5CP6A

Nucleosome core particle with adducts from the anticancer compound, [(eta6-5,8,9,10-tetrahydroanthracene)ru(ethylenediamine)cl][pf6]
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
96
structure length
96
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/dna
molecule keywords DNA (145-MER)
publication title An Organometallic Compound which Exhibits a DNA Topology-Dependent One-Stranded Intercalation Mode.
pubmed doi rcsb
source organism Xenopus laevis
total genus 30
structure length 96
sequence length 96
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cp6A00
4QLCB 3C1BA 2AROC 3KXBA 3KWQC 3AZKD 3MGRC 1M19D 4WU9A 1KX4C 4G91C 2CV5B 3AV1D 2AROA 2NQBC 3KWQA 3MGRA 1P3AB 4Z2MG 1M18C 5DNMB 1TZYB 4J8VC 4KHAB 5AVBB 3X1VD 3AZNC 1A7WA 3B6GC 3W98D 4QLCC 1B67A 1M18A 2NZDD 4WNNB 3AZJD 1TAFB 4H9PB 4XZQD 2CV5C 4WV4B 3AZGB 4QLCA 3X1TB 3AZLB 1P3AC 5DNMC 3AZFD 1TZYC 5AV8B 4Z66B 3LJAA 2CV5A 5AVBC 1F66B 2PYOB 4UUZB 1P3AA 5DNMA 1TZYA 1P34B 2YFVB 4KHAA 5AVBA 3MVDB 4YS3D 2F8NG 3AZGC 3X1TC 5DNND 2JSSA 3AZLC 1HQ3B 1TAFA 3NQUB 4Z66C 3AZGA 1F66C 2PYOC 3X1TA 3AZLA 3AFAB 5AV8A 4Z66A 1P34C 3MVDC 3AZED 1U35D 1KX5A 1F66A 2PYOA 4UUZA 1HQ3C 1P34A 5B33D 5B1LD 4Z2MH 3MVDA 4ZUXD 3MGPD 3UTBB 3AN2B 5BS7C 3LZ0D 1HQ3A 3AFAC 4LD9D 3AZMB 5E5AB 5BS7A 3AV2B 5F99D 3AZIB 3W97A 5AV9B 3WA9D 3UTBC 3AN2C 4JJND 3WAAB 3O62B 3AZMC 4WZSB 5E5AC 3UTBA 1HTAA 3AN2A 1P3FD 2F8NH 3AV2C 5GSUB 5CP6A 3AZIC 3TU4B 5AV9C 3AZMA 5E5AA 3REHB 4R8PA 1P3LD 2BYMB 3AV2A 3AZIA 5AV9A 5BO0B 3WAAC 3O62C 3X1UD 4WU8B 3MNNB 5CPJB 4H9QA 3A6ND 5GSUC 3WAAA 4J8WD 3TU4C 4H9NB 3REHC 1P3BB 5GT3B 5GSUA 5B2IA 5B0YD 5BT1D 3TU4A 3REJD 2HIOD 3R45A 3MNNC 5AVCB 3MGQA 3AZHB 4WU8C 2BYMA 5CPJC 5B2JB 5BO0A 3MNNA 3MGSB 1ZLAB 2LY8A 1P3BC 5GT3C 5B1MB 4X23D 5G49B 4H9NA 5AVCC 3AZHC 5GT0B 3B0CT 5GT3A 4G92B 3C1CD 4J8XB 5B2JC 1EQZD 5CPKD 5B0ZD 3UT9D 5AVCA 4NE3A 3AZHA 3MGSC 1M1AD 1ZLAC 5CPIA 5B1MC 1AOID 3NQJB 3VH5T 3LELD 3MGSA 1ZLAA 5GT0C 3REKB 5AY8D 5B1MA 5BNXB 5G49A 4J8XC 4G92C 5CHLB 3VH6T 5GT0A 4J8XA 3RELD 3WTPA 3B6FD 3REKC 4AWLB 3AV1B 3LJAB 3UTAD 3NQJA 3C1BD 4EO5B 4DRBA 3X1SB 3KUYB 2FJ7D 3KXBD 3REKA 4WU9D 5BNXA 3W98B 4KGCD 4H9RB 3KWQD 1KX4D 2BYKB 3AV1C 4AWLC 1M19A 3LJAC 1R4VA 2NQBD 3AZFB 1B6WA 3AYWD 4EO5C 5GXQB 5JA4A 5B31D 3KUYC 3X1SC 3AV1A 4J8VD 3W98C 3AZND 3W96D 1KX5B 3B6GD 4QLCD 3X1SA 3KUYA 4YS3B 1WWIA 3W98A 4H9RA 2YFWB 3AZFC 5GXQC 4XZQA 2BYKA 1S32B 5AVBD 5AV8C 3AZFA 1KX5C 5GXQA 3AZEB 4YS3C 3B0BA 4J8UB 3W97B 3LZ1B 3AZGD 3REID 3X1TD 4YS3A 4NE6A 4ZUXB 3MGPB 1S32C 3W99D 4ZBJB 3LZ0B 2YFWA 1KX3D 1BH9B 1S32A 3AZEC 5CP6B 2F8NK 3WKJB 3W97C 4J8UC 3LZ1C 3B0CW 5F99B 4R8PB 3AZEA 4J8UA 4ZUXC 3MGPC 3LZ1A 4JJNB 3LZ0C 4ZBJC 5B33A 5B1LA 4H9QB 3AFAD 4ZUXA 3VH5W 5CP6C 3MGPA 3WKJC 1ULYA 3LZ0A 4E45A 5F99C 3VH6W 4R8PC 4LD9A 1BH9A 2F8ND 5B2IB 3WKJA 1P3LB 4H9SA 5F99A 4JJNC 3R45B 3MGQB 5AV6B 3X1UB 1JFIB 2RVQD 3WA9A 4JJNA 4J8WB 3AV2D 5B2IC 1P3LC 2L5AA 5B40D 3MGQC 1P3GD 4XUJD 4KUDD 5AV6C 3X1UC 3WAAD 4E44A 3O62D 1P3LA 4J8WC 1P3OD 5AV6A 3X1UA 1JFIA 4CSRB 3TU4D 5CPIB 1P3PD 3A6NA 3REHD 4J8WA 5BT1C 5AV5D 5B32B 1P3KB 4Z5TD 5B24D 5JRGB 1P3MB 4WU8D 5B0YA 1EQZB 5CPJD 3REJA 2HIOA 5CPKB 5B0ZB 5CPIC 5FUGB 3WTPB 1M1AB 1AOIB 1P3BD 5GT3D 1P3ID 4CSRA 3LELB 5B32C 5BNVB 1P3KC 4HGAB 5JRGC 5AY8B 1P3MC 4X23A 5AVCD 2IO5B 3AZHD 1EQZC 5B2JD 5CPKC 5B32A 5B0ZC 1P3KA 5JRGA 4H9OB 4YM6D 1P3MA 1ID3D 3WTPC 3C1CA 1M1AC 1EQZA 3RELB 5CPKA 5B0ZA 3LELC 5FUGA 1M19B 3AZKB 1M1AA 4HGAC 5AY8C 3V9RA 5JA4B 2IO5C 5GT0D 1AOIA 4J8XD 2FJ7B 3LELA 5BNVA 5AY8A 4KGCB 3X1VB 3RELC 1M19C 4H9OA 3AZKC 2NZDB 3AZJB 2AROD 3MGRD 4XZQB 3RELA 3AYWB 2FJ7C 5B31B 3AZKA 4KGCC 1KU5A 1M18D 3W96B 3X1VC 2FJ7A 2NZDC 4KGCA 3AZJC 4XZQC 3X1VA 3LJAD 3AYWC 2CV5D 5B31C 2NZDA 5DNNB 1KX4A 3AZJA 3X1SD 5C3IB 3KUYD 1P3AD 5DNMD 3W96C 2NQBA 1TZYD 3AYWA 1WWSA 5B31A 4J8VA 3W96A 3AZNA 3B6GA 1U35B 1N1JB 3REIB 5DNNC 5GXQD 5C3IC 3AZLD 5B33B 5B1LB 3W99B 5AV8D 4Z66D 1KX3B 5DNNA 1KX5D 1F66D 2PYOD 4LD9B 1U35C 1P34D 3REIC 3MVDD 4WNNA 4H9PA 4DRAA 5B33C 1HQ3D 5B1LC 3W99C 1N1JA 1U35A 3WTPE 3REIA 1S32D 3WA9B 1KX3C 1F1EA 1BFMA 3W99A 4LD9C 3W97D 4J8UD 1KX3A 3LZ1D 1P3FB 2F8NB 4H9SC 2YFVA 3WA9C 3NQUA 3UTBD 3AN2D 5CP6D 3WKJD 3VH5A 3AZMD 1P3FC 3B0DB 5E5AD 3AFAA 3A6NB 4R8PD 3VH6A 3AZID 4NE5A 5B40B 5AV9D 1P3GB 4XUJB 1P3FA 2F8NA 4KUDB 5B32G 1H3OB 5B0YB 2RVQC 3REJB 2HIOB 4CAYB 1P3OB 4NFTA 3B0DC 3A6NC 5KDMB 1P3PB 5GSUD 5B2ID 5B40C 3B6GB 1P3GC 4XUJC 4KUDC 5AV5B 4X23B 5B0YC 2HUEB 3MGQD 4Z5TB 5B24B 5AV6D 3REJC 2HIOC 5B40A 1P3GA 4XUJA 1P3OC 1Q9CA 3KSYA 4KUDA 3MNND 1H3OA 3C1CB 3O62A 4CAYA 1P3PC 3UT9B 1P3OA 1BH8B 1P3IB 5AV5C 3V9RB 4X23C 2HUEC 4Z5TC 5KDMA 5B24C 1P3PA 3REHA 5AV5A 3C1CC 4Z5TA 5B24A 4YM6B 1ID3B 4WU8A 5CPID 3UT9C 5CPJA 1P3IC 3MGSD 1ZLAD 1AOIC 5B1MD 3B6FB 5B32D 3UT9A 1P3KD 1BH8A 5JRGD 1P3BA 1P3MD 1P3IA 5B31G 3UTAB 4YM6C 2CWEA 3C1BB 1ID3C 3KXBB 3WTPD 5B2JA 4WU9B 4YM6A 1ID3A 2AROB 3KWQB 3B6FC 3MGRB 1KX4B 4G91B 3UTAC 3REKD 2NQBB 3B6FA 3C1BC 1M18B 3KXBC 4J8VB 4WU9C 3UTAA 3AZNB 4M6BA
chains in the Genus database with same CATH superfamily
4QLCB 3C1BA 2AROC 3KXBA 3KWQC 3AZKD 3MGRC 1M19D 4WU9A 1KX4C 4G91C 2CV5B 3AV1D 2AROA 2JE5A 2NQBC 3KWQA 3MGRA 1P3AB 4Z2MG 1M18C 5DNMB 1TZYB 4J8VC 4KHAB 5AVBB 3X1VD 3AZNC 1A7WA 3B6GC 3W98D 4QLCC 1B67A 1M18A 2XD5A 4WNNB 2NZDD 3AZJD 1TAFB 4H9PB 4XZQD 2CV5C 4WV4B 3AZGB 4QLCA 3X1TB 3AZLB 1P3AC 3FDDA 5DNMC 3AZFD 1TZYC 5AV8B 4Z66B 3LJAA 2CV5A 5AVBC 1F66B 2PYOB 4UUZB 1P3AA 5DNMA 1TZYA 1P34B 2YFVB 4KHAA 5AVBA 3MVDB 4YS3D 2F8NG 3AZGC 3X1TC 5DNND 2JSSA 3AZLC 1HQ3B 1TAFA 2ZY4A 3NQUB 4Z66C 3AZGA 1F66C 2PYOC 3X1TA 3AZLA 3AFAB 5AV8A 4Z66A 1P34C 3MVDC 3AZED 1U35D 2DF4C 1KX5A 1F66A 2PYOA 4UUZA 1HQ3C 1P34A 4DQYB 5B33D 5B1LD 4Z2MH 3MVDA 4ZUXD 3MGPD 3UTBB 3AN2B 5BS7C 2ZY3A 3LZ0D 1HQ3A 3AFAC 4LD9D 3AZMB 5E5AB 2Y2HA 5BS7A 3AV2B 5F99D 3AZIB 3W97A 5AV9B 3WA9D 3UTBC 3AN2C 4JJND 3WAAB 3O62B 3AZMC 3A1IA 4WZSB 5E5AC 3UTBA 2Y2GA 1HTAA 2Y2QA 3AN2A 1P3FD 2F8NH 3AV2C 5GSUB 5CP6A 3AZIC 3TU4B 5AV9C 3AZMA 5E5AA 3REHB 4R8PA 1P3LD 2BYMB 3AV2A 3AZIA 5AV9A 5BO0B 3WAAC 3O62C 3X1UD 4WU8B 2ZY5A 3MNNB 5CPJB 4H9QA 3A6ND 5GSUC 3WAAA 4J8WD 3TU4C 4H9NB 3EPJA 3REHC 1P3BB 5GT3B 5GSUA 5B2IA 5B0YD 5BT1D 3TU4A 3REJD 2HIOD 3R45A 3MNNC 5AVCB 3MGQA 3AZHB 4WU8C 2BYMA 5CPJC 5B2JB 5BO0A 3MNNA 3MGSB 1ZLAB 2LY8A 1P3BC 5GT3C 5B1MB 4X23D 5G49B 4H9NA 5AVCC 3AZHC 5GT0B 3B0CT 5GT3A 4G92B 3C1CD 4J8XB 5B2JC 1EQZD 2Y2OA 5CPKD 5B0ZD 3UT9D 5AVCA 4NE3A 3AZHA 2XD1A 3MGSC 1M1AD 1ZLAC 5CPIA 5B1MC 1AOID 3NQJB 3VH5T 3LELD 2JCHA 3MGSA 1ZLAA 5GT0C 3REKB 5AY8D 5B1MA 5BNXB 5G49A 4J8XC 4G92C 5CHLB 3VH6T 2RIQA 5GT0A 4J8XA 3RELD 3WTPA 3B6FD 2UWXA 3REKC 4AWLB 3AV1B 3LJAB 3UTAD 3NQJA 3C1BD 4EO5B 4DRBA 3X1SB 3KUYB 2FJ7D 3KXBD 3REKA 4WU9D 5BNXA 3W98B 4KGCD 1Z2CB 4H9RB 3KWQD 2FFFB 1T3UA 1KX4D 2BYKB 3AV1C 4AWLC 1M19A 3LJAC 1R4VA 2NQBD 3AZFB 1B6WA 2Y2IA 3AYWD 4EO5C 5GXQB 5JA4A 5B31D 3KUYC 3X1SC 3AV1A 4J8VD 3W98C 3AZND 3W96D 4UPKA 1KX5B 3B6GD 4QLCD 3X1SA 3KUYA 4YS3B 1WWIA 3F6TA 3W98A 4H9RA 2YFWB 3AZFC 5GXQC 4XZQA 2BYKA 1S32B 5AVBD 5AV8C 3AZFA 1KX5C 5GXQA 3AZEB 4YS3C 3B0BA 4J8UB 3W97B 3LZ1B 3AZGD 3REID 3X1TD 4YS3A 4NE6A 4ZUXB 3MGPB 1S32C 3W99D 4ZBJB 3LZ0B 2YFWA 1KX3D 1BH9B 3KFUG 1S32A 3AZEC 5CP6B 2F8NK 3WKJB 2Y2MA 4J8UC 3W97C 3LZ1C 3B0CW 5F99B 4R8PB 3AZEA 4J8UA 4ZUXC 3MGPC 3LZ1A 4JJNB 3LZ0C 4ZBJC 5B33A 5B1LA 4H9QB 3AFAD 4ZUXA 3VH5W 5CP6C 3MGPA 3WKJC 1ULYA 2Y2NA 3IP4C 3LZ0A 4E45A 5F99C 3VH6W 4R8PC 4LD9A 1BH9A 2F8ND 5B2IB 3WKJA 1P3LB 4H9SA 5F99A 4JJNC 2Y2PA 3R45B 3MGQB 5AV6B 3X1UB 1JFIB 2RVQD 3WA9A 4JJNA 2W8SA 4J8WB 3AV2D 5B2IC 1P3LC 2L5AA 5B40D 3MGQC 1P3GD 4XUJD 4KUDD 5AV6C 3X1UC 3WAAD 4E44A 3O62D 1P3LA 4J8WC 1P3OD 5AV6A 3X1UA 1JFIA 4CSRB 3TU4D 5CPIB 1P3PD 3H0RC 3A6NA 3REHD 4J8WA 5BT1C 2Y2JA 5AV5D 5B32B 2J8PA 1P3KB 4Z5TD 5B24D 5JRGB 1P3MB 4WU8D 5B0YA 1EQZB 5CPJD 3REJA 2HIOA 5CPKB 5B0ZB 5CPIC 5FUGB 3WTPB 1M1AB 1AOIB 1P3BD 5GT3D 1P3ID 4CSRA 3LELB 5B32C 5BNVB 1P3KC 4HGAB 5JRGC 5AY8B 1P3MC 4X23A 5AVCD 2IO5B 3AZHD 1EQZC 3AL0C 5B2JD 5CPKC 5B32A 5B0ZC 1P3KA 5JRGA 4H9OB 4YM6D 1P3MA 1ID3D 3WTPC 3C1CA 1M1AC 1EQZA 3RELB 5CPKA 5B0ZA 3LELC 5FUGA 1M19B 3AZKB 1M1AA 2BG1A 4HGAC 5AY8C 3V9RA 5JA4B 2ZM5A 2IO5C 5GT0D 1AOIA 4J8XD 2FJ7B 3LELA 5BNVA 5AY8A 4KGCB 3X1VB 3RELC 1M19C 4H9OA 3AZKC 2NZDB 3AZJB 2AROD 3MGRD 4XZQB 3RELA 3AYWB 2FJ7C 5B31B 3AZKA 4KGCC 1KU5A 1M18D 3W96B 3X1VC 2FJ7A 1W2EA 2NZDC 4KGCA 3AZJC 4XZQC 3X1VA 2ZY2A 3LJAD 3AYWC 2CV5D 5B31C 2NZDA 5DNNB 1KX4A 3AZJA 3X1SD 5C3IB 3KUYD 4WJ3C 1P3AD 5DNMD 3W96C 2NQBA 1TZYD 3AYWA 3EPLA 1WWSA 5B31A 4J8VA 2Y2KA 3W96A 3AZNA 3B6GA 1U35B 1N1JB 3REIB 3P5JB 5DNNC 5GXQD 5C3IC 3AZLD 2Y2LA 5B33B 5B1LB 3W99B 5AV8D 4Z66D 1KX3B 5DNNA 1KX5D 1F66D 2PYOD 1PZRA 4LD9B 1U35C 1P34D 3REIC 3MVDD 4WNNA 4H9PA 4DRAA 3EPKA 5B33C 1HQ3D 5B1LC 3W99C 1N1JA 1U35A 3WTPE 3REIA 1S32D 3WA9B 1KX3C 1F1EA 2DQNC 1BFMA 3W99A 4LD9C 3W97D 4J8UD 1KX3A 3LZ1D 2VQRA 1P3FB 2F8NB 4H9SC 2YFVA 3H0LC 3WA9C 2G5HC 3NQUA 3UTBD 3AN2D 3A1KA 5CP6D 3WKJD 3VH5A 3AZMD 1P3FC 3B0DB 5E5AD 3AFAA 3A6NB 4R8PD 3VH6A 3AZID 4NE5A 5B40B 5AV9D 1P3GB 4XUJB 1P3FA 2F8NA 4KUDB 5B32G 1H3OB 5B0YB 2RVQC 3REJB 2HIOB 4CAYB 1P3OB 4NFTA 3B0DC 3A6NC 5KDMB 1P3PB 5GSUD 5B2ID 5B40C 3B6GB 1P3GC 4XUJC 4KUDC 5AV5B 4X23B 5B0YC 2HUEB 3MGQD 4Z5TB 5B24B 5AV6D 3REJC 2HIOC 5B40A 1P3GA 4XUJA 1P3OC 1Q9CA 3KSYA 4KUDA 3MNND 1H3OA 3C1CB 3O62A 4CAYA 1P3PC 3UT9B 1P3OA 1BH8B 3EPHA 1P3IB 5AV5C 3V9RB 4X23C 2HUEC 4Z5TC 5KDMA 5B24C 1P3PA 3REHA 5AV5A 3C1CC 4Z5TA 5B24A 2F2AC 4YM6B 1ID3B 4WU8A 2G5IC 5CPID 3UT9C 5CPJA 1P3IC 3MGSD 1ZLAD 1AOIC 5B1MD 3B6FB 5B32D 3UT9A 1P3KD 1BH8A 5JRGD 1P3BA 1P3MD 1P3IA 5B31G 3UTAB 4YM6C 2CWEA 3C1BB 1ID3C 3KXBB 3WTPD 5B2JA 4WU9B 4YM6A 1ID3A 2AROB 3KWQB 3B6FC 3MGRB 1KX4B 4G91B 3H0MC 3UTAC 3REKD 2NQBB 3B6FA 3C1BC 1M18B 3KXBC 3EG5B 4J8VB 4WU9C 3UTAA 3AZNB 4M6BA
chains in the Genus database with same CATH topology
4QLCB 3C1BA 2AROC 3KXBA 3KWQC 3AZKD 3MGRC 1M19D 4WU9A 1KX4C 4G91C 2CV5B 3AV1D 2AROA 2JE5A 2NQBC 3KWQA 3MGRA 1P3AB 4Z2MG 1M18C 5DNMB 1TZYB 4J8VC 4KHAB 5AVBB 3X1VD 3AZNC 1A7WA 3B6GC 3W98D 4QLCC 1B67A 1M18A 2XD5A 4WNNB 2NZDD 3AZJD 1TAFB 4H9PB 4XZQD 2CV5C 4WV4B 3AZGB 4QLCA 3X1TB 3AZLB 1P3AC 3FDDA 5DNMC 3AZFD 1TZYC 5AV8B 4Z66B 3LJAA 2CV5A 5AVBC 1F66B 2PYOB 4UUZB 1P3AA 5DNMA 1TZYA 1P34B 2YFVB 4KHAA 5AVBA 3MVDB 4YS3D 2F8NG 3AZGC 3X1TC 5DNND 2JSSA 3AZLC 1HQ3B 1TAFA 2ZY4A 3NQUB 4Z66C 3AZGA 1F66C 2PYOC 3X1TA 3AZLA 3AFAB 5AV8A 4Z66A 1P34C 3MVDC 3AZED 1U35D 2DF4C 1KX5A 1F66A 2PYOA 4UUZA 1HQ3C 1P34A 4DQYB 5B33D 5B1LD 4Z2MH 3MVDA 4ZUXD 3MGPD 3UTBB 3AN2B 5BS7C 2ZY3A 3LZ0D 1HQ3A 3AFAC 4LD9D 3AZMB 5E5AB 2Y2HA 5BS7A 3AV2B 5F99D 3AZIB 3W97A 5AV9B 3WA9D 3UTBC 3AN2C 4JJND 3WAAB 3O62B 3AZMC 3A1IA 4WZSB 5E5AC 3UTBA 2Y2GA 1HTAA 2Y2QA 3AN2A 1P3FD 2F8NH 3AV2C 5GSUB 5CP6A 3AZIC 3TU4B 5AV9C 3AZMA 5E5AA 3REHB 4R8PA 1P3LD 2BYMB 3AV2A 3AZIA 5AV9A 5BO0B 3WAAC 3O62C 3X1UD 4WU8B 2ZY5A 3MNNB 5CPJB 4H9QA 3A6ND 5GSUC 3WAAA 4J8WD 3TU4C 4H9NB 3EPJA 3REHC 1P3BB 5GT3B 5GSUA 5B2IA 5B0YD 5BT1D 3TU4A 3REJD 2HIOD 3R45A 3MNNC 5AVCB 3MGQA 3AZHB 4WU8C 2BYMA 5CPJC 5B2JB 5BO0A 3MNNA 3MGSB 1ZLAB 2LY8A 1P3BC 5GT3C 5B1MB 4X23D 5G49B 4H9NA 5AVCC 3AZHC 5GT0B 3B0CT 5GT3A 4G92B 3C1CD 4J8XB 5B2JC 1EQZD 2Y2OA 5CPKD 5B0ZD 3UT9D 5AVCA 4NE3A 3AZHA 2XD1A 3MGSC 1M1AD 1ZLAC 5CPIA 5B1MC 1AOID 3NQJB 3VH5T 3LELD 2JCHA 3MGSA 1ZLAA 5GT0C 3REKB 5AY8D 5B1MA 5BNXB 5G49A 4J8XC 4G92C 5CHLB 3VH6T 2RIQA 5GT0A 4J8XA 3RELD 3WTPA 3B6FD 2UWXA 3REKC 4AWLB 3AV1B 3LJAB 3UTAD 3NQJA 3C1BD 4EO5B 4DRBA 3X1SB 3KUYB 2FJ7D 3KXBD 3REKA 4WU9D 5BNXA 3W98B 4KGCD 1Z2CB 4H9RB 3KWQD 2FFFB 1T3UA 1KX4D 2BYKB 3AV1C 4AWLC 1M19A 3LJAC 1R4VA 2NQBD 3AZFB 1B6WA 2Y2IA 3AYWD 4EO5C 5GXQB 5JA4A 5B31D 3KUYC 3X1SC 3AV1A 4J8VD 3W98C 3AZND 3W96D 4UPKA 1KX5B 3B6GD 4QLCD 3X1SA 3KUYA 4YS3B 1WWIA 3F6TA 3W98A 4H9RA 2YFWB 3AZFC 5GXQC 4XZQA 2BYKA 1S32B 5AVBD 5AV8C 3AZFA 1KX5C 5GXQA 3AZEB 4YS3C 3B0BA 4J8UB 3W97B 3LZ1B 3AZGD 3REID 3X1TD 4YS3A 4NE6A 4ZUXB 3MGPB 1S32C 3W99D 4ZBJB 3LZ0B 2YFWA 1KX3D 1BH9B 3KFUG 1S32A 3AZEC 5CP6B 2F8NK 3WKJB 2Y2MA 4J8UC 3W97C 3LZ1C 3B0CW 5F99B 4R8PB 3AZEA 4J8UA 4ZUXC 3MGPC 3LZ1A 4JJNB 3LZ0C 4ZBJC 5B33A 5B1LA 4H9QB 3AFAD 4ZUXA 3VH5W 5CP6C 3MGPA 3WKJC 1ULYA 2Y2NA 3IP4C 3LZ0A 4E45A 5F99C 3VH6W 4R8PC 4LD9A 1BH9A 2F8ND 5B2IB 3WKJA 1P3LB 4H9SA 5F99A 4JJNC 2Y2PA 3R45B 3MGQB 5AV6B 3X1UB 1JFIB 2RVQD 3WA9A 4JJNA 2W8SA 4J8WB 3AV2D 5B2IC 1P3LC 2L5AA 5B40D 3MGQC 1P3GD 4XUJD 4KUDD 5AV6C 3X1UC 3WAAD 4E44A 3O62D 1P3LA 4J8WC 1P3OD 5AV6A 3X1UA 1JFIA 4CSRB 3TU4D 5CPIB 1P3PD 3H0RC 3A6NA 3REHD 4J8WA 5BT1C 2Y2JA 5AV5D 5B32B 2J8PA 1P3KB 4Z5TD 5B24D 5JRGB 1P3MB 4WU8D 5B0YA 1EQZB 5CPJD 3REJA 2HIOA 5CPKB 5B0ZB 5CPIC 5FUGB 3WTPB 1M1AB 1AOIB 1P3BD 5GT3D 1P3ID 4CSRA 3LELB 5B32C 5BNVB 1P3KC 4HGAB 5JRGC 5AY8B 1P3MC 4X23A 5AVCD 2IO5B 3AZHD 1EQZC 3AL0C 5B2JD 5CPKC 5B32A 5B0ZC 1P3KA 5JRGA 4H9OB 4YM6D 1P3MA 1ID3D 3WTPC 3C1CA 1M1AC 1EQZA 3RELB 5CPKA 5B0ZA 3LELC 5FUGA 1M19B 3AZKB 1M1AA 2BG1A 4HGAC 5AY8C 3V9RA 5JA4B 2ZM5A 2IO5C 5GT0D 1AOIA 4J8XD 2FJ7B 3LELA 5BNVA 5AY8A 4KGCB 3X1VB 3RELC 1M19C 4H9OA 3AZKC 2NZDB 3AZJB 2AROD 3MGRD 4XZQB 3RELA 3AYWB 2FJ7C 5B31B 3AZKA 4KGCC 1KU5A 1M18D 3W96B 3X1VC 2FJ7A 1W2EA 2NZDC 4KGCA 3AZJC 4XZQC 3X1VA 2ZY2A 3LJAD 3AYWC 2CV5D 5B31C 2NZDA 5DNNB 1KX4A 3AZJA 3X1SD 5C3IB 3KUYD 4WJ3C 1P3AD 5DNMD 3W96C 2NQBA 1TZYD 3AYWA 3EPLA 1WWSA 5B31A 4J8VA 2Y2KA 3W96A 3AZNA 3B6GA 1U35B 1N1JB 3REIB 3P5JB 5DNNC 5GXQD 5C3IC 3AZLD 2Y2LA 5B33B 5B1LB 3W99B 5AV8D 4Z66D 1KX3B 5DNNA 1KX5D 1F66D 2PYOD 1PZRA 4LD9B 1U35C 1P34D 3REIC 3MVDD 4WNNA 4H9PA 4DRAA 3EPKA 5B33C 1HQ3D 5B1LC 3W99C 1N1JA 1U35A 3WTPE 3REIA 1S32D 3WA9B 1KX3C 1F1EA 2DQNC 1BFMA 3W99A 4LD9C 3W97D 4J8UD 1KX3A 3LZ1D 2VQRA 1P3FB 2F8NB 4H9SC 2YFVA 3H0LC 3WA9C 2G5HC 3NQUA 3UTBD 3AN2D 3A1KA 5CP6D 3WKJD 3VH5A 3AZMD 1P3FC 3B0DB 5E5AD 3AFAA 3A6NB 4R8PD 3VH6A 3AZID 4NE5A 5B40B 5AV9D 1P3GB 4XUJB 1P3FA 2F8NA 4KUDB 5B32G 1H3OB 5B0YB 2RVQC 3REJB 2HIOB 4CAYB 1P3OB 4NFTA 3B0DC 3A6NC 5KDMB 1P3PB 5GSUD 5B2ID 5B40C 3B6GB 1P3GC 4XUJC 4KUDC 5AV5B 4X23B 5B0YC 2HUEB 3MGQD 4Z5TB 5B24B 5AV6D 3REJC 2HIOC 5B40A 1P3GA 4XUJA 1P3OC 1Q9CA 3KSYA 4KUDA 3MNND 1H3OA 3C1CB 3O62A 4CAYA 1P3PC 3UT9B 1P3OA 1BH8B 3EPHA 1P3IB 5AV5C 3V9RB 4X23C 2HUEC 4Z5TC 5KDMA 5B24C 1P3PA 3REHA 5AV5A 3C1CC 4Z5TA 5B24A 2F2AC 4YM6B 1ID3B 4WU8A 2G5IC 5CPID 3UT9C 5CPJA 1P3IC 3MGSD 1ZLAD 1AOIC 5B1MD 3B6FB 5B32D 3UT9A 1P3KD 1BH8A 5JRGD 1P3BA 1P3MD 1P3IA 5B31G 3UTAB 4YM6C 2CWEA 3C1BB 1ID3C 3KXBB 3WTPD 5B2JA 4WU9B 4YM6A 1ID3A 2AROB 3KWQB 3B6FC 3MGRB 1KX4B 4G91B 3H0MC 3UTAC 3REKD 2NQBB 3B6FA 3C1BC 1M18B 3KXBC 3EG5B 4J8VB 4WU9C 3UTAA 3AZNB 4M6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QLC B;  3C1B A;  2ARO C;  3KXB A;  3KWQ C;  3AZK D;  3MGR C;  1M19 D;  4WU9 A;  1KX4 C;  4G91 C;  2CV5 B;  3AV1 D;  2ARO A;  2NQB C;  3KWQ A;  3MGR A;  1P3A B;  4Z2M G;  1M18 C;  5DNM B;  1TZY B;  4J8V C;  4KHA B;  5AVB B;  3X1V D;  3AZN C;  1A7W A;  3B6G C;  3W98 D;  4QLC C;  1B67 A;  1M18 A;  2NZD D;  4WNN B;  3AZJ D;  1TAF B;  4H9P B;  4XZQ D;  2CV5 C;  4WV4 B;  3AZG B;  4QLC A;  3X1T B;  3AZL B;  1P3A C;  5DNM C;  3AZF D;  1TZY C;  5AV8 B;  4Z66 B;  3LJA A;  2CV5 A;  5AVB C;  1F66 B;  2PYO B;  4UUZ B;  1P3A A;  5DNM A;  1TZY A;  1P34 B;  2YFV B;  4KHA A;  5AVB A;  3MVD B;  4YS3 D;  2F8N G;  3AZG C;  3X1T C;  5DNN D;  2JSS A;  3AZL C;  1HQ3 B;  1TAF A;  3NQU B;  4Z66 C;  3AZG A;  1F66 C;  2PYO C;  3X1T A;  3AZL A;  3AFA B;  5AV8 A;  4Z66 A;  1P34 C;  3MVD C;  3AZE D;  1U35 D;  1KX5 A;  1F66 A;  2PYO A;  4UUZ A;  1HQ3 C;  1P34 A;  5B33 D;  5B1L D;  4Z2M H;  3MVD A;  4ZUX D;  3MGP D;  3UTB B;  3AN2 B;  5BS7 C;  3LZ0 D;  1HQ3 A;  3AFA C;  4LD9 D;  3AZM B;  5E5A B;  5BS7 A;  3AV2 B;  5F99 D;  3AZI B;  3W97 A;  5AV9 B;  3WA9 D;  3UTB C;  3AN2 C;  4JJN D;  3WAA B;  3O62 B;  3AZM C;  4WZS B;  5E5A C;  3UTB A;  1HTA A;  3AN2 A;  1P3F D;  2F8N H;  3AV2 C;  5GSU B;  5CP6 A;  3AZI C;  3TU4 B;  5AV9 C;  3AZM A;  5E5A A;  3REH B;  4R8P A;  1P3L D;  2BYM B;  3AV2 A;  3AZI A;  5AV9 A;  5BO0 B;  3WAA C;  3O62 C;  3X1U D;  4WU8 B;  3MNN B;  5CPJ B;  4H9Q A;  3A6N D;  5GSU C;  3WAA A;  4J8W D;  3TU4 C;  4H9N B;  3REH C;  1P3B B;  5GT3 B;  5GSU A;  5B2I A;  5B0Y D;  5BT1 D;  3TU4 A;  3REJ D;  2HIO D;  3R45 A;  3MNN C;  5AVC B;  3MGQ A;  3AZH B;  4WU8 C;  2BYM A;  5CPJ C;  5B2J B;  5BO0 A;  3MNN A;  3MGS B;  1ZLA B;  2LY8 A;  1P3B C;  5GT3 C;  5B1M B;  4X23 D;  5G49 B;  4H9N A;  5AVC C;  3AZH C;  5GT0 B;  3B0C T;  5GT3 A;  4G92 B;  3C1C D;  4J8X B;  5B2J C;  1EQZ D;  5CPK D;  5B0Z D;  3UT9 D;  5AVC A;  4NE3 A;  3AZH A;  3MGS C;  1M1A D;  1ZLA C;  5CPI A;  5B1M C;  1AOI D;  3NQJ B;  3VH5 T;  3LEL D;  3MGS A;  1ZLA A;  5GT0 C;  3REK B;  5AY8 D;  5B1M A;  5BNX B;  5G49 A;  4J8X C;  4G92 C;  5CHL B;  3VH6 T;  5GT0 A;  4J8X A;  3REL D;  3WTP A;  3B6F D;  3REK C;  4AWL B;  3AV1 B;  3LJA B;  3UTA D;  3NQJ A;  3C1B D;  4EO5 B;  4DRB A;  3X1S B;  3KUY B;  2FJ7 D;  3KXB D;  3REK A;  4WU9 D;  5BNX A;  3W98 B;  4KGC D;  4H9R B;  3KWQ D;  1KX4 D;  2BYK B;  3AV1 C;  4AWL C;  1M19 A;  3LJA C;  1R4V A;  2NQB D;  3AZF B;  1B6W A;  3AYW D;  4EO5 C;  5GXQ B;  5JA4 A;  5B31 D;  3KUY C;  3X1S C;  3AV1 A;  4J8V D;  3W98 C;  3AZN D;  3W96 D;  1KX5 B;  3B6G D;  4QLC D;  3X1S A;  3KUY A;  4YS3 B;  1WWI A;  3W98 A;  4H9R A;  2YFW B;  3AZF C;  5GXQ C;  4XZQ A;  2BYK A;  1S32 B;  5AVB D;  5AV8 C;  3AZF A;  1KX5 C;  5GXQ A;  3AZE B;  4YS3 C;  3B0B A;  4J8U B;  3W97 B;  3LZ1 B;  3AZG D;  3REI D;  3X1T D;  4YS3 A;  4NE6 A;  4ZUX B;  3MGP B;  1S32 C;  3W99 D;  4ZBJ B;  3LZ0 B;  2YFW A;  1KX3 D;  1BH9 B;  1S32 A;  3AZE C;  5CP6 B;  2F8N K;  3WKJ B;  3W97 C;  4J8U C;  3LZ1 C;  3B0C W;  5F99 B;  4R8P B;  3AZE A;  4J8U A;  4ZUX C;  3MGP C;  3LZ1 A;  4JJN B;  3LZ0 C;  4ZBJ C;  5B33 A;  5B1L A;  4H9Q B;  3AFA D;  4ZUX A;  3VH5 W;  5CP6 C;  3MGP A;  3WKJ C;  1ULY A;  3LZ0 A;  4E45 A;  5F99 C;  3VH6 W;  4R8P C;  4LD9 A;  1BH9 A;  2F8N D;  5B2I B;  3WKJ A;  1P3L B;  4H9S A;  5F99 A;  4JJN C;  3R45 B;  3MGQ B;  5AV6 B;  3X1U B;  1JFI B;  2RVQ D;  3WA9 A;  4JJN A;  4J8W B;  3AV2 D;  5B2I C;  1P3L C;  2L5A A;  5B40 D;  3MGQ C;  1P3G D;  4XUJ D;  4KUD D;  5AV6 C;  3X1U C;  3WAA D;  4E44 A;  3O62 D;  1P3L A;  4J8W C;  1P3O D;  5AV6 A;  3X1U A;  1JFI A;  4CSR B;  3TU4 D;  5CPI B;  1P3P D;  3A6N A;  3REH D;  4J8W A;  5BT1 C;  5AV5 D;  5B32 B;  1P3K B;  4Z5T D;  5B24 D;  5JRG B;  1P3M B;  4WU8 D;  5B0Y A;  1EQZ B;  5CPJ D;  3REJ A;  2HIO A;  5CPK B;  5B0Z B;  5CPI C;  5FUG B;  3WTP B;  1M1A B;  1AOI B;  1P3B D;  5GT3 D;  1P3I D;  4CSR A;  3LEL B;  5B32 C;  5BNV B;  1P3K C;  4HGA B;  5JRG C;  5AY8 B;  1P3M C;  4X23 A;  5AVC D;  2IO5 B;  3AZH D;  1EQZ C;  5B2J D;  5CPK C;  5B32 A;  5B0Z C;  1P3K A;  5JRG A;  4H9O B;  4YM6 D;  1P3M A;  1ID3 D;  3WTP C;  3C1C A;  1M1A C;  1EQZ A;  3REL B;  5CPK A;  5B0Z A;  3LEL C;  5FUG A;  1M19 B;  3AZK B;  1M1A A;  4HGA C;  5AY8 C;  3V9R A;  5JA4 B;  2IO5 C;  5GT0 D;  1AOI A;  4J8X D;  2FJ7 B;  3LEL A;  5BNV A;  5AY8 A;  4KGC B;  3X1V B;  3REL C;  1M19 C;  4H9O A;  3AZK C;  2NZD B;  3AZJ B;  2ARO D;  3MGR D;  4XZQ B;  3REL A;  3AYW B;  2FJ7 C;  5B31 B;  3AZK A;  4KGC C;  1KU5 A;  1M18 D;  3W96 B;  3X1V C;  2FJ7 A;  2NZD C;  4KGC A;  3AZJ C;  4XZQ C;  3X1V A;  3LJA D;  3AYW C;  2CV5 D;  5B31 C;  2NZD A;  5DNN B;  1KX4 A;  3AZJ A;  3X1S D;  5C3I B;  3KUY D;  1P3A D;  5DNM D;  3W96 C;  2NQB A;  1TZY D;  3AYW A;  1WWS A;  5B31 A;  4J8V A;  3W96 A;  3AZN A;  3B6G A;  1U35 B;  1N1J B;  3REI B;  5DNN C;  5GXQ D;  5C3I C;  3AZL D;  5B33 B;  5B1L B;  3W99 B;  5AV8 D;  4Z66 D;  1KX3 B;  5DNN A;  1KX5 D;  1F66 D;  2PYO D;  4LD9 B;  1U35 C;  1P34 D;  3REI C;  3MVD D;  4WNN A;  4H9P A;  4DRA A;  5B33 C;  1HQ3 D;  5B1L C;  3W99 C;  1N1J A;  1U35 A;  3WTP E;  3REI A;  1S32 D;  3WA9 B;  1KX3 C;  1F1E A;  1BFM A;  3W99 A;  4LD9 C;  3W97 D;  4J8U D;  1KX3 A;  3LZ1 D;  1P3F B;  2F8N B;  4H9S C;  2YFV A;  3WA9 C;  3NQU A;  3UTB D;  3AN2 D;  5CP6 D;  3WKJ D;  3VH5 A;  3AZM D;  1P3F C;  3B0D B;  5E5A D;  3AFA A;  3A6N B;  4R8P D;  3VH6 A;  3AZI D;  4NE5 A;  5B40 B;  5AV9 D;  1P3G B;  4XUJ B;  1P3F A;  2F8N A;  4KUD B;  5B32 G;  1H3O B;  5B0Y B;  2RVQ C;  3REJ B;  2HIO B;  4CAY B;  1P3O B;  4NFT A;  3B0D C;  3A6N C;  5KDM B;  1P3P B;  5GSU D;  5B2I D;  5B40 C;  3B6G B;  1P3G C;  4XUJ C;  4KUD C;  5AV5 B;  4X23 B;  5B0Y C;  2HUE B;  3MGQ D;  4Z5T B;  5B24 B;  5AV6 D;  3REJ C;  2HIO C;  5B40 A;  1P3G A;  4XUJ A;  1P3O C;  1Q9C A;  3KSY A;  4KUD A;  3MNN D;  1H3O A;  3C1C B;  3O62 A;  4CAY A;  1P3P C;  3UT9 B;  1P3O A;  1BH8 B;  1P3I B;  5AV5 C;  3V9R B;  4X23 C;  2HUE C;  4Z5T C;  5KDM A;  5B24 C;  1P3P A;  3REH A;  5AV5 A;  3C1C C;  4Z5T A;  5B24 A;  4YM6 B;  1ID3 B;  4WU8 A;  5CPI D;  3UT9 C;  5CPJ A;  1P3I C;  3MGS D;  1ZLA D;  1AOI C;  5B1M D;  3B6F B;  5B32 D;  3UT9 A;  1P3K D;  1BH8 A;  5JRG D;  1P3B A;  1P3M D;  1P3I A;  5B31 G;  3UTA B;  4YM6 C;  2CWE A;  3C1B B;  1ID3 C;  3KXB B;  3WTP D;  5B2J A;  4WU9 B;  4YM6 A;  1ID3 A;  2ARO B;  3KWQ B;  3B6F C;  3MGR B;  1KX4 B;  4G91 B;  3UTA C;  3REK D;  2NQB B;  3B6F A;  3C1B C;  1M18 B;  3KXB C;  4J8V B;  4WU9 C;  3UTA A;  3AZN B;  4M6B A; 
#chains in the Genus database with same CATH topology
 4QLC B;  3C1B A;  2ARO C;  3KXB A;  3KWQ C;  3AZK D;  3MGR C;  1M19 D;  4WU9 A;  1KX4 C;  4G91 C;  2CV5 B;  3AV1 D;  2ARO A;  2JE5 A;  2NQB C;  3KWQ A;  3MGR A;  1P3A B;  4Z2M G;  1M18 C;  5DNM B;  1TZY B;  4J8V C;  4KHA B;  5AVB B;  3X1V D;  3AZN C;  1A7W A;  3B6G C;  3W98 D;  4QLC C;  1B67 A;  1M18 A;  2XD5 A;  4WNN B;  2NZD D;  3AZJ D;  1TAF B;  4H9P B;  4XZQ D;  2CV5 C;  4WV4 B;  3AZG B;  4QLC A;  3X1T B;  3AZL B;  1P3A C;  3FDD A;  5DNM C;  3AZF D;  1TZY C;  5AV8 B;  4Z66 B;  3LJA A;  2CV5 A;  5AVB C;  1F66 B;  2PYO B;  4UUZ B;  1P3A A;  5DNM A;  1TZY A;  1P34 B;  2YFV B;  4KHA A;  5AVB A;  3MVD B;  4YS3 D;  2F8N G;  3AZG C;  3X1T C;  5DNN D;  2JSS A;  3AZL C;  1HQ3 B;  1TAF A;  2ZY4 A;  3NQU B;  4Z66 C;  3AZG A;  1F66 C;  2PYO C;  3X1T A;  3AZL A;  3AFA B;  5AV8 A;  4Z66 A;  1P34 C;  3MVD C;  3AZE D;  1U35 D;  2DF4 C;  1KX5 A;  1F66 A;  2PYO A;  4UUZ A;  1HQ3 C;  1P34 A;  4DQY B;  5B33 D;  5B1L D;  4Z2M H;  3MVD A;  4ZUX D;  3MGP D;  3UTB B;  3AN2 B;  5BS7 C;  2ZY3 A;  3LZ0 D;  1HQ3 A;  3AFA C;  4LD9 D;  3AZM B;  5E5A B;  2Y2H A;  5BS7 A;  3AV2 B;  5F99 D;  3AZI B;  3W97 A;  5AV9 B;  3WA9 D;  3UTB C;  3AN2 C;  4JJN D;  3WAA B;  3O62 B;  3AZM C;  3A1I A;  4WZS B;  5E5A C;  3UTB A;  2Y2G A;  1HTA A;  2Y2Q A;  3AN2 A;  1P3F D;  2F8N H;  3AV2 C;  5GSU B;  5CP6 A;  3AZI C;  3TU4 B;  5AV9 C;  3AZM A;  5E5A A;  3REH B;  4R8P A;  1P3L D;  2BYM B;  3AV2 A;  3AZI A;  5AV9 A;  5BO0 B;  3WAA C;  3O62 C;  3X1U D;  4WU8 B;  2ZY5 A;  3MNN B;  5CPJ B;  4H9Q A;  3A6N D;  5GSU C;  3WAA A;  4J8W D;  3TU4 C;  4H9N B;  3EPJ A;  3REH C;  1P3B B;  5GT3 B;  5GSU A;  5B2I A;  5B0Y D;  5BT1 D;  3TU4 A;  3REJ D;  2HIO D;  3R45 A;  3MNN C;  5AVC B;  3MGQ A;  3AZH B;  4WU8 C;  2BYM A;  5CPJ C;  5B2J B;  5BO0 A;  3MNN A;  3MGS B;  1ZLA B;  2LY8 A;  1P3B C;  5GT3 C;  5B1M B;  4X23 D;  5G49 B;  4H9N A;  5AVC C;  3AZH C;  5GT0 B;  3B0C T;  5GT3 A;  4G92 B;  3C1C D;  4J8X B;  5B2J C;  1EQZ D;  2Y2O A;  5CPK D;  5B0Z D;  3UT9 D;  5AVC A;  4NE3 A;  3AZH A;  2XD1 A;  3MGS C;  1M1A D;  1ZLA C;  5CPI A;  5B1M C;  1AOI D;  3NQJ B;  3VH5 T;  3LEL D;  2JCH A;  3MGS A;  1ZLA A;  5GT0 C;  3REK B;  5AY8 D;  5B1M A;  5BNX B;  5G49 A;  4J8X C;  4G92 C;  5CHL B;  3VH6 T;  2RIQ A;  5GT0 A;  4J8X A;  3REL D;  3WTP A;  3B6F D;  2UWX A;  3REK C;  4AWL B;  3AV1 B;  3LJA B;  3UTA D;  3NQJ A;  3C1B D;  4EO5 B;  4DRB A;  3X1S B;  3KUY B;  2FJ7 D;  3KXB D;  3REK A;  4WU9 D;  5BNX A;  3W98 B;  4KGC D;  1Z2C B;  4H9R B;  3KWQ D;  2FFF B;  1T3U A;  1KX4 D;  2BYK B;  3AV1 C;  4AWL C;  1M19 A;  3LJA C;  1R4V A;  2NQB D;  3AZF B;  1B6W A;  2Y2I A;  3AYW D;  4EO5 C;  5GXQ B;  5JA4 A;  5B31 D;  3KUY C;  3X1S C;  3AV1 A;  4J8V D;  3W98 C;  3AZN D;  3W96 D;  4UPK A;  1KX5 B;  3B6G D;  4QLC D;  3X1S A;  3KUY A;  4YS3 B;  1WWI A;  3F6T A;  3W98 A;  4H9R A;  2YFW B;  3AZF C;  5GXQ C;  4XZQ A;  2BYK A;  1S32 B;  5AVB D;  5AV8 C;  3AZF A;  1KX5 C;  5GXQ A;  3AZE B;  4YS3 C;  3B0B A;  4J8U B;  3W97 B;  3LZ1 B;  3AZG D;  3REI D;  3X1T D;  4YS3 A;  4NE6 A;  4ZUX B;  3MGP B;  1S32 C;  3W99 D;  4ZBJ B;  3LZ0 B;  2YFW A;  1KX3 D;  1BH9 B;  3KFU G;  1S32 A;  3AZE C;  5CP6 B;  2F8N K;  3WKJ B;  2Y2M A;  4J8U C;  3W97 C;  3LZ1 C;  3B0C W;  5F99 B;  4R8P B;  3AZE A;  4J8U A;  4ZUX C;  3MGP C;  3LZ1 A;  4JJN B;  3LZ0 C;  4ZBJ C;  5B33 A;  5B1L A;  4H9Q B;  3AFA D;  4ZUX A;  3VH5 W;  5CP6 C;  3MGP A;  3WKJ C;  1ULY A;  2Y2N A;  3IP4 C;  3LZ0 A;  4E45 A;  5F99 C;  3VH6 W;  4R8P C;  4LD9 A;  1BH9 A;  2F8N D;  5B2I B;  3WKJ A;  1P3L B;  4H9S A;  5F99 A;  4JJN C;  2Y2P A;  3R45 B;  3MGQ B;  5AV6 B;  3X1U B;  1JFI B;  2RVQ D;  3WA9 A;  4JJN A;  2W8S A;  4J8W B;  3AV2 D;  5B2I C;  1P3L C;  2L5A A;  5B40 D;  3MGQ C;  1P3G D;  4XUJ D;  4KUD D;  5AV6 C;  3X1U C;  3WAA D;  4E44 A;  3O62 D;  1P3L A;  4J8W C;  1P3O D;  5AV6 A;  3X1U A;  1JFI A;  4CSR B;  3TU4 D;  5CPI B;  1P3P D;  3H0R C;  3A6N A;  3REH D;  4J8W A;  5BT1 C;  2Y2J A;  5AV5 D;  5B32 B;  2J8P A;  1P3K B;  4Z5T D;  5B24 D;  5JRG B;  1P3M B;  4WU8 D;  5B0Y A;  1EQZ B;  5CPJ D;  3REJ A;  2HIO A;  5CPK B;  5B0Z B;  5CPI C;  5FUG B;  3WTP B;  1M1A B;  1AOI B;  1P3B D;  5GT3 D;  1P3I D;  4CSR A;  3LEL B;  5B32 C;  5BNV B;  1P3K C;  4HGA B;  5JRG C;  5AY8 B;  1P3M C;  4X23 A;  5AVC D;  2IO5 B;  3AZH D;  1EQZ C;  3AL0 C;  5B2J D;  5CPK C;  5B32 A;  5B0Z C;  1P3K A;  5JRG A;  4H9O B;  4YM6 D;  1P3M A;  1ID3 D;  3WTP C;  3C1C A;  1M1A C;  1EQZ A;  3REL B;  5CPK A;  5B0Z A;  3LEL C;  5FUG A;  1M19 B;  3AZK B;  1M1A A;  2BG1 A;  4HGA C;  5AY8 C;  3V9R A;  5JA4 B;  2ZM5 A;  2IO5 C;  5GT0 D;  1AOI A;  4J8X D;  2FJ7 B;  3LEL A;  5BNV A;  5AY8 A;  4KGC B;  3X1V B;  3REL C;  1M19 C;  4H9O A;  3AZK C;  2NZD B;  3AZJ B;  2ARO D;  3MGR D;  4XZQ B;  3REL A;  3AYW B;  2FJ7 C;  5B31 B;  3AZK A;  4KGC C;  1KU5 A;  1M18 D;  3W96 B;  3X1V C;  2FJ7 A;  1W2E A;  2NZD C;  4KGC A;  3AZJ C;  4XZQ C;  3X1V A;  2ZY2 A;  3LJA D;  3AYW C;  2CV5 D;  5B31 C;  2NZD A;  5DNN B;  1KX4 A;  3AZJ A;  3X1S D;  5C3I B;  3KUY D;  4WJ3 C;  1P3A D;  5DNM D;  3W96 C;  2NQB A;  1TZY D;  3AYW A;  3EPL A;  1WWS A;  5B31 A;  4J8V A;  2Y2K A;  3W96 A;  3AZN A;  3B6G A;  1U35 B;  1N1J B;  3REI B;  3P5J B;  5DNN C;  5GXQ D;  5C3I C;  3AZL D;  2Y2L A;  5B33 B;  5B1L B;  3W99 B;  5AV8 D;  4Z66 D;  1KX3 B;  5DNN A;  1KX5 D;  1F66 D;  2PYO D;  1PZR A;  4LD9 B;  1U35 C;  1P34 D;  3REI C;  3MVD D;  4WNN A;  4H9P A;  4DRA A;  3EPK A;  5B33 C;  1HQ3 D;  5B1L C;  3W99 C;  1N1J A;  1U35 A;  3WTP E;  3REI A;  1S32 D;  3WA9 B;  1KX3 C;  1F1E A;  2DQN C;  1BFM A;  3W99 A;  4LD9 C;  3W97 D;  4J8U D;  1KX3 A;  3LZ1 D;  2VQR A;  1P3F B;  2F8N B;  4H9S C;  2YFV A;  3H0L C;  3WA9 C;  2G5H C;  3NQU A;  3UTB D;  3AN2 D;  3A1K A;  5CP6 D;  3WKJ D;  3VH5 A;  3AZM D;  1P3F C;  3B0D B;  5E5A D;  3AFA A;  3A6N B;  4R8P D;  3VH6 A;  3AZI D;  4NE5 A;  5B40 B;  5AV9 D;  1P3G B;  4XUJ B;  1P3F A;  2F8N A;  4KUD B;  5B32 G;  1H3O B;  5B0Y B;  2RVQ C;  3REJ B;  2HIO B;  4CAY B;  1P3O B;  4NFT A;  3B0D C;  3A6N C;  5KDM B;  1P3P B;  5GSU D;  5B2I D;  5B40 C;  3B6G B;  1P3G C;  4XUJ C;  4KUD C;  5AV5 B;  4X23 B;  5B0Y C;  2HUE B;  3MGQ D;  4Z5T B;  5B24 B;  5AV6 D;  3REJ C;  2HIO C;  5B40 A;  1P3G A;  4XUJ A;  1P3O C;  1Q9C A;  3KSY A;  4KUD A;  3MNN D;  1H3O A;  3C1C B;  3O62 A;  4CAY A;  1P3P C;  3UT9 B;  1P3O A;  1BH8 B;  3EPH A;  1P3I B;  5AV5 C;  3V9R B;  4X23 C;  2HUE C;  4Z5T C;  5KDM A;  5B24 C;  1P3P A;  3REH A;  5AV5 A;  3C1C C;  4Z5T A;  5B24 A;  2F2A C;  4YM6 B;  1ID3 B;  4WU8 A;  2G5I C;  5CPI D;  3UT9 C;  5CPJ A;  1P3I C;  3MGS D;  1ZLA D;  1AOI C;  5B1M D;  3B6F B;  5B32 D;  3UT9 A;  1P3K D;  1BH8 A;  5JRG D;  1P3B A;  1P3M D;  1P3I A;  5B31 G;  3UTA B;  4YM6 C;  2CWE A;  3C1B B;  1ID3 C;  3KXB B;  3WTP D;  5B2J A;  4WU9 B;  4YM6 A;  1ID3 A;  2ARO B;  3KWQ B;  3B6F C;  3MGR B;  1KX4 B;  4G91 B;  3H0M C;  3UTA C;  3REK D;  2NQB B;  3B6F A;  3C1B C;  1M18 B;  3KXB C;  3EG5 B;  4J8V B;  4WU9 C;  3UTA A;  3AZN B;  4M6B A; 
#chains in the Genus database with same CATH homology
 4QLC B;  3C1B A;  2ARO C;  3KXB A;  3KWQ C;  3AZK D;  3MGR C;  1M19 D;  4WU9 A;  1KX4 C;  4G91 C;  2CV5 B;  3AV1 D;  2ARO A;  2JE5 A;  2NQB C;  3KWQ A;  3MGR A;  1P3A B;  4Z2M G;  1M18 C;  5DNM B;  1TZY B;  4J8V C;  4KHA B;  5AVB B;  3X1V D;  3AZN C;  1A7W A;  3B6G C;  3W98 D;  4QLC C;  1B67 A;  1M18 A;  2XD5 A;  4WNN B;  2NZD D;  3AZJ D;  1TAF B;  4H9P B;  4XZQ D;  2CV5 C;  4WV4 B;  3AZG B;  4QLC A;  3X1T B;  3AZL B;  1P3A C;  3FDD A;  5DNM C;  3AZF D;  1TZY C;  5AV8 B;  4Z66 B;  3LJA A;  2CV5 A;  5AVB C;  1F66 B;  2PYO B;  4UUZ B;  1P3A A;  5DNM A;  1TZY A;  1P34 B;  2YFV B;  4KHA A;  5AVB A;  3MVD B;  4YS3 D;  2F8N G;  3AZG C;  3X1T C;  5DNN D;  2JSS A;  3AZL C;  1HQ3 B;  1TAF A;  2ZY4 A;  3NQU B;  4Z66 C;  3AZG A;  1F66 C;  2PYO C;  3X1T A;  3AZL A;  3AFA B;  5AV8 A;  4Z66 A;  1P34 C;  3MVD C;  3AZE D;  1U35 D;  2DF4 C;  1KX5 A;  1F66 A;  2PYO A;  4UUZ A;  1HQ3 C;  1P34 A;  4DQY B;  5B33 D;  5B1L D;  4Z2M H;  3MVD A;  4ZUX D;  3MGP D;  3UTB B;  3AN2 B;  5BS7 C;  2ZY3 A;  3LZ0 D;  1HQ3 A;  3AFA C;  4LD9 D;  3AZM B;  5E5A B;  2Y2H A;  5BS7 A;  3AV2 B;  5F99 D;  3AZI B;  3W97 A;  5AV9 B;  3WA9 D;  3UTB C;  3AN2 C;  4JJN D;  3WAA B;  3O62 B;  3AZM C;  3A1I A;  4WZS B;  5E5A C;  3UTB A;  2Y2G A;  1HTA A;  2Y2Q A;  3AN2 A;  1P3F D;  2F8N H;  3AV2 C;  5GSU B;  5CP6 A;  3AZI C;  3TU4 B;  5AV9 C;  3AZM A;  5E5A A;  3REH B;  4R8P A;  1P3L D;  2BYM B;  3AV2 A;  3AZI A;  5AV9 A;  5BO0 B;  3WAA C;  3O62 C;  3X1U D;  4WU8 B;  2ZY5 A;  3MNN B;  5CPJ B;  4H9Q A;  3A6N D;  5GSU C;  3WAA A;  4J8W D;  3TU4 C;  4H9N B;  3EPJ A;  3REH C;  1P3B B;  5GT3 B;  5GSU A;  5B2I A;  5B0Y D;  5BT1 D;  3TU4 A;  3REJ D;  2HIO D;  3R45 A;  3MNN C;  5AVC B;  3MGQ A;  3AZH B;  4WU8 C;  2BYM A;  5CPJ C;  5B2J B;  5BO0 A;  3MNN A;  3MGS B;  1ZLA B;  2LY8 A;  1P3B C;  5GT3 C;  5B1M B;  4X23 D;  5G49 B;  4H9N A;  5AVC C;  3AZH C;  5GT0 B;  3B0C T;  5GT3 A;  4G92 B;  3C1C D;  4J8X B;  5B2J C;  1EQZ D;  2Y2O A;  5CPK D;  5B0Z D;  3UT9 D;  5AVC A;  4NE3 A;  3AZH A;  2XD1 A;  3MGS C;  1M1A D;  1ZLA C;  5CPI A;  5B1M C;  1AOI D;  3NQJ B;  3VH5 T;  3LEL D;  2JCH A;  3MGS A;  1ZLA A;  5GT0 C;  3REK B;  5AY8 D;  5B1M A;  5BNX B;  5G49 A;  4J8X C;  4G92 C;  5CHL B;  3VH6 T;  2RIQ A;  5GT0 A;  4J8X A;  3REL D;  3WTP A;  3B6F D;  2UWX A;  3REK C;  4AWL B;  3AV1 B;  3LJA B;  3UTA D;  3NQJ A;  3C1B D;  4EO5 B;  4DRB A;  3X1S B;  3KUY B;  2FJ7 D;  3KXB D;  3REK A;  4WU9 D;  5BNX A;  3W98 B;  4KGC D;  1Z2C B;  4H9R B;  3KWQ D;  2FFF B;  1T3U A;  1KX4 D;  2BYK B;  3AV1 C;  4AWL C;  1M19 A;  3LJA C;  1R4V A;  2NQB D;  3AZF B;  1B6W A;  2Y2I A;  3AYW D;  4EO5 C;  5GXQ B;  5JA4 A;  5B31 D;  3KUY C;  3X1S C;  3AV1 A;  4J8V D;  3W98 C;  3AZN D;  3W96 D;  4UPK A;  1KX5 B;  3B6G D;  4QLC D;  3X1S A;  3KUY A;  4YS3 B;  1WWI A;  3F6T A;  3W98 A;  4H9R A;  2YFW B;  3AZF C;  5GXQ C;  4XZQ A;  2BYK A;  1S32 B;  5AVB D;  5AV8 C;  3AZF A;  1KX5 C;  5GXQ A;  3AZE B;  4YS3 C;  3B0B A;  4J8U B;  3W97 B;  3LZ1 B;  3AZG D;  3REI D;  3X1T D;  4YS3 A;  4NE6 A;  4ZUX B;  3MGP B;  1S32 C;  3W99 D;  4ZBJ B;  3LZ0 B;  2YFW A;  1KX3 D;  1BH9 B;  3KFU G;  1S32 A;  3AZE C;  5CP6 B;  2F8N K;  3WKJ B;  2Y2M A;  4J8U C;  3W97 C;  3LZ1 C;  3B0C W;  5F99 B;  4R8P B;  3AZE A;  4J8U A;  4ZUX C;  3MGP C;  3LZ1 A;  4JJN B;  3LZ0 C;  4ZBJ C;  5B33 A;  5B1L A;  4H9Q B;  3AFA D;  4ZUX A;  3VH5 W;  5CP6 C;  3MGP A;  3WKJ C;  1ULY A;  2Y2N A;  3IP4 C;  3LZ0 A;  4E45 A;  5F99 C;  3VH6 W;  4R8P C;  4LD9 A;  1BH9 A;  2F8N D;  5B2I B;  3WKJ A;  1P3L B;  4H9S A;  5F99 A;  4JJN C;  2Y2P A;  3R45 B;  3MGQ B;  5AV6 B;  3X1U B;  1JFI B;  2RVQ D;  3WA9 A;  4JJN A;  2W8S A;  4J8W B;  3AV2 D;  5B2I C;  1P3L C;  2L5A A;  5B40 D;  3MGQ C;  1P3G D;  4XUJ D;  4KUD D;  5AV6 C;  3X1U C;  3WAA D;  4E44 A;  3O62 D;  1P3L A;  4J8W C;  1P3O D;  5AV6 A;  3X1U A;  1JFI A;  4CSR B;  3TU4 D;  5CPI B;  1P3P D;  3H0R C;  3A6N A;  3REH D;  4J8W A;  5BT1 C;  2Y2J A;  5AV5 D;  5B32 B;  2J8P A;  1P3K B;  4Z5T D;  5B24 D;  5JRG B;  1P3M B;  4WU8 D;  5B0Y A;  1EQZ B;  5CPJ D;  3REJ A;  2HIO A;  5CPK B;  5B0Z B;  5CPI C;  5FUG B;  3WTP B;  1M1A B;  1AOI B;  1P3B D;  5GT3 D;  1P3I D;  4CSR A;  3LEL B;  5B32 C;  5BNV B;  1P3K C;  4HGA B;  5JRG C;  5AY8 B;  1P3M C;  4X23 A;  5AVC D;  2IO5 B;  3AZH D;  1EQZ C;  3AL0 C;  5B2J D;  5CPK C;  5B32 A;  5B0Z C;  1P3K A;  5JRG A;  4H9O B;  4YM6 D;  1P3M A;  1ID3 D;  3WTP C;  3C1C A;  1M1A C;  1EQZ A;  3REL B;  5CPK A;  5B0Z A;  3LEL C;  5FUG A;  1M19 B;  3AZK B;  1M1A A;  2BG1 A;  4HGA C;  5AY8 C;  3V9R A;  5JA4 B;  2ZM5 A;  2IO5 C;  5GT0 D;  1AOI A;  4J8X D;  2FJ7 B;  3LEL A;  5BNV A;  5AY8 A;  4KGC B;  3X1V B;  3REL C;  1M19 C;  4H9O A;  3AZK C;  2NZD B;  3AZJ B;  2ARO D;  3MGR D;  4XZQ B;  3REL A;  3AYW B;  2FJ7 C;  5B31 B;  3AZK A;  4KGC C;  1KU5 A;  1M18 D;  3W96 B;  3X1V C;  2FJ7 A;  1W2E A;  2NZD C;  4KGC A;  3AZJ C;  4XZQ C;  3X1V A;  2ZY2 A;  3LJA D;  3AYW C;  2CV5 D;  5B31 C;  2NZD A;  5DNN B;  1KX4 A;  3AZJ A;  3X1S D;  5C3I B;  3KUY D;  4WJ3 C;  1P3A D;  5DNM D;  3W96 C;  2NQB A;  1TZY D;  3AYW A;  3EPL A;  1WWS A;  5B31 A;  4J8V A;  2Y2K A;  3W96 A;  3AZN A;  3B6G A;  1U35 B;  1N1J B;  3REI B;  3P5J B;  5DNN C;  5GXQ D;  5C3I C;  3AZL D;  2Y2L A;  5B33 B;  5B1L B;  3W99 B;  5AV8 D;  4Z66 D;  1KX3 B;  5DNN A;  1KX5 D;  1F66 D;  2PYO D;  1PZR A;  4LD9 B;  1U35 C;  1P34 D;  3REI C;  3MVD D;  4WNN A;  4H9P A;  4DRA A;  3EPK A;  5B33 C;  1HQ3 D;  5B1L C;  3W99 C;  1N1J A;  1U35 A;  3WTP E;  3REI A;  1S32 D;  3WA9 B;  1KX3 C;  1F1E A;  2DQN C;  1BFM A;  3W99 A;  4LD9 C;  3W97 D;  4J8U D;  1KX3 A;  3LZ1 D;  2VQR A;  1P3F B;  2F8N B;  4H9S C;  2YFV A;  3H0L C;  3WA9 C;  2G5H C;  3NQU A;  3UTB D;  3AN2 D;  3A1K A;  5CP6 D;  3WKJ D;  3VH5 A;  3AZM D;  1P3F C;  3B0D B;  5E5A D;  3AFA A;  3A6N B;  4R8P D;  3VH6 A;  3AZI D;  4NE5 A;  5B40 B;  5AV9 D;  1P3G B;  4XUJ B;  1P3F A;  2F8N A;  4KUD B;  5B32 G;  1H3O B;  5B0Y B;  2RVQ C;  3REJ B;  2HIO B;  4CAY B;  1P3O B;  4NFT A;  3B0D C;  3A6N C;  5KDM B;  1P3P B;  5GSU D;  5B2I D;  5B40 C;  3B6G B;  1P3G C;  4XUJ C;  4KUD C;  5AV5 B;  4X23 B;  5B0Y C;  2HUE B;  3MGQ D;  4Z5T B;  5B24 B;  5AV6 D;  3REJ C;  2HIO C;  5B40 A;  1P3G A;  4XUJ A;  1P3O C;  1Q9C A;  3KSY A;  4KUD A;  3MNN D;  1H3O A;  3C1C B;  3O62 A;  4CAY A;  1P3P C;  3UT9 B;  1P3O A;  1BH8 B;  3EPH A;  1P3I B;  5AV5 C;  3V9R B;  4X23 C;  2HUE C;  4Z5T C;  5KDM A;  5B24 C;  1P3P A;  3REH A;  5AV5 A;  3C1C C;  4Z5T A;  5B24 A;  2F2A C;  4YM6 B;  1ID3 B;  4WU8 A;  2G5I C;  5CPI D;  3UT9 C;  5CPJ A;  1P3I C;  3MGS D;  1ZLA D;  1AOI C;  5B1M D;  3B6F B;  5B32 D;  3UT9 A;  1P3K D;  1BH8 A;  5JRG D;  1P3B A;  1P3M D;  1P3I A;  5B31 G;  3UTA B;  4YM6 C;  2CWE A;  3C1B B;  1ID3 C;  3KXB B;  3WTP D;  5B2J A;  4WU9 B;  4YM6 A;  1ID3 A;  2ARO B;  3KWQ B;  3B6F C;  3MGR B;  1KX4 B;  4G91 B;  3H0M C;  3UTA C;  3REK D;  2NQB B;  3B6F A;  3C1B C;  1M18 B;  3KXB C;  3EG5 B;  4J8V B;  4WU9 C;  3UTA A;  3AZN B;  4M6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...