5CP6A

Nucleosome core particle with adducts from the anticancer compound, [(eta6-5,8,9,10-tetrahydroanthracene)ru(ethylenediamine)cl][pf6]
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
96
structure length
96
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Organometallic Compound which Exhibits a DNA Topology-Dependent One-Stranded Intercalation Mode.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords DNA (145-MER)
total genus 30
structure length 96
sequence length 96
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5cp6A00
5CPJD 3W96A 3LZ0C 5B24B 3AFAA 4H9NA 5B1LD 4WU8B 5B2JA 3X1TC 1BH8B 3AZKC 4ZBJC 1Q9CA 2JSSA 4HGAC 3LJAA 1P3MB 1F66D 2FJ7B 3B6FB 1M1AB 2HIOA 5B40D 3KUYD 4ZUXC 4J8WA 3X1VD 1P3FA 3REJA 5E5AD 1B6WA 4EO5B 3LJAC 3REIA 1KX4B 5G49B 1F1EA 1KX5A 5AV5B 2F8NK 2AROD 3AYWA 3AFAC 1M18D 3AZJA 3REKA 2AROB 2NZDC 3NQJB 2BYKA 4EO5C 1AOIA 3AZNA 1P3OD 1ZLAB 3AZHD 3NQUA 3C1BC 3AZEB 2YFWA 5B0YB 3LZ1D 4WV4B 5DNNA 1P34B 3C1CD 1P3GB 1N1JA 5GSUB 4R8PA 4J8XD 3W97D 3VH5W 5BT1D 1M19C 1P3PC 3REIB 3W97A 4J8XA 4R8PD 3C1CA 5C3IB 5DNND 5AY8B 5AVCC 3LZ1A 4J8WB 3AZJB 3AZHA 3AZND 5G49A 1P3OA 1TAFB 1AOID 3AYWB 3REKD 3AZJD 1M18A 3O62B 3KWQB 2IO5C 4Z5TB 2AROA 3AYWD 5FUGB 3AZGB 5CHLB 1KX5D 3REID 3LELB 3X1UC 1ID3B 5E5AA 4JJNC 3MGQB 5CPIC 3REJD 4WU9B 3X1VA 4J8WD 5B40A 3KUYA 2HIOD 1P3FD 4UUZA 3LJAD 1F66A 1JFIB 5B2JD 4H9OA 5B1LA 3AFAD 5BS7C 3W96D 5CPJA 1KX3D 4KHAB 5B33A 4H9RA 4XZQD 1M1AA 1B67A 1U35A 5BO0B 5B31A 2FJ7D 1WWSA 3B6FD 4XUJD 1ZLAC 4H9OB 4WU8D 1BFMA 5AVBC 4WU9A 4Z2MH 4YM6D 3KXBC 5B31C 1S32D 3WA9A 3AN2C 3AZLC 5B33C 3REHB 3REKB 1P3BB 4CAYA 3AV2D 5B32C 3W99C 3LELD 4NE5A 4LD9B 5GSUC 2AROC 3X1TB 3W99B 3REHD 3AZEA 5CP6C 3LZ0B 3V9RB 1U35B 2BYKB 1AOIB 5CP6B 3X1TD 5B31B 3WAAB 2F8ND 1P3MC 3R45A 3NQUB 1P3KA 3UT9C 2RVQC 2YFWB 5B0YD 1TZYB 5AV6B 3AN2B 3A6NB 1ULYA 4WU8C 3MNNC 2YFVB 4KUDD 4J8UA 3KSYA 3KXBD 1P3LB 3VH6T 3O62A 3KWQA 3AZKB 1P3BA 3W96B 3AZGA 3UTBA 5B32B 3W98C 4J8UC 2NQBD 3AZIC 1P3OB 5GT0C 5DNMC 3RELC 3MGQA 1KU5A 3WKJD 1P3MD 1ID3D 4X23B 2YFVA 1TZYC 5AV6C 2BYMB 4Z66B 5BT1C 5GT3B 5DNNC 3UTAC 1P3PA 3X1VB 3AZMA 1EQZD 1P3FB 4R8PC 4Z5TC 1H3OA 3W99D 3MGSA 1JFIA 5AV8C 3WAAD 4YS3A 5B1LB 4JJNB 5CP6D 4DRAA 4J8VC 3AZHC 3C1BD 3MGPC 3AZJC 2NZDA 1P3GA 4JJND 3AZID 2CV5B 5C3IC 1HQ3B 5BNXA 5AVBA 2RVQD 4H9RB 4X23D 3MGRB 1KX5C 1ZLAA 5B2IA 3AZFB 3B0DB 3X1UD 5B31G 1P3IA 4H9PB 3TU4D 4KGCC 3VH5T 5AVCD 4XUJC 3X1SA 3UTAD 2NQBB 5CPIA 3MGPA 5DNMB 1KX3C 1HQ3C 4H9SC 5KDMB 3AZNC 3AZLD 1KX3B 3W96C 3LZ0A 2PYOA 5B24A 5DNMD 2CV5A 5CPJC 5CPKA 5B1LC 4LD9A 5B0ZC 3R45B 3MVDC 3LJAB 3AZKD 2F8NH 5F99B 3WTPE 1P3FC 1TZYA 5AV6A 5FUGA 3WTPD 4ZUXB 5AV5D 2NZDB 3A6NA 3AFAB 4H9QB 5B2JB 4Z66C 3UTAB 4KGCB 4ZBJB 5JRGB 5B2IB 3AZFA 2FJ7C 3B6FC 1P3KB 3AN2D 1P3LA 5KDMA 4Z5TD 5B0YC 4CSRB 1P3IB 5B0ZA 3MGRD 3AZGC 1HQ3D 1KX4A 3O62C 3KWQC 4LD9C 3W98B 1P3AD 5AV9B 2HUEC 5DNNB 1HTAA 1P34A 3REHC 3W98D 1N1JB 5GSUA 5GXQA 5B32A 1P3LC 5JRGD 5GT0D 3RELD 4KGCA 1M19A 4Z66A 4WZSB 3WKJB 3UT9A 3X1SC 1S32B 3AZMC 3WTPC 5AY8A 4HGAB 4YM6C 3MNND 4QLCD 4ZUXA 3B6GD 1S32C 2HUEB 5AV9C 3AV1D 2F8NG 4CAYB 3MVDA 5GT3A 5B1MA 3AZMB 3C1CB 5F99D 4J8VA 5GXQB 4AWLB 3VH6W 1P3AC 1BH8A 5AV8A 2CWEA 4QLCB 5AV9A 3WKJC 3KXBB 4DRBA 5JA4A 5BNXB 5B2IC 5CPIB 5B2JC 5CPJB 1P3KC 5AV9D 3AV1C 5AV8D 3UTBB 1BH9B 2F8NB 5BNVA 4E45A 1M18C 1R4VA 2PYOC 5JRGC 5F99A 4J8VD 4XZQC 5B1MD 5GT3D 3MVDD 5B33B 3AZFC 3AV2B 1P3PB 3AV1A 3WA9C 3B6GA 4ZUXD 4G92B 4QLCA 3MNNA 5AY8D 4XZQB 3WA9B 3UT9D 5B0ZB 4E44A 5BO0A 4Z66D 3AZHB 1M19D 3TU4C 1BH9A 4KGCD 3MGQC 5GT0A 3RELA 5JRGA 4YS3B 5B32D 5GXQD 3LELC 5GSUD 3UTBC 3W98A 1P34D 1P3AA 1KX4D 4H9SA 1HQ3A 3VH6A 3MGRA 5E5AB 3B0BA 3AV1B 1M18B 5B0ZD 4WU9C 4M6BA 4Z5TA 4NE6A 3MGSC 1P3LD 3AN2A 3AZFD 5GT0B 3RELB 3MGPB 2IO5B 3A6ND 4J8UB 3WTPA 5AV5A 1TZYD 5AV6D 3KUYC 5B40C 4J8VB 3X1VC 1P3GC 3AZKA 4KHAA 3AZEC 4LD9D 5CPKD 3AZIB 2CV5D 5DNMA 5B1MB 5B24D 2PYOD 3LZ0D 4Z2MG 5GT3C 4WNNA 3AZLA 3REIC 1P3AB 4YM6B 1P3OC 5AV5C 4H9QA 5JA4B 3MGPD 5CPID 3REJC 3UTAA 4J8WC 5BS7A 3X1SD 3VH5A 5AVCA 3LZ1C 3WTPB 3TU4A 3C1CC 1P3ID 1U35C 3LZ1B 3X1UA 1M1AC 5B2ID 1ZLAD 2LY8A 5AVBD 4X23A 3A6NC 2BYMA 1P34C 3AZIA 5E5AC 4JJNA 3WAAC 1P3GD 2NZDD 4CSRA 3C1BA 4WNNB 3AZLB 1P3BC 3MGSB 5F99C 5CP6A 4H9NB 4YS3D 3WAAA 1WWIA 3W99A 3MGSD 3B6GB 3UT9B 5B40B 3KUYB 3V9RA 1EQZA 3AZMD 4UUZB 1F66B 1P3PD 5AVBB 1ID3A 3MVDB 3W97C 1P3MA 1P3IC 3WKJA 3TU4B 5B32G 3REJB 5CPKC 1A7WA 3MGQD 3AZNB 5B24C 3REKC 2NQBA 3UTBD 3MGRC 3AZGD 1KX5B 1P3BD 5B1MC 3O62D 3KWQD 3KXBA 4YS3C 2PYOB 3B0CT 4J8UD 2NQBC 4J8XC 4KUDA 2HIOC 3W97B 5AV8B 5B0YA 4G92C 3B0DC 1EQZB 1F66C 4R8PB 4KUDC 1P3KD 4G91B 4QLCC 2F8NA 4XUJB 3B6GC 3X1TA 4J8XB 1TAFA 4NFTA 5GXQC 3AZED 3REHA 1H3OB 4G91C 3AYWC 2CV5C 3LELA 4KUDB 5BNVB 3AV2A 1M19B 1S32A 3WA9D 2HIOB 4YM6A 2L5AA 5AY8C 3X1UB 1ID3C 4WU9D 4X23C 4WU8A 3X1SB 1EQZC 4XUJA 2FJ7A 5B31D 3B6FA 5AVCB 1U35D 3MNNB 1M1AD 4XZQA 4H9PA 3AV2C 3B0CW 3NQJA 4NE3A 4AWLC 5B33D 5CPKB 1KX4C 3C1BB 1KX3A 1AOIC
chains in the Genus database with same CATH superfamily
5CPJD 3W96A 5B24B 3LZ0C 3AFAA 4H9NA 5B1LD 4WU8B 5B2JA 3X1TC 1BH8B 3AZKC 4ZBJC 1Q9CA 2JSSA 4HGAC 3LJAA 1P3MB 1F66D 2FJ7B 3B6FB 1M1AB 2HIOA 5B40D 3KUYD 4ZUXC 4J8WA 3X1VD 1P3FA 3REJA 5E5AD 1B6WA 4EO5B 3LJAC 3REIA 1KX4B 1PZRA 5G49B 1F1EA 1KX5A 5AV5B 2F8NK 2AROD 3AYWA 3AFAC 3EG5B 1M18D 3AZJA 3REKA 2AROB 2NZDC 3NQJB 2BYKA 4EO5C 1AOIA 3AZNA 1P3OD 1ZLAB 3AZHD 3NQUA 3C1BC 3AZEB 2YFWA 5B0YB 3LZ1D 4WV4B 5DNNA 1P34B 3C1CD 1P3GB 1N1JA 5GSUB 4R8PA 4J8XD 3W97D 3VH5W 5BT1D 1M19C 1P3PC 3REIB 3W97A 4J8XA 4R8PD 3C1CA 5C3IB 5DNND 5AY8B 5AVCC 2Y2JA 3LZ1A 4J8WB 3AZJB 2XD5A 3AZHA 3AZND 5G49A 1P3OA 1TAFB 1AOID 3KFUG 3AYWB 3REKD 3AZJD 1M18A 3O62B 3KWQB 2IO5C 4Z5TB 2AROA 3AYWD 5FUGB 3AZGB 5CHLB 1KX5D 3REID 3LELB 2Y2KA 3X1UC 1ID3B 5E5AA 4JJNC 3MGQB 5CPIC 3REJD 4WU9B 3X1VA 4J8WD 5B40A 3KUYA 2HIOD 1P3FD 4UUZA 3LJAD 1F66A 2Y2OA 3EPKA 1JFIB 5B2JD 4H9OA 5B1LA 3AFAD 5BS7C 3W96D 5CPJA 1KX3D 4KHAB 2RIQA 5B33A 4H9RA 4XZQD 1M1AA 1B67A 1U35A 5BO0B 5B31A 2FJ7D 1WWSA 3B6FD 4XUJD 1ZLAC 4H9OB 4WU8D 1BFMA 5AVBC 4WU9A 4Z2MH 4YM6D 3KXBC 5B31C 1S32D 3WA9A 3AN2C 3AZLC 5B33C 3REHB 3REKB 1P3BB 4CAYA 3AV2D 5B32C 3W99C 3LELD 4NE5A 4LD9B 5GSUC 2AROC 3X1TB 3W99B 3REHD 3AZEA 3H0MC 5CP6C 3LZ0B 3V9RB 1U35B 2BYKB 1AOIB 2F2AC 5CP6B 3X1TD 5B31B 3WAAB 2F8ND 1P3MC 3R45A 3NQUB 1P3KA 3UT9C 2RVQC 2YFWB 5B0YD 1TZYB 5AV6B 3AN2B 1T3UA 3A6NB 1ULYA 4WU8C 3MNNC 2YFVB 4KUDD 4J8UA 3KSYA 3KXBD 1P3LB 2ZY4A 3VH6T 3O62A 3KWQA 3AZKB 1P3BA 3W96B 3AZGA 2Y2LA 5B32B 3UTBA 3W98C 4J8UC 2NQBD 3AZIC 1P3OB 5GT0C 5DNMC 3RELC 3MGQA 1KU5A 3WKJD 1P3MD 2Y2HA 2G5IC 1ID3D 4X23B 2YFVA 1TZYC 5AV6C 2BYMB 4Z66B 5BT1C 5GT3B 5DNNC 3UTAC 1P3PA 3X1VB 3AZMA 1EQZD 1P3FB 4R8PC 4Z5TC 1H3OA 3W99D 3MGSA 1JFIA 5AV8C 3WAAD 4YS3A 5B1LB 4JJNB 5CP6D 4DRAA 4J8VC 3AZHC 3C1BD 3MGPC 2BG1A 3AZJC 2NZDA 1P3GA 4JJND 3AZID 2CV5B 5C3IC 1HQ3B 5BNXA 5AVBA 2RVQD 4H9RB 4X23D 3MGRB 1KX5C 1ZLAA 5B2IA 3AZFB 3B0DB 3FDDA 3X1UD 3EPJA 5B31G 1P3IA 4H9PB 3TU4D 4KGCC 3VH5T 5AVCD 4XUJC 2Y2PA 3X1SA 3F6TA 3UTAD 2NQBB 5CPIA 3MGPA 3EPLA 5DNMB 1HQ3C 1KX3C 4H9SC 5KDMB 3AZNC 3AZLD 1KX3B 3W96C 3LZ0A 2PYOA 5B24A 5DNMD 2CV5A 5CPJC 5CPKA 5B1LC 4LD9A 5B0ZC 3R45B 3MVDC 3LJAB 3AZKD 2F8NH 5F99B 3WTPE 1P3FC 5AV6A 1TZYA 5FUGA 5AV5D 4ZUXB 3WTPD 2NZDB 3A6NA 3AFAB 4H9QB 5B2JB 4Z66C 3UTAB 4KGCB 2Y2MA 4ZBJB 3P5JB 5JRGB 5B2IB 3AZFA 1P3KB 2FJ7C 3AN2D 3B6FC 1P3LA 5KDMA 4Z5TD 5B0YC 4CSRB 2Y2QA 1P3IB 5B0ZA 3MGRD 3AZGC 1HQ3D 1KX4A 3O62C 3KWQC 4LD9C 3W98B 1P3AD 5AV9B 2HUEC 5DNNB 1HTAA 1P34A 3H0RC 3REHC 3W98D 1N1JB 5GSUA 5GXQA 5B32A 1P3LC 5JRGD 5GT0D 3RELD 4WJ3C 4KGCA 1M19A 4Z66A 4WZSB 3WKJB 3UT9A 3X1SC 1S32B 3AZMC 3WTPC 5AY8A 4HGAB 4YM6C 3MNND 4QLCD 4ZUXA 3B6GD 1S32C 2HUEB 5AV9C 3AV1D 2F8NG 4CAYB 3MVDA 5GT3A 5B1MA 3AZMB 3C1CB 5F99D 4J8VA 5GXQB 4AWLB 2W8SA 3VH6W 1P3AC 1BH8A 5AV8A 2CWEA 4QLCB 5AV9A 3WKJC 3KXBB 4DRBA 5JA4A 5BNXB 5B2IC 5CPIB 5B2JC 5CPJB 1P3KC 5AV9D 3AV1C 2DF4C 5AV8D 2JCHA 3UTBB 1BH9B 2F8NB 5BNVA 4E45A 2ZY2A 2UWXA 3IP4C 1M18C 1R4VA 3A1IA 5JRGC 5F99A 4J8VD 2PYOC 4XZQC 5B1MD 5GT3D 3MVDD 5B33B 3AZFC 3AV2B 1P3PB 3AV1A 3WA9C 3B6GA 4ZUXD 4G92B 4QLCA 3MNNA 4DQYB 5AY8D 4XZQB 3WA9B 3UT9D 5B0ZB 4E44A 5BO0A 4Z66D 3AZHB 1M19D 3TU4C 1BH9A 4KGCD 3MGQC 5GT0A 3RELA 5JRGA 4YS3B 5B32D 5GXQD 3LELC 5GSUD 3UTBC 3W98A 1P34D 1P3AA 1KX4D 4H9SA 1HQ3A 3VH6A 3MGRA 5E5AB 3B0BA 3AV1B 1M18B 5B0ZD 4WU9C 2Y2IA 4M6BA 4Z5TA 4NE6A 3MGSC 1P3LD 3AN2A 3AZFD 5GT0B 3RELB 3MGPB 2IO5B 3A6ND 4J8UB 3WTPA 5AV5A 1TZYD 5AV6D 3KUYC 5B40C 4J8VB 3X1VC 1P3GC 3AZKA 4KHAA 3AZEC 4LD9D 5CPKD 3AZIB 2CV5D 5DNMA 5B1MB 5B24D 2PYOD 3LZ0D 4Z2MG 5GT3C 4WNNA 3AZLA 3REIC 1P3AB 4YM6B 1P3OC 5AV5C 4H9QA 5JA4B 3MGPD 5CPID 3REJC 3UTAA 4J8WC 5BS7A 3X1SD 3VH5A 2G5HC 5AVCA 3LZ1C 3WTPB 3TU4A 3C1CC 1P3ID 1U35C 3LZ1B 3X1UA 1M1AC 5B2ID 1ZLAD 2LY8A 5AVBD 4X23A 3A6NC 2BYMA 1P34C 3AZIA 5E5AC 4JJNA 3WAAC 1P3GD 2NZDD 4CSRA 3C1BA 3AL0C 4WNNB 3AZLB 1P3BC 3MGSB 5F99C 5CP6A 4H9NB 4YS3D 1W2EA 3WAAA 1WWIA 3W99A 3MGSD 3B6GB 3UT9B 5B40B 3KUYB 3V9RA 1EQZA 3AZMD 4UUZB 1F66B 1P3PD 5AVBB 1ID3A 3MVDB 3W97C 1P3MA 1P3IC 3WKJA 3TU4B 5B32G 3A1KA 3REJB 5CPKC 1A7WA 3MGQD 3AZNB 5B24C 2Y2NA 3REKC 2ZY5A 2NQBA 3EPHA 3UTBD 1Z2CB 3MGRC 3AZGD 1KX5B 2XD1A 1P3BD 2J8PA 5B1MC 3O62D 3KWQD 3KXBA 2VQRA 4YS3C 3B0CT 4J8UD 2PYOB 2NQBC 4J8XC 4KUDA 2HIOC 3W97B 5AV8B 5B0YA 4G92C 3B0DC 1EQZB 1F66C 2Y2GA 4R8PB 1P3KD 4KUDC 4G91B 4QLCC 2F8NA 4XUJB 3B6GC 3X1TA 3H0LC 4J8XB 1TAFA 2ZY3A 2ZM5A 4NFTA 5GXQC 3AZED 3REHA 1H3OB 4G91C 3AYWC 2CV5C 3LELA 4KUDB 5BNVB 4UPKA 3AV2A 1M19B 1S32A 3WA9D 2HIOB 4YM6A 2L5AA 5AY8C 3X1UB 1ID3C 4WU9D 2JE5A 4X23C 4WU8A 3X1SB 1EQZC 4XUJA 2FJ7A 5B31D 2FFFB 5AVCB 3B6FA 1U35D 3MNNB 1M1AD 4XZQA 4H9PA 3AV2C 3B0CW 3NQJA 4NE3A 2DQNC 5B33D 4AWLC 5CPKB 1KX4C 3C1BB 1KX3A 1AOIC
chains in the Genus database with same CATH topology
5CPJD 3W96A 5B24B 3LZ0C 3AFAA 4H9NA 5B1LD 4WU8B 5B2JA 3X1TC 1BH8B 3AZKC 4ZBJC 1Q9CA 2JSSA 4HGAC 3LJAA 1P3MB 1F66D 2FJ7B 3B6FB 1M1AB 2HIOA 5B40D 3KUYD 4ZUXC 4J8WA 3X1VD 1P3FA 3REJA 5E5AD 1B6WA 4EO5B 3LJAC 3REIA 1KX4B 1PZRA 5G49B 1F1EA 1KX5A 5AV5B 2F8NK 2AROD 3AYWA 3AFAC 3EG5B 1M18D 3AZJA 3REKA 2AROB 2NZDC 3NQJB 2BYKA 4EO5C 1AOIA 3AZNA 1P3OD 1ZLAB 3AZHD 3NQUA 3C1BC 3AZEB 2YFWA 5B0YB 3LZ1D 4WV4B 5DNNA 1P34B 3C1CD 1P3GB 1N1JA 5GSUB 4R8PA 4J8XD 3W97D 3VH5W 5BT1D 1M19C 1P3PC 3REIB 3W97A 4J8XA 4R8PD 3C1CA 5C3IB 5DNND 5AY8B 5AVCC 2Y2JA 3LZ1A 4J8WB 3AZJB 2XD5A 3AZHA 3AZND 5G49A 1P3OA 1TAFB 1AOID 3KFUG 3AYWB 3REKD 3AZJD 1M18A 3O62B 3KWQB 2IO5C 4Z5TB 2AROA 3AYWD 5FUGB 3AZGB 5CHLB 1KX5D 3REID 3LELB 2Y2KA 3X1UC 1ID3B 5E5AA 4JJNC 3MGQB 5CPIC 3REJD 4WU9B 3X1VA 4J8WD 5B40A 3KUYA 2HIOD 1P3FD 4UUZA 3LJAD 1F66A 2Y2OA 3EPKA 1JFIB 5B2JD 4H9OA 5B1LA 3AFAD 5BS7C 3W96D 5CPJA 1KX3D 4KHAB 2RIQA 5B33A 4H9RA 4XZQD 1M1AA 1B67A 1U35A 5BO0B 5B31A 2FJ7D 1WWSA 3B6FD 4XUJD 1ZLAC 4H9OB 4WU8D 1BFMA 5AVBC 4WU9A 4Z2MH 4YM6D 3KXBC 5B31C 1S32D 3WA9A 3AN2C 3AZLC 5B33C 3REHB 3REKB 1P3BB 4CAYA 3AV2D 5B32C 3W99C 3LELD 4NE5A 4LD9B 5GSUC 2AROC 3X1TB 3W99B 3REHD 3AZEA 3H0MC 5CP6C 3LZ0B 3V9RB 1U35B 2BYKB 1AOIB 2F2AC 5CP6B 3X1TD 5B31B 3WAAB 2F8ND 1P3MC 3R45A 3NQUB 1P3KA 3UT9C 2RVQC 2YFWB 5B0YD 1TZYB 5AV6B 3AN2B 1T3UA 3A6NB 1ULYA 4WU8C 3MNNC 2YFVB 4KUDD 4J8UA 3KSYA 3KXBD 1P3LB 2ZY4A 3VH6T 3O62A 3KWQA 3AZKB 1P3BA 3W96B 3AZGA 2Y2LA 5B32B 3UTBA 3W98C 4J8UC 2NQBD 3AZIC 1P3OB 5GT0C 5DNMC 3RELC 3MGQA 1KU5A 3WKJD 1P3MD 2Y2HA 2G5IC 1ID3D 4X23B 2YFVA 1TZYC 5AV6C 2BYMB 4Z66B 5BT1C 5GT3B 5DNNC 3UTAC 1P3PA 3X1VB 3AZMA 1EQZD 1P3FB 4R8PC 4Z5TC 1H3OA 3W99D 3MGSA 1JFIA 5AV8C 3WAAD 4YS3A 5B1LB 4JJNB 5CP6D 4DRAA 4J8VC 3AZHC 3C1BD 3MGPC 2BG1A 3AZJC 2NZDA 1P3GA 4JJND 3AZID 2CV5B 5C3IC 1HQ3B 5BNXA 5AVBA 2RVQD 4H9RB 4X23D 3MGRB 1KX5C 1ZLAA 5B2IA 3AZFB 3B0DB 3FDDA 3X1UD 3EPJA 5B31G 1P3IA 4H9PB 3TU4D 4KGCC 3VH5T 5AVCD 4XUJC 2Y2PA 3X1SA 3F6TA 3UTAD 2NQBB 5CPIA 3MGPA 3EPLA 5DNMB 1HQ3C 1KX3C 4H9SC 5KDMB 3AZNC 3AZLD 1KX3B 3W96C 3LZ0A 2PYOA 5B24A 5DNMD 2CV5A 5CPJC 5CPKA 5B1LC 4LD9A 5B0ZC 3R45B 3MVDC 3LJAB 3AZKD 2F8NH 5F99B 3WTPE 1P3FC 5AV6A 1TZYA 5FUGA 5AV5D 4ZUXB 3WTPD 2NZDB 3A6NA 3AFAB 4H9QB 5B2JB 4Z66C 3UTAB 4KGCB 2Y2MA 4ZBJB 3P5JB 5JRGB 5B2IB 3AZFA 1P3KB 2FJ7C 3AN2D 3B6FC 1P3LA 5KDMA 4Z5TD 5B0YC 4CSRB 2Y2QA 1P3IB 5B0ZA 3MGRD 3AZGC 1HQ3D 1KX4A 3O62C 3KWQC 4LD9C 3W98B 1P3AD 5AV9B 2HUEC 5DNNB 1HTAA 1P34A 3H0RC 3REHC 3W98D 1N1JB 5GSUA 5GXQA 5B32A 1P3LC 5JRGD 5GT0D 3RELD 4WJ3C 4KGCA 1M19A 4Z66A 4WZSB 3WKJB 3UT9A 3X1SC 1S32B 3AZMC 3WTPC 5AY8A 4HGAB 4YM6C 3MNND 4QLCD 4ZUXA 3B6GD 1S32C 2HUEB 5AV9C 3AV1D 2F8NG 4CAYB 3MVDA 5GT3A 5B1MA 3AZMB 3C1CB 5F99D 4J8VA 5GXQB 4AWLB 2W8SA 3VH6W 1P3AC 1BH8A 5AV8A 2CWEA 4QLCB 5AV9A 3WKJC 3KXBB 4DRBA 5JA4A 5BNXB 5B2IC 5CPIB 5B2JC 5CPJB 1P3KC 5AV9D 3AV1C 2DF4C 5AV8D 2JCHA 3UTBB 1BH9B 2F8NB 5BNVA 4E45A 2ZY2A 2UWXA 3IP4C 1M18C 1R4VA 3A1IA 5JRGC 5F99A 4J8VD 2PYOC 4XZQC 5B1MD 5GT3D 3MVDD 5B33B 3AZFC 3AV2B 1P3PB 3AV1A 3WA9C 3B6GA 4ZUXD 4G92B 4QLCA 3MNNA 4DQYB 5AY8D 4XZQB 3WA9B 3UT9D 5B0ZB 4E44A 5BO0A 4Z66D 3AZHB 1M19D 3TU4C 1BH9A 4KGCD 3MGQC 5GT0A 3RELA 5JRGA 4YS3B 5B32D 5GXQD 3LELC 5GSUD 3UTBC 3W98A 1P34D 1P3AA 1KX4D 4H9SA 1HQ3A 3VH6A 3MGRA 5E5AB 3B0BA 3AV1B 1M18B 5B0ZD 4WU9C 2Y2IA 4M6BA 4Z5TA 4NE6A 3MGSC 1P3LD 3AN2A 3AZFD 5GT0B 3RELB 3MGPB 2IO5B 3A6ND 4J8UB 3WTPA 5AV5A 1TZYD 5AV6D 3KUYC 5B40C 4J8VB 3X1VC 1P3GC 3AZKA 4KHAA 3AZEC 4LD9D 5CPKD 3AZIB 2CV5D 5DNMA 5B1MB 5B24D 2PYOD 3LZ0D 4Z2MG 5GT3C 4WNNA 3AZLA 3REIC 1P3AB 4YM6B 1P3OC 5AV5C 4H9QA 5JA4B 3MGPD 5CPID 3REJC 3UTAA 4J8WC 5BS7A 3X1SD 3VH5A 2G5HC 5AVCA 3LZ1C 3WTPB 3TU4A 3C1CC 1P3ID 1U35C 3LZ1B 3X1UA 1M1AC 5B2ID 1ZLAD 2LY8A 5AVBD 4X23A 3A6NC 2BYMA 1P34C 3AZIA 5E5AC 4JJNA 3WAAC 1P3GD 2NZDD 4CSRA 3C1BA 3AL0C 4WNNB 3AZLB 1P3BC 3MGSB 5F99C 5CP6A 4H9NB 4YS3D 1W2EA 3WAAA 1WWIA 3W99A 3MGSD 3B6GB 3UT9B 5B40B 3KUYB 3V9RA 1EQZA 3AZMD 4UUZB 1F66B 1P3PD 5AVBB 1ID3A 3MVDB 3W97C 1P3MA 1P3IC 3WKJA 3TU4B 5B32G 3A1KA 3REJB 5CPKC 1A7WA 3MGQD 3AZNB 5B24C 2Y2NA 3REKC 2ZY5A 2NQBA 3EPHA 3UTBD 1Z2CB 3MGRC 3AZGD 1KX5B 2XD1A 1P3BD 2J8PA 5B1MC 3O62D 3KWQD 3KXBA 2VQRA 4YS3C 3B0CT 4J8UD 2PYOB 2NQBC 4J8XC 4KUDA 2HIOC 3W97B 5AV8B 5B0YA 4G92C 3B0DC 1EQZB 1F66C 2Y2GA 4R8PB 1P3KD 4KUDC 4G91B 4QLCC 2F8NA 4XUJB 3B6GC 3X1TA 3H0LC 4J8XB 1TAFA 2ZY3A 2ZM5A 4NFTA 5GXQC 3AZED 3REHA 1H3OB 4G91C 3AYWC 2CV5C 3LELA 4KUDB 5BNVB 4UPKA 3AV2A 1M19B 1S32A 3WA9D 2HIOB 4YM6A 2L5AA 5AY8C 3X1UB 1ID3C 4WU9D 2JE5A 4X23C 4WU8A 3X1SB 1EQZC 4XUJA 2FJ7A 5B31D 2FFFB 5AVCB 3B6FA 1U35D 3MNNB 1M1AD 4XZQA 4H9PA 3AV2C 3B0CW 3NQJA 4NE3A 2DQNC 5B33D 4AWLC 5CPKB 1KX4C 3C1BB 1KX3A 1AOIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CPJ D;  3W96 A;  3LZ0 C;  5B24 B;  3AFA A;  4H9N A;  5B1L D;  4WU8 B;  5B2J A;  3X1T C;  1BH8 B;  3AZK C;  4ZBJ C;  1Q9C A;  2JSS A;  4HGA C;  3LJA A;  1P3M B;  1F66 D;  2FJ7 B;  3B6F B;  1M1A B;  2HIO A;  5B40 D;  3KUY D;  4ZUX C;  4J8W A;  3X1V D;  1P3F A;  3REJ A;  5E5A D;  1B6W A;  4EO5 B;  3LJA C;  3REI A;  1KX4 B;  5G49 B;  1F1E A;  1KX5 A;  5AV5 B;  2F8N K;  2ARO D;  3AYW A;  3AFA C;  1M18 D;  3AZJ A;  3REK A;  2ARO B;  2NZD C;  3NQJ B;  2BYK A;  4EO5 C;  1AOI A;  3AZN A;  1P3O D;  1ZLA B;  3AZH D;  3NQU A;  3C1B C;  3AZE B;  2YFW A;  5B0Y B;  3LZ1 D;  4WV4 B;  5DNN A;  1P34 B;  3C1C D;  1P3G B;  1N1J A;  5GSU B;  4R8P A;  4J8X D;  3W97 D;  3VH5 W;  5BT1 D;  1M19 C;  1P3P C;  3REI B;  3W97 A;  4J8X A;  4R8P D;  3C1C A;  5C3I B;  5DNN D;  5AY8 B;  5AVC C;  3LZ1 A;  4J8W B;  3AZJ B;  3AZH A;  3AZN D;  5G49 A;  1P3O A;  1TAF B;  1AOI D;  3AYW B;  3REK D;  3AZJ D;  1M18 A;  3O62 B;  3KWQ B;  2IO5 C;  4Z5T B;  2ARO A;  3AYW D;  5FUG B;  3AZG B;  5CHL B;  1KX5 D;  3REI D;  3LEL B;  3X1U C;  1ID3 B;  5E5A A;  4JJN C;  3MGQ B;  5CPI C;  3REJ D;  4WU9 B;  3X1V A;  4J8W D;  5B40 A;  3KUY A;  2HIO D;  1P3F D;  4UUZ A;  3LJA D;  1F66 A;  1JFI B;  5B2J D;  4H9O A;  5B1L A;  3AFA D;  5BS7 C;  3W96 D;  5CPJ A;  1KX3 D;  4KHA B;  5B33 A;  4H9R A;  4XZQ D;  1M1A A;  1B67 A;  1U35 A;  5BO0 B;  5B31 A;  2FJ7 D;  1WWS A;  3B6F D;  4XUJ D;  1ZLA C;  4H9O B;  4WU8 D;  1BFM A;  5AVB C;  4WU9 A;  4Z2M H;  4YM6 D;  3KXB C;  5B31 C;  1S32 D;  3WA9 A;  3AN2 C;  3AZL C;  5B33 C;  3REH B;  3REK B;  1P3B B;  4CAY A;  3AV2 D;  5B32 C;  3W99 C;  3LEL D;  4NE5 A;  4LD9 B;  5GSU C;  2ARO C;  3X1T B;  3W99 B;  3REH D;  3AZE A;  5CP6 C;  3LZ0 B;  3V9R B;  1U35 B;  2BYK B;  1AOI B;  5CP6 B;  3X1T D;  5B31 B;  3WAA B;  2F8N D;  1P3M C;  3R45 A;  3NQU B;  1P3K A;  3UT9 C;  2RVQ C;  2YFW B;  5B0Y D;  1TZY B;  5AV6 B;  3AN2 B;  3A6N B;  1ULY A;  4WU8 C;  3MNN C;  2YFV B;  4KUD D;  4J8U A;  3KSY A;  3KXB D;  1P3L B;  3VH6 T;  3O62 A;  3KWQ A;  3AZK B;  1P3B A;  3W96 B;  3AZG A;  3UTB A;  5B32 B;  3W98 C;  4J8U C;  2NQB D;  3AZI C;  1P3O B;  5GT0 C;  5DNM C;  3REL C;  3MGQ A;  1KU5 A;  3WKJ D;  1P3M D;  1ID3 D;  4X23 B;  2YFV A;  1TZY C;  5AV6 C;  2BYM B;  4Z66 B;  5BT1 C;  5GT3 B;  5DNN C;  3UTA C;  1P3P A;  3X1V B;  3AZM A;  1EQZ D;  1P3F B;  4R8P C;  4Z5T C;  1H3O A;  3W99 D;  3MGS A;  1JFI A;  5AV8 C;  3WAA D;  4YS3 A;  5B1L B;  4JJN B;  5CP6 D;  4DRA A;  4J8V C;  3AZH C;  3C1B D;  3MGP C;  3AZJ C;  2NZD A;  1P3G A;  4JJN D;  3AZI D;  2CV5 B;  5C3I C;  1HQ3 B;  5BNX A;  5AVB A;  2RVQ D;  4H9R B;  4X23 D;  3MGR B;  1KX5 C;  1ZLA A;  5B2I A;  3AZF B;  3B0D B;  3X1U D;  5B31 G;  1P3I A;  4H9P B;  3TU4 D;  4KGC C;  3VH5 T;  5AVC D;  4XUJ C;  3X1S A;  3UTA D;  2NQB B;  5CPI A;  3MGP A;  5DNM B;  1KX3 C;  1HQ3 C;  4H9S C;  5KDM B;  3AZN C;  3AZL D;  1KX3 B;  3W96 C;  3LZ0 A;  2PYO A;  5B24 A;  5DNM D;  2CV5 A;  5CPJ C;  5CPK A;  5B1L C;  4LD9 A;  5B0Z C;  3R45 B;  3MVD C;  3LJA B;  3AZK D;  2F8N H;  5F99 B;  3WTP E;  1P3F C;  1TZY A;  5AV6 A;  5FUG A;  3WTP D;  4ZUX B;  5AV5 D;  2NZD B;  3A6N A;  3AFA B;  4H9Q B;  5B2J B;  4Z66 C;  3UTA B;  4KGC B;  4ZBJ B;  5JRG B;  5B2I B;  3AZF A;  2FJ7 C;  3B6F C;  1P3K B;  3AN2 D;  1P3L A;  5KDM A;  4Z5T D;  5B0Y C;  4CSR B;  1P3I B;  5B0Z A;  3MGR D;  3AZG C;  1HQ3 D;  1KX4 A;  3O62 C;  3KWQ C;  4LD9 C;  3W98 B;  1P3A D;  5AV9 B;  2HUE C;  5DNN B;  1HTA A;  1P34 A;  3REH C;  3W98 D;  1N1J B;  5GSU A;  5GXQ A;  5B32 A;  1P3L C;  5JRG D;  5GT0 D;  3REL D;  4KGC A;  1M19 A;  4Z66 A;  4WZS B;  3WKJ B;  3UT9 A;  3X1S C;  1S32 B;  3AZM C;  3WTP C;  5AY8 A;  4HGA B;  4YM6 C;  3MNN D;  4QLC D;  4ZUX A;  3B6G D;  1S32 C;  2HUE B;  5AV9 C;  3AV1 D;  2F8N G;  4CAY B;  3MVD A;  5GT3 A;  5B1M A;  3AZM B;  3C1C B;  5F99 D;  4J8V A;  5GXQ B;  4AWL B;  3VH6 W;  1P3A C;  1BH8 A;  5AV8 A;  2CWE A;  4QLC B;  5AV9 A;  3WKJ C;  3KXB B;  4DRB A;  5JA4 A;  5BNX B;  5B2I C;  5CPI B;  5B2J C;  5CPJ B;  1P3K C;  5AV9 D;  3AV1 C;  5AV8 D;  3UTB B;  1BH9 B;  2F8N B;  5BNV A;  4E45 A;  1M18 C;  1R4V A;  2PYO C;  5JRG C;  5F99 A;  4J8V D;  4XZQ C;  5B1M D;  5GT3 D;  3MVD D;  5B33 B;  3AZF C;  3AV2 B;  1P3P B;  3AV1 A;  3WA9 C;  3B6G A;  4ZUX D;  4G92 B;  4QLC A;  3MNN A;  5AY8 D;  4XZQ B;  3WA9 B;  3UT9 D;  5B0Z B;  4E44 A;  5BO0 A;  4Z66 D;  3AZH B;  1M19 D;  3TU4 C;  1BH9 A;  4KGC D;  3MGQ C;  5GT0 A;  3REL A;  5JRG A;  4YS3 B;  5B32 D;  5GXQ D;  3LEL C;  5GSU D;  3UTB C;  3W98 A;  1P34 D;  1P3A A;  1KX4 D;  4H9S A;  1HQ3 A;  3VH6 A;  3MGR A;  5E5A B;  3B0B A;  3AV1 B;  1M18 B;  5B0Z D;  4WU9 C;  4M6B A;  4Z5T A;  4NE6 A;  3MGS C;  1P3L D;  3AN2 A;  3AZF D;  5GT0 B;  3REL B;  3MGP B;  2IO5 B;  3A6N D;  4J8U B;  3WTP A;  5AV5 A;  1TZY D;  5AV6 D;  3KUY C;  5B40 C;  4J8V B;  3X1V C;  1P3G C;  3AZK A;  4KHA A;  3AZE C;  4LD9 D;  5CPK D;  3AZI B;  2CV5 D;  5DNM A;  5B1M B;  5B24 D;  2PYO D;  3LZ0 D;  4Z2M G;  5GT3 C;  4WNN A;  3AZL A;  3REI C;  1P3A B;  4YM6 B;  1P3O C;  5AV5 C;  4H9Q A;  5JA4 B;  3MGP D;  5CPI D;  3REJ C;  3UTA A;  4J8W C;  5BS7 A;  3X1S D;  3VH5 A;  5AVC A;  3LZ1 C;  3WTP B;  3TU4 A;  3C1C C;  1P3I D;  1U35 C;  3LZ1 B;  3X1U A;  1M1A C;  5B2I D;  1ZLA D;  2LY8 A;  5AVB D;  4X23 A;  3A6N C;  2BYM A;  1P34 C;  3AZI A;  5E5A C;  4JJN A;  3WAA C;  1P3G D;  2NZD D;  4CSR A;  3C1B A;  4WNN B;  3AZL B;  1P3B C;  3MGS B;  5F99 C;  5CP6 A;  4H9N B;  4YS3 D;  3WAA A;  1WWI A;  3W99 A;  3MGS D;  3B6G B;  3UT9 B;  5B40 B;  3KUY B;  3V9R A;  1EQZ A;  3AZM D;  4UUZ B;  1F66 B;  1P3P D;  5AVB B;  1ID3 A;  3MVD B;  3W97 C;  1P3M A;  1P3I C;  3WKJ A;  3TU4 B;  5B32 G;  3REJ B;  5CPK C;  1A7W A;  3MGQ D;  3AZN B;  5B24 C;  3REK C;  2NQB A;  3UTB D;  3MGR C;  3AZG D;  1KX5 B;  1P3B D;  5B1M C;  3O62 D;  3KWQ D;  3KXB A;  4YS3 C;  2PYO B;  3B0C T;  4J8U D;  2NQB C;  4J8X C;  4KUD A;  2HIO C;  3W97 B;  5AV8 B;  5B0Y A;  4G92 C;  3B0D C;  1EQZ B;  1F66 C;  4R8P B;  4KUD C;  1P3K D;  4G91 B;  4QLC C;  2F8N A;  4XUJ B;  3B6G C;  3X1T A;  4J8X B;  1TAF A;  4NFT A;  5GXQ C;  3AZE D;  3REH A;  1H3O B;  4G91 C;  3AYW C;  2CV5 C;  3LEL A;  4KUD B;  5BNV B;  3AV2 A;  1M19 B;  1S32 A;  3WA9 D;  2HIO B;  4YM6 A;  2L5A A;  5AY8 C;  3X1U B;  1ID3 C;  4WU9 D;  4X23 C;  4WU8 A;  3X1S B;  1EQZ C;  4XUJ A;  2FJ7 A;  5B31 D;  3B6F A;  5AVC B;  1U35 D;  3MNN B;  1M1A D;  4XZQ A;  4H9P A;  3AV2 C;  3B0C W;  3NQJ A;  4NE3 A;  4AWL C;  5B33 D;  5CPK B;  1KX4 C;  3C1B B;  1KX3 A;  1AOI C; 
#chains in the Genus database with same CATH topology
 5CPJ D;  3W96 A;  5B24 B;  3LZ0 C;  3AFA A;  4H9N A;  5B1L D;  4WU8 B;  5B2J A;  3X1T C;  1BH8 B;  3AZK C;  4ZBJ C;  1Q9C A;  2JSS A;  4HGA C;  3LJA A;  1P3M B;  1F66 D;  2FJ7 B;  3B6F B;  1M1A B;  2HIO A;  5B40 D;  3KUY D;  4ZUX C;  4J8W A;  3X1V D;  1P3F A;  3REJ A;  5E5A D;  1B6W A;  4EO5 B;  3LJA C;  3REI A;  1KX4 B;  1PZR A;  5G49 B;  1F1E A;  1KX5 A;  5AV5 B;  2F8N K;  2ARO D;  3AYW A;  3AFA C;  3EG5 B;  1M18 D;  3AZJ A;  3REK A;  2ARO B;  2NZD C;  3NQJ B;  2BYK A;  4EO5 C;  1AOI A;  3AZN A;  1P3O D;  1ZLA B;  3AZH D;  3NQU A;  3C1B C;  3AZE B;  2YFW A;  5B0Y B;  3LZ1 D;  4WV4 B;  5DNN A;  1P34 B;  3C1C D;  1P3G B;  1N1J A;  5GSU B;  4R8P A;  4J8X D;  3W97 D;  3VH5 W;  5BT1 D;  1M19 C;  1P3P C;  3REI B;  3W97 A;  4J8X A;  4R8P D;  3C1C A;  5C3I B;  5DNN D;  5AY8 B;  5AVC C;  2Y2J A;  3LZ1 A;  4J8W B;  3AZJ B;  2XD5 A;  3AZH A;  3AZN D;  5G49 A;  1P3O A;  1TAF B;  1AOI D;  3KFU G;  3AYW B;  3REK D;  3AZJ D;  1M18 A;  3O62 B;  3KWQ B;  2IO5 C;  4Z5T B;  2ARO A;  3AYW D;  5FUG B;  3AZG B;  5CHL B;  1KX5 D;  3REI D;  3LEL B;  2Y2K A;  3X1U C;  1ID3 B;  5E5A A;  4JJN C;  3MGQ B;  5CPI C;  3REJ D;  4WU9 B;  3X1V A;  4J8W D;  5B40 A;  3KUY A;  2HIO D;  1P3F D;  4UUZ A;  3LJA D;  1F66 A;  2Y2O A;  3EPK A;  1JFI B;  5B2J D;  4H9O A;  5B1L A;  3AFA D;  5BS7 C;  3W96 D;  5CPJ A;  1KX3 D;  4KHA B;  2RIQ A;  5B33 A;  4H9R A;  4XZQ D;  1M1A A;  1B67 A;  1U35 A;  5BO0 B;  5B31 A;  2FJ7 D;  1WWS A;  3B6F D;  4XUJ D;  1ZLA C;  4H9O B;  4WU8 D;  1BFM A;  5AVB C;  4WU9 A;  4Z2M H;  4YM6 D;  3KXB C;  5B31 C;  1S32 D;  3WA9 A;  3AN2 C;  3AZL C;  5B33 C;  3REH B;  3REK B;  1P3B B;  4CAY A;  3AV2 D;  5B32 C;  3W99 C;  3LEL D;  4NE5 A;  4LD9 B;  5GSU C;  2ARO C;  3X1T B;  3W99 B;  3REH D;  3AZE A;  3H0M C;  5CP6 C;  3LZ0 B;  3V9R B;  1U35 B;  2BYK B;  1AOI B;  2F2A C;  5CP6 B;  3X1T D;  5B31 B;  3WAA B;  2F8N D;  1P3M C;  3R45 A;  3NQU B;  1P3K A;  3UT9 C;  2RVQ C;  2YFW B;  5B0Y D;  1TZY B;  5AV6 B;  3AN2 B;  1T3U A;  3A6N B;  1ULY A;  4WU8 C;  3MNN C;  2YFV B;  4KUD D;  4J8U A;  3KSY A;  3KXB D;  1P3L B;  2ZY4 A;  3VH6 T;  3O62 A;  3KWQ A;  3AZK B;  1P3B A;  3W96 B;  3AZG A;  2Y2L A;  5B32 B;  3UTB A;  3W98 C;  4J8U C;  2NQB D;  3AZI C;  1P3O B;  5GT0 C;  5DNM C;  3REL C;  3MGQ A;  1KU5 A;  3WKJ D;  1P3M D;  2Y2H A;  2G5I C;  1ID3 D;  4X23 B;  2YFV A;  1TZY C;  5AV6 C;  2BYM B;  4Z66 B;  5BT1 C;  5GT3 B;  5DNN C;  3UTA C;  1P3P A;  3X1V B;  3AZM A;  1EQZ D;  1P3F B;  4R8P C;  4Z5T C;  1H3O A;  3W99 D;  3MGS A;  1JFI A;  5AV8 C;  3WAA D;  4YS3 A;  5B1L B;  4JJN B;  5CP6 D;  4DRA A;  4J8V C;  3AZH C;  3C1B D;  3MGP C;  2BG1 A;  3AZJ C;  2NZD A;  1P3G A;  4JJN D;  3AZI D;  2CV5 B;  5C3I C;  1HQ3 B;  5BNX A;  5AVB A;  2RVQ D;  4H9R B;  4X23 D;  3MGR B;  1KX5 C;  1ZLA A;  5B2I A;  3AZF B;  3B0D B;  3FDD A;  3X1U D;  3EPJ A;  5B31 G;  1P3I A;  4H9P B;  3TU4 D;  4KGC C;  3VH5 T;  5AVC D;  4XUJ C;  2Y2P A;  3X1S A;  3F6T A;  3UTA D;  2NQB B;  5CPI A;  3MGP A;  3EPL A;  5DNM B;  1HQ3 C;  1KX3 C;  4H9S C;  5KDM B;  3AZN C;  3AZL D;  1KX3 B;  3W96 C;  3LZ0 A;  2PYO A;  5B24 A;  5DNM D;  2CV5 A;  5CPJ C;  5CPK A;  5B1L C;  4LD9 A;  5B0Z C;  3R45 B;  3MVD C;  3LJA B;  3AZK D;  2F8N H;  5F99 B;  3WTP E;  1P3F C;  5AV6 A;  1TZY A;  5FUG A;  5AV5 D;  4ZUX B;  3WTP D;  2NZD B;  3A6N A;  3AFA B;  4H9Q B;  5B2J B;  4Z66 C;  3UTA B;  4KGC B;  2Y2M A;  4ZBJ B;  3P5J B;  5JRG B;  5B2I B;  3AZF A;  1P3K B;  2FJ7 C;  3AN2 D;  3B6F C;  1P3L A;  5KDM A;  4Z5T D;  5B0Y C;  4CSR B;  2Y2Q A;  1P3I B;  5B0Z A;  3MGR D;  3AZG C;  1HQ3 D;  1KX4 A;  3O62 C;  3KWQ C;  4LD9 C;  3W98 B;  1P3A D;  5AV9 B;  2HUE C;  5DNN B;  1HTA A;  1P34 A;  3H0R C;  3REH C;  3W98 D;  1N1J B;  5GSU A;  5GXQ A;  5B32 A;  1P3L C;  5JRG D;  5GT0 D;  3REL D;  4WJ3 C;  4KGC A;  1M19 A;  4Z66 A;  4WZS B;  3WKJ B;  3UT9 A;  3X1S C;  1S32 B;  3AZM C;  3WTP C;  5AY8 A;  4HGA B;  4YM6 C;  3MNN D;  4QLC D;  4ZUX A;  3B6G D;  1S32 C;  2HUE B;  5AV9 C;  3AV1 D;  2F8N G;  4CAY B;  3MVD A;  5GT3 A;  5B1M A;  3AZM B;  3C1C B;  5F99 D;  4J8V A;  5GXQ B;  4AWL B;  2W8S A;  3VH6 W;  1P3A C;  1BH8 A;  5AV8 A;  2CWE A;  4QLC B;  5AV9 A;  3WKJ C;  3KXB B;  4DRB A;  5JA4 A;  5BNX B;  5B2I C;  5CPI B;  5B2J C;  5CPJ B;  1P3K C;  5AV9 D;  3AV1 C;  2DF4 C;  5AV8 D;  2JCH A;  3UTB B;  1BH9 B;  2F8N B;  5BNV A;  4E45 A;  2ZY2 A;  2UWX A;  3IP4 C;  1M18 C;  1R4V A;  3A1I A;  5JRG C;  5F99 A;  4J8V D;  2PYO C;  4XZQ C;  5B1M D;  5GT3 D;  3MVD D;  5B33 B;  3AZF C;  3AV2 B;  1P3P B;  3AV1 A;  3WA9 C;  3B6G A;  4ZUX D;  4G92 B;  4QLC A;  3MNN A;  4DQY B;  5AY8 D;  4XZQ B;  3WA9 B;  3UT9 D;  5B0Z B;  4E44 A;  5BO0 A;  4Z66 D;  3AZH B;  1M19 D;  3TU4 C;  1BH9 A;  4KGC D;  3MGQ C;  5GT0 A;  3REL A;  5JRG A;  4YS3 B;  5B32 D;  5GXQ D;  3LEL C;  5GSU D;  3UTB C;  3W98 A;  1P34 D;  1P3A A;  1KX4 D;  4H9S A;  1HQ3 A;  3VH6 A;  3MGR A;  5E5A B;  3B0B A;  3AV1 B;  1M18 B;  5B0Z D;  4WU9 C;  2Y2I A;  4M6B A;  4Z5T A;  4NE6 A;  3MGS C;  1P3L D;  3AN2 A;  3AZF D;  5GT0 B;  3REL B;  3MGP B;  2IO5 B;  3A6N D;  4J8U B;  3WTP A;  5AV5 A;  1TZY D;  5AV6 D;  3KUY C;  5B40 C;  4J8V B;  3X1V C;  1P3G C;  3AZK A;  4KHA A;  3AZE C;  4LD9 D;  5CPK D;  3AZI B;  2CV5 D;  5DNM A;  5B1M B;  5B24 D;  2PYO D;  3LZ0 D;  4Z2M G;  5GT3 C;  4WNN A;  3AZL A;  3REI C;  1P3A B;  4YM6 B;  1P3O C;  5AV5 C;  4H9Q A;  5JA4 B;  3MGP D;  5CPI D;  3REJ C;  3UTA A;  4J8W C;  5BS7 A;  3X1S D;  3VH5 A;  2G5H C;  5AVC A;  3LZ1 C;  3WTP B;  3TU4 A;  3C1C C;  1P3I D;  1U35 C;  3LZ1 B;  3X1U A;  1M1A C;  5B2I D;  1ZLA D;  2LY8 A;  5AVB D;  4X23 A;  3A6N C;  2BYM A;  1P34 C;  3AZI A;  5E5A C;  4JJN A;  3WAA C;  1P3G D;  2NZD D;  4CSR A;  3C1B A;  3AL0 C;  4WNN B;  3AZL B;  1P3B C;  3MGS B;  5F99 C;  5CP6 A;  4H9N B;  4YS3 D;  1W2E A;  3WAA A;  1WWI A;  3W99 A;  3MGS D;  3B6G B;  3UT9 B;  5B40 B;  3KUY B;  3V9R A;  1EQZ A;  3AZM D;  4UUZ B;  1F66 B;  1P3P D;  5AVB B;  1ID3 A;  3MVD B;  3W97 C;  1P3M A;  1P3I C;  3WKJ A;  3TU4 B;  5B32 G;  3A1K A;  3REJ B;  5CPK C;  1A7W A;  3MGQ D;  3AZN B;  5B24 C;  2Y2N A;  3REK C;  2ZY5 A;  2NQB A;  3EPH A;  3UTB D;  1Z2C B;  3MGR C;  3AZG D;  1KX5 B;  2XD1 A;  1P3B D;  2J8P A;  5B1M C;  3O62 D;  3KWQ D;  3KXB A;  2VQR A;  4YS3 C;  3B0C T;  4J8U D;  2PYO B;  2NQB C;  4J8X C;  4KUD A;  2HIO C;  3W97 B;  5AV8 B;  5B0Y A;  4G92 C;  3B0D C;  1EQZ B;  1F66 C;  2Y2G A;  4R8P B;  1P3K D;  4KUD C;  4G91 B;  4QLC C;  2F8N A;  4XUJ B;  3B6G C;  3X1T A;  3H0L C;  4J8X B;  1TAF A;  2ZY3 A;  2ZM5 A;  4NFT A;  5GXQ C;  3AZE D;  3REH A;  1H3O B;  4G91 C;  3AYW C;  2CV5 C;  3LEL A;  4KUD B;  5BNV B;  4UPK A;  3AV2 A;  1M19 B;  1S32 A;  3WA9 D;  2HIO B;  4YM6 A;  2L5A A;  5AY8 C;  3X1U B;  1ID3 C;  4WU9 D;  2JE5 A;  4X23 C;  4WU8 A;  3X1S B;  1EQZ C;  4XUJ A;  2FJ7 A;  5B31 D;  2FFF B;  5AVC B;  3B6F A;  1U35 D;  3MNN B;  1M1A D;  4XZQ A;  4H9P A;  3AV2 C;  3B0C W;  3NQJ A;  4NE3 A;  2DQN C;  5B33 D;  4AWL C;  5CPK B;  1KX4 C;  3C1B B;  1KX3 A;  1AOI C; 
#chains in the Genus database with same CATH homology
 5CPJ D;  3W96 A;  5B24 B;  3LZ0 C;  3AFA A;  4H9N A;  5B1L D;  4WU8 B;  5B2J A;  3X1T C;  1BH8 B;  3AZK C;  4ZBJ C;  1Q9C A;  2JSS A;  4HGA C;  3LJA A;  1P3M B;  1F66 D;  2FJ7 B;  3B6F B;  1M1A B;  2HIO A;  5B40 D;  3KUY D;  4ZUX C;  4J8W A;  3X1V D;  1P3F A;  3REJ A;  5E5A D;  1B6W A;  4EO5 B;  3LJA C;  3REI A;  1KX4 B;  1PZR A;  5G49 B;  1F1E A;  1KX5 A;  5AV5 B;  2F8N K;  2ARO D;  3AYW A;  3AFA C;  3EG5 B;  1M18 D;  3AZJ A;  3REK A;  2ARO B;  2NZD C;  3NQJ B;  2BYK A;  4EO5 C;  1AOI A;  3AZN A;  1P3O D;  1ZLA B;  3AZH D;  3NQU A;  3C1B C;  3AZE B;  2YFW A;  5B0Y B;  3LZ1 D;  4WV4 B;  5DNN A;  1P34 B;  3C1C D;  1P3G B;  1N1J A;  5GSU B;  4R8P A;  4J8X D;  3W97 D;  3VH5 W;  5BT1 D;  1M19 C;  1P3P C;  3REI B;  3W97 A;  4J8X A;  4R8P D;  3C1C A;  5C3I B;  5DNN D;  5AY8 B;  5AVC C;  2Y2J A;  3LZ1 A;  4J8W B;  3AZJ B;  2XD5 A;  3AZH A;  3AZN D;  5G49 A;  1P3O A;  1TAF B;  1AOI D;  3KFU G;  3AYW B;  3REK D;  3AZJ D;  1M18 A;  3O62 B;  3KWQ B;  2IO5 C;  4Z5T B;  2ARO A;  3AYW D;  5FUG B;  3AZG B;  5CHL B;  1KX5 D;  3REI D;  3LEL B;  2Y2K A;  3X1U C;  1ID3 B;  5E5A A;  4JJN C;  3MGQ B;  5CPI C;  3REJ D;  4WU9 B;  3X1V A;  4J8W D;  5B40 A;  3KUY A;  2HIO D;  1P3F D;  4UUZ A;  3LJA D;  1F66 A;  2Y2O A;  3EPK A;  1JFI B;  5B2J D;  4H9O A;  5B1L A;  3AFA D;  5BS7 C;  3W96 D;  5CPJ A;  1KX3 D;  4KHA B;  2RIQ A;  5B33 A;  4H9R A;  4XZQ D;  1M1A A;  1B67 A;  1U35 A;  5BO0 B;  5B31 A;  2FJ7 D;  1WWS A;  3B6F D;  4XUJ D;  1ZLA C;  4H9O B;  4WU8 D;  1BFM A;  5AVB C;  4WU9 A;  4Z2M H;  4YM6 D;  3KXB C;  5B31 C;  1S32 D;  3WA9 A;  3AN2 C;  3AZL C;  5B33 C;  3REH B;  3REK B;  1P3B B;  4CAY A;  3AV2 D;  5B32 C;  3W99 C;  3LEL D;  4NE5 A;  4LD9 B;  5GSU C;  2ARO C;  3X1T B;  3W99 B;  3REH D;  3AZE A;  3H0M C;  5CP6 C;  3LZ0 B;  3V9R B;  1U35 B;  2BYK B;  1AOI B;  2F2A C;  5CP6 B;  3X1T D;  5B31 B;  3WAA B;  2F8N D;  1P3M C;  3R45 A;  3NQU B;  1P3K A;  3UT9 C;  2RVQ C;  2YFW B;  5B0Y D;  1TZY B;  5AV6 B;  3AN2 B;  1T3U A;  3A6N B;  1ULY A;  4WU8 C;  3MNN C;  2YFV B;  4KUD D;  4J8U A;  3KSY A;  3KXB D;  1P3L B;  2ZY4 A;  3VH6 T;  3O62 A;  3KWQ A;  3AZK B;  1P3B A;  3W96 B;  3AZG A;  2Y2L A;  5B32 B;  3UTB A;  3W98 C;  4J8U C;  2NQB D;  3AZI C;  1P3O B;  5GT0 C;  5DNM C;  3REL C;  3MGQ A;  1KU5 A;  3WKJ D;  1P3M D;  2Y2H A;  2G5I C;  1ID3 D;  4X23 B;  2YFV A;  1TZY C;  5AV6 C;  2BYM B;  4Z66 B;  5BT1 C;  5GT3 B;  5DNN C;  3UTA C;  1P3P A;  3X1V B;  3AZM A;  1EQZ D;  1P3F B;  4R8P C;  4Z5T C;  1H3O A;  3W99 D;  3MGS A;  1JFI A;  5AV8 C;  3WAA D;  4YS3 A;  5B1L B;  4JJN B;  5CP6 D;  4DRA A;  4J8V C;  3AZH C;  3C1B D;  3MGP C;  2BG1 A;  3AZJ C;  2NZD A;  1P3G A;  4JJN D;  3AZI D;  2CV5 B;  5C3I C;  1HQ3 B;  5BNX A;  5AVB A;  2RVQ D;  4H9R B;  4X23 D;  3MGR B;  1KX5 C;  1ZLA A;  5B2I A;  3AZF B;  3B0D B;  3FDD A;  3X1U D;  3EPJ A;  5B31 G;  1P3I A;  4H9P B;  3TU4 D;  4KGC C;  3VH5 T;  5AVC D;  4XUJ C;  2Y2P A;  3X1S A;  3F6T A;  3UTA D;  2NQB B;  5CPI A;  3MGP A;  3EPL A;  5DNM B;  1HQ3 C;  1KX3 C;  4H9S C;  5KDM B;  3AZN C;  3AZL D;  1KX3 B;  3W96 C;  3LZ0 A;  2PYO A;  5B24 A;  5DNM D;  2CV5 A;  5CPJ C;  5CPK A;  5B1L C;  4LD9 A;  5B0Z C;  3R45 B;  3MVD C;  3LJA B;  3AZK D;  2F8N H;  5F99 B;  3WTP E;  1P3F C;  5AV6 A;  1TZY A;  5FUG A;  5AV5 D;  4ZUX B;  3WTP D;  2NZD B;  3A6N A;  3AFA B;  4H9Q B;  5B2J B;  4Z66 C;  3UTA B;  4KGC B;  2Y2M A;  4ZBJ B;  3P5J B;  5JRG B;  5B2I B;  3AZF A;  1P3K B;  2FJ7 C;  3AN2 D;  3B6F C;  1P3L A;  5KDM A;  4Z5T D;  5B0Y C;  4CSR B;  2Y2Q A;  1P3I B;  5B0Z A;  3MGR D;  3AZG C;  1HQ3 D;  1KX4 A;  3O62 C;  3KWQ C;  4LD9 C;  3W98 B;  1P3A D;  5AV9 B;  2HUE C;  5DNN B;  1HTA A;  1P34 A;  3H0R C;  3REH C;  3W98 D;  1N1J B;  5GSU A;  5GXQ A;  5B32 A;  1P3L C;  5JRG D;  5GT0 D;  3REL D;  4WJ3 C;  4KGC A;  1M19 A;  4Z66 A;  4WZS B;  3WKJ B;  3UT9 A;  3X1S C;  1S32 B;  3AZM C;  3WTP C;  5AY8 A;  4HGA B;  4YM6 C;  3MNN D;  4QLC D;  4ZUX A;  3B6G D;  1S32 C;  2HUE B;  5AV9 C;  3AV1 D;  2F8N G;  4CAY B;  3MVD A;  5GT3 A;  5B1M A;  3AZM B;  3C1C B;  5F99 D;  4J8V A;  5GXQ B;  4AWL B;  2W8S A;  3VH6 W;  1P3A C;  1BH8 A;  5AV8 A;  2CWE A;  4QLC B;  5AV9 A;  3WKJ C;  3KXB B;  4DRB A;  5JA4 A;  5BNX B;  5B2I C;  5CPI B;  5B2J C;  5CPJ B;  1P3K C;  5AV9 D;  3AV1 C;  2DF4 C;  5AV8 D;  2JCH A;  3UTB B;  1BH9 B;  2F8N B;  5BNV A;  4E45 A;  2ZY2 A;  2UWX A;  3IP4 C;  1M18 C;  1R4V A;  3A1I A;  5JRG C;  5F99 A;  4J8V D;  2PYO C;  4XZQ C;  5B1M D;  5GT3 D;  3MVD D;  5B33 B;  3AZF C;  3AV2 B;  1P3P B;  3AV1 A;  3WA9 C;  3B6G A;  4ZUX D;  4G92 B;  4QLC A;  3MNN A;  4DQY B;  5AY8 D;  4XZQ B;  3WA9 B;  3UT9 D;  5B0Z B;  4E44 A;  5BO0 A;  4Z66 D;  3AZH B;  1M19 D;  3TU4 C;  1BH9 A;  4KGC D;  3MGQ C;  5GT0 A;  3REL A;  5JRG A;  4YS3 B;  5B32 D;  5GXQ D;  3LEL C;  5GSU D;  3UTB C;  3W98 A;  1P34 D;  1P3A A;  1KX4 D;  4H9S A;  1HQ3 A;  3VH6 A;  3MGR A;  5E5A B;  3B0B A;  3AV1 B;  1M18 B;  5B0Z D;  4WU9 C;  2Y2I A;  4M6B A;  4Z5T A;  4NE6 A;  3MGS C;  1P3L D;  3AN2 A;  3AZF D;  5GT0 B;  3REL B;  3MGP B;  2IO5 B;  3A6N D;  4J8U B;  3WTP A;  5AV5 A;  1TZY D;  5AV6 D;  3KUY C;  5B40 C;  4J8V B;  3X1V C;  1P3G C;  3AZK A;  4KHA A;  3AZE C;  4LD9 D;  5CPK D;  3AZI B;  2CV5 D;  5DNM A;  5B1M B;  5B24 D;  2PYO D;  3LZ0 D;  4Z2M G;  5GT3 C;  4WNN A;  3AZL A;  3REI C;  1P3A B;  4YM6 B;  1P3O C;  5AV5 C;  4H9Q A;  5JA4 B;  3MGP D;  5CPI D;  3REJ C;  3UTA A;  4J8W C;  5BS7 A;  3X1S D;  3VH5 A;  2G5H C;  5AVC A;  3LZ1 C;  3WTP B;  3TU4 A;  3C1C C;  1P3I D;  1U35 C;  3LZ1 B;  3X1U A;  1M1A C;  5B2I D;  1ZLA D;  2LY8 A;  5AVB D;  4X23 A;  3A6N C;  2BYM A;  1P34 C;  3AZI A;  5E5A C;  4JJN A;  3WAA C;  1P3G D;  2NZD D;  4CSR A;  3C1B A;  3AL0 C;  4WNN B;  3AZL B;  1P3B C;  3MGS B;  5F99 C;  5CP6 A;  4H9N B;  4YS3 D;  1W2E A;  3WAA A;  1WWI A;  3W99 A;  3MGS D;  3B6G B;  3UT9 B;  5B40 B;  3KUY B;  3V9R A;  1EQZ A;  3AZM D;  4UUZ B;  1F66 B;  1P3P D;  5AVB B;  1ID3 A;  3MVD B;  3W97 C;  1P3M A;  1P3I C;  3WKJ A;  3TU4 B;  5B32 G;  3A1K A;  3REJ B;  5CPK C;  1A7W A;  3MGQ D;  3AZN B;  5B24 C;  2Y2N A;  3REK C;  2ZY5 A;  2NQB A;  3EPH A;  3UTB D;  1Z2C B;  3MGR C;  3AZG D;  1KX5 B;  2XD1 A;  1P3B D;  2J8P A;  5B1M C;  3O62 D;  3KWQ D;  3KXB A;  2VQR A;  4YS3 C;  3B0C T;  4J8U D;  2PYO B;  2NQB C;  4J8X C;  4KUD A;  2HIO C;  3W97 B;  5AV8 B;  5B0Y A;  4G92 C;  3B0D C;  1EQZ B;  1F66 C;  2Y2G A;  4R8P B;  1P3K D;  4KUD C;  4G91 B;  4QLC C;  2F8N A;  4XUJ B;  3B6G C;  3X1T A;  3H0L C;  4J8X B;  1TAF A;  2ZY3 A;  2ZM5 A;  4NFT A;  5GXQ C;  3AZE D;  3REH A;  1H3O B;  4G91 C;  3AYW C;  2CV5 C;  3LEL A;  4KUD B;  5BNV B;  4UPK A;  3AV2 A;  1M19 B;  1S32 A;  3WA9 D;  2HIO B;  4YM6 A;  2L5A A;  5AY8 C;  3X1U B;  1ID3 C;  4WU9 D;  2JE5 A;  4X23 C;  4WU8 A;  3X1S B;  1EQZ C;  4XUJ A;  2FJ7 A;  5B31 D;  2FFF B;  5AVC B;  3B6F A;  1U35 D;  3MNN B;  1M1A D;  4XZQ A;  4H9P A;  3AV2 C;  3B0C W;  3NQJ A;  4NE3 A;  2DQN C;  5B33 D;  4AWL C;  5CPK B;  1KX4 C;  3C1B B;  1KX3 A;  1AOI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...