40A 3UTBB 3VH5T 3LJAD 5B24D 1P3KB 1P3FD 3REHB 1KX5B 3AZJA 1P3PA 5CPJC 4H9QA 3X1SA 2CV5B 4Z5TA 1M1AD 1WWSA 3WAAC 1S32A 3TU4D 3MGPB 4WU9A 4J8UC 3C1BB 2CWEA 1BH8A 5FUGA 1ZLAA 4CAYA 3LJAC 5DNND 5B24C 1P3FC 1U35D 1P3BB 3W98A 5B33B 3UT9D 5AY8D 5AV5B 4WZSB 1M1AC 5F99B 4QLCB 5E5AB 3REKB 4J8XD 3TU4C 3REJA 5CPJA 2NQBD 3NQUA 3WAAA 5DNNC 5B31D 1U35C 4J8UA 3UT9C 5AY8C 3WKJD 5B1MB 3LJAA 5B24A 1P3FA 4NE6A 3AFAD 4J8XC 3LZ0B 3KXBD 3R45A 3AZKB 1M1AA 2NQBC 1P3LB 5BNXB 1P34D 3B0DB 5GSUB 5B31C 5B2ID 5G49A 5B31G 2RVQD 5CPKD 4H9OB 5DNNA 5B0YB 3AZHB 1P3MD 4UUZB 4KGCD 1U35A 5AY8A 5BO0A 3KXBC 3MGRD 5GT3B 4R8PB 1P34C 5B2IC 4J8XA
chains in the Genus database with same CATH superfamily
2RVQC 4ZUXB 1KX4D 2NQBA 4H9RB 5CPKC 3AZND 1P3MC 5B31A 4KGCC 3WKJA 3MGRC 2F8ND 5B2JD 1EQZC 3AFAA 3REID 3X1VC 3AZMD 4X23B 1A7WA 3KXBA 1KX4C 2W8SA 5JRGB 3A6ND 3AZNC 1P34A 5B2IA 1B67A 3AZGD 3AV2D 4YM6D 4J8WB 2ZY3A 3H0LC 3EPLA 2FJ7B 3WA9D 5B2JC 3VH6A 2F8NG 1H3OA 3REIC 4ZBJC 3AZMC 2NZDB 3MGRA 2UWXA 3A6NC 1N1JA 3AYWD 2Y2QA 3RELB 3AV2C 5GT0B 4YS3D 1KX4A 4YM6C 1F66B 5B1LB 4XUJB 3WA9C 3AZID 1ID3B 3LELB 1P3GB 1KX3D 3AZED 2AROA 5B32D 2F8NA 5B2JA 2VQRA 3AYWC 1HQ3D 2PYOA 3REIA 3AZMA 4YS3C 3O62D 3A6NA 3W99B 5B0ZB 1P3PB 3AZIC 3X1UA 4H9QB 3AZGA 3AV2A 1KX3C 4KUDD 4YM6A 3AZEC 4Z5TB 2IO5B 1S32B 1AOIA 3WA9A 5B32C 4WU9B 1HQ3C 5B32G 4LD9D 5CP6B 5FUGB 1ZLAB 3O62C 4XZQD 2LY8A 3UTBD 1P3KD 3EPJA 1KX5D 4G92B 4YS3A 4KUDC 4NE3A 5DNMD 3VH5W 3REJB 4JJNB 3AZIA 5CPJB 4LD9C 3MGPD 1KX3A 3W97D 1ULYA 3WAAB 4XZQC 5AV9D 5GXQA 5B32A 3UTBC 1P3KC 3WTPD 1HQ3A 4Z2MH 2F8NK 4J8UB 3REHC 1KX5C 1P3BD 5B33D 3O62A 4DQYB 5AV5D 3AZFB 1P3FB 5DNMC 5F99D 4QLCD 3MGPC 4KUDA 3R45B 3V9RA 1P3ID 1M1AB 3W97C 5AV9C 1B6WA 5G49B 3WTPC 4LD9A 2BYKA 3B6FD 3MGSB 1P3BC 5B33C 4XZQA 5AV5C 5DNNB 3KSYA 5AV8D 3UTBA 5F99C 5C3IB 5AY8B 4QLCC 3KWQD 3X1TB 3VH6T 1P3IC 1P3OD 3MGQD 5DNMA 1P3LD 4J8XB 2FFFB 3TU4A 5AVCD 3KUYD 3EG5B 3AN2D 3W97A 3B6FC 2NQBB 4G91C 5CHLB 5AV9A 5B31B 2Y2PA 5AV8C 5B0YD 3WTPA 4UPKA 2DF4C 3KWQC 3MVDD 3UT9A 1P3BA 5B33A 3WKJB 5CPIB 1P3OC 5AV5A 3MGQC 3B6GD 3AFAB 1P3LC 1EQZD 5GT3D 4QLCA 3X1VD 3B0DC 5AVCC 3KUYC 3AN2C 3AV1B 1P3IA 1JFIA 4H9NA 1P3AB 1P34B 2ZY4A 4J8VB 4KHAA 5B0YC 4CSRA 4AWLB 3B6FA 3MVDC 1KU5A 5AVBD 5AV8A 3B6GC 5BT1D 1H3OB 3H0MC 2HUEC 5GT3C 3KWQA 3MGRB 1P3OA 3MGQA 1N1JB 5JRGD 1BH9B 1KX4B 2Y2GA 5AVCA 3KUYA 3AN2A 1M19B 1TZYD 4J8WD 5CPKA 5AVBC 2YFWB 1P3MA 5B0YA 5BT1C 4KGCA 3AZLB 2JSSA 4UUZA 3MVDA 2J8PA 5AV6B 2AROB 1M18D 2NZDD 1Q9CA 3MNNB 2F8NB 5B2JB 3W96D 5JRGC 3B6GA 4NE5A 1EQZA 2Y2HA 5JA4B 3UTAD 2PYOB 4ZBJB 3AZMB 3X1VA 4H9SC 3RELD 4HGAC 1TZYC 4J8WC 3AZNA 1BFMA 2L5AA 4WU8B 3X1UB 3B0BA 4Z66D 3AZGB 3AV2B 4YM6B 3LELD 3H0RC 1AOIB 2NZDC 3WTPE 1M18C 3W96C 5AVBA 3UTAC 5B40B 3RELC 5BS7C 1F66C 5JRGA 5B1LC 4XUJC 3W99D 3AZJB 4H9SA 5KDMA 5B0ZD 4Z66C 4YS3B 3X1SB 2Y2LA 3LELC 2Y2IA 1TZYA 3C1CD 2F8NH 2HIOD 3NQJA 1TAFA 1S32D 3AZIB 4EO5B 1KX3B 3LZ1D 5CP6D 1BH8B 4NFTA 1M18A 4CAYB 5GXQB 3W96A 5B32B 2NZDA 1HQ3B 3AYWA 3UTAA 3W98B 3REHD 3W99C 5B0ZC 3O62B 5BS7A 3C1CC 2IO5C 2CV5D 2HIOC 1S32C 4Z66A 3REJD 4KUDB 4JJND 2DQNC 3LELA 3AZEA 3LZ1C 2BYMA 5CP6C 3A1KA 3NQUB 3C1BD 4LD9B 2BYKB 2Y2NA 2YFVA 4DRAA 4XZQB 4G92C 3LJAB 5B24B 2CV5C 3AZFD 3W99A 5B0ZA 2G5HC 5E5AD 3REJC 3F6TA 3REKD 4JJNC 4WNNA 3C1CA 4H9PA 5DNMB 3EPHA 2HIOA 3C1BC 3TU4B 2Y2OA 5BNVA 3W97B 1T3UA 5CP6A 3LZ1A 3MGSD 5AV9B 3WTPB 3AZFC 5B1MD 1P3KA 1U35B 3REHA 3UT9B 1KX5A 5E5AC 3REKC 5BO0B 3X1TD 3IP4C 3LZ0D 2CV5A 3AZKD 4E44A 5GSUD 1PZRA 3MGPA 4JJNA 1P3IB 1JFIB 4H9NB 3MGSC 4DRBA 3VH6W 3C1BA 4KHAB 4CSRB 5B1MC 3AZHD 3B6FB 5C3IC 4G91B 3X1TC 3LZ0C 5CPID 5AV8B 3AZKC 3AZFA 5F99A 3KWQB 4R8PD 5E5AA 3REKA 5GSUC 3KXBB 1P3OB 3MGQB 4ZUXD 3AV1D 1P3AD 5B2IB 2XD5A 3AZHC 5AVCB 3KUYB 4J8VD 3AN2B 3VH5A 5CPKB 2G5IC 3MGSA 3WKJC 5CPIC 1P3MB 2Y2KA 4KGCB 5B1MA 3AFAC 3MVDB 4R8PC 3X1TA 3LZ0A 4X23D 4ZUXC 3AV1C 3B6GB 3AZKA 1EQZB 1P3AC 2HUEB 1P3LA 5BNXA 3X1VB 5GSUA 4J8VC 1F1EA 4AWLC 3AZNB 1M19D 3FDDA 3A1IA 2FJ7D 4H9OA 3AZHA 3AZLD 5AVBB 5AV6D 4X23C 2AROD 5CPIA 3MNND 3REIB 5GT3A 3KFUG 2PYOD 4R8PA 4ZUXA 5GT0D 3A6NB 3AV1A 1M19C 1F66D 4WV4B 4E45A 5B1LD 4H9RA 1P3AA 2FJ7C 4XUJD 5KDMB 4WU8D 4J8VA 3X1UD 4HGAB 3AZLC 1ID3D 1TZYB 1P3GD 3NQJB 5AV6C 1TAFB 2AROC 1AOID 3WA9B 3MNNC 1W2EA 2PYOC 5B40D 1R4VA 1M18B 3W96B 4WJ3C 4X23A 5GT0C 3AYWB 3UTAB 2F2AC 4WU8C 3AZJD 3X1UC 1P3PD 1BH9A 3B0CT 3AZGC 2ZY5A 1ID3C 3X1SD 1P3GC 4J8WA 4Z5TD 1HTAA 1M19A 1AOIC 2FJ7A 4Z66B 2YFWA 4WU9D 3AZEB 3AZLA 2BYMB 5B40C 3B0CW 5AV6A 1ZLAD 5GXQD 3MNNA 2YFVB 5JA4A 3W98D 3RELA 3AZJC 1P3PC 4Z2MG 3X1SC 5GT0A 4Z5TC 1F66A 5B1LA 4XUJA 4WU8A 4WU9C 4EO5C 3V9RB 5CPJD 1ID3A 4WNNB 1P3GA 3C1CB 4H9PB 2HIOB 1ZLAC 3WAAD 4M6BA 5GXQC 5BNVB 3AL0C 1WWIA 3LZ1B 3W98C 4J8UD 5B40A 2JCHA 2JE5A 3UTBB 3VH5T 3LJAD 5B24D 1P3KB 1P3FD 3REHB 2Y2JA 1KX5B 3AZJA 1P3PA 1Z2CB 5CPJC 4H9QA 3X1SA 2CV5B 4Z5TA 1M1AD 1WWSA 3WAAC 1S32A 3TU4D 3MGPB 4WU9A 2Y2MA 4J8UC 3C1BB 2CWEA 1BH8A 2RIQA 5FUGA 4CAYA 1ZLAA 3LJAC 5DNND 5B24C 1P3FC 1U35D 2BG1A 1P3BB 2XD1A 3W98A 5B33B 3UT9D 5AY8D 5AV5B 4WZSB 1M1AC 5F99B 4QLCB 5E5AB 3REKB 4J8XD 3TU4C 3REJA 5CPJA 2NQBD 3NQUA 3WAAA 5DNNC 5B31D 1U35C 2ZY2A 4J8UA 3UT9C 5AY8C 3WKJD 5B1MB 3LJAA 5B24A 1P3FA 4NE6A 3AFAD 4J8XC 3LZ0B 3KXBD 3P5JB 3EPKA 3R45A 3AZKB 1M1AA 2NQBC 1P3LB 5BNXB 1P34D 3B0DB 5GSUB 5B31C 5B2ID 5G49A 5B31G 2RVQD 5CPKD 2ZM5A 4H9OB 5DNNA 5B0YB 3AZHB 1P3MD 4UUZB 4KGCD 1U35A 5AY8A 5BO0A 3KXBC 3MGRD 5GT3B 4R8PB 1P34C 5B2IC 4J8XA
chains in the Genus database with same CATH topology
2RVQC 4ZUXB 1KX4D 2NQBA 4H9RB 5CPKC 3AZND 1P3MC 5B31A 4KGCC 3WKJA 3MGRC 2F8ND 5B2JD 1EQZC 3AFAA 3REID 3X1VC 3AZMD 4X23B 1A7WA 3KXBA 1KX4C 2W8SA 5JRGB 3A6ND 3AZNC 1P34A 5B2IA 1B67A 3AZGD 3AV2D 4YM6D 4J8WB 2ZY3A 3H0LC 3EPLA 2FJ7B 3WA9D 5B2JC 3VH6A 2F8NG 1H3OA 3REIC 4ZBJC 3AZMC 2NZDB 3MGRA 2UWXA 3A6NC 1N1JA 3AYWD 2Y2QA 3RELB 3AV2C 5GT0B 4YS3D 1KX4A 4YM6C 1F66B 5B1LB 4XUJB 3WA9C 3AZID 1ID3B 3LELB 1P3GB 1KX3D 3AZED 2AROA 5B32D 2F8NA 5B2JA 2VQRA 3AYWC 1HQ3D 2PYOA 3REIA 3AZMA 4YS3C 3O62D 3A6NA 3W99B 5B0ZB 1P3PB 3AZIC 3X1UA 4H9QB 3AZGA 3AV2A 1KX3C 4KUDD 4YM6A 3AZEC 4Z5TB 2IO5B 1S32B 1AOIA 3WA9A 5B32C 4WU9B 1HQ3C 5B32G 4LD9D 5CP6B 5FUGB 1ZLAB 3O62C 4XZQD 2LY8A 3UTBD 1P3KD 3EPJA 1KX5D 4G92B 4YS3A 4KUDC 4NE3A 5DNMD 3VH5W 3REJB 4JJNB 3AZIA 5CPJB 4LD9C 3MGPD 1KX3A 3W97D 1ULYA 3WAAB 4XZQC 5AV9D 5GXQA 5B32A 3UTBC 1P3KC 3WTPD 1HQ3A 4Z2MH 2F8NK 4J8UB 3REHC 1KX5C 1P3BD 5B33D 3O62A 4DQYB 5AV5D 3AZFB 1P3FB 5DNMC 5F99D 4QLCD 3MGPC 4KUDA 3R45B 3V9RA 1P3ID 1M1AB 3W97C 5AV9C 1B6WA 5G49B 3WTPC 4LD9A 2BYKA 3B6FD 3MGSB 1P3BC 5B33C 4XZQA 5AV5C 5DNNB 3KSYA 5AV8D 3UTBA 5F99C 5C3IB 5AY8B 4QLCC 3KWQD 3X1TB 3VH6T 1P3IC 1P3OD 3MGQD 5DNMA 1P3LD 4J8XB 2FFFB 3TU4A 5AVCD 3KUYD 3EG5B 3AN2D 3W97A 3B6FC 2NQBB 4G91C 5CHLB 5AV9A 5B31B 2Y2PA 5AV8C 5B0YD 3WTPA 4UPKA 2DF4C 3KWQC 3MVDD 3UT9A 1P3BA 5B33A 3WKJB 5CPIB 1P3OC 5AV5A 3MGQC 3B6GD 3AFAB 1P3LC 1EQZD 5GT3D 4QLCA 3X1VD 3B0DC 5AVCC 3KUYC 3AN2C 3AV1B 1P3IA 1JFIA 4H9NA 1P3AB 1P34B 2ZY4A 4J8VB 4KHAA 5B0YC 4CSRA 4AWLB 3B6FA 3MVDC 1KU5A 5AVBD 5AV8A 3B6GC 5BT1D 1H3OB 3H0MC 2HUEC 5GT3C 3KWQA 3MGRB 1P3OA 3MGQA 1N1JB 5JRGD 1BH9B 1KX4B 2Y2GA 5AVCA 3KUYA 3AN2A 1M19B 1TZYD 4J8WD 5CPKA 5AVBC 2YFWB 1P3MA 5B0YA 5BT1C 4KGCA 3AZLB 2JSSA 4UUZA 3MVDA 2J8PA 5AV6B 2AROB 1M18D 2NZDD 1Q9CA 3MNNB 2F8NB 5B2JB 3W96D 5JRGC 3B6GA 4NE5A 1EQZA 2Y2HA 5JA4B 3UTAD 2PYOB 4ZBJB 3AZMB 3X1VA 4H9SC 3RELD 4HGAC 1TZYC 4J8WC 3AZNA 1BFMA 2L5AA 4WU8B 3X1UB 3B0BA 4Z66D 3AZGB 3AV2B 4YM6B 3LELD 3H0RC 1AOIB 2NZDC 3WTPE 1M18C 3W96C 5AVBA 3UTAC 5B40B 3RELC 5BS7C 1F66C 5JRGA 5B1LC 4XUJC 3W99D 3AZJB 4H9SA 5KDMA 5B0ZD 4Z66C 4YS3B 3X1SB 2Y2LA 3LELC 2Y2IA 1TZYA 3C1CD 2F8NH 2HIOD 3NQJA 1TAFA 1S32D 3AZIB 4EO5B 1KX3B 3LZ1D 5CP6D 1BH8B 4NFTA 1M18A 4CAYB 5GXQB 3W96A 5B32B 2NZDA 1HQ3B 3AYWA 3UTAA 3W98B 3REHD 3W99C 5B0ZC 3O62B 5BS7A 3C1CC 2IO5C 2CV5D 2HIOC 1S32C 4Z66A 3REJD 4KUDB 4JJND 2DQNC 3LELA 3AZEA 3LZ1C 2BYMA 5CP6C 3A1KA 3NQUB 3C1BD 4LD9B 2BYKB 2Y2NA 2YFVA 4DRAA 4XZQB 4G92C 3LJAB 5B24B 2CV5C 3AZFD 3W99A 5B0ZA 2G5HC 5E5AD 3REJC 3F6TA 3REKD 4JJNC 4WNNA 3C1CA 4H9PA 5DNMB 3EPHA 2HIOA 3C1BC 3TU4B 2Y2OA 5BNVA 3W97B 1T3UA 5CP6A 3LZ1A 3MGSD 5AV9B 3WTPB 3AZFC 5B1MD 1P3KA 1U35B 3REHA 3UT9B 1KX5A 5E5AC 3REKC 5BO0B 3X1TD 3IP4C 3LZ0D 2CV5A 3AZKD 4E44A 5GSUD 1PZRA 3MGPA 4JJNA 1P3IB 1JFIB 4H9NB 3MGSC 4DRBA 3VH6W 3C1BA 4KHAB 4CSRB 5B1MC 3AZHD 3B6FB 5C3IC 4G91B 3X1TC 3LZ0C 5CPID 5AV8B 3AZKC 3AZFA 5F99A 3KWQB 4R8PD 5E5AA 3REKA 5GSUC 3KXBB 1P3OB 3MGQB 4ZUXD 3AV1D 1P3AD 5B2IB 2XD5A 3AZHC 5AVCB 3KUYB 4J8VD 3AN2B 3VH5A 5CPKB 2G5IC 3MGSA 3WKJC 5CPIC 1P3MB 2Y2KA 4KGCB 5B1MA 3AFAC 3MVDB 4R8PC 3X1TA 3LZ0A 4X23D 4ZUXC 3AV1C 3B6GB 3AZKA 1EQZB 1P3AC 2HUEB 1P3LA 5BNXA 3X1VB 5GSUA 4J8VC 1F1EA 4AWLC 3AZNB 1M19D 3FDDA 3A1IA 2FJ7D 4H9OA 3AZHA 3AZLD 5AVBB 5AV6D 4X23C 2AROD 5CPIA 3MNND 3REIB 5GT3A 3KFUG 2PYOD 4R8PA 4ZUXA 5GT0D 3A6NB 3AV1A 1M19C 1F66D 4WV4B 4E45A 5B1LD 4H9RA 1P3AA 2FJ7C 4XUJD 5KDMB 4WU8D 4J8VA 3X1UD 4HGAB 3AZLC 1ID3D 1TZYB 1P3GD 3NQJB 5AV6C 1TAFB 2AROC 1AOID 3WA9B 3MNNC 1W2EA 2PYOC 5B40D 1R4VA 1M18B 3W96B 4WJ3C 4X23A 5GT0C 3AYWB 3UTAB 2F2AC 4WU8C 3AZJD 3X1UC 1P3PD 1BH9A 3B0CT 3AZGC 2ZY5A 1ID3C 3X1SD 1P3GC 4J8WA 4Z5TD 1HTAA 1M19A 1AOIC 2FJ7A 4Z66B 2YFWA 4WU9D 3AZEB 3AZLA 2BYMB 5B40C 3B0CW 5AV6A 1ZLAD 5GXQD 3MNNA 2YFVB 5JA4A 3W98D 3RELA 3AZJC 1P3PC 4Z2MG 3X1SC 5GT0A 4Z5TC 1F66A 5B1LA 4XUJA 4WU8A 4WU9C 4EO5C 3V9RB 5CPJD 1ID3A 4WNNB 1P3GA 3C1CB 4H9PB 2HIOB 1ZLAC 3WAAD 4M6BA 5GXQC 5BNVB 3AL0C 1WWIA 3LZ1B 3W98C 4J8UD 5B40A 2JCHA 2JE5A 3UTBB 3VH5T 3LJAD 5B24D 1P3KB 1P3FD 3REHB 2Y2JA 1KX5B 3AZJA 1P3PA 1Z2CB 5CPJC 4H9QA 3X1SA 2CV5B 4Z5TA 1M1AD 1WWSA 3WAAC 1S32A 3TU4D 3MGPB 4WU9A 2Y2MA 4J8UC 3C1BB 2CWEA 1BH8A 2RIQA 5FUGA 4CAYA 1ZLAA 3LJAC 5DNND 5B24C 1P3FC 1U35D 2BG1A 1P3BB 2XD1A 3W98A 5B33B 3UT9D 5AY8D 5AV5B 4WZSB 1M1AC 5F99B 4QLCB 5E5AB 3REKB 4J8XD 3TU4C 3REJA 5CPJA 2NQBD 3NQUA 3WAAA 5DNNC 5B31D 1U35C 2ZY2A 4J8UA 3UT9C 5AY8C 3WKJD 5B1MB 3LJAA 5B24A 1P3FA 4NE6A 3AFAD 4J8XC 3LZ0B 3KXBD 3P5JB 3EPKA 3R45A 3AZKB 1M1AA 2NQBC 1P3LB 5BNXB 1P34D 3B0DB 5GSUB 5B31C 5B2ID 5G49A 5B31G 2RVQD 5CPKD 2ZM5A 4H9OB 5DNNA 5B0YB 3AZHB 1P3MD 4UUZB 4KGCD 1U35A 5AY8A 5BO0A 3KXBC 3MGRD 5GT3B 4R8PB 1P34C 5B2IC 4J8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RVQ C;  4ZUX B;  1KX4 D;  2NQB A;  4H9R B;  5CPK C;  3AZN D;  1P3M C;  5B31 A;  4KGC C;  3WKJ A;  3MGR C;  2F8N D;  5B2J D;  1EQZ C;  3AFA A;  3REI D;  3X1V C;  3AZM D;  4X23 B;  1A7W A;  3KXB A;  1KX4 C;  5JRG B;  3A6N D;  3AZN C;  1P34 A;  5B2I A;  1B67 A;  3AZG D;  3AV2 D;  4YM6 D;  4J8W B;  2FJ7 B;  3WA9 D;  5B2J C;  3VH6 A;  2F8N G;  1H3O A;  3REI C;  4ZBJ C;  3AZM C;  2NZD B;  3MGR A;  3A6N C;  1N1J A;  3AYW D;  3REL B;  3AV2 C;  5GT0 B;  4YS3 D;  1KX4 A;  4YM6 C;  1F66 B;  5B1L B;  4XUJ B;  3WA9 C;  3AZI D;  1ID3 B;  3LEL B;  1P3G B;  1KX3 D;  3AZE D;  2ARO A;  5B32 D;  2F8N A;  5B2J A;  3AYW C;  1HQ3 D;  2PYO A;  3REI A;  3AZM A;  4YS3 C;  3O62 D;  3A6N A;  3W99 B;  5B0Z B;  1P3P B;  3AZI C;  3X1U A;  4H9Q B;  3AZG A;  3AV2 A;  1KX3 C;  4KUD D;  4YM6 A;  3AZE C;  4Z5T B;  2IO5 B;  1S32 B;  1AOI A;  3WA9 A;  5B32 C;  4WU9 B;  1HQ3 C;  5B32 G;  4LD9 D;  5CP6 B;  5FUG B;  1ZLA B;  3O62 C;  4XZQ D;  2LY8 A;  3UTB D;  1P3K D;  1KX5 D;  4G92 B;  4YS3 A;  4KUD C;  4NE3 A;  5DNM D;  3VH5 W;  3REJ B;  4JJN B;  3AZI A;  5CPJ B;  4LD9 C;  3MGP D;  1KX3 A;  3W97 D;  1ULY A;  3WAA B;  4XZQ C;  5AV9 D;  5GXQ A;  5B32 A;  3UTB C;  1P3K C;  3WTP D;  1HQ3 A;  4Z2M H;  2F8N K;  4J8U B;  3REH C;  1KX5 C;  1P3B D;  5B33 D;  3O62 A;  5AV5 D;  3AZF B;  1P3F B;  5DNM C;  5F99 D;  4QLC D;  3MGP C;  4KUD A;  3R45 B;  3V9R A;  1P3I D;  1M1A B;  3W97 C;  5AV9 C;  1B6W A;  5G49 B;  3WTP C;  4LD9 A;  2BYK A;  3B6F D;  3MGS B;  1P3B C;  5B33 C;  4XZQ A;  5AV5 C;  5DNN B;  3KSY A;  5AV8 D;  3UTB A;  5F99 C;  5C3I B;  5AY8 B;  4QLC C;  3KWQ D;  3X1T B;  3VH6 T;  1P3I C;  1P3O D;  3MGQ D;  5DNM A;  1P3L D;  4J8X B;  3TU4 A;  5AVC D;  3KUY D;  3AN2 D;  3B6F C;  3W97 A;  2NQB B;  4G91 C;  5CHL B;  5AV9 A;  5B31 B;  5AV8 C;  5B0Y D;  3WTP A;  3KWQ C;  3MVD D;  3UT9 A;  1P3B A;  5B33 A;  3WKJ B;  5CPI B;  1P3O C;  5AV5 A;  3MGQ C;  3B6G D;  3AFA B;  1P3L C;  1EQZ D;  5GT3 D;  4QLC A;  3X1V D;  3B0D C;  5AVC C;  3KUY C;  3AN2 C;  3AV1 B;  1P3I A;  1JFI A;  4H9N A;  1P3A B;  1P34 B;  4J8V B;  4KHA A;  5B0Y C;  4CSR A;  4AWL B;  3B6F A;  3MVD C;  1KU5 A;  5AVB D;  5AV8 A;  3B6G C;  5BT1 D;  1H3O B;  5GT3 C;  2HUE C;  3KWQ A;  3MGR B;  1P3O A;  3MGQ A;  1N1J B;  5JRG D;  1BH9 B;  1KX4 B;  5AVC A;  3KUY A;  3AN2 A;  1M19 B;  1TZY D;  4J8W D;  5CPK A;  5AVB C;  2YFW B;  1P3M A;  5B0Y A;  5BT1 C;  4KGC A;  3AZL B;  2JSS A;  4UUZ A;  3MVD A;  5AV6 B;  2ARO B;  1M18 D;  2NZD D;  1Q9C A;  3MNN B;  2F8N B;  5B2J B;  3W96 D;  5JRG C;  3B6G A;  4NE5 A;  1EQZ A;  3UTA D;  5JA4 B;  2PYO B;  4ZBJ B;  3AZM B;  3X1V A;  4H9S C;  3REL D;  4HGA C;  1TZY C;  4J8W C;  3AZN A;  1BFM A;  2L5A A;  4WU8 B;  3X1U B;  3B0B A;  4Z66 D;  3AZG B;  3AV2 B;  4YM6 B;  3LEL D;  1AOI B;  2NZD C;  3WTP E;  1M18 C;  3W96 C;  5AVB A;  3UTA C;  5B40 B;  3REL C;  5BS7 C;  1F66 C;  5JRG A;  5B1L C;  4XUJ C;  3W99 D;  3AZJ B;  4H9S A;  5KDM A;  5B0Z D;  4Z66 C;  4YS3 B;  3X1S B;  3LEL C;  1TZY A;  3C1C D;  2F8N H;  2HIO D;  3NQJ A;  1TAF A;  1S32 D;  3AZI B;  4EO5 B;  1KX3 B;  3LZ1 D;  5CP6 D;  1BH8 B;  4NFT A;  1M18 A;  4CAY B;  5GXQ B;  3W96 A;  5B32 B;  2NZD A;  1HQ3 B;  3AYW A;  3UTA A;  3W98 B;  3REH D;  3W99 C;  5B0Z C;  3O62 B;  5BS7 A;  3C1C C;  2IO5 C;  2CV5 D;  2HIO C;  1S32 C;  4Z66 A;  3REJ D;  4KUD B;  4JJN D;  3LEL A;  3AZE A;  3LZ1 C;  2BYM A;  5CP6 C;  3NQU B;  3C1B D;  4LD9 B;  2BYK B;  2YFV A;  4DRA A;  4XZQ B;  4G92 C;  3LJA B;  5B24 B;  2CV5 C;  3AZF D;  3W99 A;  5B0Z A;  5E5A D;  3REK D;  3REJ C;  4JJN C;  4WNN A;  3C1C A;  4H9P A;  5DNM B;  2HIO A;  3C1B C;  3TU4 B;  5BNV A;  3W97 B;  3LZ1 A;  5CP6 A;  3MGS D;  5AV9 B;  3WTP B;  3AZF C;  5B1M D;  1P3K A;  1U35 B;  3REH A;  3UT9 B;  1KX5 A;  5E5A C;  3REK C;  5BO0 B;  3X1T D;  3LZ0 D;  2CV5 A;  3AZK D;  4E44 A;  5GSU D;  3MGP A;  4JJN A;  1P3I B;  1JFI B;  4H9N B;  3MGS C;  4DRB A;  3VH6 W;  3C1B A;  4KHA B;  4CSR B;  5B1M C;  3AZH D;  3B6F B;  5C3I C;  4G91 B;  3X1T C;  3LZ0 C;  5CPI D;  5AV8 B;  3AZK C;  3AZF A;  5F99 A;  3KWQ B;  4R8P D;  5E5A A;  3REK A;  5GSU C;  3KXB B;  1P3O B;  3MGQ B;  4ZUX D;  3AV1 D;  1P3A D;  5B2I B;  3AZH C;  5AVC B;  3KUY B;  4J8V D;  3AN2 B;  3VH5 A;  5CPK B;  3MGS A;  3WKJ C;  5CPI C;  1P3M B;  4KGC B;  5B1M A;  3AFA C;  3MVD B;  4R8P C;  3X1T A;  3LZ0 A;  4X23 D;  4ZUX C;  3AV1 C;  3B6G B;  3AZK A;  1EQZ B;  1P3A C;  2HUE B;  1P3L A;  5BNX A;  3X1V B;  5GSU A;  4J8V C;  1F1E A;  4AWL C;  3AZN B;  1M19 D;  2FJ7 D;  4H9O A;  3AZH A;  3AZL D;  5AVB B;  5AV6 D;  4X23 C;  2ARO D;  5CPI A;  3MNN D;  3REI B;  5GT3 A;  2PYO D;  4R8P A;  4ZUX A;  5GT0 D;  3A6N B;  3AV1 A;  1M19 C;  1F66 D;  4WV4 B;  4E45 A;  5B1L D;  4H9R A;  1P3A A;  2FJ7 C;  4XUJ D;  5KDM B;  4WU8 D;  4J8V A;  3X1U D;  4HGA B;  3AZL C;  1ID3 D;  1TZY B;  1P3G D;  3NQJ B;  5AV6 C;  1TAF B;  2ARO C;  1AOI D;  3WA9 B;  3MNN C;  2PYO C;  5B40 D;  1R4V A;  1M18 B;  3W96 B;  4X23 A;  5GT0 C;  3AYW B;  3UTA B;  4WU8 C;  3AZJ D;  3X1U C;  1P3P D;  1BH9 A;  3B0C T;  3AZG C;  1ID3 C;  3X1S D;  1P3G C;  4J8W A;  4Z5T D;  1HTA A;  1M19 A;  1AOI C;  2FJ7 A;  4Z66 B;  2YFW A;  4WU9 D;  3AZE B;  3AZL A;  2BYM B;  5B40 C;  3B0C W;  5AV6 A;  1ZLA D;  5GXQ D;  3MNN A;  2YFV B;  5JA4 A;  3W98 D;  3REL A;  3AZJ C;  1P3P C;  4Z2M G;  3X1S C;  5GT0 A;  4Z5T C;  1F66 A;  5B1L A;  4XUJ A;  4WU8 A;  4WU9 C;  4EO5 C;  3V9R B;  5CPJ D;  1ID3 A;  4WNN B;  1P3G A;  3C1C B;  4H9P B;  2HIO B;  1ZLA C;  3WAA D;  4M6B A;  5GXQ C;  5BNV B;  1WWI A;  3LZ1 B;  3W98 C;  4J8U D;  5B40 A;  3UTB B;  3VH5 T;  3LJA D;  5B24 D;  1P3K B;  1P3F D;  3REH B;  1KX5 B;  3AZJ A;  1P3P A;  5CPJ C;  4H9Q A;  3X1S A;  2CV5 B;  4Z5T A;  1M1A D;  1WWS A;  3WAA C;  1S32 A;  3TU4 D;  3MGP B;  4WU9 A;  4J8U C;  3C1B B;  2CWE A;  1BH8 A;  5FUG A;  1ZLA A;  4CAY A;  3LJA C;  5DNN D;  5B24 C;  1P3F C;  1U35 D;  1P3B B;  3W98 A;  5B33 B;  3UT9 D;  5AY8 D;  5AV5 B;  4WZS B;  1M1A C;  5F99 B;  4QLC B;  5E5A B;  3REK B;  4J8X D;  3TU4 C;  3REJ A;  5CPJ A;  2NQB D;  3NQU A;  3WAA A;  5DNN C;  5B31 D;  1U35 C;  4J8U A;  3UT9 C;  5AY8 C;  3WKJ D;  5B1M B;  3LJA A;  5B24 A;  1P3F A;  4NE6 A;  3AFA D;  4J8X C;  3LZ0 B;  3KXB D;  3R45 A;  3AZK B;  1M1A A;  2NQB C;  1P3L B;  5BNX B;  1P34 D;  3B0D B;  5GSU B;  5B31 C;  5B2I D;  5G49 A;  5B31 G;  2RVQ D;  5CPK D;  4H9O B;  5DNN A;  5B0Y B;  3AZH B;  1P3M D;  4UUZ B;  4KGC D;  1U35 A;  5AY8 A;  5BO0 A;  3KXB C;  3MGR D;  5GT3 B;  4R8P B;  1P34 C;  5B2I C;  4J8X A; 
#chains in the Genus database with same CATH topology
 2RVQ C;  4ZUX B;  1KX4 D;  2NQB A;  4H9R B;  5CPK C;  3AZN D;  1P3M C;  5B31 A;  4KGC C;  3WKJ A;  3MGR C;  2F8N D;  5B2J D;  1EQZ C;  3AFA A;  3REI D;  3X1V C;  3AZM D;  4X23 B;  1A7W A;  3KXB A;  1KX4 C;  2W8S A;  5JRG B;  3A6N D;  3AZN C;  1P34 A;  5B2I A;  1B67 A;  3AZG D;  3AV2 D;  4YM6 D;  4J8W B;  2ZY3 A;  3H0L C;  3EPL A;  2FJ7 B;  3WA9 D;  5B2J C;  3VH6 A;  2F8N G;  1H3O A;  3REI C;  4ZBJ C;  3AZM C;  2NZD B;  3MGR A;  2UWX A;  3A6N C;  1N1J A;  3AYW D;  2Y2Q A;  3REL B;  3AV2 C;  5GT0 B;  4YS3 D;  1KX4 A;  4YM6 C;  1F66 B;  5B1L B;  4XUJ B;  3WA9 C;  3AZI D;  1ID3 B;  3LEL B;  1P3G B;  1KX3 D;  3AZE D;  2ARO A;  5B32 D;  2F8N A;  5B2J A;  2VQR A;  3AYW C;  1HQ3 D;  2PYO A;  3REI A;  3AZM A;  4YS3 C;  3O62 D;  3A6N A;  3W99 B;  5B0Z B;  1P3P B;  3AZI C;  3X1U A;  4H9Q B;  3AZG A;  3AV2 A;  1KX3 C;  4KUD D;  4YM6 A;  3AZE C;  4Z5T B;  2IO5 B;  1S32 B;  1AOI A;  3WA9 A;  5B32 C;  4WU9 B;  1HQ3 C;  5B32 G;  4LD9 D;  5CP6 B;  5FUG B;  1ZLA B;  3O62 C;  4XZQ D;  2LY8 A;  3UTB D;  1P3K D;  3EPJ A;  1KX5 D;  4G92 B;  4YS3 A;  4KUD C;  4NE3 A;  5DNM D;  3VH5 W;  3REJ B;  4JJN B;  3AZI A;  5CPJ B;  4LD9 C;  3MGP D;  1KX3 A;  3W97 D;  1ULY A;  3WAA B;  4XZQ C;  5AV9 D;  5GXQ A;  5B32 A;  3UTB C;  1P3K C;  3WTP D;  1HQ3 A;  4Z2M H;  2F8N K;  4J8U B;  3REH C;  1KX5 C;  1P3B D;  5B33 D;  3O62 A;  4DQY B;  5AV5 D;  3AZF B;  1P3F B;  5DNM C;  5F99 D;  4QLC D;  3MGP C;  4KUD A;  3R45 B;  3V9R A;  1P3I D;  1M1A B;  3W97 C;  5AV9 C;  1B6W A;  5G49 B;  3WTP C;  4LD9 A;  2BYK A;  3B6F D;  3MGS B;  1P3B C;  5B33 C;  4XZQ A;  5AV5 C;  5DNN B;  3KSY A;  5AV8 D;  3UTB A;  5F99 C;  5C3I B;  5AY8 B;  4QLC C;  3KWQ D;  3X1T B;  3VH6 T;  1P3I C;  1P3O D;  3MGQ D;  5DNM A;  1P3L D;  4J8X B;  2FFF B;  3TU4 A;  5AVC D;  3KUY D;  3EG5 B;  3AN2 D;  3W97 A;  3B6F C;  2NQB B;  4G91 C;  5CHL B;  5AV9 A;  5B31 B;  2Y2P A;  5AV8 C;  5B0Y D;  3WTP A;  4UPK A;  2DF4 C;  3KWQ C;  3MVD D;  3UT9 A;  1P3B A;  5B33 A;  3WKJ B;  5CPI B;  1P3O C;  5AV5 A;  3MGQ C;  3B6G D;  3AFA B;  1P3L C;  1EQZ D;  5GT3 D;  4QLC A;  3X1V D;  3B0D C;  5AVC C;  3KUY C;  3AN2 C;  3AV1 B;  1P3I A;  1JFI A;  4H9N A;  1P3A B;  1P34 B;  2ZY4 A;  4J8V B;  4KHA A;  5B0Y C;  4CSR A;  4AWL B;  3B6F A;  3MVD C;  1KU5 A;  5AVB D;  5AV8 A;  3B6G C;  5BT1 D;  1H3O B;  3H0M C;  2HUE C;  5GT3 C;  3KWQ A;  3MGR B;  1P3O A;  3MGQ A;  1N1J B;  5JRG D;  1BH9 B;  1KX4 B;  2Y2G A;  5AVC A;  3KUY A;  3AN2 A;  1M19 B;  1TZY D;  4J8W D;  5CPK A;  5AVB C;  2YFW B;  1P3M A;  5B0Y A;  5BT1 C;  4KGC A;  3AZL B;  2JSS A;  4UUZ A;  3MVD A;  2J8P A;  5AV6 B;  2ARO B;  1M18 D;  2NZD D;  1Q9C A;  3MNN B;  2F8N B;  5B2J B;  3W96 D;  5JRG C;  3B6G A;  4NE5 A;  1EQZ A;  2Y2H A;  5JA4 B;  3UTA D;  2PYO B;  4ZBJ B;  3AZM B;  3X1V A;  4H9S C;  3REL D;  4HGA C;  1TZY C;  4J8W C;  3AZN A;  1BFM A;  2L5A A;  4WU8 B;  3X1U B;  3B0B A;  4Z66 D;  3AZG B;  3AV2 B;  4YM6 B;  3LEL D;  3H0R C;  1AOI B;  2NZD C;  3WTP E;  1M18 C;  3W96 C;  5AVB A;  3UTA C;  5B40 B;  3REL C;  5BS7 C;  1F66 C;  5JRG A;  5B1L C;  4XUJ C;  3W99 D;  3AZJ B;  4H9S A;  5KDM A;  5B0Z D;  4Z66 C;  4YS3 B;  3X1S B;  2Y2L A;  3LEL C;  2Y2I A;  1TZY A;  3C1C D;  2F8N H;  2HIO D;  3NQJ A;  1TAF A;  1S32 D;  3AZI B;  4EO5 B;  1KX3 B;  3LZ1 D;  5CP6 D;  1BH8 B;  4NFT A;  1M18 A;  4CAY B;  5GXQ B;  3W96 A;  5B32 B;  2NZD A;  1HQ3 B;  3AYW A;  3UTA A;  3W98 B;  3REH D;  3W99 C;  5B0Z C;  3O62 B;  5BS7 A;  3C1C C;  2IO5 C;  2CV5 D;  2HIO C;  1S32 C;  4Z66 A;  3REJ D;  4KUD B;  4JJN D;  2DQN C;  3LEL A;  3AZE A;  3LZ1 C;  2BYM A;  5CP6 C;  3A1K A;  3NQU B;  3C1B D;  4LD9 B;  2BYK B;  2Y2N A;  2YFV A;  4DRA A;  4XZQ B;  4G92 C;  3LJA B;  5B24 B;  2CV5 C;  3AZF D;  3W99 A;  5B0Z A;  2G5H C;  5E5A D;  3REJ C;  3F6T A;  3REK D;  4JJN C;  4WNN A;  3C1C A;  4H9P A;  5DNM B;  3EPH A;  2HIO A;  3C1B C;  3TU4 B;  2Y2O A;  5BNV A;  3W97 B;  1T3U A;  5CP6 A;  3LZ1 A;  3MGS D;  5AV9 B;  3WTP B;  3AZF C;  5B1M D;  1P3K A;  1U35 B;  3REH A;  3UT9 B;  1KX5 A;  5E5A C;  3REK C;  5BO0 B;  3X1T D;  3IP4 C;  3LZ0 D;  2CV5 A;  3AZK D;  4E44 A;  5GSU D;  1PZR A;  3MGP A;  4JJN A;  1P3I B;  1JFI B;  4H9N B;  3MGS C;  4DRB A;  3VH6 W;  3C1B A;  4KHA B;  4CSR B;  5B1M C;  3AZH D;  3B6F B;  5C3I C;  4G91 B;  3X1T C;  3LZ0 C;  5CPI D;  5AV8 B;  3AZK C;  3AZF A;  5F99 A;  3KWQ B;  4R8P D;  5E5A A;  3REK A;  5GSU C;  3KXB B;  1P3O B;  3MGQ B;  4ZUX D;  3AV1 D;  1P3A D;  5B2I B;  2XD5 A;  3AZH C;  5AVC B;  3KUY B;  4J8V D;  3AN2 B;  3VH5 A;  5CPK B;  2G5I C;  3MGS A;  3WKJ C;  5CPI C;  1P3M B;  2Y2K A;  4KGC B;  5B1M A;  3AFA C;  3MVD B;  4R8P C;  3X1T A;  3LZ0 A;  4X23 D;  4ZUX C;  3AV1 C;  3B6G B;  3AZK A;  1EQZ B;  1P3A C;  2HUE B;  1P3L A;  5BNX A;  3X1V B;  5GSU A;  4J8V C;  1F1E A;  4AWL C;  3AZN B;  1M19 D;  3FDD A;  3A1I A;  2FJ7 D;  4H9O A;  3AZH A;  3AZL D;  5AVB B;  5AV6 D;  4X23 C;  2ARO D;  5CPI A;  3MNN D;  3REI B;  5GT3 A;  3KFU G;  2PYO D;  4R8P A;  4ZUX A;  5GT0 D;  3A6N B;  3AV1 A;  1M19 C;  1F66 D;  4WV4 B;  4E45 A;  5B1L D;  4H9R A;  1P3A A;  2FJ7 C;  4XUJ D;  5KDM B;  4WU8 D;  4J8V A;  3X1U D;  4HGA B;  3AZL C;  1ID3 D;  1TZY B;  1P3G D;  3NQJ B;  5AV6 C;  1TAF B;  2ARO C;  1AOI D;  3WA9 B;  3MNN C;  1W2E A;  2PYO C;  5B40 D;  1R4V A;  1M18 B;  3W96 B;  4WJ3 C;  4X23 A;  5GT0 C;  3AYW B;  3UTA B;  2F2A C;  4WU8 C;  3AZJ D;  3X1U C;  1P3P D;  1BH9 A;  3B0C T;  3AZG C;  2ZY5 A;  1ID3 C;  3X1S D;  1P3G C;  4J8W A;  4Z5T D;  1HTA A;  1M19 A;  1AOI C;  2FJ7 A;  4Z66 B;  2YFW A;  4WU9 D;  3AZE B;  3AZL A;  2BYM B;  5B40 C;  3B0C W;  5AV6 A;  1ZLA D;  5GXQ D;  3MNN A;  2YFV B;  5JA4 A;  3W98 D;  3REL A;  3AZJ C;  1P3P C;  4Z2M G;  3X1S C;  5GT0 A;  4Z5T C;  1F66 A;  5B1L A;  4XUJ A;  4WU8 A;  4WU9 C;  4EO5 C;  3V9R B;  5CPJ D;  1ID3 A;  4WNN B;  1P3G A;  3C1C B;  4H9P B;  2HIO B;  1ZLA C;  3WAA D;  4M6B A;  5GXQ C;  5BNV B;  3AL0 C;  1WWI A;  3LZ1 B;  3W98 C;  4J8U D;  5B40 A;  2JCH A;  2JE5 A;  3UTB B;  3VH5 T;  3LJA D;  5B24 D;  1P3K B;  1P3F D;  3REH B;  2Y2J A;  1KX5 B;  3AZJ A;  1P3P A;  1Z2C B;  5CPJ C;  4H9Q A;  3X1S A;  2CV5 B;  4Z5T A;  1M1A D;  1WWS A;  3WAA C;  1S32 A;  3TU4 D;  3MGP B;  4WU9 A;  2Y2M A;  4J8U C;  3C1B B;  2CWE A;  1BH8 A;  2RIQ A;  5FUG A;  4CAY A;  1ZLA A;  3LJA C;  5DNN D;  5B24 C;  1P3F C;  1U35 D;  2BG1 A;  1P3B B;  2XD1 A;  3W98 A;  5B33 B;  3UT9 D;  5AY8 D;  5AV5 B;  4WZS B;  1M1A C;  5F99 B;  4QLC B;  5E5A B;  3REK B;  4J8X D;  3TU4 C;  3REJ A;  5CPJ A;  2NQB D;  3NQU A;  3WAA A;  5DNN C;  5B31 D;  1U35 C;  2ZY2 A;  4J8U A;  3UT9 C;  5AY8 C;  3WKJ D;  5B1M B;  3LJA A;  5B24 A;  1P3F A;  4NE6 A;  3AFA D;  4J8X C;  3LZ0 B;  3KXB D;  3P5J B;  3EPK A;  3R45 A;  3AZK B;  1M1A A;  2NQB C;  1P3L B;  5BNX B;  1P34 D;  3B0D B;  5GSU B;  5B31 C;  5B2I D;  5G49 A;  5B31 G;  2RVQ D;  5CPK D;  2ZM5 A;  4H9O B;  5DNN A;  5B0Y B;  3AZH B;  1P3M D;  4UUZ B;  4KGC D;  1U35 A;  5AY8 A;  5BO0 A;  3KXB C;  3MGR D;  5GT3 B;  4R8P B;  1P34 C;  5B2I C;  4J8X A; 
#chains in the Genus database with same CATH homology
 2RVQ C;  4ZUX B;  1KX4 D;  2NQB A;  4H9R B;  5CPK C;  3AZN D;  1P3M C;  5B31 A;  4KGC C;  3WKJ A;  3MGR C;  2F8N D;  5B2J D;  1EQZ C;  3AFA A;  3REI D;  3X1V C;  3AZM D;  4X23 B;  1A7W A;  3KXB A;  1KX4 C;  2W8S A;  5JRG B;  3A6N D;  3AZN C;  1P34 A;  5B2I A;  1B67 A;  3AZG D;  3AV2 D;  4YM6 D;  4J8W B;  2ZY3 A;  3H0L C;  3EPL A;  2FJ7 B;  3WA9 D;  5B2J C;  3VH6 A;  2F8N G;  1H3O A;  3REI C;  4ZBJ C;  3AZM C;  2NZD B;  3MGR A;  2UWX A;  3A6N C;  1N1J A;  3AYW D;  2Y2Q A;  3REL B;  3AV2 C;  5GT0 B;  4YS3 D;  1KX4 A;  4YM6 C;  1F66 B;  5B1L B;  4XUJ B;  3WA9 C;  3AZI D;  1ID3 B;  3LEL B;  1P3G B;  1KX3 D;  3AZE D;  2ARO A;  5B32 D;  2F8N A;  5B2J A;  2VQR A;  3AYW C;  1HQ3 D;  2PYO A;  3REI A;  3AZM A;  4YS3 C;  3O62 D;  3A6N A;  3W99 B;  5B0Z B;  1P3P B;  3AZI C;  3X1U A;  4H9Q B;  3AZG A;  3AV2 A;  1KX3 C;  4KUD D;  4YM6 A;  3AZE C;  4Z5T B;  2IO5 B;  1S32 B;  1AOI A;  3WA9 A;  5B32 C;  4WU9 B;  1HQ3 C;  5B32 G;  4LD9 D;  5CP6 B;  5FUG B;  1ZLA B;  3O62 C;  4XZQ D;  2LY8 A;  3UTB D;  1P3K D;  3EPJ A;  1KX5 D;  4G92 B;  4YS3 A;  4KUD C;  4NE3 A;  5DNM D;  3VH5 W;  3REJ B;  4JJN B;  3AZI A;  5CPJ B;  4LD9 C;  3MGP D;  1KX3 A;  3W97 D;  1ULY A;  3WAA B;  4XZQ C;  5AV9 D;  5GXQ A;  5B32 A;  3UTB C;  1P3K C;  3WTP D;  1HQ3 A;  4Z2M H;  2F8N K;  4J8U B;  3REH C;  1KX5 C;  1P3B D;  5B33 D;  3O62 A;  4DQY B;  5AV5 D;  3AZF B;  1P3F B;  5DNM C;  5F99 D;  4QLC D;  3MGP C;  4KUD A;  3R45 B;  3V9R A;  1P3I D;  1M1A B;  3W97 C;  5AV9 C;  1B6W A;  5G49 B;  3WTP C;  4LD9 A;  2BYK A;  3B6F D;  3MGS B;  1P3B C;  5B33 C;  4XZQ A;  5AV5 C;  5DNN B;  3KSY A;  5AV8 D;  3UTB A;  5F99 C;  5C3I B;  5AY8 B;  4QLC C;  3KWQ D;  3X1T B;  3VH6 T;  1P3I C;  1P3O D;  3MGQ D;  5DNM A;  1P3L D;  4J8X B;  2FFF B;  3TU4 A;  5AVC D;  3KUY D;  3EG5 B;  3AN2 D;  3W97 A;  3B6F C;  2NQB B;  4G91 C;  5CHL B;  5AV9 A;  5B31 B;  2Y2P A;  5AV8 C;  5B0Y D;  3WTP A;  4UPK A;  2DF4 C;  3KWQ C;  3MVD D;  3UT9 A;  1P3B A;  5B33 A;  3WKJ B;  5CPI B;  1P3O C;  5AV5 A;  3MGQ C;  3B6G D;  3AFA B;  1P3L C;  1EQZ D;  5GT3 D;  4QLC A;  3X1V D;  3B0D C;  5AVC C;  3KUY C;  3AN2 C;  3AV1 B;  1P3I A;  1JFI A;  4H9N A;  1P3A B;  1P34 B;  2ZY4 A;  4J8V B;  4KHA A;  5B0Y C;  4CSR A;  4AWL B;  3B6F A;  3MVD C;  1KU5 A;  5AVB D;  5AV8 A;  3B6G C;  5BT1 D;  1H3O B;  3H0M C;  2HUE C;  5GT3 C;  3KWQ A;  3MGR B;  1P3O A;  3MGQ A;  1N1J B;  5JRG D;  1BH9 B;  1KX4 B;  2Y2G A;  5AVC A;  3KUY A;  3AN2 A;  1M19 B;  1TZY D;  4J8W D;  5CPK A;  5AVB C;  2YFW B;  1P3M A;  5B0Y A;  5BT1 C;  4KGC A;  3AZL B;  2JSS A;  4UUZ A;  3MVD A;  2J8P A;  5AV6 B;  2ARO B;  1M18 D;  2NZD D;  1Q9C A;  3MNN B;  2F8N B;  5B2J B;  3W96 D;  5JRG C;  3B6G A;  4NE5 A;  1EQZ A;  2Y2H A;  5JA4 B;  3UTA D;  2PYO B;  4ZBJ B;  3AZM B;  3X1V A;  4H9S C;  3REL D;  4HGA C;  1TZY C;  4J8W C;  3AZN A;  1BFM A;  2L5A A;  4WU8 B;  3X1U B;  3B0B A;  4Z66 D;  3AZG B;  3AV2 B;  4YM6 B;  3LEL D;  3H0R C;  1AOI B;  2NZD C;  3WTP E;  1M18 C;  3W96 C;  5AVB A;  3UTA C;  5B40 B;  3REL C;  5BS7 C;  1F66 C;  5JRG A;  5B1L C;  4XUJ C;  3W99 D;  3AZJ B;  4H9S A;  5KDM A;  5B0Z D;  4Z66 C;  4YS3 B;  3X1S B;  2Y2L A;  3LEL C;  2Y2I A;  1TZY A;  3C1C D;  2F8N H;  2HIO D;  3NQJ A;  1TAF A;  1S32 D;  3AZI B;  4EO5 B;  1KX3 B;  3LZ1 D;  5CP6 D;  1BH8 B;  4NFT A;  1M18 A;  4CAY B;  5GXQ B;  3W96 A;  5B32 B;  2NZD A;  1HQ3 B;  3AYW A;  3UTA A;  3W98 B;  3REH D;  3W99 C;  5B0Z C;  3O62 B;  5BS7 A;  3C1C C;  2IO5 C;  2CV5 D;  2HIO C;  1S32 C;  4Z66 A;  3REJ D;  4KUD B;  4JJN D;  2DQN C;  3LEL A;  3AZE A;  3LZ1 C;  2BYM A;  5CP6 C;  3A1K A;  3NQU B;  3C1B D;  4LD9 B;  2BYK B;  2Y2N A;  2YFV A;  4DRA A;  4XZQ B;  4G92 C;  3LJA B;  5B24 B;  2CV5 C;  3AZF D;  3W99 A;  5B0Z A;  2G5H C;  5E5A D;  3REJ C;  3F6T A;  3REK D;  4JJN C;  4WNN A;  3C1C A;  4H9P A;  5DNM B;  3EPH A;  2HIO A;  3C1B C;  3TU4 B;  2Y2O A;  5BNV A;  3W97 B;  1T3U A;  5CP6 A;  3LZ1 A;  3MGS D;  5AV9 B;  3WTP B;  3AZF C;  5B1M D;  1P3K A;  1U35 B;  3REH A;  3UT9 B;  1KX5 A;  5E5A C;  3REK C;  5BO0 B;  3X1T D;  3IP4 C;  3LZ0 D;  2CV5 A;  3AZK D;  4E44 A;  5GSU D;  1PZR A;  3MGP A;  4JJN A;  1P3I B;  1JFI B;  4H9N B;  3MGS C;  4DRB A;  3VH6 W;  3C1B A;  4KHA B;  4CSR B;  5B1M C;  3AZH D;  3B6F B;  5C3I C;  4G91 B;  3X1T C;  3LZ0 C;  5CPI D;  5AV8 B;  3AZK C;  3AZF A;  5F99 A;  3KWQ B;  4R8P D;  5E5A A;  3REK A;  5GSU C;  3KXB B;  1P3O B;  3MGQ B;  4ZUX D;  3AV1 D;  1P3A D;  5B2I B;  2XD5 A;  3AZH C;  5AVC B;  3KUY B;  4J8V D;  3AN2 B;  3VH5 A;  5CPK B;  2G5I C;  3MGS A;  3WKJ C;  5CPI C;  1P3M B;  2Y2K A;  4KGC B;  5B1M A;  3AFA C;  3MVD B;  4R8P C;  3X1T A;  3LZ0 A;  4X23 D;  4ZUX C;  3AV1 C;  3B6G B;  3AZK A;  1EQZ B;  1P3A C;  2HUE B;  1P3L A;  5BNX A;  3X1V B;  5GSU A;  4J8V C;  1F1E A;  4AWL C;  3AZN B;  1M19 D;  3FDD A;  3A1I A;  2FJ7 D;  4H9O A;  3AZH A;  3AZL D;  5AVB B;  5AV6 D;  4X23 C;  2ARO D;  5CPI A;  3MNN D;  3REI B;  5GT3 A;  3KFU G;  2PYO D;  4R8P A;  4ZUX A;  5GT0 D;  3A6N B;  3AV1 A;  1M19 C;  1F66 D;  4WV4 B;  4E45 A;  5B1L D;  4H9R A;  1P3A A;  2FJ7 C;  4XUJ D;  5KDM B;  4WU8 D;  4J8V A;  3X1U D;  4HGA B;  3AZL C;  1ID3 D;  1TZY B;  1P3G D;  3NQJ B;  5AV6 C;  1TAF B;  2ARO C;  1AOI D;  3WA9 B;  3MNN C;  1W2E A;  2PYO C;  5B40 D;  1R4V A;  1M18 B;  3W96 B;  4WJ3 C;  4X23 A;  5GT0 C;  3AYW B;  3UTA B;  2F2A C;  4WU8 C;  3AZJ D;  3X1U C;  1P3P D;  1BH9 A;  3B0C T;  3AZG C;  2ZY5 A;  1ID3 C;  3X1S D;  1P3G C;  4J8W A;  4Z5T D;  1HTA A;  1M19 A;  1AOI C;  2FJ7 A;  4Z66 B;  2YFW A;  4WU9 D;  3AZE B;  3AZL A;  2BYM B;  5B40 C;  3B0C W;  5AV6 A;  1ZLA D;  5GXQ D;  3MNN A;  2YFV B;  5JA4 A;  3W98 D;  3REL A;  3AZJ C;  1P3P C;  4Z2M G;  3X1S C;  5GT0 A;  4Z5T C;  1F66 A;  5B1L A;  4XUJ A;  4WU8 A;  4WU9 C;  4EO5 C;  3V9R B;  5CPJ D;  1ID3 A;  4WNN B;  1P3G A;  3C1C B;  4H9P B;  2HIO B;  1ZLA C;  3WAA D;  4M6B A;  5GXQ C;  5BNV B;  3AL0 C;  1WWI A;  3LZ1 B;  3W98 C;  4J8U D;  5B40 A;  2JCH A;  2JE5 A;  3UTB B;  3VH5 T;  3LJA D;  5B24 D;  1P3K B;  1P3F D;  3REH B;  2Y2J A;  1KX5 B;  3AZJ A;  1P3P A;  1Z2C B;  5CPJ C;  4H9Q A;  3X1S A;  2CV5 B;  4Z5T A;  1M1A D;  1WWS A;  3WAA C;  1S32 A;  3TU4 D;  3MGP B;  4WU9 A;  2Y2M A;  4J8U C;  3C1B B;  2CWE A;  1BH8 A;  2RIQ A;  5FUG A;  4CAY A;  1ZLA A;  3LJA C;  5DNN D;  5B24 C;  1P3F C;  1U35 D;  2BG1 A;  1P3B B;  2XD1 A;  3W98 A;  5B33 B;  3UT9 D;  5AY8 D;  5AV5 B;  4WZS B;  1M1A C;  5F99 B;  4QLC B;  5E5A B;  3REK B;  4J8X D;  3TU4 C;  3REJ A;  5CPJ A;  2NQB D;  3NQU A;  3WAA A;  5DNN C;  5B31 D;  1U35 C;  2ZY2 A;  4J8U A;  3UT9 C;  5AY8 C;  3WKJ D;  5B1M B;  3LJA A;  5B24 A;  1P3F A;  4NE6 A;  3AFA D;  4J8X C;  3LZ0 B;  3KXB D;  3P5J B;  3EPK A;  3R45 A;  3AZK B;  1M1A A;  2NQB C;  1P3L B;  5BNX B;  1P34 D;  3B0D B;  5GSU B;  5B31 C;  5B2I D;  5G49 A;  5B31 G;  2RVQ D;  5CPK D;  2ZM5 A;  4H9O B;  5DNN A;  5B0Y B;  3AZH B;  1P3M D;  4UUZ B;  4KGC D;  1U35 A;  5AY8 A;  5BO0 A;  3KXB C;  3MGR D;  5GT3 B;  4R8P B;  1P34 C;  5B2I C;  4J8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...